WorldWideScience

Sample records for nursery insecticides electronic

  1. Preharvest quarantine treatments of chlorantraniliprole, clothianidin, and imidacloprid-based insecticides for control of Japanese beetle (Coleoptera: Scarabaeidae) and other scarab larvae in the root zone of field-grown nursery trees.

    Science.gov (United States)

    Oliver, Jason B; Ranger, Christopher M; Reding, Michael E; Moyseenko, James J; Youssef, Nadeer N; Bray, Alicia M

    2013-06-01

    Japanese beetle, Popillia japonica Newman (Coleoptera: Scarabaeidae), is an important quarantine pest of nurseries. Nursery plant movement from P. japonica-infested regions is regulated by the U.S. Domestic Japanese Beetle Harmonization Plan (DJHP), which classifies states by risk categories. Treatments for category 2 states include preharvest soil surface treatment of nursery plants grown in field soil using Discus SC, Marathon (1G or 60 WP), or Flagship (0.22G or 25 WG). In this study, Discus, Marathon 60 WP, or Flagship 0.22G DJHP standards were compared with labeled rates of non-DJHP-approved insecticides, including neonicotinoids clothianidin (Arena 50WDG), generic imidacloprid (Quali-Pro Imidacloprid 2 F T&O Insecticide, Mallet 2 F T&O Insecticide, and Lada 2 F Insecticide), and imidacloprid + bifenthrin (Allectus SC), as well as the anthranilic diamide, chlorantraniliprole (Acelepryn Insecticide). Arena provided 100% P. japonica control in May, June, and July over four test years, but had one larva recovered during August in two of those 4 yr. Acelepryn did not provide DJHP-acceptable P. japonica control. During July, Allectus provided 100% P. japonica control in three of four test years, but had four larvae in one test year. Other treatments tested only during July, which provided 100% P. japonica control, included Discus (five tests); Marathon, Quali-Pro, and Mallet (two tests); and Lada and Flagship (one test). Generic imidacloprid 2 F formulations were equivalent in P. japonica control to DJHP-approved insecticides. Insecticides generally performed poorly on other scarabs or curculionid larvae. The study supports Arena, Allectus, and generic imidacloprid 2 F products as suitable candidates for the DJHP.

  2. Identification of insecticide residues with a conducting-polymer electronic nose

    Science.gov (United States)

    A.D. Wilson

    2014-01-01

    The identification of insecticide residues on crop foliage is needed to make periodic pest management decisions. Electronic-nose (e-nose) methods were developed and tested as a means of acquiring rapid identifications of insecticide residue types at relatively low cost by detection of headspace volatiles released from inert surfaces in vitro. Detection methods were...

  3. Nursery School

    CERN Multimedia

    Nursery School

    2016-01-01

    Enrolments 2016-2017 Enrolments for the school year 2016-2017 to the Nursery, the Nursery school and the school will take place on 7, 8 and 9 March 2016 from 8 to 10 am at the Nursery School. Registration forms will be available from Thursday 3rd March. More information on the website: http://nurseryschool.web.cern.ch/.

  4. Systemic Insecticides Reduce Feeding, Survival and Fecundity of Adult Black Vine Weevils (Coleoptera: Curculionidae) on a Variety of Ornamental Nursery Crops

    Science.gov (United States)

    A series of bioassays were conducted to test the systemic activity of clothianidin, chlorantraniliprole, dinotefuran, and thiamethoxam against adult black vine weevils (Otiorhynchus sulcatus F.) on Taxus, Heuchera, Astilbe, Sedum, Euonymus, and Rhododendron grown in containers. The insecticides wer...

  5. Single and combination insecticides evaluated as regulatory immersion treatments to eliminate third-instar Japanese beetle (Coleoptera: Scarabaeidae) from small diameter field-grown and containerized nursery plants

    Science.gov (United States)

    Japanese beetles, Popillia japonica Newman, are a nursery regulatory pest. Immersion of field-grown plants harvested as balled and burlapped (B&B) or container plants grown in pine bark substrates in a solution of chlorpyrifos or bifenthrin is allowed for certification in the Domestic Japanese Beet...

  6. Nursery school

    CERN Document Server

    Jardin d'enfants

    2010-01-01

    * * * * * Enrollments 2010-2011 Monday 8, Tuesday 9 and Wednesday 10 March From 8:00 to 10:00 at the Nursery School   Registration forms will be available from 5th March onwards: At the Nursery School, from Catherine Regelbrugge, Secretary tel: 73604, Catherine.Regelbrugge@cern.ch At the Nursery School, from Brigitte Pillionnel, Headmistress tel: 77925, Brigitte.Pillionnel@cern.ch On the pages of the Nursery School website http://kindergarten.web.cern.ch/kindergarten/docs/cond%20gales%2010-2011%20EN.pdf  

  7. Nursery School

    CERN Document Server

    Jardin d'enfant

    2012-01-01

      Enrollments 2012-2013  Monday 5, Tuesday 6 and Wednesday 7 March From 8.00 to 10.00 at the Nursery School  Registration forms will be available from 2nd March onwards: – At the Nursery School, from Catherine Regelbrugge, Secretary   Catherine.Regelbrugge@cern.ch, tel : 73604. – At the Nursery School, from Brigitte Pillionnel, Headmistress    Brigitte.Pillionnel@cern.ch, tel : 77925. – On the pages of the Nursery School website    http://kindergarten.web.cern.ch/kindergarten/docs/cond%20gales%2012-2013%20EN.pdf

  8. Nursery School

    CERN Document Server

    Nursery School

    2015-01-01

    Enrolments 2015-2016 Enrolments for the school year 2015-2016 to the Nursery, the Nursery school and the school will take place on: Monday 2, Tuesday 3 and Thursday 4 March 2015 More information on the website: http://nurseryschool.web.cern.ch/

  9. Nursery School

    CERN Document Server

    Staff Association

    2014-01-01

      Registration of school year of 2014-2015 at the Nursery school of Cern Staff Association     Dear parents, We would like to inform you that the dates of enrolments will be 3, 4 and 5th March 2014 from 8:00 a.m to 10:00 a.m at the nursery school Bulding 562. Reminder : From 0-2 years, your child goes to the nursery, from 2-4 to the kindergarten, and from 4 years onwards, your child will join the school, following the program of first and second year of primary school (première and deuxième primaire in the Swiss system), which corresponds to the moyenne and grande section in France.

  10. Nursery school

    CERN Multimedia

    Staff Association

    2015-01-01

    The CERN Nursery school was founded in 1961 in Meyrin, before it found a new home on the CERN site in 1965. It expanded from a “garderie” in the morning-only with 30 children, to the Crèche/Kindergarten/School with 147 children and 42 staff we have today. Every year the Nursery school makes an art exhibition in the main building. In 2000 the theme was “Monet’s garden” and it was complete, not even the little bridge was missing! This year, the theme of the exhibition was transport. We could see a garbage truck, a train, and much more.

  11. Getting Started in the Nursery Business: Nursery Production Options

    OpenAIRE

    Eaton, Gregory Kent, 1959-; Appleton, Bonnie Lee, 1948-2012

    2009-01-01

    Summarizes factors, such as nursery design and capitalization, that individuals in Virginia's nursery industry should consider when deciding whether to grow nursery stock in the field verses containers.

  12. Iceberg Nursery

    Science.gov (United States)

    2002-01-01

    Almost an iceberg 'nursery,' icebergs continue to break away from the Ross Ice Shelf in Antarctica. This image from the MODerate-resolution Imaging Spectroradiometer (MODIS) aboard the Terra spacecraft, shows the level of activity along the shelf near Ross Island on September 21, 2000. The B-15 fragments are remnants of the huge iceberg (nearly 4,250 sqare miles) which broke away from the Antarctic shelf in late March 2000. Slightly visible is the line where iceberg B-20 broke away from the shelf in the last week of September. Cracks in the Antarctic ice shelf are closely observed by satellite and are of interest to scientists studying the potential effects of global warming. This true-color image was produced using MODIS bands 1, 3, and 4. Image by Brian Montgomery, NASA GSFC; data courtesy MODIS Science Team

  13. Agriculture: Nurseries and Greenhouses

    Science.gov (United States)

    Nurseries and Greenhouses. Information about environmental requirements specifically relating to the production of many types of agricultural crops grown in nurseries and greenhouses, such as ornamental plants and specialty fruits and vegetables.

  14. Control del minador de la hoja de los cítricos Phyllocnistis citrella Stainton en plantas de limonero en vivero con insecticidas sistémicos Control of citrus leafminer Phyllocnistis citrella Stainton in nursery lemon plants with systemic insecticides

    Directory of Open Access Journals (Sweden)

    Hernán Salas

    2006-12-01

    , several foliar sprays insecticides are needed every 10 to 15 days during the growing season. In this paper, CLM control in nursery lemon plants with systemic insecticides imidacloprid and thiametoxam, applied by "drench", is reported. Treatments were imidacloprid at 0.035, 0.105 and 0.175 g a.i. and thiametoxam at 0.025, 0.075 and 0.125 g a.i per plant in a five-liter container. An unsprayed control was included. CLM was effectively controlled from November to March (120 days approximately with medium and high doses, and from 25 to 45 days with low doses of both insecticides. In one of the trials, imidacloprid and thiametoxam low doses did not control CLM. Considering the obtained results, it would be more appropriate to use imidacloprid 35% SC (0,105 g a. i. per plant and thiametoxam 25% WG (0,075 g a. i. per plant for citrus leafminer control in greenhouse plants.

  15. Interaction of insecticide and media moisture on ambrosia beetle (Coleoptera: Curculionidae) attacks on ornamental trees

    Science.gov (United States)

    Exotic ambrosia beetles, particularly Xylosandrus crassiusculus (Motschulsky) and Xylosandrus germanus (Blandford), are among the most economically damaging pests of ornamental trees in nurseries. Growers have had few tactics besides insecticide applications to reduce ambrosia beetle attacks but rec...

  16. Residue age and tree attractiveness influence efficacy of insecticide treatments against ambrosia beetles (Coleoptera: Curculionidae)

    Science.gov (United States)

    Management of ambrosia beetles in ornamental nurseries relies, in part, on treatments of insecticides to prevent beetles from boring into trees emitting stress-induced ethanol. However, data on residual efficacy of commonly used pyrethroid insecticides is warranted to gauge the duration that trees ...

  17. Practice variation in the transfer of premature infants from incubators to open cots in Australian and New Zealand neonatal nurseries: results of an electronic survey.

    Science.gov (United States)

    New, Karen; Bogossian, Fiona; East, Christine; Davies, Mark William

    2010-06-01

    The incubator environment is essential for optimal physiological functioning and development of the premature infant but the infant is ultimately required to make a successful transfer from incubator to open cot in order to be discharged from hospital. Criteria for transfer lack a systematic approach because no clear, specific guideline predominates in clinical practice. Practice variation exists between continents, regions and nurseries in the same countries, but there is no recent review of current practices utilised for transferring premature infants from incubators to open cots. To document current practice for transferring premature infants to open cots in neonatal nurseries. A descriptive, cross-sectional survey. Twenty-two neonatal intensive care units and fifty-six high dependency special care baby units located in public hospitals in Australia and New Zealand. A sample of 78 key clinical nursing leaders (nurse unit managers, clinical nurse consultants or clinical nurse specialists) within neonatal nurseries identified through email or telephone contact. Data were collected using a web-based survey on practice, decision-making and strategies utilised for transferring premature infants from incubators to open cots. Descriptive statistics (frequencies and crosstabs) were used to analyse data. Comparisons between groups were tested for statistical significance using Chi-squared or Fisher's exact test. Significant practice variation between countries was found for only one variable, nursing infants clothed (p=0.011). Processes and practices undertaken similarly in both countries include use of incubator air control mode, current weight criterion, thermal challenging, single-walled incubators and heated mattress systems. Practice variation was significant between neonatal intensive care units and special care baby units for weight range (p=0.005), evidence-based practice (p=0.004), historical nursery practice (p=0.029) and incubator air control mode (p=0

  18. Nursery and nursery products in Beijing, Tianjin, Shandong and Shanghai

    NARCIS (Netherlands)

    Post, J.H.; Zhang XiaoYong, Xiaoyong

    2003-01-01

    The production and demand of nursery products is growing rapidly in China, particularly in big cities as Beijing, Tianjin, Shandong and Shanghai. The report describes the development and the prospects of production and demand of nursery products and the structure of the nursery sector in these

  19. Nursery management [Chapter 16

    Science.gov (United States)

    Kim M. Wilkinson

    2009-01-01

    This handbook provides an overview of the factors that go into starting and operating a native plant nursery. Management includes all aspects of working with plants in all their phases of growth as described in Chapter 3, Crop Planning and Developing Propagation Protocols. Management also includes working with the community; organizing materials and infrastructure;...

  20. Forest nursery pests

    Science.gov (United States)

    Michelle M. Cram; Michelle S. Frank; Katy M. Mallams

    2012-01-01

    This edition of Forest Nursery Pests, Agriculture Handbook No. 680, was made possible by the work of many people from around the country. Contributing authors include U.S. Department of Agriculture, Forest Service and Agricultural Research Service entomologists and pathologists, university professors and researchers, State extension specialists, consultants, and plant...

  1. 7 CFR 701.55 - Nursery.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Nursery. 701.55 Section 701.55 Agriculture Regulations... ADMINISTERED UNDER THIS PART § 701.55 Nursery. (a) Subject to the other eligibility provisions of this part... under this section for the cost of removing nursery debris such as nursery structures, shade houses, and...

  2. 7 CFR 1437.305 - Ornamental nursery.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Ornamental nursery. 1437.305 Section 1437.305... Determining Coverage Using Value § 1437.305 Ornamental nursery. (a) Eligible ornamental nursery stock is a... ornamental nursery stock is limited to field-grown and containerized decorative plants grown in a controlled...

  3. Nursery School - Enrollments 2011-2012

    CERN Multimedia

    Jardin d'Enfants

    2011-01-01

    Tuesday 8, Wednesday 9 and Thursday 10 March From 8.00 to 10.00 at the Nursery School Registration forms will be available from 4th March onwards: At the Nursery School, from Catherine Regelbrugge, Secretary tel: 73604, Catherine.Regelbrugge@cern.ch    At the Nursery School, from Brigitte Pillionnel, Headmistress tel:77925, Brigitte.Pillionnel@cern.ch    On the pages of the Nursery School website

  4. Nursery School - ENROLMENTS 2011-2012

    CERN Multimedia

    Jardin d'enfants

    2011-01-01

    Tuesday 8, Wednesday 9 and Thursday 10 March From 8.00 to 10.00 at the Nursery School Registration forms available from 4th March onwards: At the Nursery School, from Catherine Regelbrugge, Secretary, tel: 73604, Catherine.Regelbrugge@cern.ch At the Nursery School, from Brigitte Pillionnel, Headmistress, tel: 77925, Brigitte.Pillionnel@cern.ch On the pages of the Nursery School website

  5. The Nursery Worker. Teacher Guide. Revised.

    Science.gov (United States)

    Welch, A. W.

    This teacher's guide is designed for use in a vocational horticulture course designed to prepare students for jobs as nursery workers. Addressed in the individual units of the guide are the following topics: the nursery industry; soils; plant growth; plant nutrition; plant propagation methods; nursery field practices; pest control; techniques for…

  6. Insecticide solvents: interference with insecticidal action.

    Science.gov (United States)

    Brattsten, L B; Wilkinson, C F

    1977-06-10

    Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.

  7. Nursery of Giants

    Science.gov (United States)

    2004-01-01

    Hidden behind a shroud of dust in the constellation Cygnus is a stellar nursery called DR21, which is giving birth to some of the most massive stars in our galaxy. Visible light images reveal no trace of this interstellar cauldron because of heavy dust obscuration. In fact, visible light is attenuated in DR21 by a factor of more than 10,000,000,000,000,000,000,000,000,000,000,000,000,000 (ten thousand trillion heptillion). New images from NASA's Spitzer Space Telescope allow us to peek behind the cosmic veil and pinpoint one of the most massive natal stars yet seen in our Milky Way galaxy. The never-before-seen star is 100,000 times as bright as the Sun. Also revealed for the first time is a powerful outflow of hot gas emanating from this star and bursting through a giant molecular cloud. This image is a large-scale mosaic assembled from individual photographs obtained with the InfraRed Array Camera (IRAC) aboard Spitzer. The image covers an area about two times that of a full moon. The mosaic is a composite of images obtained at mid-infrared wavelengths of 3.6 microns (blue), 4.5 microns (green), 5.8 microns (orange) and 8 microns (red). The brightest infrared cloud near the top center corresponds to DR21, which presumably contains a cluster of newly forming stars at a distance of 10,000 light-years. Protruding out from DR21 toward the bottom left of the image is a gaseous outflow (green), containing both carbon monoxide and molecular hydrogen. Data from the Spitzer spectrograph, which breaks light into its constituent individual wavelengths, indicate the presence of hot steam formed as the outflow heats the surrounding molecular gas. Outflows are physical signatures of processes that create supersonic beams, or jets, of gas. They are usually accompanied by discs of material around the new star, which likely contain the materials from which future planetary systems are formed. Additional newborn stars, depicted in green, can be seen surrounding the DR21 region

  8. Recirculation nursery systems for bivalves

    NARCIS (Netherlands)

    Kamermans, P.; Blanco Garcia, A.; Joaquim, Sandra; Matias, Domitilia; Magnesen, Thorolf; Nicolas, J.; Petten, Bruno; Robert, Rene

    2016-01-01

    n order to increase production of bivalves in hatcheries and nurseries, the development of new technology and its integration into commercial bivalve hatcheries is important. Recirculation aquaculture systems (RASs) have several advantages: high densities of the species can be cultured resulting in

  9. Nursery Product-Related Injuries Treated in United States Emergency Departments.

    Science.gov (United States)

    Gaw, Christopher E; Chounthirath, Thiphalak; Smith, Gary A

    2017-04-01

    The goal of this study was to determine the epidemiology of injuries associated with nursery products among young children treated in US emergency departments. Data from the National Electronic Injury Surveillance System were retrospectively analyzed for patients aged nursery product from 1991 through 2011. An estimated 1 391 844 (95% confidence interval, 1 169 489-1 614 199) nursery product-related injuries among children aged Nursery product-related injuries were most commonly associated with baby carriers (19.5%), cribs/mattresses (18.6%), strollers/carriages (16.5%), or baby walkers/jumpers/exercisers (16.2%). The most common mechanism of injury was a self-precipitated fall (80.0%), and the most frequently injured body region was the head or neck (47.1%). Although successful injury prevention efforts with baby walkers led to a decline in nursery product-related injuries from 1991 to 2003, the number and rate of these injuries have been increasing since 2003. Greater efforts are warranted to prevent injuries associated with other nursery products, especially baby carriers, cribs, and strollers. Prevention of falls and concussions/closed head injuries associated with nursery products also deserves special attention. Copyright © 2017 by the American Academy of Pediatrics.

  10. Case studies of nurseries in Malawi

    DEFF Research Database (Denmark)

    Namoto, M.; Likoswe, M.G.

    This study of 42 case studies of nurseries was made as part of a major sample survey of 360 nurseries in 6 districts in Malawi. The purpose of the study was to let the small nurseries in the country explain in their own words how they source seed, how and for whom they produce seedlings......, and to explain about their problems and opportunities in the nursery business. The assessment was made within the framework of Improved Seed Supply for Agroforestry in African Countries (ISSAAC), a Danida supported programme implemented in cooperation between Forest & Landscape Denmark and World Agroforestry...

  11. Forest nursery pest management in Cuba

    Science.gov (United States)

    Rene Alberto Lopez Castilla; Angela Duarte Casanova; Celia Guerra Rivero; Haylett Cruz Escoto; Natividad Triguero Issasi

    2002-01-01

    A systematic survey of methods to detect pests in forest nurseries before they damage plants was done. These surveys recorded the most important forest nursery pests during 18 years (from 1980 to 1998) and their geographical and temporal distribution in the principal enterprises in Cuba. Approximately a dozen insect species and three fungi species responsible for the...

  12. Hot spots of Phytophthora in commercial nurseries

    Science.gov (United States)

    Corina Junker; Patrick Goff; Stefan Wagner; Sabine Werres

    2017-01-01

    Studies have shown that nurseries are an important source for the spread of Phytophthora. Most surveys and studies focusing on the epidemiology of these pathogens in nurseries are based on sampling of symptomatic plants or on samples like water of different sources used for irrigation. There is little knowledge, however, on the survival and...

  13. Rhizoctonia crown and root rot disease nursery

    Science.gov (United States)

    The BSDF cooperative CRR Eastern Evaluation Nursery Rhizoctonia crown and root rot Evaluation Nursery in 2016 was a randomized complete-block design with five replications in 15 feet long, one-row plots (20 in row spacing), at the Saginaw Valley Research and Education Center near Frankenmuth, MI. F...

  14. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2002-01-01

    Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

  15. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2001-01-01

    Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

  16. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2003-01-01

    Behavioral, neurochemical, and immunocytochemical studies are characterizing the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and/or permethrin (PM...

  17. 3 Insecticide Use Practice

    African Journals Online (AJOL)

    Administrator

    500,000 metric tonnes in the 1964/1965 season. Problems ... insecticides on the open market. ... effective in the management of insect pests of cocoa. .... Effectiveness and profitability of pest ... Youth in Agriculture; Programme Policy, Strategy.

  18. Insecticides and Biological Control

    Science.gov (United States)

    Furness, G. O.

    1972-01-01

    Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

  19. The Influence of Neonatal Nursery Design on Mothers' Interactions in the Nursery.

    Science.gov (United States)

    Jones, Liz; Peters, Kathryn; Rowe, Jennifer; Sheeran, Nicola

    2016-01-01

    This study examined the influence of neonatal nursery design on interactions between nurses and mothers of infants in the nursery. We used a natural quasi-experimental design, using semi-structured interviews and a structured measure of mothers' and nurses' perceptions of nursing care, to compare mothers (n=26 and n=40) and nurses (n=22 and n=29) in an open-bay (OB) nursery and a single family room (SFR) nursery. Thematic analysis was used to generate key themes from the interviews. Mothers and nurses in both nursery designs talked about Valuing interactions; the importance of interactions between mothers and nurses. Mothers and nurses described SFRs as providing a space, My/their room, which enhanced mothers' sense of control and connection with the infant. SFRs were also associated with Changing the norms of interactions with nurses and other mothers, which created challenges in the desired quantity and quality of interactions for mothers and nurses. Nurses in the SFR nursery also reported Enhanced interactions, including improved confidentiality and personalized communication. Mothers in the OB nursery reported more supportive mothering actions from nurses than mothers in the SFR nursery. Both mothers and nurses in the OB nursery also talked about Our nursery community, which captured the value of having other nurses and mothers in the rooms. Mothers and nurses perceived that the SFR nursery enhanced privacy and maternal closeness for mothers compared to the OB nursery. However, the SFR nursery design presented challenges to some interactions of value to nurses and mothers. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. 29 CFR 780.205 - Nursery activities generally.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Nursery activities generally. 780.205 Section 780.205 Labor... as It Relates to Specific Situations Nursery and Landscaping Operations § 780.205 Nursery activities generally. The employees of a nursery who are engaged in the following activities are employed in...

  1. 76 FR 78610 - Notice of Intent To Suspend the Nursery Production, the Nursery and Floriculture Chemical Use...

    Science.gov (United States)

    2011-12-19

    ... Nursery Production, the Nursery and Floriculture Chemical Use, and the Christmas Tree Production Surveys... Agricultural Statistics Service (NASS) to suspend currently approved information collections for all Nursery and Christmas Tree Production Surveys along with the Nursery and Floriculture Chemical Use Survey...

  2. Botanical Insecticides in Plant Protection

    OpenAIRE

    Grdiša, Martina; Gršić, Kristina

    2013-01-01

    Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....

  3. Reduced risk insecticides to control scale insects and protect natural enemies in the production and maintenance of urban landscape plants.

    Science.gov (United States)

    Frank, Steven D

    2012-04-01

    Armored scale insects are among the most difficult to manage and economically important arthropod pests in the production and maintenance of urban landscape plants. This is because of morphological traits that protect them from contact insecticides. I compared initial and season-long control of euonymus scale, Unaspis euonymi Comstock (Hemiptera: Diaspidae), by reduced-risk insecticides (insect growth regulators [IGRs], neonicotinoids, spirotetramat) to determine if they controlled scale as well as more toxic insecticides such as the organophosphate, acephate, and pyrethroid, bifenthrin. I also evaluated how these insecticides affected natural enemy abundance on experimental plants and survival when exposed to insecticide residue. All insecticides tested reduced first generation euonymus scale abundance. In 2009, reinfestation by second generation euonymus scale was highest on plants treated with acetamiprid and granular dinotefuran. In 2010, systemic neonicotinoids and spirotetramat prevented cottony cushion scale infestation 133 d after treatment whereas scale readily infested plants treated with bifenthrin and horticultural oil. Encarsia spp. and Cybocephalus spp. abundance was related to scale abundance. These natural enemies were generally less abundant than predicted by scale abundance on granular dinotefuran treated plants and more abundant on granular thiamethoxam treated plants. Bifenthrin residue killed 90-100% of O. insidiosus and E. citrina within 24 h. My results indicate that reduced risk insecticides can provide season-long scale control with less impact on natural enemies than conventional insecticides. This could have economic and environmental benefits by reducing the number of applications necessary to protect nursery and landscape plants from scale.

  4. Enhancing forest nursery education: Input from the 2007 Joint Meeting of the Western Forest and Conservation Nursery Association and Forest Nursery Association of British Coumbia

    Science.gov (United States)

    Anthony S. Davis

    2008-01-01

    Concern has been noted over the lack of qualified applicants for vacancies in forest nursery positions. The University of Idaho Center for Forest Nursery and Seedling Research is uniquely qualified to address the issue of training given its faculty, staff, and resources. The keystone resource in this regard is the Franklin H. Pitkin Forest Nursery, a seedling...

  5. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  6. IRRIGATION OF ORNAMENTAL PLANT NURSERY

    Directory of Open Access Journals (Sweden)

    Eduardo de Aguiar do Couto

    2013-01-01

    Full Text Available Airports consume significant amounts of water which can be compared to the volume consumed by mid-size cities, thus practices aimed at reducing water consumption are important and necessar y. The objective of this study was to assess the reuse potential of sewage effluent produced at a mid-size international airport for nursery irri gation. The sewage treatment system consisted of a facultative pond followed by a constructed wetland, which were monitored during one hydrological year a nd the parameters COD, pH, solids, nitrogen, phosphorus and Escherichia coli we re analyzed. Removal efficiencies of 85% and 91% were achieved for C OD and solids, respectively. Removal efficiencies for ammonia nitrogen a nd total phosphorus were 77% and 59%, respectively. In terms of E. coli concen tration, the treated effluent met the recommendations by the World Health Organization for reuse in irrigation with the advantage of providing high levels of residual nutrient. The ornamental species Impatiens walleriana was irrigated with treated sewage effluent and plant growth characteristics were evalua ted. The experiment showed that reuse can enhance plant growth without signi ficantly affecting leaf tissue and soil characteristics. This study highlighted th e importance of simple technologies for sewage treatment especially in count ries which still do not present great investment in sanitation and proved that effluent reuse for landscape irrigation can provide great savings of water and financial resources for airport environments.

  7. Development of an intertidal mangrove nursery and afforestation techniques

    Digital Repository Service at National Institute of Oceanography (India)

    Untawale, A.G.

    The development of an intertidal mangrove nursery and afforestation technique for regeneration and restoration of mangroves of Goa is described. Site selection, source of plant material, nursery plantation, season of transplantation, technique...

  8. MEANING AND FORM IN NURSERY RHYMES TRANSLATION

    Directory of Open Access Journals (Sweden)

    Ikke Dewi Pratama

    2017-07-01

    Full Text Available Abstract MAKNA DAN BENTUK DALAM PENERJEMAHAN LAGU-LAGU ANAK Abstract Translating nursery rhymes is not an easy task. The problems of equivalence in meaning and form as well as in the harmony between the translated lyrics and the music are aspects that need to be considered by the translators. By considering nursery rhyme lyric as poetry text, this research analyzes the equivalence of meaning and form in nursery rhymes translation. This research focuses on five nursery rhymes. The meaning analysis was done by conducting particular procedures on translation quality assessment. Meanwhile, the analysis of the form was conducted by comparing the two versions of the nursery rhymes focusing on the sound values. From the equivalence of meaning, the result shows that most nursery rhymes are translated less accurately. On the other hand, the finding of the equivalence in form shows that most of the auditory devices are deleted while most of the rhymes are shifted. This research is expected to give a contribution to song translation activities especially those involving children as the target listeners. Keywords: equivalence, accuracy, sound values, auditory devices, rhymes Abstrak Menerjemahkan lagu anak bukanlah hal yang mudah. Masalah kesepadanan makna dan bentuk, serta harmonisasi antara lirik terjemahan dan musik adalah aspek-aspek yang harus dipertimbangkan oleh penerjemah. Dengan mempertimbangkan lirik lagu anak sebagai teks puisi, penelitian ini menganalisis kesepadanan antara makna dan bentuk dalam terjemahan lagu anak. Dengan menggunakan teknik sampling, penelitian ini berfokus kepada lima lagu anak. Analisis makna dilakukan dengan prosedur penelitian kualitas terjemahan sedangkan analisis bentuk dilakukan dengan membandingkan dua versi lagu anak dengan fokus kepada sound values (bunyi. Analisis kesepadanan makna menunjukkan bahwa sebagian besar lagu anak diterjemahkan dengan kurang akurat. Dari segi bentuk, sebagian besar auditory devices

  9. 7 CFR 457.164 - Nursery rehabilitation endorsement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery rehabilitation endorsement. 457.164 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.164 Nursery rehabilitation endorsement. Nursery Crop Insurance Rehabilitation Endorsement If you elect this endorsement and pay the...

  10. 7 CFR 457.163 - Nursery peak inventory endorsement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery peak inventory endorsement. 457.163 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.163 Nursery peak inventory endorsement. Nursery Crop Insurance Peak Inventory Endorsement This endorsement is not continuous and must be...

  11. 7 CFR 457.162 - Nursery crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery crop insurance provisions. 457.162 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.162 Nursery crop insurance provisions. The Nursery Crop Insurance Provisions for the 2006 and succeeding crop years are as follows: FCIC...

  12. National Proceedings: Forest and Conservation Nursery Associations-2009

    Science.gov (United States)

    L. E. Riley; J. R. Pinto; R. K. Dumroese

    2010-01-01

    These proceedings are a compilation of 20 papers that were presented at the regional meetings of the Intertribal Nursery Council and the forest and conservation nursery associations in the United States in 2009. The Intertribal Nursery Council Meeting was held at the Best Western University Inn in Moscow, Idaho, on July 14, 2009. Subject matter for the technical...

  13. Thiamethoxam and imidacloprid drench applications on sweet orange nursery trees disrupt the feeding and settling behaviour of Diaphorina citri (Hemiptera: Liviidae).

    Science.gov (United States)

    Miranda, Marcelo P; Yamamoto, Pedro T; Garcia, Rafael B; Lopes, João Pa; Lopes, João Rs

    2016-09-01

    Chemical control is the method most used for management of Diaphorina citri, the vector of the phloem-limited bacteria associated with citrus huanglongbing (HLB) disease. The objectives of this study were to determine the influence of soil-drench applications of neonicotinoids (thiamethoxam and imidacloprid) on the probing behaviour of D. citri on citrus nursery trees, using the electrical penetration graph (EPG) technique, and to measure the D. citri settling behaviour after probing on citrus nursery trees that had received these neonicotinoid treatments. The drench applications of neonicotinoids on citrus nursery trees disrupt D. citri probing, mainly for EPG variables related to phloem sap ingestion, with a significant reduction (≈90%) in the duration of this activity compared with untreated plants in all assessment periods (15, 35 and 90 days after application). Moreover, both insecticides have a repellent effect on D. citri, resulting in significant dispersal of psyllids from treated plants. This study clearly demonstrates the interference of soil-applied neonicotinoids on the feeding and settling behaviour of D. citri on citrus nursery trees, mainly during the phloem ingestion phase. These findings reinforce the recommendation of drench application of neonicotinoids before planting nursery trees as a useful strategy for HLB management. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  14. A short history of insecticides

    Directory of Open Access Journals (Sweden)

    Oberemok Volodymyr Volodymyrovych

    2015-07-01

    Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.

  15. Nursery School Headteacher Leadership Behaviour Correlates of Nursery School Teachers Job Satisfaction in Akoko North, Ondo State, Nigeria

    Science.gov (United States)

    Clara, Okoroafor Nnenna

    2016-01-01

    The present study focuses on nursery school head teacher leadership behaviour as it correlates to nursery school teacher's job satisfaction. Data were collected through a scale and returned by sample of two hundred and fifty nursery school teacher's in Akoko North, Ondo State, Nigeria.Data collected were analyzed using mean and standard deviation…

  16. Fumigant distribution in forest nursery soils

    Science.gov (United States)

    Dong Wang; Stephen W. Fraedrich; Jennifer Juzwik; Kurt Spokas; Yi Zhang; William C. Koskinen

    2006-01-01

    Adequate concentration, exposure time and distribution uniformity of activated fumigant gases are prerequisites for successful soil fumigation. Field experiments were conducted to evaluate gas phase distributions of methyl isothiocyanate (MITC) and chloropicrin (CP) in two forest-tree nurseries. Concentrations of MITC and CP in soil air were measured from replicated...

  17. Ambitious Survey Spots Stellar Nurseries

    Science.gov (United States)

    2010-08-01

    -dimensional geometry of the Magellanic system. Chris Evans from the VMC team adds: "The VISTA images will allow us to extend our studies beyond the inner regions of the Tarantula into the multitude of smaller stellar nurseries nearby, which also harbour a rich population of young and massive stars. Armed with the new, exquisite infrared images, we will be able to probe the cocoons in which massive stars are still forming today, while also looking at their interaction with older stars in the wider region." The wide-field image shows a host of different objects. The bright area above the centre is the Tarantula Nebula itself, with the RMC 136 cluster of massive stars in its core. To the left is the NGC 2100 star cluster. To the right is the tiny remnant of the supernova SN1987A (eso1032). Below the centre are a series of star-forming regions including NGC 2080 - nicknamed the "Ghost Head Nebula" - and the NGC 2083 star cluster. The VISTA Magellanic Cloud Survey is one of six huge near-infrared surveys of the southern sky that will take up most of the first five years of operations of VISTA. Notes [1] VISTA ― the Visible and Infrared Survey Telescope for Astronomy ― is the newest telescope at ESO's Paranal Observatory in northern Chile. VISTA is a survey telescope working at near-infrared wavelengths and is the world's largest survey telescope. Its large mirror, wide field of view and very sensitive detectors will reveal a completely new view of the southern sky. The telescope is housed on the peak adjacent to the one hosting ESO's Very Large Telescope (VLT) and shares the same exceptional observing conditions. VISTA has a main mirror that is 4.1 m across. In photographic terms it can be thought of as a 67-megapixel digital camera with a 13 000 mm f/3.25 mirror lens. More information ESO, the European Southern Observatory, is the foremost intergovernmental astronomy organisation in Europe and the world's most productive astronomical observatory. It is supported by 14 countries

  18. Piano instruction for nursery school trainees

    OpenAIRE

    新海, 節; Makoto, SHINKAI; 藤女子大学人間生活学部保育学科

    2012-01-01

    It is important piano instruction in childcare training schools be viewed primarily as "music for childcare". To this end,it is also important that the view of piano instruction for nursery school trainees be switched from one mainly focused on the technical aspects of performance using many etudes to a form of instruction based on developing the musicality of the trainees and their ability to display emotion through music. Further, through this instruction, the trainees need to develop the a...

  19. Neurotoxicology of insecticides and pheromones

    National Research Council Canada - National Science Library

    Narahashi, Toshio

    1979-01-01

    The purpose of this symposium was to provide a forum where a variety of scientists who were interested in the interactions of insecticides and pheromones with the nervous system got together to exchange their views...

  20. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.

  1. Nutrient removal by apple, pear and cherry nursery trees

    OpenAIRE

    Giovambattista Sorrenti; Maurizio Quartieri; Silvia Salvi; Moreno Toselli

    2017-01-01

    Given that nursery is a peculiar environment, the amount of nutrients removed by nursery trees represents a fundamental acquisition to optimise fertilisation strategies, with economic and environmental implications. In this context, we determined nutrient removal by apple, pear and cherry nursery trees at the end of the nursery growing cycle. We randomly removed 5 leafless apple (Golden Delicious/EMLA M9; density of 30,000 trees ha–1), pear (Santa Maria/Adams; density of 30,000 trees ha–1) an...

  2. Particulate matter in rural and urban nursery schools in Portugal

    International Nuclear Information System (INIS)

    Nunes, R.A.O.; Branco, P.T.B.S.; Alvim-Ferraz, M.C.M.; Martins, F.G.; Sousa, S.I.V.

    2015-01-01

    Studies have been showing strong associations between exposures to indoor particulate matter (PM) and health effects on children. Urban and rural nursery schools have different known environmental and social differences which make their study relevant. Thus, this study aimed to evaluate indoor PM concentrations on different microenvironments of three rural nursery schools and one urban nursery school, being the only study comparing urban and rural nursery schools considering the PM 1 , PM 2.5 and PM 10 fractions (measured continuously and in terms of mass). Outdoor PM 2.5 and PM 10 were also obtained and I/O ratios have been determined. Indoor PM mean concentrations were higher in the urban nursery than in rural ones, which might have been related to traffic emissions. However, I/O ratios allowed concluding that the recorded concentrations depended more significantly of indoor sources. WHO guidelines and Portuguese legislation exceedances for PM 2.5 and PM 10 were observed mainly in the urban nursery school. - Highlights: • This is the only study comparing urban and rural nurseries considering PM fractions. • A low number of children in classrooms is enough to increase PM concentrations. • Children in urban nurseries are exposed to higher PM concentrations than in rural. • Children were mainly exposed to the finer fractions, which are worse to health. - PM levels were higher in the urban nursery than in the rural ones, which might have been related to traffic emissions. Still concentrations depended more significantly of indoor sources

  3. Pollution Of Insecticide Residues In PPTN Pasar Jumat Area

    International Nuclear Information System (INIS)

    Syahrir, Ulfa T.; Chairul, Sofnie M.

    2000-01-01

    Measurement of insecticide residue pollution from some organochlorin and organo-phosphat in soil and water samples were carried out 1999-2000 periode. The aim of the measurement was to get information about impact of laboratorium activity on insecticide contents in PPTN PASAR JUMAT. Gas chromatograph with electron capture and flame ionization detector were used to measure the pesticide content. Result of the measurement in PPTN area showed that organo-chlorin were alpha BHC, endosulfan band DDT and organo-phosphat were klorphyriphos and malation and were lower than tolerance level

  4. Evaluation of systemic neonicotinoid insecticides for the management of the Asian citrus psyllid Diaphorina citri on containerized citrus.

    Science.gov (United States)

    Byrne, Frank J; Daugherty, Matthew P; Grafton-Cardwell, Elizabeth E; Bethke, James A; Morse, Joseph G

    2017-03-01

    Studies were conducted to evaluate uptake and retention of three systemic neonicotinoid insecticides, dinotefuran, imidacloprid and thiamethoxam, in potted citrus nursery plants treated at standard label rates. Infestation of these plants placed at a field site with moderate levels of Asian citrus psyllid (ACP) was monitored for 14 weeks following treatments, and insecticide residues in leaf tissue were quantified using enzyme-linked immunosorbent assay (ELISA). Bioassays were conducted using leaves harvested on various dates post-treatment to compare the efficacies of residues against adult ACP. Residues of the three neonicotinoids were detected in leaf tissues within 1 week after treatment. Peak concentrations established at 1 week for imidacloprid and dinotefuran and at 2 weeks for thiamethoxam. Imidacloprid and thiamethoxam outperformed the control and dinotefuran treatments at protecting trees from infestations by ACP eggs and nymphs. For a given insecticide concentration in leaf tissue, thiamethoxam induced the highest mortality of the three insecticides, and dinotefuran was the least toxic. If the time needed to achieve effective thresholds of a systemic neonicotinoid is known, treatments at production facilities could be scheduled that would minimize unnecessary post-treatment holding periods and ensure maximum retention of effective concentrations after the plants have shipped to retail outlets. The rapid uptake of the insecticides and retention at effective concentrations in containerized citrus suggest that the current 30 day post-treatment shipping restriction from production facilities to retail outlets outside of quarantine could be shortened to 14 days. Thiamethoxam should be added to the list of approved nursery treatments. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  5. Juvenile nursery colonization patterns for the European flounder (

    NARCIS (Netherlands)

    Martinho, F.; van der Veer, H.W.; Cabral, H.N.; Pardal, M.A.

    2013-01-01

    In this work, we analysed the latitudinal trends in the nursery habitat colonization processes of the European flounder (Platichthys flesus). This was accomplished by estimating the duration of the pelagic and metamorphic stages, as well as the duration of the spawning period, in several nursery

  6. Development of Two Intelligent Spray Systems for Ornamental Nurseries

    Science.gov (United States)

    Current application technology for floral, nursery, and other specialty crop production wastes significant amounts of pesticides. Two different real-time variable-rate sprayer prototypes for ornamental nursery and tree crops were developed to deliver chemicals on target areas as needed. The first pr...

  7. How to test herbicides at forest tree nurseries.

    Science.gov (United States)

    Roger E. Sandquist; Peyton W. Owston; Stephen E. McDonald

    1981-01-01

    Procedures developed in a cooperative westwide study of weed control in forest tree nurseries are described in a form modified for use by nursery managers. The proven, properly designed test and evaluation methods can be used to generate data needed for evaluation and registration of herbicides.

  8. Investigations of Fusarium diseases within Inland Pacific Northwest forest nurseries

    Science.gov (United States)

    Robert L. James; R. Kasten Dumroese

    2007-01-01

    Fusarium spp. cause important diseases that limit production of seedlings in forest nurseries worldwide. Several aspects of these diseases have been investigated for many years within Inland Pacific Northwest nurseries to better understand disease etiology, pathogen inoculum sources, and epidemiology. Investigations have also involved improving...

  9. National Proceedings: Forest and Conservation Nursery Associations-2007

    Science.gov (United States)

    Kas Dumroese; L. E. Riley

    2008-01-01

    These proceedings are a compilation of the papers that were presented at the regional meetings of the forest and conservation nursery associations in the United States and Canada in 2007. The Northeastern Forest and Conservation Nursery Association meeting was held July 16 to 19 at the Grappone Conference Center in Concord, NH. The meeting was hosted by the New...

  10. Using organic fertilizers in forest and native plant nurseries

    Science.gov (United States)

    Thomas D. Landis; R. Kasten Dumroese

    2012-01-01

    Since World War II, synthetic fertilizers have been used almost exclusively to grow forest and native plant nursery crops because they are quickly soluble and readily taken up by crops, producing the rapid growth rates that are necessary in nursery culture. In recent years, however, a wide variety of new organic fertilizers have become available. We divided these...

  11. Nursery function of tropical back-reef systems

    NARCIS (Netherlands)

    Adams, A.J.; Dahlgren, C.P.; Kellison, G.T.; Kendall, M.S.; Layman, C.A.; Ley, J.A.; Nagelkerken, I.; Serafy, J.E.

    2006-01-01

    Similar to nearshore systems in temperate latitudes, the nursery paradigm for tropical back-reef systems is that they provide a habitat for juveniles of species that subsequently make ontogenetic shifts to adult populations on coral reefs (we refer to this as the nursery function of back-reef

  12. Pedagogy with Babies: Perspectives of Eight Nursery Managers

    Science.gov (United States)

    Elfer, Peter; Page, Jools

    2015-01-01

    The last 30 years have seen a significant increase in babies attending nursery, with corresponding questions about the aims and organisation of practice. Research broadly agrees on the importance of emotionally consistent, sensitive and responsive interactions between staff and babies. Policy objectives for nursery and expectations of parents and…

  13. A canteen for the Nursery School A project for CERN

    CERN Document Server

    Association du personnel

    2007-01-01

    For a number of years a minimum service has been offered at lunchtime between 12.15 and 13.30 for children enrolled for the full day at the CERN Nursery School. This service is provided by qualified staff at the Nursery School, on the premises, the meals being supplied by the parents.

  14. Signing In: Knowledge and Action in Nursery Teaching

    Science.gov (United States)

    Plum, Maja

    2018-01-01

    Based on fieldwork conducted in two day care centres in Denmark, this paper explores knowledge and action as relational and intertwined phenomena in nursery teaching. Engaging with perspectives from actor network theory, emphasis is put on the socio-material distribution of knowing and acting. That is, how the nursery teacher becomes part of…

  15. Optimaal en efficient voeren van mosselbroed in een nursery

    NARCIS (Netherlands)

    Hiele, van der T.M.

    2007-01-01

    Stage verslag van een student van de hogeschool Zeeland, opleiding aquatische Ecotechnologie. Bij dit onderzoek is gekeken naar optimaal en efficient voeren van mosselbroed in een nursery. Geconcludeerd wordt dat de beste manier om mosselbroed in een nursery te voeren is door de algen toe te dienen

  16. National Proceedings: Forest and Conservation Nursery Associations - 2013

    Science.gov (United States)

    K. M. Wilkinson; D. L. Haase; J. R. Pinto

    2014-01-01

    These proceedings are a compilation of 14 papers that were presented at the regional meetings of the forest and conservation nursery associations in the United States in 2013. The Joint Northeast and Southern Forest Nursery Conference was held at the Holiday Inn City Centre, Lafayette, Indiana, July 22 to 25, 2013. Subject matter for the technical sections included...

  17. Proactive approach to containment of enterovirus infection in the nursery.

    Science.gov (United States)

    Fuchs, Inbal; Golan, Agneta; Borer, Abraham; Shemer-Avni, Yonat; Dagan, Ron; Greenberg, David

    2013-07-01

    Administration of prophylactic intravenous immunoglobulins to contacts of infants actively shedding enterovirus during a hospital nursery outbreak may attenuate severity of disease in those contacts and aid in containment of the outbreak. Four cases of neonatal enteroviral disease were treated in our hospital nursery in July and August 2011; 3 were presumed or proven vertical transmission cases and 1 was a presumed horizontal transmission. We aimed to prevent development of severe illness in contacts of affected neonates following a ministry of health advisory during the summer of 2011 warning of increased neonatal enteroviral morbidity and mortality in Israel. Strict infection control measures were implemented, including meticulous decontamination of the nursery environment and administration of intravenous immunoglobulin prophylaxis to contacts. No further horizontal transmission occurred after infection control interventions. Immunoglobulin prophylaxis to control enteroviral infection in the nursery should be considered as an auxiliary infection control intervention during a nursery outbreak.

  18. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.

  19. Optimalisatie van een nursery systeem voor de kweek van mosselbroed en een algenkweek systeem t.b.v. deze nursery

    NARCIS (Netherlands)

    Peene, F.

    2006-01-01

    Stage rapport van een leerling van Hogeschool Zeeland, opleiding Aquatische Ecotechnologie. De studie die tijdens deze stage uitgevoerd is, is een literatuurstudie naar systemen voor de nursery van mosselen en systemen voor grootschalige algenkweek ten behoeve van deze nursery. Ook zijn experimenten

  20. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors

    OpenAIRE

    Reid, Molly C.; McKenzie, F. Ellis

    2016-01-01

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...

  1. Four years experience with filtration systems in commercial nurseries for eliminating Phytophthora species from recirculation water

    Science.gov (United States)

    T. Ufer; M. Posner; H.-P. Wessels; S. Wagner; K. Kaminski; T. Brand; Werres S.

    2008-01-01

    In a four year project, three different filtration systems were tested under commercial nursery conditions to eliminate Phytophthora spp. from irrigation water. Five nurseries were involved in the project. Slow sand filtration systems were tested in three nurseries. In the fourth nursery, a filtration system with lava grains (Shieer® Bio filtration)...

  2. 7 CFR 301.75-17 - Funds for the replacement of certified citrus nursery stock.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Funds for the replacement of certified citrus nursery... nursery stock. Subject to the availability of appropriated funds, a commercial citrus nursery may be eligible to receive funds to replace certified citrus nursery stock in accordance with the provisions of...

  3. 29 CFR 780.216 - Nursery activities generally and Christmas tree production.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Nursery activities generally and Christmas tree production... Nursery activities generally and Christmas tree production. (a) The employees of a nursery who are engaged... horticultural commodities such as the following are employed in agriculture: (1) Planting seedlings in a nursery...

  4. Caribou nursery site habitat characteristics in two northern Ontario parks

    Directory of Open Access Journals (Sweden)

    Natasha L. Carr

    2007-04-01

    Full Text Available To prevent further range recession, habitat features essential to the life-history requisites of woodland caribou (Rangifer tarandus caribou such as calving and nursery sites need to be protected for the persistence of the species. Woodland caribou may minimize predation risk during calving by either spacing out or spacing away from predators in the forest to calve on islands, wetlands, or shorelines. Our objective was to determine the characteristics of shoreline habitats used as calving and nursery sites by female woodland caribou in northern Ontario. Detailed vegetation and other site characteristics were measured at nursery sites used by cow-calf pairs in Wabakimi and Woodland Caribou Provincial Parks for comparison with shoreline sites that were not used by caribou within each park. Differences in habitat variables selected by female caribou in the two study areas reflect broad ecoregional differences in vegetation and topography. In Wabakimi Provincial Park, understorey tree density and ground detection distance played key roles in distinguishing nursery sites from sites that were not used. In Woodland Caribou Provincial Park, groundcover vegetation and shrub density were important in the selection of nursery sites by female caribou. Generally, female caribou in both parks selected nursery sites with greater slope, lower shrub density but thicker groundcover vegetation, including greater lichen abundance, and higher densities of mature trees than shoreline sites that were not used. The identification of these important features for caribou nursery sites provides a basis for improving their protection in future management policies and legislation.

  5. Desert bighorn sheep lambing habitat: Parturition, nursery, and predation sites

    Science.gov (United States)

    Karsch, Rebekah C.; Cain, James W.; Rominger, Eric M.; Goldstein, Elise J.

    2016-01-01

    Fitness of female ungulates is determined by neonate survival and lifetime reproductive success. Therefore, adult female ungulates should adopt behaviors and habitat selection patterns that enhance survival of neonates during parturition and lactation. Parturition site location may play an important role in neonatal mortality of desert bighorn sheep (Ovis canadensis mexicana) when lambs are especially vulnerable to predation, but parturition sites are rarely documented for this species. Our objectives were to assess environmental characteristics at desert bighorn parturition, lamb nursery, and predation sites and to assess differences in habitat characteristics between parturition sites and nursery group sites, and predation sites and nursery group sites. We used vaginal implant transmitters (VITs) to identify parturition sites and capture neonates. We then compared elevation, slope, terrain ruggedness, and visibility at parturition, nursery, and lamb predation sites with paired random sites and compared characteristics of parturition sites and lamb predation sites to those of nursery sites. When compared to random sites, odds of a site being a parturition site were highest at intermediate slopes and decreased with increasing female visibility. Odds of a site being a predation site increased with decreasing visibility. When compared to nursery group sites, odds of a site being a parturition site had a quadratic relationship with elevation and slope, with odds being highest at intermediate elevations and intermediate slopes. When we compared predation sites to nursery sites, odds of a site being a predation were highest at low elevation areas with high visibility and high elevation areas with low visibility likely because of differences in hunting strategies of coyote (Canis latrans) and puma (Puma concolor). Parturition sites were lower in elevation and slope than nursery sites. Understanding selection of parturition sites by adult females and how habitat

  6. Pyrethrum flowers and pyrethroid insecticides.

    OpenAIRE

    Casida, J E

    1980-01-01

    The natural pyrethrins from the daisy-like flower, Tanacetum or Chrysanthemum cinerariifolium, are nonpersistent insecticides of low toxicity to mammals. Synthetic analogs or pyrethroids, evolved from the natural compounds by successive isosteric modifications, are more potent and stable and are the newest important class of crop protection chemicals. They retain many of the favorable properties of the pyrethrins.

  7. Limonene--A Natural Insecticide.

    Science.gov (United States)

    Beatty, Joseph H.

    1986-01-01

    Describes a high school chemistry student's research project in which limonene was isolated from the oil of lemons and oranges. Outlines the students' tests on the use of this chemical as an insecticide. Discusses possible extensions of the exercises based on questions generated by the students. (TW)

  8. Radioligand Recognition of Insecticide Targets.

    Science.gov (United States)

    Casida, John E

    2018-04-04

    Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.

  9. Variation effect on the insecticide activity of DDT analogues. A chemometric approach

    Science.gov (United States)

    Itoh, S.; Nagashima, U.

    2002-08-01

    We investigated a variation effect on the insecticide activity of DDT analogues by using the first principles electronic structure calculations and the neural network analysis. It has been found that the charge distribution at the specific atomic sites in the DDT molecule is related to their toxicity. This approach can contribute to designing a new insecticide and a new harmlessness process of the DDT analogues.

  10. Environmental impact of passive house nursery

    Energy Technology Data Exchange (ETDEWEB)

    Vares, S., Email: sirje.vares@vtt.fi

    2012-06-15

    It is often believed that reduction in energy use automatically leads to the total reduction of the carbon footprint and other emissions. To achieve better energy efficiency more raw materials may be needed not only for insulation and better windows but also for heating systems like ground source heat and solar panels. The use of advanced building systems increase the use of electricity and in winter where electricity production is already inadequate the additional stand-by power plants must be taken in use. These are not as effective as CHP plants for heat production. Moreover also the passive house structures can be produced in dozens ways and from many different materials which all have different service life, different need for maintenance and also different effect on the overall carbon footprint. Finally as the nursery is the overall concept, besides the building structures outdoor playgrounds and specific operations requiring day care trips, personnel commuting and waste treatment must be taken into account. (orig.)

  11. Evaluation of the efficacy of insecticidal coatings based on teflutrin and chlorpyrifos against Rhynchophorus ferrugineus.

    Science.gov (United States)

    Pugliese, Massimo; Rettori, Andrea Alberto; Martinis, Roberto; Al-Rohily, Khalid; Velate, Suresh; Moideen, Mohamed Ashraf; Al-Maashi, Ali

    2017-08-01

    The date palm (Phoenix dactylifera L.), an important economic resource for many nations worldwide, has recently been threatened by the presence of different insect pests, like the red palm weevil (RPW) Rhynchophorus ferrugineus. Two products, a glue (polyvinyl acetate) and an oil (raw linseed oil) were used as coatings and applied together with a repellent and two insecticides (teflutrin and chlorpyrifos) at different dosages on two species of palm (P. dactylifera and P. canariensis). Phytotoxic effects of the treatments were evaluated in a greenhouse on 260 potted palms (130 P. dactylifera and 130 P. canariensis) and no negative effects were observed. Afterwards, a trial lasting 400 days was carried out in a nursery located in Sicily (south Italy), treating 572 potted palm trees (286 P. dactylifera and 286 P. canariensis) with an average diameter at the base of 18-20 cm. After 400 days, 48% of the untreated palms were infested, while only 3% of date palms and 7% of Canary palms treated with insecticide at lower dosages were infested. The application of an insecticide-based coating is a good strategy to control and prevent the red palm weevil infestation, in particular on date palms. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  12. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors.

    Science.gov (United States)

    Reid, Molly C; McKenzie, F Ellis

    2016-02-19

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.

  13. Cooperative Atlantic States Shark Pupping and Nursery (COASTSPAN)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Survey of inshore areas used by sharks for pupping and nurseries. Various locations have been surveyed, from the U.S. Virgin Islands to Massachusetts, most in...

  14. Emission and soil distribution of fumigants in forest tree nurseries

    Science.gov (United States)

    Dong Wang; Jennifer Juzwik; Stephen Fraedrich

    2005-01-01

    Production of tree seedlings in the majority of forest nurseries in the USA has relied on soil fumigation with methyl bromide (MeBr) to control soil-borne plant pathogens, weeds, parasitic nematodes and insects. Since the announcement of the scheduled MeBr phase-out, a number of nurseries throughout the United States have participated in research programs on MeBr...

  15. Nursery words and hypocorisms among Germanic kinship terms

    DEFF Research Database (Denmark)

    Hansen, Bjarne Simmelkjær Sandgaard

    2018-01-01

    By using Jakobson’s (1960: 127-130) criteria for determining the nursery-word sta-tus of a given lexeme, I argue in this article that, even if we should no longer re-gard PG *aiþīn-/-ōn- ‘mother’ (Goth. aiþei), *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ as nursery words...

  16. Fluconazole use and safety in the nursery.

    Science.gov (United States)

    Castagnola, E; Jacqz-Aigrain, E; Kaguelidou, F; Maragliano, R; Stronati, M; Rizzollo, S; Farina, D; Manzoni, P

    2012-05-01

    Fluconazole is a triazole antifungal agent that is widely used in the nursery. It is available in both intravenous and oral formulation, and is active against most of the fungal pathogens that require treatment when retrieved from culture samples in neonatal intensive care units. Although clinical use has been wide for over 15 years, there have been small safety and efficacy studies completed in young infants. Randomised clinical trials assessing effectiveness of this agent in prevention of systemic fungal infections in neonates have been published in the last decade, and one large additional randomised study has been recently completed. Nevertheless, a certain degree of uncertainty still exists regarding the kinetics and appropriate dosing of this agent in premature and term infants, as well as regarding safety. Areas of poignant debate include the feasibility of loading dose strategies, appropriate dosages in the early days of life in the different subgroups of preterm infants, and long-term safety of fluconazole administered in prophylaxis during the first weeks of life in extremely premature infants. This paper reviews the most recent evidence on fluconazole and its role in the NICU settings. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  17. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  18. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  19. Recidivism after release from a prison nursery program.

    Science.gov (United States)

    Goshin, Lorie S; Byrne, Mary W; Henninger, Alana M

    2014-01-01

    To analyze 3-year recidivism after release from a prison nursery, a secure unit that allows imprisoned women to care for their infants. Descriptive study of 139 women who co-resided with their infants between 2001 and 2007 in a New York State prison nursery. Administrative criminal justice data were analyzed along with prospective study data on demographic, mental health, and prison nursery policy-related factors. Results reflect a sample of young women of color with histories of clinically significant depressive symptoms and substance dependence, who were convicted of nonviolent crimes and had multiple prior arrests. Three years after release 86.3% remained in the community. Only 4% of women returned to prison for new crimes. Survival modeling indicated that women who had previously violated parole had a significantly shorter mean return to prison time than those who were in the nursery for a new crime. Women released from a prison nursery have a low likelihood of recidivism. Innovative interventions are needed to address incarceration's public health effects. Nurses can partner with criminal justice organizations to develop, implement, and evaluate programs to ensure the health needs of criminal justice involved people and their families are met. © 2013 Wiley Periodicals, Inc.

  20. 75 FR 51245 - Agency Information Collection Activities; Proposed Collection; Comment Request; Durable Nursery...

    Science.gov (United States)

    2010-08-19

    ... CONSUMER PRODUCT SAFETY COMMISSION [Docket No. CPSC-2010-0088] Agency Information Collection Activities; Proposed Collection; Comment Request; Durable Nursery Products Exposure Survey AGENCY: Consumer... efforts on durable infant and toddler products. The draft Durable Nursery Products Exposure Survey...

  1. Benthic food webs support the production of sympatric flatfish larvae in estuarine nursery habitat

    Science.gov (United States)

    Identifying nursery habitats is of paramount importance to define proper management and conservation strategies for flatfish species. Flatfish nursery studies usually report upon habitat occupation, but few attempted to quantify the importance of those habitats to larvae developm...

  2. 2 Assessmen of the Efficiency of Insecticide

    African Journals Online (AJOL)

    Administrator

    malaria vectors and nuisance in West Africa – a-part. 2. Field evaluation. Malar J. 9: 341. Mosqueira B., Duchon S., Chandre F., Hougard, J. M., Carnevale P. and Mas-Coma S. (2010). Efficacy of an insecticide paint against insecticide- susceptible and resistant mosquitoes – b- Part 1: Laboratory evaluation. Malar J. 9: 340.

  3. Trifluoromethylphenyl amides as novel insecticides and fungicides

    Science.gov (United States)

    Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...

  4. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    2007-01-24

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.  Created: 1/24/2007 by Emerging Infectious Diseases.   Date Released: 3/13/2007.

  5. of Several Organophosphorus Insecticide Metabolites

    Directory of Open Access Journals (Sweden)

    Russell L. Carr

    2015-01-01

    Full Text Available Paraoxonase (PON1 is a calcium dependent enzyme that is capable of hydrolyzing organophosphate anticholinesterases. PON1 activity is present in most mammals and previous research established that PON1 activity differs depending on the species. These studies mainly used the organophosphate substrate paraoxon, the active metabolite of the insecticide parathion. Using serum PON1 from different mammalian species, we compared the hydrolysis of paraoxon with the hydrolysis of the active metabolites (oxons of two additional organophosphorus insecticides, methyl parathion and chlorpyrifos. Paraoxon hydrolysis was greater than that of methyl paraoxon, but the level of activity between species displayed a similar pattern. Regardless of the species tested, the hydrolysis of chlorpyrifos-oxon was significantly greater than that of paraoxon or methyl paraoxon. These data indicate that chlorpyrifos-oxon is a better substrate for PON1 regardless of the species. The pattern of species differences in PON1 activity varied with the change in substrate to chlorpyrifos-oxon from paraoxon or methyl paraoxon. For example, the sex difference observed here and reported elsewhere in the literature for rat PON1 hydrolysis of paraoxon was not present when chlorpyrifos-oxon was the substrate.

  6. Insecticide resistance and intracellular proteases.

    Science.gov (United States)

    Wilkins, Richard M

    2017-12-01

    Pesticide resistance is an example of evolution in action with mechanisms of resistance arising from mutations or increased expression of intrinsic genes. Intracellular proteases have a key role in maintaining healthy cells and in responding to stressors such as pesticides. Insecticide-resistant insects have constitutively elevated intracellular protease activity compared to corresponding susceptible strains. This increase was shown for some cases originally through biochemical enzyme studies and subsequently putatively by transcriptomics and proteomics methods. Upregulation and expression of proteases have been characterised in resistant strains of some insect species, including mosquitoes. This increase in proteolysis results in more degradation products (amino acids) of intracellular proteins. These may be utilised in the resistant strain to better protect the cell from stress. There are changes in insect intracellular proteases shortly after insecticide exposure, suggesting a role in stress response. The use of protease and proteasome inhibitors or peptide mimetics as synergists with improved application techniques and through protease gene knockdown using RNA interference (possibly expressed in crop plants) may be potential pest management strategies, in situations where elevated intracellular proteases are relevant. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  7. Investigation of Nursery Rhymes According to the Classification of Semantic Fields and Values

    Science.gov (United States)

    Dinçel, Betül Keray

    2017-01-01

    Nursery rhymes are quite important in terms of developing children's language skills. It was observed that there is a paucity of research looking at semantic fields and value regarding nursery rhymes; therefore, this study was intended to fill that gap in the literature by investigating nursery rhymes in terms of semantic fields and value. In this…

  8. Molecular characterization of Fusarium oxysporum and fusarium commune isolates from a conifer nursery

    Science.gov (United States)

    Jane E. Stewart; Mee-Sook Kim; Robert L. James; R. Kasten Dumroese; Ned B. Klopfenstein

    2006-01-01

    Fusarium species can cause severe root disease and damping-off in conifer nurseries. Fusarium inoculum is commonly found in most container and bareroot nurseries on healthy and diseased seedlings, in nursery soils, and on conifer seeds. Isolates of Fusarium spp. can differ in virulence; however, virulence and...

  9. Genetic bottlenecks in agroforestry systems: results of tree nursery surveys in East Africa

    NARCIS (Netherlands)

    Lengkeek, A.G.; Jaenicke, H.; Dawson, I.K.

    2005-01-01

    Seedlings sourced through tree nurseries are expected to form an important component of future tree cover on farms. As such, the genetic composition of nursery seedlings is expected to impact on the productivity and sustainability of agroforestry ecosystems. By surveying current practices of nursery

  10. 7 CFR 301.75-6 - Interstate movement of regulated nursery stock from a quarantined area.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Interstate movement of regulated nursery stock from a... Citrus Canker Notice of Quarantine and Regulations § 301.75-6 Interstate movement of regulated nursery stock from a quarantined area. (a) Regulated nursery stock may not be moved interstate from a...

  11. 29 CFR 780.209 - Packing, storage, warehousing, and sale of nursery products.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Packing, storage, warehousing, and sale of nursery products... FAIR LABOR STANDARDS ACT Agriculture as It Relates to Specific Situations Nursery and Landscaping Operations § 780.209 Packing, storage, warehousing, and sale of nursery products. Employees of a grower of...

  12. Heroes and villains: Research identifies harmful and beneficial microbes in nursery soil

    Science.gov (United States)

    Phytophthora and Pythium species are common pathogens in nursery systems that can cause rhododendron root rot. Plants with root rot are often stunted, and may wilt and die, thus directly reducing nursery profit. Rhododendrons are an important crop in Pacific Northwest nurseries, but are highly susc...

  13. Weed management at ArborGen, South Carolina SuperTree Nursery

    Science.gov (United States)

    Mike Arnette

    2009-01-01

    Weed management is vital to producing healthy hardwood seedlings. Several methods are available to each nursery, and it is common knowledge that what works for one situation may not work for another. The weed control methods used in nursery beds of hardwood species at the South Carolina SuperTree Nursery (Blenheim) are listed below.

  14. Phytophthora community structure analyses in Oregon nurseries inform systems approaches to disease management

    Science.gov (United States)

    J.L. Parke; B.J. Knaus; V.J. Fieland; C. Lewis; N.J. Grünwald

    2014-01-01

    Nursery plants are important vectors for plant pathogens. Understanding what pathogens occur in nurseries in different production stages can be useful to the development of integrated systems approaches. Four horticultural nurseries in Oregon were sampled every 2 months for 4 years to determine the identity and community structure of Phytophthora...

  15. Photodegradation of neonicotinoid insecticides in water by semiconductor oxides.

    Science.gov (United States)

    Fenoll, José; Garrido, Isabel; Hellín, Pilar; Flores, Pilar; Navarro, Simón

    2015-10-01

    The photocatalytic degradation of three neonicotinoid insecticides (NIs), thiamethoxam (TH), imidacloprid (IM) and acetamiprid (AC), in pure water has been studied using zinc oxide (ZnO) and titanium dioxide (TiO2) as photocatalysts under natural sunlight and artificial light irradiation. Photocatalytic experiments showed that the addition of these chalcogenide oxides in tandem with the electron acceptor (Na2S2O8) strongly enhances the degradation rate of these compounds in comparison with those carried out with ZnO and TiO2 alone and photolytic tests. Comparison of catalysts showed that ZnO is the most efficient for the removal of such insecticides in optimal conditions and at constant volumetric rate of photon absorption. Thus, the complete disappearance of all the studied compounds was achieved after 10 and 30 min of artificial light irradiation, in the ZnO/Na2S2O8 and TiO2/Na2S2O8 systems, respectively. The highest degradation rate was noticed for IM, while the lowest rate constant was obtained for AC under artificial light irradiation. In addition, solar irradiation was more efficient compared to artificial light for the removal of these insecticides from water. The main photocatalytic intermediates detected during the degradation of NIs were identified.

  16. Insecticide control of vector-borne diseases: when is insecticide resistance a problem?

    Directory of Open Access Journals (Sweden)

    Ana Rivero

    Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.

  17. Prevalence, Characteristics, and Perception of Nursery Antibiotic Stewardship Coverage in the United States.

    Science.gov (United States)

    Cantey, Joseph B; Vora, Niraj; Sunkara, Mridula

    2017-09-01

    Prolonged or unnecessary antibiotic use is associated with adverse outcomes in infants. Antibiotic stewardship programs (ASPs) aim to prevent these adverse outcomes and optimize antibiotic prescribing. However, data evaluating ASP coverage of nurseries are limited. The objectives of this study were to describe the characteristics of nurseries with and without ASP coverage and to determine perceptions of and barriers to nursery ASP coverage. The 2014 American Hospital Association annual survey was used to randomly select a level III neonatal intensive care unit from all 50 states. A level I and level II nursery from the same city as the level III nursery were then randomly selected. Hospital, nursery, and ASP characteristics were collected. Nursery and ASP providers (pharmacists or infectious disease providers) were interviewed using a semistructured template. Transcribed interviews were analyzed for themes. One hundred forty-six centers responded; 104 (71%) provided nursery ASP coverage. In multivariate analysis, level of nursery, university affiliation, and number of full-time equivalent ASP staff were the main predictors of nursery ASP coverage. Several themes were identified from interviews: unwanted coverage, unnecessary coverage, jurisdiction issues, need for communication, and a focus on outcomes. Most providers had a favorable view of nursery ASP coverage. Larger, higher-acuity nurseries in university-affiliated hospitals are more likely to have ASP coverage. Low ASP staffing and a perceived lack of importance were frequently cited as barriers to nursery coverage. Most nursery ASP coverage is viewed favorably by providers, but nursery providers regard it as less important than ASP providers. © The Author 2016. Published by Oxford University Press on behalf of the Pediatric Infectious Diseases Society. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  18. Energy conservation with semi-controlled areas by air conditioning in nursery schools. The nursery school Dragvoll

    Energy Technology Data Exchange (ETDEWEB)

    Brattset, O; Hestnes, A G

    1985-02-01

    Dragvoll nursery school in Trondheim (Norway) is designed with a central winter garden built up by glazed walls and a glass roof, and surrounded by classrooms. The ventilating air is preheated in a heat exchanger, and then postheated in the said garden by the solar flux before entering the air conditioning system. A comparative evaluation of the energy consumption with the total floor area of about 57 m/sup 2/ is done in relation to a conventionally built nursery school with a floor area of about 520 m/sup 2/. The saving potential is found to 52%. 9 drawing.

  19. Weevil x Insecticide: Does 'Personality' Matter?

    Science.gov (United States)

    Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C

    2013-01-01

    An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be

  20. Fungal degradation of organophosphorous insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Bumpus, J.A. [Notre Dame Univ., IN (United States); Kakar, S.N.; Coleman, R.D. [Argonne National Lab., IL (United States)

    1992-07-01

    Organophosphorous insecticides are used extensively to treat a variety of pests and insects. Although as a group they are easily degraded by bacteria in the environment, a number of them have half-lives of several months. Little is known about their biodegradation by fungi. We have shown that Phanerochaete chrysosporium can substantially degrade chlorpyrifos, fonofos, and terbufos (27.5%, 12.2%, and 26.6%, respectively) during 18-day incubation in nitrogen-limited stationary cultures. The results demonstrate that the clorinated pyridinyl ring of chlorpyrifos and the phenyl ring of fonofos undergo ring cleavage during biodegradation by the fungus. The usefulness of the fungus system for bioremediation is discussed. 16 refs., 7 figs., 2 tabs.

  1. Fungal degradation of organophosphorous insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Bumpus, J.A. (Notre Dame Univ., IN (United States)); Kakar, S.N.; Coleman, R.D. (Argonne National Lab., IL (United States))

    1992-01-01

    Organophosphorous insecticides are used extensively to treat a variety of pests and insects. Although as a group they are easily degraded by bacteria in the environment, a number of them have half-lives of several months. Little is known about their biodegradation by fungi. We have shown that Phanerochaete chrysosporium can substantially degrade chlorpyrifos, fonofos, and terbufos (27.5%, 12.2%, and 26.6%, respectively) during 18-day incubation in nitrogen-limited stationary cultures. The results demonstrate that the clorinated pyridinyl ring of chlorpyrifos and the phenyl ring of fonofos undergo ring cleavage during biodegradation by the fungus. The usefulness of the fungus system for bioremediation is discussed. 16 refs., 7 figs., 2 tabs.

  2. Development of Intelligent Spray Systems for Nursery Crop Production

    Science.gov (United States)

    Two intelligent sprayer prototypes were developed to increase pesticide application efficiency in nursery production. The first prototype was a hydraulic vertical boom system using ultrasonic sensors to detect tree size and volume for liner-sized trees and the second prototype was an air-assisted sp...

  3. Light-emitting diode lighting for forest nursery seedling production

    Science.gov (United States)

    R. Kasten Dumroese; Jeremiah R. Pinto; Anthony S. Davis

    2015-01-01

    Crop lighting is an energy-intensive necessity for nursery production of high-quality native plants and forest tree seedlings. During the winter months (especially in northern USA latitudes) or overcast or cloudy days, the amount of solar radiation reaching greenhouse crops is insufficient resulting in growth cessation, early terminal bud formation, and failure of...

  4. Occurrence of soil-transmitted helminths on playgrounds of nursery ...

    African Journals Online (AJOL)

    STHs are prevalent on play grounds of nursery and primary schools in Plateau State. Improved hygiene and sanitation, fencing of school premises and the regulation of school population will help to reduce environmental contamination and human infections. Présence d'helminthes transmis par le sol sur les terrains de jeux ...

  5. Improved ventilation and temperature control in a nursery

    NARCIS (Netherlands)

    Jacobs, P.

    2011-01-01

    We performed an intervention study in a nursery. We have measured the air quality with as indicator CO2 and temperature in the original configuration. The maximum observed CO2 concentration during a three week monitoring period was 1834 ppm. The average CO2 concentration during the sleeping period

  6. Nursery growing of some apple varieties using different grafting ...

    African Journals Online (AJOL)

    This study was carried out at the Eğirdir Horticultural Research Institute, between the years 2006 and 2007. The aim of this study was to investigate the advantages of apple nursery growing greenhouse rather than outdoor medium. Scions of Red Chief (dwarf), Braeburn (semi dwarf) and Mondial Gala (vigorous) apple ...

  7. Nursery Pest Management of Phytolyma lata Walker (Scott) Attack ...

    African Journals Online (AJOL)

    The establishment of plantations of Milicia excelsa has been constrained by the gall-forming psyllid Phytolyma lata Walker (Scott) that causes extensive damage to young plants. We present findings of an experiment aimed at preventing Phytolyma attack on Milicia seedlings in the nursery using chemical control and ...

  8. Developing native plant nurseries in emerging market areas

    Science.gov (United States)

    Elliott Duemler

    2012-01-01

    The importance of developing a market for quality native plant materials in a region prior to the establishment of a nursery is crucial to ensure its success. Certain tactics can be applied to help develop a demand for native plant materials in a region. Using these tactics will help create a new market for native plant materials.

  9. Effect on nursery and field performance of Pinus patula seedlings ...

    African Journals Online (AJOL)

    Fusarium circinatum is an important fungal pathogen of Pinus species. In South Africa, it is the most significant pathogen of Pinus patula seedlings in forestry nurseries where it presents a substantial constraint to productivity and can continue to cause mortality in-field for up to two years after establishment. This study ...

  10. Early selection of Eucalyptus clones in retrospective nursery test ...

    African Journals Online (AJOL)

    Within the framework of the eucalyptus breeding programme in the Congo, two retrospective tests were conducted using mature clones in the field and young cuttings under nursery conditions with two hybrids: 13 clones of Eucalyptus tereticornis* Eucalyptus grandis for the test TC 82-1B and 17 clones of Eucalyptus ...

  11. Predicting movement of nursery hosts using a linear network model

    Science.gov (United States)

    Steve McKelvey; Frank Koch; Bill Smith

    2008-01-01

    There is widespread concern among scientists and land managers that Phytophthora ramorum may be accidentally introduced into oak-dominated eastern U.S. forests through the transfer of the pathogen from infected nursery plants to susceptible understory forest species (for example, Rhododendron spp.) at the forest-urban interface....

  12. Nursery school at Vincennes: O.P.R.I. investigation

    International Nuclear Information System (INIS)

    Pasquier, J.L.; Fouquet, G.; Linden, G.

    2001-01-01

    After five children neoplasms at the nursery of Vincennes, the O.P.R.I. has realised two measurement campaigns during the year 2001. The track of a radioactive contamination, based on the private laboratory analysis has been denied by O.P.R.I. (N.C.)

  13. Children's Exposure to Radon in Nursery and Primary Schools.

    Science.gov (United States)

    Branco, Pedro T B S; Nunes, Rafael A O; Alvim-Ferraz, Maria C M; Martins, Fernando G; Sousa, Sofia I V

    2016-03-30

    The literature proves an evident association between indoor radon exposure and lung cancer, even at low doses. This study brings a new approach to the study of children's exposure to radon by aiming to evaluate exposure to indoor radon concentrations in nursery and primary schools from two districts in Portugal (Porto and Bragança), considering different influencing factors (occupation patterns, classroom floor level, year of the buildings' construction and soil composition of the building site), as well as the comparison with IAQ standard values for health protection. Fifteen nursery and primary schools in the Porto and Bragança districts were considered: five nursery schools for infants and twelve for pre-schoolers (seven different buildings), as well as eight primary schools. Radon measurements were performed continuously. The measured concentrations depended on the building occupation, classroom floor level and year of the buildings' construction. Although they were in general within the Portuguese legislation for IAQ, exceedances to international standards were found. These results point out the need of assessing indoor radon concentrations not only in primary schools, but also in nursery schools, never performed in Portugal before this study. It is important to extend the study to other microenvironments like homes, and in time to estimate the annual effective dose and to assess lifetime health risks.

  14. Nursery Rhyme Knowledge and Phonological Awareness in Preschool Children

    Science.gov (United States)

    Harper, Laurie J.

    2011-01-01

    Phonological awareness is an important precursor in learning to read. This awareness of phonemes fosters a child's ability to hear and blend sounds, encode and decode words, and to spell phonetically. This quantitative study assessed pre-K children's existing Euro-American nursery rhyme knowledge and phonological awareness literacy, provided…

  15. The Emotional Complexity of Attachment Interactions in Nursery

    Science.gov (United States)

    Page, Jools; Elfer, Peter

    2013-01-01

    In a single intensive nursery case study, using in depth interviews, group discussion and self completed daily diaries, this article reports on staff accounts of the emotional aspects of their interactions with young children. The findings show how much the staff achieved through their empathy for children and families and the establishment of…

  16. Growing media alternatives for forest and native plant nurseries

    Science.gov (United States)

    Thomas D. Landis; Nancy Morgan

    2009-01-01

    The choice of growing medium, along with container type, is one of the critical decisions that must be made when starting a nursery. The first growing medium was called "compost" and was developed in the 1930s at the John Innes Horticultural Institute in Great Britain. It consisted of a loam soil that was amended with peat moss, sand, and fertilizers (Bunt...

  17. Water management in container nurseries to minimize pests

    Science.gov (United States)

    R. Kasten Dumroese; Diane L. Haase

    2018-01-01

    Water is the most important and most common chemical used in plant nurseries. It is also the most dangerous chemical used. Insufficient water, excessive water, and poorly timed irrigation can all lead to poor-quality crops and unacceptable mortality. Anticipated future declines of water availability, higher costs to use it, and continuing concerns about irrigation...

  18. Marine nurseries and effective juvenile habitats: concepts and applications.

    NARCIS (Netherlands)

    Dahlgren, C.P.; Kellison, G.T.; Adams, A.J.; Gillanders, B.M.; Kendall, M.S.; Layman, C.A.; Ley, J.A.; Nagelkerken, I.; Serafy, J.E.

    2006-01-01

    Much recent attention has been focused on juvenile fish and invertebrate habitat use, particularly defining and identifying marine nurseries. The most significant advancement in this area has been the development of a standardized framework for assessing the relative importance of juvenile habitats

  19. Provenance variability in nursery growth of subalpine fir

    Science.gov (United States)

    Charlie Cartwright; Cheng Ying

    2011-01-01

    Subalpine fir (Abies lasiocarpa [Hook] Nutt.) is a wide-ranging, high-elevation species in the interior of British Columbia. It is commonly harvested for lumber, but replanting of it is limited. Some reticence is based upon wood quality and rate of growth, but there are also seed and nursery culturing difficulties. This study investigated seedling growth traits of 111...

  20. Radioactive 32P fertilizing experiment in a vegetative tea nursery

    International Nuclear Information System (INIS)

    Darmawijaya, M.I.

    1979-01-01

    To support the Indonesian tea replanting programme, Vegetative Propagation (VP) clonal tea plants of a high-yielding and high-quality variety are prepared. For a quick start of growth in the nursery and eventual good crop, the soils filled into polythene sleeves should have optimum conditions for rooting. The VP nursery manuring recommendation in Indonesia is 135 g N+72 g P 2 O 5 +70 g K 2 O per cubic metre of topsoil. Uptake of phosphorus by young VP tea plants in the nursery was studied by using 32 P-labelled superphosphate. A specific activity of 0.3 mCi/g (11 MBq/g) P 2 O 2 was still detectable 12 weeks after treatment of manuring. The laboratory analytical data proved that the P-fertilizer utilization by young VP tea plant was less than 1%. The best time for P-fertilizer application was the time of planting. It seems that the P uptake in the VP tea nursery starts with the early growth of the tea cutting. To increase the efficiency of P manuring in relation to the slower and lesser phosphate adsorption by the young VP tea plants, the best application is effected at 10 cm depth of soil. Mixing P fertilizers with soil also gives higher uptake of fertilizer P. So tea plants can use phosphate efficiently when placed as close to active roots as possible. (author)

  1. Decrease of insecticide resistance over generations without exposure to insecticides in Nilaparvata lugens (Hemipteran: Delphacidae).

    Science.gov (United States)

    Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian

    2014-08-01

    The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.

  2. Effects of marine reserves versus nursery habitat availability on structure of reef fish communities.

    Science.gov (United States)

    Nagelkerken, Ivan; Grol, Monique G G; Mumby, Peter J

    2012-01-01

    No-take marine fishery reserves sustain commercial stocks by acting as buffers against overexploitation and enhancing fishery catches in adjacent areas through spillover. Likewise, nursery habitats such as mangroves enhance populations of some species in adjacent habitats. However, there is lack of understanding of the magnitude of stock enhancement and the effects on community structure when both protection from fishing and access to nurseries concurrently act as drivers of fish population dynamics. In this study we test the separate as well as interactive effects of marine reserves and nursery habitat proximity on structure and abundance of coral reef fish communities. Reserves had no effect on fish community composition, while proximity to nursery habitat only had a significant effect on community structure of species that use mangroves or seagrass beds as nurseries. In terms of reef fish biomass, proximity to nursery habitat by far outweighed (biomass 249% higher than that in areas with no nursery access) the effects of protection from fishing in reserves (biomass 21% lower than non-reserve areas) for small nursery fish (≤ 25 cm total length). For large-bodied individuals of nursery species (>25 cm total length), an additive effect was present for these two factors, although fish benefited more from fishing protection (203% higher biomass) than from proximity to nurseries (139% higher). The magnitude of elevated biomass for small fish on coral reefs due to proximity to nurseries was such that nursery habitats seem able to overrule the usually positive effects on fish biomass by reef reserves. As a result, conservation of nursery habitats gains importance and more consideration should be given to the ecological processes that occur along nursery-reef boundaries that connect neighboring ecosystems.

  3. Effects of marine reserves versus nursery habitat availability on structure of reef fish communities.

    Directory of Open Access Journals (Sweden)

    Ivan Nagelkerken

    Full Text Available No-take marine fishery reserves sustain commercial stocks by acting as buffers against overexploitation and enhancing fishery catches in adjacent areas through spillover. Likewise, nursery habitats such as mangroves enhance populations of some species in adjacent habitats. However, there is lack of understanding of the magnitude of stock enhancement and the effects on community structure when both protection from fishing and access to nurseries concurrently act as drivers of fish population dynamics. In this study we test the separate as well as interactive effects of marine reserves and nursery habitat proximity on structure and abundance of coral reef fish communities. Reserves had no effect on fish community composition, while proximity to nursery habitat only had a significant effect on community structure of species that use mangroves or seagrass beds as nurseries. In terms of reef fish biomass, proximity to nursery habitat by far outweighed (biomass 249% higher than that in areas with no nursery access the effects of protection from fishing in reserves (biomass 21% lower than non-reserve areas for small nursery fish (≤ 25 cm total length. For large-bodied individuals of nursery species (>25 cm total length, an additive effect was present for these two factors, although fish benefited more from fishing protection (203% higher biomass than from proximity to nurseries (139% higher. The magnitude of elevated biomass for small fish on coral reefs due to proximity to nurseries was such that nursery habitats seem able to overrule the usually positive effects on fish biomass by reef reserves. As a result, conservation of nursery habitats gains importance and more consideration should be given to the ecological processes that occur along nursery-reef boundaries that connect neighboring ecosystems.

  4. Transformation of the insecticide teflubenzuron by microorganisms

    NARCIS (Netherlands)

    Finkelstein, Z.I.; Baskunov, B.P.; Rietjens, I.M.C.M.; Boersma, M.G.; Vervoort, J.; Golovleva, L.A.

    2001-01-01

    Transformation of teflubenzuron, the active component in the insecticide commercialized as Nomolt, by soil microorganisms was studied. It was shown that microorganisms, belonging to Bacillus, Alcaligenes, Pseudomonas and Acinetobacter genera are capable to perform the hydrolytic cleavage of the

  5. Both nursery and field performance determine suitable nitrogen supply of nursery-grown, exponentially fertilized Chinese pine

    Science.gov (United States)

    Jiaxi Wang; Guolei Li; Jeremiah R. Pinto; Jiajia Liu; Wenhui Shi; Yong Liu

    2015-01-01

    Optimum fertilization levels are often determined solely from nursery growth responses. However, it is the performance of the seedling on the outplanting site that is the most important. For Pinus species seedlings, little information is known about the field performance of plants cultured with different nutrient rates, especially with exponential fertilization. In...

  6. Rates of Complications After Newborn Circumcision in a Well-Baby Nursery, Special Care Nursery, and Neonatal Intensive Care Unit.

    Science.gov (United States)

    Srinivasan, Mythili; Hamvas, Corrine; Coplen, Douglas

    2015-10-01

    To determine rates of complications after newborn circumcision by performing a retrospective chart review of patients circumcised at a well-baby nursery, neonatal intensive care units (NICU), and special care nursery (SCN) from 2007 to 2012. A total of 5129 babies (73%) were circumcised at the well-baby nursery and 1909 babies (27%) at the NICU and SCN. Forty-seven patients (0.67%, 95% CI 0.49% to 0.89%) had circumcision-related complications: 5 (0.07%) patients with acute and 42 (0.6%) with late complications. Babies in the NICU/SCN had increased odds of complication (OR 4.00, 95% CI 2.23 to 7.19) compared with those in well-baby nursery. There were increased odds of complications in babies with Caucasian ethnicity (OR 2.60, 95% CI 1.48 to 4.89) compared with African American babies and in babies with private insurance (OR 4.0, 95% CI 2.1 to 7.5) compared with nonprivate insurance. The rates of complications after newborn circumcisions were low. Babies in the NICU/SCN had increased odds of complication. © The Author(s) 2015.

  7. Modeling global distribution of agricultural insecticides in surface waters.

    Science.gov (United States)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias

    2015-03-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Existence of Insecticides in Tap Drinking Surface and Ground Water in Dakahlyia Governorate, Egypt in 2011

    Directory of Open Access Journals (Sweden)

    RA Mandour

    2011-12-01

    Full Text Available Background: The environmental degradation products of pesticides may enter drinking water and result in serious health problems. Objective: To evaluate the occurrence of insecticides in drinking surface and ground water in Dakahlyia Governorate, northern Egypt in 2011. Methods: We studied blood samples collected from 36 consecutive patients diagnosed with pesticides poisoning and 36 tap drinking water (surface and ground. Blood and water samples were analyzed for pesticides using gas chromatography-electron captured detector (GC-ECD. In addition, blood samples were analyzed for plasma pseudo-cholinesterase level (PChE and red blood cells acetyl cholinesterase activity (AChE. Results: The results confirmed the presence of high concentrations of insecticides, including organonitrogenous and organochlorine in tap drinking surface and ground water. Conclusion: Drinking water contaminated with insecticides constitutes an important health concern in Dakahlyia governorate, Egypt.

  9. Malaria Vector Control Still Matters despite Insecticide Resistance.

    Science.gov (United States)

    Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna

    2017-08-01

    Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Indoor/outdoor elemental concentration relationships at a nursery school

    International Nuclear Information System (INIS)

    Lannefors, H.; Hansson, H.C.

    1981-01-01

    Indoor and outdoor concentrations of lead and bromine have been measured at a nursery school, using streaker samplers with 2.4 h resolution. The observed variations in concentration were well-correlated with traffic intensity variations. In addition to their closely related time-variation curves, the bromine to lead ratios pointed to the emissions from leaded gasoline-powered vehicles as the main source of these elements both in and outdoors. Time-variation patterns on weekdays and during weekends indicated that the lead and bromine containing particles entered the nursery school mainly by leaking. Only a minor fraction seemed to be brought in and resuspended by the staff and children. The indoor concentrations of the elements studied were about 5 times lower than the outdoor levels thus considerably reducing the indoor exposure. (orig.)

  11. Modeling global distribution of agricultural insecticides in surface waters

    International Nuclear Information System (INIS)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias

    2015-01-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects

  12. Experiences in the containerized tree seedlings forest nurseries production

    Directory of Open Access Journals (Sweden)

    Eduardo González-Izquierdo

    2014-12-01

    Full Text Available The work summarizes the results of the research carried out by the team of forest nurseries at Sustainable Forest Management Group in Pinar del Río University Forest Research Centre in the last 25 years. The characteristics of seedlings quality are presented, the best growing media, the water management to harden the forest species under the ecological conditions of more and more lingering periods of drought. The studied forest species were: Talipariti elatum (Sw. Fryxell, Pinus tropicalis Morelet , Swietenia mahagon(L.Jacq. Swietenia macrophylla King, Caesalpinia violacea (Mill. Stand, Genipa americana L, Gerascanthus gerascanthoides (Kunth Borhidi y Cedrela odorata L. y Eucalyptus grandis Hill ex Maiden. The main results can be summarized in the following way: the size of the containers oscillates between 90 and 300 cubic centimeters; the growing media combines organic and composted components fundamentally of Pinus caribaea and Eucalyptus ssp bark., with proportions that they vary according to the species and the disposability of these components in the nurseries where the plants take place; for the water management hardening procedures were used by watering in last month of the cultivation. In general the economic analyses demonstrated the decrease of the production costs for seedlings with the employment of this novel technology, the same as their advantages on the traditional technology of seedlings production in polybags: humanization of manpower work in forest nursery, reduction of costs production, improvement of produced seedling quality and productivity increase of their workers.

  13. Cactus Nurseries and Conservation in a Biosphere Reserve in Mexico

    Directory of Open Access Journals (Sweden)

    María T. Pulido

    2013-09-01

    Full Text Available Documenting how socio-ecosystem conservation knowledge and practice arise and are modified are issues of ethnobiological interest. In the Barranca de Metztitlán Biosphere Reserve (RBBM, plant nurseries, some of which were created as Environmental Management Units (UMAs, have been established to grow and conserve cacti. This paper describes these nurseries, their role in cactus conservation, and the benefits and limitations for the people managing them. The nurseries have helped decrease illegal traffic in cacti and have enabled ex situ conservation of 22 cacti species. Cactus management has changed from extraction to cultivation, as a result of the knowledge and actions of multiple actors. The main limitation is marketing, a recurring problem for non-timber forest products (NTFP. Greater coordination among stakeholders is recommended, such as involvement by non-governmental organizations to improve their probability of success, as well as learning from the experience of other cactus UMAs. Improving the market for cacti is an issue that needs an immediate solution; otherwise conservation efforts could relapse.

  14. Alleged nursery words and hypocorisms among Germanic kinship terms

    DEFF Research Database (Denmark)

    Hansen, Bjarne Simmelkjær Sandgaard

    2017-01-01

    By (re-)evaluating the etymologies of the three Proto-Germanic kinship terms *aiþīn-/-ōn- ‘mother’, *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ that are all claimed by at least some etymological handbooks to be nursery words or hypocorisms, I contend that we must abandon their nurs......By (re-)evaluating the etymologies of the three Proto-Germanic kinship terms *aiþīn-/-ōn- ‘mother’, *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ that are all claimed by at least some etymological handbooks to be nursery words or hypocorisms, I contend that we must abandon...... their nursery-word interpretations and rather regard them as inherited words derived from known Indo-European lexical material in a way that reveals important information on the Old Germanic society and its family pattern....

  15. Nurseries surveyed in Southern California adopt best practices for water quality

    OpenAIRE

    Mangiafico, Salvatore S; Newman, Julie; Mochizuki, Maren; Zurawski, Dale; Merhaut, Donald J.; Faber, Ben

    2010-01-01

    A variety of good management practices have been recommended to minimize the impact of water runoff from production nurseries. However, studies have not been conducted to gauge which management practices nursery producers are most likely to adopt in response to education and increased government oversight. We surveyed 85 production nurseries in Southern California about their existing practices to limit the impacts of runoff from their facilities. Of these, 65 in Ventura County were resurveye...

  16. Voices from Nursery : A Crack of Intervention to Child Abuse and Neglect in Japan

    OpenAIRE

    Ishikawa, Hiroaki

    2008-01-01

    Purpose: This article aims to describe the status quo of abuse and neglected children in nursery school, and to analyze the factors affecting the conditions of those abused and neglected children. Method: Intensive interview to the directors of 9 nursery schools were conducted and data of 32 cases were collected. Results: 5 modified case episodes edited from collected data were presented to show the typical conditions of abused and neglected children in nursery schools. Some common characteri...

  17. Neurobehavioral toxicology of pyrethroid insecticides

    International Nuclear Information System (INIS)

    Crofton, K.M.

    1986-01-01

    Pyrethroid insecticides are classified as either Type I or Type II based upon in vivo toxic signs, and neurophysiological and biochemical data. Both axonal sodium channels and the γ-aminobutyric acid (GABA) receptor complex have been proposed as the major site of action of the Type II pyrethroids. This investigation characterized the behavior and biochemical effects of low dosages of pyrethroids in rats. Type I and II pyrethroids were tested for effects on figure-eight maze activity and the acoustic startle response (ASR). All compounds decreased figure-eight maze activity. Interactions of Type I and II pyrethroids with the three major binding sites on the GABA complex were determined in vivo. Radioligand binding experiments assessed in vitro interactions of pyrethroids with the three major GABA-complex binding sites. None of the pyrethroids competed for [ 3 H]-muscimol or [ 3 H]-flunitrazepam binding. Only Type II pyrethroids inhibited binding of [ 35 S]-t-butylbicyclophosphorothionate (TBPS) in cortical synaptosome preparations with K/sub i/ values of 5 to 10 μM. The [ 35 S]-TBPS data implicate the TBPS/picrotoxinin binding site in the mechanism of Type II pyrethroid toxicity. The results of these experiments support the classification of pyrethroids into two classes, and demonstrate the utility of the figure-eight maze and the ASR in studies to elucidate neurotoxic mechanisms. The interaction of the Type II pyrethroids is probably restricted to the TBPS/picrotoxinin binding domain on the GABA complex as shown by both the in vivo and in vitro studies

  18. Maternal Separations During the Reentry Years for 100 Infants Raised in a Prison Nursery

    Science.gov (United States)

    Byrne, Mary W.; Goshin, Lorie; Blanchard-Lewis, Barbara

    2011-01-01

    Prison nurseries prevent maternal separations related to incarceration for the small subset of children whose pregnant mothers are incarcerated in states with such programs. For a cohort of 100 children accepted by corrections into one prison nursery, subsequent separation patterns are analyzed. The largest numbers are caused by corrections’ removal of infants from the nursery and infants reaching a one-year age limit. Criminal recidivism and substance abuse relapse threaten continued mothering during reentry. Focused and coordinated services are needed during prison stay and reentry years to sustain mothering for women and children accepted into prison nursery programs. PMID:22328865

  19. Relative resistance or susceptibility of maple (Acer) species, hybrids and cultivars to six arthropod pests of production nurseries.

    Science.gov (United States)

    Seagraves, Bonny L; Redmond, Carl T; Potter, Daniel A

    2013-01-01

    Maples (Acer spp.) in production nurseries are vulnerable to numerous arthropod pests that can stunt or even kill the young trees. Seventeen cultivars representing various Acer species and hybrids were evaluated for extent of infestation or injury by shoot and trunk borers (Proteoteras aesculana, Chrysobothris femorata), potato leafhopper (Empoasca fabae), Japanese beetle (Popillia japonica), maple spider mite (Oligonychus aceris) and calico scale (Eulecanium cerasorum). Evaluations were done in replicated field plots in central and western Kentucky. All of the maples were susceptible, to varying degrees, to one or more key pest(s). Red maples (A. rubrum) were relatively vulnerable to potato leafhopper injury and borers but nearly free of Japanese beetle feeding and spider mites. Sugar maples sustained conspicuous Japanese beetle damage but had very low mite populations, whereas the opposite was true for Freeman maples (A. × freemanii). A. campestre was heavily infested by calico scale. Within each species or hybrid there were cultivar differences in degree of infestation or damage by particular pests. The results should help growers to focus pest management efforts on those plantings at greatest risk from particular pests, and to choose cultivars requiring fewer insecticide inputs to produce a quality tree. Copyright © 2012 Society of Chemical Industry.

  20. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...

  1. Microbes as interesting source of novel insecticides: A review ...

    African Journals Online (AJOL)

    ... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...

  2. RFID Tracking of Sublethal Effects of Two Neonicotinoid Insecticides on the Foraging Behavior of Apis mellifera

    Science.gov (United States)

    Schneider, Christof W.; Tautz, Jürgen; Grünewald, Bernd; Fuchs, Stefan

    2012-01-01

    The development of insecticides requires valid risk assessment procedures to avoid causing harm to beneficial insects and especially to pollinators such as the honeybee Apis mellifera. In addition to testing according to current guidelines designed to detect bee mortality, tests are needed to determine possible sublethal effects interfering with the animal's vitality and behavioral performance. Several methods have been used to detect sublethal effects of different insecticides under laboratory conditions using olfactory conditioning. Furthermore, studies have been conducted on the influence insecticides have on foraging activity and homing ability which require time-consuming visual observation. We tested an experimental design using the radiofrequency identification (RFID) method to monitor the influence of sublethal doses of insecticides on individual honeybee foragers on an automated basis. With electronic readers positioned at the hive entrance and at an artificial food source, we obtained quantifiable data on honeybee foraging behavior. This enabled us to efficiently retrieve detailed information on flight parameters. We compared several groups of bees, fed simultaneously with different dosages of a tested substance. With this experimental approach we monitored the acute effects of sublethal doses of the neonicotinoids imidacloprid (0.15–6 ng/bee) and clothianidin (0.05–2 ng/bee) under field-like circumstances. At field-relevant doses for nectar and pollen no adverse effects were observed for either substance. Both substances led to a significant reduction of foraging activity and to longer foraging flights at doses of ≥0.5 ng/bee (clothianidin) and ≥1.5 ng/bee (imidacloprid) during the first three hours after treatment. This study demonstrates that the RFID-method is an effective way to record short-term alterations in foraging activity after insecticides have been administered once, orally, to individual bees. We contribute further information on

  3. RFID tracking of sublethal effects of two neonicotinoid insecticides on the foraging behavior of Apis mellifera.

    Directory of Open Access Journals (Sweden)

    Christof W Schneider

    Full Text Available The development of insecticides requires valid risk assessment procedures to avoid causing harm to beneficial insects and especially to pollinators such as the honeybee Apis mellifera. In addition to testing according to current guidelines designed to detect bee mortality, tests are needed to determine possible sublethal effects interfering with the animal's vitality and behavioral performance. Several methods have been used to detect sublethal effects of different insecticides under laboratory conditions using olfactory conditioning. Furthermore, studies have been conducted on the influence insecticides have on foraging activity and homing ability which require time-consuming visual observation. We tested an experimental design using the radiofrequency identification (RFID method to monitor the influence of sublethal doses of insecticides on individual honeybee foragers on an automated basis. With electronic readers positioned at the hive entrance and at an artificial food source, we obtained quantifiable data on honeybee foraging behavior. This enabled us to efficiently retrieve detailed information on flight parameters. We compared several groups of bees, fed simultaneously with different dosages of a tested substance. With this experimental approach we monitored the acute effects of sublethal doses of the neonicotinoids imidacloprid (0.15-6 ng/bee and clothianidin (0.05-2 ng/bee under field-like circumstances. At field-relevant doses for nectar and pollen no adverse effects were observed for either substance. Both substances led to a significant reduction of foraging activity and to longer foraging flights at doses of ≥0.5 ng/bee (clothianidin and ≥1.5 ng/bee (imidacloprid during the first three hours after treatment. This study demonstrates that the RFID-method is an effective way to record short-term alterations in foraging activity after insecticides have been administered once, orally, to individual bees. We contribute further

  4. Metabolic control of the insecticides safety use

    Directory of Open Access Journals (Sweden)

    L.I. Solomenko

    2016-06-01

    Full Text Available The results of the conducted research affirm that the phosphororganic insecticides utilization can lead to the break in the nitrogen metabolism, breaking the protein formation, reducing the protein molecules renewal, causing the amino acid and amides accumulation in the active state. It has been revealed that the translocation and transformation of the insecticides under consideration are more closely connected with the changes of insoluble protein fraction. The stagnation point of the Phosphamide and Kaunter impact on the plant has been determined. And only the use of the preparation in optimal norms can influence stimulatingly the course of the process under consideration.

  5. Effect of selected insecticides on SF9 insect cell line

    International Nuclear Information System (INIS)

    Saleh, M.; Rahmo, A.; Hajjar, J.

    2013-01-01

    The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)

  6. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:MŠk(CZ) 2B08049 Institutional support: RVO:67985858 Keywords : botanical insecticides * plant extracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  7. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:GA MŠMT(CZ) 2B08049 Institutional research plan: CEZ:AV0Z40720504 Keywords : botanical insecticides * plant exctracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  8. Insecticidal and fungicidal compounds from Isatis tinctoria.

    Science.gov (United States)

    Seifert, K; Unger, W

    1994-01-01

    Tryptanthrin (1), indole-3-acetonitrile (2) and p-coumaric acid methylester (3) were isolated from the aerial parts of Isatis tinctoria L. The compounds show insecticidal and anti-feedant activity against termites (Reticulitermis santonensis), insect preventive and control activity against larvae of the house longhorn beetle (Hylotrupes bajulus) and fungicidal activity against the brown-rot fungus (Coniophora puteana).

  9. Nutrient removal by apple, pear and cherry nursery trees

    Directory of Open Access Journals (Sweden)

    Giovambattista Sorrenti

    2017-06-01

    Full Text Available Given that nursery is a peculiar environment, the amount of nutrients removed by nursery trees represents a fundamental acquisition to optimise fertilisation strategies, with economic and environmental implications. In this context, we determined nutrient removal by apple, pear and cherry nursery trees at the end of the nursery growing cycle. We randomly removed 5 leafless apple (Golden Delicious/EMLA M9; density of 30,000 trees ha–1, pear (Santa Maria/Adams; density of 30,000 trees ha–1 and cherry (AlexTM/Gisela 6®; density of 40,000 trees ha–1 trees from a commercial nursery. Trees were divided into roots (below the root collar, rootstock (above-ground wood between root collar and grafting point and variety (1-year-old wood above the grafting point. For each organ we determined biomass, macro- (N, P, K, Ca, Mg, S, and micro- (Fe, Mn, Zn, Cu, and B nutrient concentration. Pear trees were the most developed (650 g (dw tree–1, equal to 1.75 and 2.78 folds than apple and cherry trees, respectively whereas, independently of the species, variety mostly contributed (>50% to the total tree biomass, followed by roots and then above-ground rootstock. However, the dry biomass and nutrient amount measured in rootstocks (including roots represent the cumulative amount of 2 and 3 seasons, for Gisela® 6 (tissue culture and pome fruit species (generated by mound layering, respectively. Macro and micronutrients were mostly concentrated in roots, followed by variety and rootstock, irrespective of the species. Independently of the tissue, macronutrients concentration hierarchy was N>Ca>K> P>Mg>S. Removed N by whole tree accounted for 6.58, 3.53 and 2.49 g tree–1 for pear, apple and cherry, respectively, corresponding to almost 200, 107 and 100 kg N ha–1, respectively. High amounts of K and Ca were used by pear (130-140 kg ha–1 and apple trees (~50 and 130 kg ha–1 of K and Ca, respectively, while ~25 kg K ha–1 and 55 kg Ca ha–1 were

  10. Is Apis mellifera more sensitive to insecticides than other insects?

    Science.gov (United States)

    Hardstone, Melissa C; Scott, Jeffrey G

    2010-11-01

    Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.

  11. [Hearing screening at nursery schools: results of an evaluation study].

    Science.gov (United States)

    Weichbold, Viktor; Rohrer, Monika; Winkler, Cornelia; Welzl-Müller, Kunigunde

    2004-07-31

    This study aimed to evaluate the hearing screening of pre-school children at nursery schools in Tyrol, Austria. 47 nursery schools with a total of 2199 enrolled children participated in the study. At the screening, the children were presented a series of tones at frequencies 0.5 kHz (25dB), 1 kHz, 2 kHz, 3 kHz, and 4 kHz (20 dB each) from portable audiometers. The tones were presented over headphones for each ear separately and at irregular intervals. Failure to respond to any of the frequencies was considered failure of the screening. Parents were then advised in written form to have the child examined by an ENT-specialist. 1832 individuals were screened (coverage: 83% of nursery school children; corresponding to at least 63% of all Tyrolean children aged 3 to 5 years). Of these, 390 failed the test (referral rate: 21% of all screened). Examination through an ENT-specialist occurred with 217 children, and this confirmed the positive test in 139 children (hit rate: 64%). In most cases, a temporary conductive hearing loss due to external or middle ear problems (glue ear, tube dysfunction, cerumen, otitis media) was diagnosed. A sensorineural hearing loss was found in 4 children (in 3 of them bilateral). The need for therapy was recognized in 81 children (4% of all screened). Pre-school hearing screening identifies children with ear and hearing problems that need therapeutical intervention. Although the hearing problems are mostly of a temporary nature, some may require monitoring over some period. Also some children with permanent sensorineural hearing loss may be detected through this measure. Hearing screening is an efficient means of assessing ear and hearing problems in pre-school children. However, the follow-up rate needs to be improved for optimizing the efficacy.

  12. Hand hygiene in the nursery during diaper changing.

    Science.gov (United States)

    Phang, Koh Ni; Maznin, Nur Liyanna; Yip, Wai Kin

    2012-12-01

    This project aimed to improve hand hygiene practice during diaper changing among nurses working in the nursery. This project was conducted in one of the nurseries in a 935-bed acute care hospital with a sample of 15 nurses. A pre- and post-intervention audit was conducted utilising the Joanna Briggs Institute Practical Application of Clinical Evidence System and Getting Research into Practice module. A revised written workflow, which specified the occasions and process for hand hygiene during diaper changing, was introduced. Modifications to the baby bassinets and nursery were made after barriers to good hand hygiene were identified. The project was carried out over 4 months, from March to June 2011. The post-intervention audit results show an improvement in performing hand washing after changing diapers (20%) and performing the correct steps of hand rubbing (25%). However, the compliance rates decreased for the other criteria that measured whether hand rubbing or hand washing was performed prior to contacting the infant and after wrapping the infant, and whether hand washing was performed correctly. The improvement in compliance with hand washing--the main focus of the new workflow--after changing diapers was especially significant. The results indicated that having a workflow on the occasions and process for hand hygiene during diaper changing was useful in standardising practice. Pre- and post-implementation audits were effective methods for evaluating the effect of translating evidence into practice. However, this project had limited success in improving compliance with hand hygiene. This suggested that more effort is needed to reinforce the importance of hand hygiene and compliance to the proposed workflow. In addition, this project showed that for change to take place successfully, environmental modifications, increased awareness and adequate communication to every staff member are essential. © 2012 The Authors. International Journal of Evidence

  13. Control of grapevine wood fungi in commercial nurseries

    Directory of Open Access Journals (Sweden)

    C. Rego

    2009-05-01

    Full Text Available Previous surveys conducted in commercial nurseries found that different wood fungi, namely Cylindrocarpon spp., Botryosphaeriaceae, Phomopsis viticola and Phaeomoniella chlamydospora infect grapevine cuttings. Two field trials were carried out to evaluate the effectiveness of cyprodinil + fludioxonil, pyraclostrobin + metiram, fludioxonil and cyprodinil to prevent or reduce natural infections caused by such fungi. Rootstock and scion cuttings were soaked in fungicidal suspensions for 50 min prior to grafting. After callusing, the grafted cuttings were planted in two commercial field nurseries with and without a previous history of grapevine cultivation. After nine months in the nursery, the plants were uprooted and analysed for the incidence and severity of the wood fungi. Plants uprooted from the field without a previous history of grapevine cultivation were generally less strongly infected by wood fungi. Under this condition, only the mixture cyprodinil + fludioxonil simultaneously reduced the incidence of Cylindrocarpon and Botryosphaeriaceae fungi, as well as the severity of Cylindrocarpon infections. Treatments did not produce significant differences in the incidence and severity of P. viticola, and Pa. chlamydospora. For plants grown in the field with a grapevine history, all fungicides except cyprodinil significantly reduced the incidence and severity of Cylindrocarpon fungi. Also, the incidence and severity of Botryosphaeriaceae pathogens were significantly decreased both by cyprodinil + fludioxonil and by cyprodinil. No significant differences were noticed for P. viticola incidence and severity, and Pa. chlamydospora was not detected again. These results suggest that the practice of soaking grapevine cuttings in selected fungicides prior to grafting significantly reduces Cylindrocarpon spp. and Botryosphaeriaceae infections, thus improving the quality of planting material.

  14. Do nursery habitats provide shelter from flow for juvenile fish?

    Directory of Open Access Journals (Sweden)

    Darren M Parsons

    Full Text Available Juvenile fish nurseries are an essential life stage requirement for the maintenance of many fish populations. With many inshore habitats globally in decline, optimising habitat management by increasing our understanding of the relationship between juvenile fish and nursery habitats may be a prudent approach. Previous research on post-settlement snapper (Chrysophrys auratus has suggested that structure may provide a water flow refuge, allowing snapper to access high water flow sites that will also have a high flux of their pelagic prey. We investigated this hypothesis by describing how Artificial Seagrass Units (ASUs modified water flow while also using a multi-camera set up to quantify snapper position in relation to this water flow environment. Horizontal water flow was reduced on the down-current side of ASUs, but only at the height of the seagrass canopy. While the highest abundance of snapper did occur down-current of the ASUs, many snapper also occupied other locations or were too high in the water column to receive any refuge from water flow. The proportion of snapper within the water column was potentially driven by strategy to access zooplankton prey, being higher on the up-current side of ASUs and on flood tides. It is possible that post-settlement snapper alternate position to provide opportunities for both feeding and flow refuging. An alternative explanation relates to an observed interaction between post-settlement snapper and a predator, which demonstrated that snapper can utilise habitat structure when threatened. The nature of this relationship, and its overall importance in determining the value of nursery habitats to post-settlement snapper remains an elusive next step.

  15. Do nursery habitats provide shelter from flow for juvenile fish?

    Science.gov (United States)

    Parsons, Darren M; MacDonald, Iain; Buckthought, Dane; Middleton, Crispin

    2018-01-01

    Juvenile fish nurseries are an essential life stage requirement for the maintenance of many fish populations. With many inshore habitats globally in decline, optimising habitat management by increasing our understanding of the relationship between juvenile fish and nursery habitats may be a prudent approach. Previous research on post-settlement snapper (Chrysophrys auratus) has suggested that structure may provide a water flow refuge, allowing snapper to access high water flow sites that will also have a high flux of their pelagic prey. We investigated this hypothesis by describing how Artificial Seagrass Units (ASUs) modified water flow while also using a multi-camera set up to quantify snapper position in relation to this water flow environment. Horizontal water flow was reduced on the down-current side of ASUs, but only at the height of the seagrass canopy. While the highest abundance of snapper did occur down-current of the ASUs, many snapper also occupied other locations or were too high in the water column to receive any refuge from water flow. The proportion of snapper within the water column was potentially driven by strategy to access zooplankton prey, being higher on the up-current side of ASUs and on flood tides. It is possible that post-settlement snapper alternate position to provide opportunities for both feeding and flow refuging. An alternative explanation relates to an observed interaction between post-settlement snapper and a predator, which demonstrated that snapper can utilise habitat structure when threatened. The nature of this relationship, and its overall importance in determining the value of nursery habitats to post-settlement snapper remains an elusive next step.

  16. Evaluation of different compound fertilizers for use in oil palm nursery

    African Journals Online (AJOL)

    The standard NPKMg 12:12:17:2 compound fertilizer (SF) for oil palm nurseries is not always available when needed. Evaluation of other compound fertilizers – NKP 15:15:15 and NPK 20:10:10 – compared with the SF were carried out in the main nursery at NIFOR to ascertain their suitability and rates of application.

  17. Forest Research Nursery Waste Water Management Plan, Integrated Pest Management Plan, and pesticide safety

    Science.gov (United States)

    Kas Dumroese; David L. Wenny

    1992-01-01

    The University of Idaho Forest Research Nursery was established in 1909 to grow bareroot (field-grown) tree and shrub seedlings for conservation. In 1982, the bareroot production was phased out and replaced by growing seedlings in containers in greenhouses. The nursery emphasizes teaching, research and service. Students learn about forest planting; scientists...

  18. Growth performances of juvenile sole Solea solea under environmental constraints of embayed nursery areas

    NARCIS (Netherlands)

    Laffargue, P.; Lagardere, F.; Rijnsdorp, A.D.; Fillon, A.; Amara, R.

    2007-01-01

    Tidal embayments in the Bay of Biscay (France) host nursery grounds where common sole, Solea solea, is the most abundant flatfish species. This study aimed to appraise the way those habitats function as nurseries through juvenile sole's responses in somatic growth and condition (Fulton's K) during

  19. Nursery temperature as a factor in root elongation of ponderosa pine seedlings

    Science.gov (United States)

    Gilbert H. Schubert; Frank J. Baron

    1965-01-01

    Greenhouse and nursery studies suggest that graphs of "effective" day and night temperatures provide a convenient method to compare nursery sites and to evaluate the effects of temperature on seedling root growth. Comparisons of root response under different natural temperature regimes should provide inforrnation use ful 'for the production of higher...

  20. Transition from neonatal intensive care unit to special care nurseries: Experiences of parents and nurses

    NARCIS (Netherlands)

    Dr. A.L. van Staa; O.K. Helder; J.C.M. Verweij

    2011-01-01

    To explore parents' and nurses' experiences with the transition of infants from the neonatal intensive care unit to a special care nursery. Qualitative explorative study in two phases. Level IIID neonatal intensive care unit in a university hospital and special care nurseries (level II) in five

  1. Biochar effects on the nursery propagation of 4 northern Rocky Mountain native plant species

    Science.gov (United States)

    Clarice P. Matt; Christopher R. Keyes; R. Kasten Dumroese

    2018-01-01

    Biochar has emerged as a promising potential amendment of soilless nursery media for plant propagation. With this greenhouse study we used biochar to displace standard soilless nursery media at 4 rates (0, 15, 30, and 45% [v:v]) and then examined media chemistry, irrigation frequency, and the growth of 4 northern Rocky Mountain native plant species: Clarkia pulchella...

  2. Prevalence of Autism Spectrum Disorder in Nurseries in Lebanon: A Cross Sectional Study

    Science.gov (United States)

    Chaaya, Monique; Saab, Dahlia; Maalouf, Fadi T.; Boustany, Rose-Mary

    2016-01-01

    In Lebanon, no estimate for autism prevalence exists. This cross-sectional study examines the prevalence of Autism spectrum disorder (ASD) in toddlers in nurseries in Beirut and Mount-Lebanon. The final sample included 998 toddlers (16-48 months) from 177 nurseries. We sent parents the Modified Checklist for Autism in Toddlers (M-CHAT) for…

  3. Detection of Phytophthora ramorum at retail nurseries in the southeastern United States

    Science.gov (United States)

    Steven N. Jeffers; Jaesoon Hwang; Yeshi A. Wamishe; Steven W. Oak

    2010-01-01

    Many nursery plants are known to be hosts of Phytophthora ramorum or to be associated with this pathogen. These plants can be infected or merely infested by P. ramorum and with or without symptoms. The pathogen has been detected most frequently on container-grown nursery plants, and occasionally has been found in the container...

  4. Improvements for energy conservation at the Coeur d'Alene Nursery

    Science.gov (United States)

    Aram Eramian

    2009-01-01

    In 2002, the USDA Forest Service Coeur d'Alene Nursery in Idaho began to evaluate ways to reduce energy consumption in lighting, refrigeration, and heating and cooling of facility workspace. The primary factor leading up to this was the inefficiency of the nursery's Freon(R)-based refrigeration system. Energy costs and maintenance of the system were becoming...

  5. Create a pollinator garden at your nursery: An emphasis on monarch butterflies

    Science.gov (United States)

    Thomas D. Landis; R. Kasten Dumroese; Matthew E. Horning

    2014-01-01

    We realize that this type of article is a departure for FNN readers but feel that it is important for forest, conservation, and native plant nurseries to be good environmental stewards. In addition, establishing a pollinator garden at your nursery can be good for business, too. Demonstrating the role and beauty of native plants and their pollinators, particulary in a...

  6. Japanese Nursery and Kindergarten Teachers' Beliefs and Practices Regarding Developmentally Appropriate Practices

    Science.gov (United States)

    Hegde, Archana V.; Sugita, Chisato; Crane-Mitchell, Linda; Averett, Paige

    2014-01-01

    This study explored Japanese day nursery and kindergarten teachers' beliefs and practices regarding developmentally appropriate practices. Data were collected using in-depth interviews. Teacher interviews provided insights into the merger of the childcare and education systems of Japan. Six themes emerged from the analysis of the day nursery and…

  7. Emotional Aspects of Nursery Policy and Practice--Progress and Prospect

    Science.gov (United States)

    Elfer, Peter

    2015-01-01

    This article argues for a turn in early years policy towards more serious attention to the emotional dimensions of nursery organisation and practice. The article describes three developing bodies of research on emotion in nursery, each taking a different theoretical perspective. The central argument of the article is that these three bodies of…

  8. French Nursery Schools and German Kindergartens: Effects of Individual and Contextual Variables on Early Learning

    Science.gov (United States)

    Tazouti, Youssef; Viriot-Goeldel, Caroline; Matter, Cornelie; Geiger-Jaillet, Anemone; Carol, Rita; Deviterne, Dominique

    2011-01-01

    The present article investigates the effects of individual and contextual variables on children's early learning in French nursery schools and German kindergartens. Our study of 552 children at preschools in France (299 children from French nursery schools) and Germany (253 children from German kindergartens) measured skills that facilitate the…

  9. An Examination of the Role of Nursery Education on Primary School Pupils in Nigeria

    Science.gov (United States)

    Oniwon, H. O. Evelyn

    2015-01-01

    This study examines the role of Nursery education among primary school pupils. The sole objective of the study was to find out the differences in academic achievement between primary school pupils who received nursery education and those who did not. Descriptive survey research design was adopted to achieve the study objective. Consequently, 20…

  10. Converging Streams of Opportunity for Prison Nursery Programs in the United States

    Science.gov (United States)

    Goshin, Lorie Smith; Byrne, Mary Woods

    2009-01-01

    Prison nursery programs allow departments of correction to positively intervene in the lives of both incarcerated mothers and their infant children. The number of prison nurseries in the United States has risen dramatically in the past decade, yet there remains a significant gap between predominant correctional policy in this area and what is…

  11. Assessing tolerance of longleaf pine understory herbaceous plants to herbicide applications in a container nursery

    Science.gov (United States)

    D. Paul Jackson; Scott A. Enebak; James West; Drew Hinnant

    2015-01-01

    Renewed efforts in longleaf pine (Pinus palustris Mill.) ecosystem restoration has increased interest in the commercial production of understory herbaceous species. Successful establishment of understory herbaceous species is enhanced when using quality nursery-grown plants that have a better chance of survival after outplanting. Nursery growing practices have not been...

  12. A systems approach for management of pests and pathogens of nursery crops

    Science.gov (United States)

    Jennifer L. Parke; Niklaus J. Grünwald

    2012-01-01

    Horticultural nurseries are heterogeneous and spatially complex agricultural systems, which present formidable challenges to management of diseases and pests. Moreover, nursery plants shipped interstate and internationally can serve as important vectors for pathogens and pests that threaten both agriculture and forestry. Current regulatory strategies to prevent this...

  13. Dissipation of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb?insecticides used to control codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae) in apples for production of baby food

    OpenAIRE

    Szpyrka, Ewa; Matyaszek, Aneta; S?owik-Borowiec, Magdalena

    2017-01-01

    Dissipations of three insecticides: chlorantraniliprole, chlorpyrifos-methyl and indoxacarb in apples were studied following their foliar application on apples intended for production of baby food. The apples were sprayed with formulations for control of codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae). Six experiments were conducted; each insecticide was applied individually on dessert apples. A validated gas chromatography-based method with simultaneous electron capture and n...

  14. Interaction of Insecticide and Media Moisture on Ambrosia Beetle (Coleoptera: Curculionidae) Attacks on Selected Ornamental Trees.

    Science.gov (United States)

    Frank, Steven D; Anderson, Amanda L; Ranger, Christopher M

    2017-12-08

    Exotic ambrosia beetles, particularly Xylosandrus crassiusculus (Motschulsky) (Coleoptera: Curculionidae: Scolytinae) and Xylosandrus germanus (Blandford) (Coleoptera: Curculionidae: Scolytinae), are among the most damaging pests of ornamental trees in nurseries. Growers have had few tactics besides insecticide applications to reduce ambrosia beetle attacks but recent research has shown that attacks may be reduced by maintaining media moisture below a 50% threshold thereby reducing flood stress. We compared the efficacy of managing media moisture and insecticide applications for reducing ambrosia beetle attacks on three ornamental tree species in North Carolina. During trials in spring 2013 and 2015, flooded Cornus florida and Cornus kousa were heavily attacked despite sprays with permethrin, but nonflooded C. kousa or C. florida were not attacked. In spring 2015 trials, both nonflooded and flooded Styrax japonicus were heavily attacked regardless of permethrin applications. Although ethanol emissions were not measured, the apparently healthy nonflooded S. japonicus trees may have been exposed to an unknown physiological stress, such as low temperature injury, the previous winter, which predisposed them to beetle attack. However, ethanol levels within host tissues were not measured as part of the current study. X. crassiusculus (75%), Xyloborinus saxesenii Ratzburg (13%), and X. germanus (9%) were the most abundant species collected in ethanol baited traps deployed in 2015, while X. crassiusculus (63%) and X. germanus (36%) were the predominant species reared from attacked trees. Results indicate that managing media moisture levels at or below 50%, and maximizing tree health overall, may provide significant protection against Xylosandrus spp. attacks in flood intolerant tree species. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  15. 75 FR 75169 - Notice of Request for Extension of Approval of an Information Collection; Update of Nursery Stock...

    Science.gov (United States)

    2010-12-02

    ... Collection; Update of Nursery Stock Regulations AGENCY: Animal and Plant Health Inspection Service, USDA... regulations for the importation of nursery stock into the United States. DATES: We will consider all comments... . FOR FURTHER INFORMATION CONTACT: For information on regulations for the importation of nursery stock...

  16. Electronics

    Science.gov (United States)

    2001-01-01

    International Acer Incorporated, Hsin Chu, Taiwan Aerospace Industrial Development Corporation, Taichung, Taiwan American Institute of Taiwan, Taipei, Taiwan...Singapore and Malaysia .5 - 4 - The largest market for semiconductor products is the high technology consumer electronics industry that consumes up...Singapore, and Malaysia . A new semiconductor facility costs around $3 billion to build and takes about two years to become operational

  17. Establishing nursery estuary otolith geochemical tags for Sea Bass (Dicentrarchus labrax): Is temporal stability estuary dependent?

    Science.gov (United States)

    Ryan, Diarmuid; Wögerbauer, Ciara; Roche, William

    2016-12-01

    The ability to determine connectivity between juveniles in nursery estuaries and adult populations is an important tool for fisheries management. Otoliths of juvenile fish contain geochemical tags, which reflect the variation in estuarine elemental chemistry, and allow discrimination of their natal and/or nursery estuaries. These tags can be used to investigate connectivity patterns between juveniles and adults. However, inter-annual variability of geochemical tags may limit the accuracy of nursery origin determinations. Otolith elemental composition was used to assign a single cohort of 0-group sea bass Dicentrarchus labrax to their nursery estuary thus establishing an initial baseline for stocks in waters around Ireland. Using a standard LDFA model, high classification accuracies to nursery sites (80-88%) were obtained. Temporal stability of otolith geochemical tags was also investigated to assess if annual sampling is required for connectivity studies. Geochemical tag stability was found to be strongly estuary dependent.

  18. The mangrove nursery paradigm revisited: otolith stable isotopes support nursery-to-reef movements by Indo-Pacific fishes.

    Science.gov (United States)

    Kimirei, Ismael A; Nagelkerken, Ivan; Mgaya, Yunus D; Huijbers, Chantal M

    2013-01-01

    Mangroves and seagrass beds have long been perceived as important nurseries for many fish species. While there is growing evidence from the Western Atlantic that mangrove habitats are intricately connected to coral reefs through ontogenetic fish migrations, there is an ongoing debate of the value of these coastal ecosystems in the Indo-Pacific. The present study used natural tags, viz. otolith stable carbon and oxygen isotopes, to investigate for the first time the degree to which multiple tropical juvenile habitats subsidize coral reef fish populations in the Indo Pacific (Tanzania). Otoliths of three reef fish species (Lethrinus harak, L. lentjan and Lutjanus fulviflamma) were collected in mangrove, seagrass and coral reef habitats and analyzed for stable isotope ratios in the juvenile and adult otolith zones. δ(13)C signatures were significantly depleted in the juvenile compared to the adult zones, indicative of different habitat use through ontogeny. Maximum likelihood analysis identified that 82% of adult reef L. harak had resided in either mangrove (29%) or seagrass (53%) or reef (18%) habitats as juveniles. Of adult L. fulviflamma caught from offshore reefs, 99% had passed through mangroves habitats as juveniles. In contrast, L. lentjan adults originated predominantly from coral reefs (65-72%) as opposed to inshore vegetated habitats (28-35%). This study presents conclusive evidence for a nursery role of Indo-Pacific mangrove habitats for reef fish populations. It shows that intertidal habitats that are only temporarily available can form an important juvenile habitat for some species, and that reef fish populations are often replenished by multiple coastal habitats. Maintaining connectivity between inshore vegetated habitats and coral reefs, and conserving habitat mosaics rather than single nursery habitats, is a major priority for the sustainability of various Indo Pacific fish populations.

  19. The mangrove nursery paradigm revisited: otolith stable isotopes support nursery-to-reef movements by Indo-Pacific fishes.

    Directory of Open Access Journals (Sweden)

    Ismael A Kimirei

    Full Text Available Mangroves and seagrass beds have long been perceived as important nurseries for many fish species. While there is growing evidence from the Western Atlantic that mangrove habitats are intricately connected to coral reefs through ontogenetic fish migrations, there is an ongoing debate of the value of these coastal ecosystems in the Indo-Pacific. The present study used natural tags, viz. otolith stable carbon and oxygen isotopes, to investigate for the first time the degree to which multiple tropical juvenile habitats subsidize coral reef fish populations in the Indo Pacific (Tanzania. Otoliths of three reef fish species (Lethrinus harak, L. lentjan and Lutjanus fulviflamma were collected in mangrove, seagrass and coral reef habitats and analyzed for stable isotope ratios in the juvenile and adult otolith zones. δ(13C signatures were significantly depleted in the juvenile compared to the adult zones, indicative of different habitat use through ontogeny. Maximum likelihood analysis identified that 82% of adult reef L. harak had resided in either mangrove (29% or seagrass (53% or reef (18% habitats as juveniles. Of adult L. fulviflamma caught from offshore reefs, 99% had passed through mangroves habitats as juveniles. In contrast, L. lentjan adults originated predominantly from coral reefs (65-72% as opposed to inshore vegetated habitats (28-35%. This study presents conclusive evidence for a nursery role of Indo-Pacific mangrove habitats for reef fish populations. It shows that intertidal habitats that are only temporarily available can form an important juvenile habitat for some species, and that reef fish populations are often replenished by multiple coastal habitats. Maintaining connectivity between inshore vegetated habitats and coral reefs, and conserving habitat mosaics rather than single nursery habitats, is a major priority for the sustainability of various Indo Pacific fish populations.

  20. Gaseous pollutants on rural and urban nursery schools in Northern Portugal

    International Nuclear Information System (INIS)

    Nunes, R.A.O.; Branco, P.T.B.S.; Alvim-Ferraz, M.C.M.; Martins, F.G.; Sousa, S.I.V.

    2016-01-01

    Indoor air quality in nursery schools is different from other schools and this has been largely ignored, particularly in rural areas. Urban and rural nursery schools have different environmental characteristics whose knowledge needs improvement. Thus, this study aimed to evaluate continuously the concentrations of CO_2, CO, NO_2, O_3, CH_2O and total VOC in three rural nursery schools and one urban, being the only one comparing urban and rural nurseries with continuous measurements, thus considering occupation and non-occupation periods. Regarding CO_2, urban nursery recorded higher concentrations (739–2328 mg m"−"3) than rural nurseries (653–1078 mg m"−"3). The influence of outdoor air was the main source of CO, NO_2 and O_3 indoor concentrations. CO and NO_2 concentrations were higher in the urban nursery and O_3 concentrations were higher in rural ones. CH_2O and TVOC concentrations seemed to be related to internal sources, such as furniture and flooring finishing and cleaning products. - Highlights: • This is the only study comparing gaseous pollutants continuously measured in urban and rural nurseries. • Children's risk of exposure occurs mainly in the urban nursery school. • Outdoor air was the main determinant of CO, NO_2 and O_3 indoor concentrations. • There is a need to implement measures to reduce critical situations regarding IAQ. - Gaseous pollutant levels were higher in the urban nursery than in rural ones, except for O_3. High concentrations were due to lack of ventilation, outdoor air and internal sources.

  1. [Nursery Teacher's Stress Scale (NTSS): reliability and validity].

    Science.gov (United States)

    Akada, Taro

    2010-06-01

    This study describes the development and evaluation of the Nursery Teacher's Stress Scale (NTSS), which explores the relation between daily hassles at work and work-related stress. In Analysis 1, 29 items were chosen to construct the NTSS. Six factors were identified: I. Stress relating to child care; II. Stress from human relations at work; III. Stress from staff-parent relations; IV. Stress from lack of time; V. Stress relating to compensation; and VI. Stress from the difference between individual beliefs and school policy. All these factors had high degrees of internal consistency. In Analysis 2, the concurrent validity of the NTSS was examined. The results showed that the NTSS total scores were significantly correlated with the Job Stress Scale-Revised Version (job stressor scale, r = .68), the Pre-school Teacher-efficacy Scale (r = -.21), and the WHO-five Well-Being Index Japanese Version (r = -.40). Work stresses are affected by several daily hassles at work. The NTSS has acceptable reliability and validity, and can be used to improve nursery teacher's mental health.

  2. Coastal Nurseries and Their Importance for Conservation of Sea Kraits

    Science.gov (United States)

    Bonnet, Xavier; Brischoux, François; Bonnet, Christophe; Plichon, Patrice; Fauvel, Thomas

    2014-01-01

    Destruction and pollution of coral reefs threaten these marine biodiversity hot stops which shelter more than two thirds of sea snake species. Notably, in many coral reef ecosystems of the Western Pacific Ocean, large populations of sea kraits (amphibious sea snakes) have drastically declined during the past three decades. Protecting remaining healthy populations is thus essential. In New Caledonia, coral reefs shelter numerous sea krait colonies spread throughout an immense lagoon (24,000 km2). Sea kraits feed on coral fish but lay their eggs on land. However, ecological information on reproduction and juveniles is extremely fragmentary, precluding protection of key habitats for reproduction. Our 10 years mark recapture study on Yellow sea kraits (L. saintgironsi >8,700 individuals marked) revealed that most neonates aggregate in highly localized coastal sites, where they feed and grow during several months before dispersal. Hundreds of females emigrate seasonally from remote populations (>50 km away) to lay their eggs in these coastal nurseries, and then return home. Protecting these nurseries is a priority to maintain recruitment rate, and to retain sea krait populations in the future. PMID:24670985

  3. Coastal nurseries and their importance for conservation of sea kraits.

    Directory of Open Access Journals (Sweden)

    Xavier Bonnet

    Full Text Available Destruction and pollution of coral reefs threaten these marine biodiversity hot stops which shelter more than two thirds of sea snake species. Notably, in many coral reef ecosystems of the Western Pacific Ocean, large populations of sea kraits (amphibious sea snakes have drastically declined during the past three decades. Protecting remaining healthy populations is thus essential. In New Caledonia, coral reefs shelter numerous sea krait colonies spread throughout an immense lagoon (24,000 km2. Sea kraits feed on coral fish but lay their eggs on land. However, ecological information on reproduction and juveniles is extremely fragmentary, precluding protection of key habitats for reproduction. Our 10 years mark recapture study on Yellow sea kraits (L. saintgironsi >8,700 individuals marked revealed that most neonates aggregate in highly localized coastal sites, where they feed and grow during several months before dispersal. Hundreds of females emigrate seasonally from remote populations (>50 km away to lay their eggs in these coastal nurseries, and then return home. Protecting these nurseries is a priority to maintain recruitment rate, and to retain sea krait populations in the future.

  4. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  5. Ion channels: molecular targets of neuroactive insecticides.

    Science.gov (United States)

    Raymond-Delpech, Valérie; Matsuda, Kazuhiko; Sattelle, Benedict M; Rauh, James J; Sattelle, David B

    2005-11-01

    Many of the insecticides in current use act on molecular targets in the insect nervous system. Recently, our understanding of these targets has improved as a result of the complete sequencing of an insect genome, i.e., Drosophila melanogaster. Here we examine the recent work, drawing on genetics, genomics and physiology, which has provided evidence that specific receptors and ion channels are targeted by distinct chemical classes of insect control agents. The examples discussed include, sodium channels (pyrethroids, p,p'-dichlorodiphenyl-trichloroethane (DDT), dihydropyrazoles and oxadiazines); nicotinic acetylcholine receptors (cartap, spinosad, imidacloprid and related nitromethylenes/nitroguanidines); gamma-aminobutyric acid (GABA) receptors (cyclodienes, gamma-BHC and fipronil) and L-glutamate receptors (avermectins). Finally, we have examined the molecular basis of resistance to these molecules, which in some cases involves mutations in the molecular target, and we also consider the future impact of molecular genetic technologies in our understanding of the actions of neuroactive insecticides.

  6. Impact of Nursery Rhymes on Iranian EFL Learners’ Listening Comprehension Skill Improvement-A Study

    Directory of Open Access Journals (Sweden)

    Omid Pourkalhor

    2017-06-01

    Full Text Available The present study was an attempt to investigate the effect of nursery rhymes on the young language learners listening comprehension ability. To do so, 30 elementary learners were selected as the potential participants of the study. The learners’ perceptions about using nursery rhymes in teaching listening as well as teachers’ perceptions about teaching listening comprehension through nursery rhymes were taken into account. The listening pre- and post-tests and teachers and learners’ interviews were employed for data collection procedures. Quantitative as well as qualitative methodologies were adapted for data analysis. Findings showed that the young learners could improve their listening comprehension ability as a result of using nursery rhymes. Interview data also indicated that the learners’ perceptions about nursery rhymes were found to be positive since the rhymes provided an interesting atmosphere for the learners to improve their listening comprehension while benefiting from peer interaction and teacher’s support in the listening classroom. Teachers’ perceptions were also realistic regarding using nursery rhymes in teaching listening, especially for young learners. As to the implication side, finding can contribute to the positive application of nursery rhymes in paving the way for young learners to improve their listening comprehension ability.

  7. Phytophthora community structure analyses in Oregon nurseries inform systems approaches to disease management.

    Science.gov (United States)

    Parke, Jennifer L; Knaus, Brian J; Fieland, Valerie J; Lewis, Carrie; Grünwald, Niklaus J

    2014-10-01

    Nursery plants are important vectors for plant pathogens. Understanding what pathogens occur in nurseries in different production stages can be useful to the development of integrated systems approaches. Four horticultural nurseries in Oregon were sampled every 2 months for 4 years to determine the identity and community structure of Phytophthora spp. associated with different sources and stages in the nursery production cycle. Plants, potting media, used containers, water, greenhouse soil, and container yard substrates were systematically sampled from propagation to the field. From 674 Phytophthora isolates recovered, 28 different species or taxa were identified. The most commonly isolated species from plants were Phytophthora plurivora (33%), P. cinnamomi (26%), P. syringae (19%), and P. citrophthora (11%). From soil and gravel substrates, P. plurivora accounted for 25% of the isolates, with P. taxon Pgchlamydo, P. cryptogea, and P. cinnamomi accounting for 18, 17, and 15%, respectively. Five species (P. plurivora, P. syringae, P. taxon Pgchlamydo, P. gonapodyides, and P. cryptogea) were found in all nurseries. The greatest diversity of taxa occurred in irrigation water reservoirs (20 taxa), with the majority of isolates belonging to internal transcribed spacer clade 6, typically including aquatic opportunists. Nurseries differed in composition of Phytophthora communities across years, seasons, and source within the nursery. These findings suggest likely contamination hazards and target critical control points for management of Phytophthora disease using a systems approach.

  8. Factors influencing parents' decision-making when sending children with respiratory tract infections to nursery.

    Science.gov (United States)

    Carroll, Fran E; Rooshenas, Leila; Owen-Smith, Amanda; Al-Janabi, Hareth; Hollinghurst, Sandra; Hay, Alastair D

    2016-06-01

    Many families rely on formal day care provision, which can be problematic when children are unwell. Attendance in these circumstances may impact on the transmission of infections in both day care and the wider community. Thirty-one semi-structured interviews were conducted to investigate how parents make decisions about nursery care when children are unwell. Topics for discussion included: illness attitudes, current practice during childhood illness and potential nursery policy changes that could affect decision-making. A combination of illness perceptions and external factors affected decision-making. Parents: (i) considered the severity of respiratory and non-respiratory symptoms differently, and stated that while most other contagious illnesses required nursery exclusion, coughs/colds did not; (ii) said decisions were not solely based on nursery policy, but on practical challenges such as work absences, financial penalties and alternative care availability; (iii) identified modifiable nursery policy factors that could potentially help parents keep unwell children at home, potentially reducing transmission of infectious illness. Decision-making is a complex interaction between the child's illness, personal circumstance and nursery policy. Improving our understanding of the modifiable aspects of nursery policies and the extent to which these factors affect decision-making could inform the design and implementation of interventions to reduce the transmission of infectious illness and the associated burden on NHS services. © The Author 2015. Published by Oxford University Press on behalf of Faculty of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  9. Gaseous pollutants on rural and urban nursery schools in Northern Portugal.

    Science.gov (United States)

    Nunes, R A O; Branco, P T B S; Alvim-Ferraz, M C M; Martins, F G; Sousa, S I V

    2016-01-01

    Indoor air quality in nursery schools is different from other schools and this has been largely ignored, particularly in rural areas. Urban and rural nursery schools have different environmental characteristics whose knowledge needs improvement. Thus, this study aimed to evaluate continuously the concentrations of CO2, CO, NO2, O3, CH2O and total VOC in three rural nursery schools and one urban, being the only one comparing urban and rural nurseries with continuous measurements, thus considering occupation and non-occupation periods. Regarding CO2, urban nursery recorded higher concentrations (739-2328 mg m(-3)) than rural nurseries (653-1078 mg m(-3)). The influence of outdoor air was the main source of CO, NO2 and O3 indoor concentrations. CO and NO2 concentrations were higher in the urban nursery and O3 concentrations were higher in rural ones. CH2O and TVOC concentrations seemed to be related to internal sources, such as furniture and flooring finishing and cleaning products. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Mixture for Controlling Insecticide-Resistant Malaria Vectors

    OpenAIRE

    Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc

    2008-01-01

    The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...

  11. Preschool Outcomes of Children Who Lived as Infants in a Prison Nursery

    Science.gov (United States)

    Goshin, Lorie S.; Byrne, Mary W.; Blanchard-Lewis, Barbara

    2015-01-01

    This study examined long-term outcomes of children who spent their first one to eighteen months in a US prison nursery. Behavioral development in 47 preschool children who lived in a prison nursery was compared with 64 children from a large national dataset who were separated from their mothers because of incarceration. Separation was associated with significantly worse anxious/depressed scores, even after controlling for risks in the caregiving environment. Findings suggest that prison nursery co-residence with developmental support confers some resilience in children who experience early maternal incarceration. Co-residence programs should be promoted as a best practice for incarcerated childbearing women. PMID:26609188

  12. Effect of tetracycline dose and treatment mode on selection of resistant coliform bacteria in nursery pigs

    DEFF Research Database (Denmark)

    Græsbøll, Kaare; Damborg, Peter; Mellerup, Anders

    2017-01-01

    This study describes the results of a randomized clinical trial investigating the effect of oxytetracycline treatment dose and mode of administration on the selection of antibiotic-resistant coliform bacteria in fecal samples from nursery pigs. Nursery pigs (pigs of 4 to 7 weeks of age) in five pig...... by the time that the pigs left the nursery unit. The counts and proportions of tetracyclineresistant coliforms did not vary significantly between treatment groups, except immediately after treatment, when the highest treatment dose resulted in the highest number of resistant coliforms. A control group treated...

  13. An overview of diseases in fish hatcheries and nurseries

    Directory of Open Access Journals (Sweden)

    Md. Ali Reza Faruk

    2017-12-01

    Full Text Available Quality and healthy fish seed is the prerequisite for sustainable aquaculture. A major challenge to the expansion of aquaculture production is the outbreak of diseases. Disease induced mortality is a serious issue for the fish seed industry. The immature immune system in fish makes the early developmental stages more susceptible to infectious diseases. Common fish diseases in hatcheries and in early rearing systems are caused by protozoan, ciliates, myxosporodians, worms, opportunistic bacteria and fungi. Production of healthy fish seed and survivality depends on the proper health management, maintenance of good water quality, proper nutrition and application of biosecurity measures. The paper highlighted the different types of diseases, causative agents and their prevention and control measures in fish hatcheries and nurseries. [Fundam Appl Agric 2017; 2(3.000: 311-316

  14. Fish utilisation of wetland nurseries with complex hydrological connectivity.

    Directory of Open Access Journals (Sweden)

    Ben Davis

    Full Text Available The physical and faunal characteristics of coastal wetlands are driven by dynamics of hydrological connectivity to adjacent habitats. Wetlands on estuary floodplains are particularly dynamic, driven by a complex interplay of tidal marine connections and seasonal freshwater flooding, often with unknown consequences for fish using these habitats. To understand the patterns and subsequent processes driving fish assemblage structure in such wetlands, we examined the nature and diversity of temporal utilisation patterns at a species or genus level over three annual cycles in a tropical Australian estuarine wetland system. Four general patterns of utilisation were apparent based on CPUE and size-structure dynamics: (i classic nursery utlisation (use by recently settled recruits for their first year (ii interrupted peristence (iii delayed recruitment (iv facultative wetland residence. Despite the small self-recruiting 'facultative wetland resident' group, wetland occupancy seems largely driven by connectivity to the subtidal estuary channel. Variable connection regimes (i.e. frequency and timing of connections within and between different wetland units (e.g. individual pools, lagoons, swamps will therefore interact with the diversity of species recruitment schedules to generate variable wetland assemblages in time and space. In addition, the assemblage structure is heavily modified by freshwater flow, through simultaneously curtailing persistence of the 'interrupted persistence' group, establishing connectivity for freshwater spawned members of both the 'facultative wetland resident' and 'delayed recruitment group', and apparently mediating use of intermediate nursery habitats for marine-spawned members of the 'delayed recruitment' group. The diversity of utilisation pattern and the complexity of associated drivers means assemblage compositions, and therefore ecosystem functioning, is likely to vary among years depending on variations in hydrological

  15. A restatement of the natural science evidence base concerning neonicotinoid insecticides and insect pollinators.

    Science.gov (United States)

    Godfray, H Charles J; Blacquière, Tjeerd; Field, Linda M; Hails, Rosemary S; Petrokofsky, Gillian; Potts, Simon G; Raine, Nigel E; Vanbergen, Adam J; McLean, Angela R

    2014-07-07

    There is evidence that in Europe and North America many species of pollinators are in decline, both in abundance and distribution. Although there is a long list of potential causes of this decline, there is concern that neonicotinoid insecticides, in particular through their use as seed treatments are, at least in part, responsible. This paper describes a project that set out to summarize the natural science evidence base relevant to neonicotinoid insecticides and insect pollinators in as policy-neutral terms as possible. A series of evidence statements are listed and categorized according to the nature of the underlying information. The evidence summary forms the appendix to this paper and an annotated bibliography is provided in the electronic supplementary material.

  16. Insecticides suppress natural enemies and increase pest damage in cabbage.

    Science.gov (United States)

    Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer

    2011-06-01

    Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy

  17. [Stress and Burnout Risk in Nursery School Teachers: Results from a Survey].

    Science.gov (United States)

    Jungbauer, J; Ehlen, S

    2015-06-01

    This article presents results from a study of 834 nursery school teachers in Germany, investigating working conditions, stress, and stress-related health problems. In order to evaluate the extent of mental and psychosomatic troubles, as well as the risk of burnout, we used the standardised questionnaire "Burnout Screening Scales" (BOSS I). Data analysis yielded a high percentage of nursery school teachers who reported a remarkably high stress level; nearly 20% can be considered as a high-risk group for burnout. Poor staff conditions in many nurseries turned out to be the crucial stress source, along with large groups, insufficient teacher-child ratio, time pressure and multitasking. In the concluding discussion of the study results, we consider possible measures to reduce stress and to improve working conditions for nursery school teachers. © Georg Thieme Verlag KG Stuttgart · New York.

  18. Reflections on a Time-Limited Mother-Baby Yoga Program at the Wee Ones Nursery

    Science.gov (United States)

    Pickholtz, Naomi

    2012-01-01

    This brief article discusses a yoga program offered to mothers and babies who were participating in a prison nursery. The author describes the goals and the sometimes unexpected effects of the program.

  19. Integrated cropping systems : an answer to environmental regulations imposed on nursery stock in the Netherlands

    NARCIS (Netherlands)

    Pronk, A.A.; Challa, H.

    2000-01-01

    Government regulations in the Netherlands are increasingly constraining and sometimes even banning conventional cultivation practices in nursery stock cropping systems. As a consequence, growers face problems concerning the use of manure, fertilisers and irrigation. In this study we analysed the

  20. Irrigation water sources and irrigation application methods used by U.S. plant nursery producers

    Science.gov (United States)

    Paudel, Krishna P.; Pandit, Mahesh; Hinson, Roger

    2016-02-01

    We examine irrigation water sources and irrigation methods used by U.S. nursery plant producers using nested multinomial fractional regression models. We use data collected from the National Nursery Survey (2009) to identify effects of different firm and sales characteristics on the fraction of water sources and irrigation methods used. We find that regions, sales of plants types, farm income, and farm age have significant roles in what water source is used. Given the fraction of alternative water sources used, results indicated that use of computer, annual sales, region, and the number of IPM practices adopted play an important role in the choice of irrigation method. Based on the findings from this study, government can provide subsidies to nursery producers in water deficit regions to adopt drip irrigation method or use recycled water or combination of both. Additionally, encouraging farmers to adopt IPM may enhance the use of drip irrigation and recycled water in nursery plant production.

  1. Protocols for sagebrush seed processing and seedling production at the Lucky Peak Nursery

    Science.gov (United States)

    Clark D. Fleege

    2010-01-01

    This paper presents the production protocols currently practiced at the USDA Forest Service Lucky Peak Nursery (Boise, ID) for seed processing and bareroot and container seedling production for three subspecies of big sagebrush (Artemisia tridentata).

  2. Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.

    Science.gov (United States)

    Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés

    2017-06-01

    The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.

  3. Ancient Nursery Area for the Extinct Giant Shark Megalodon from the Miocene of Panama

    OpenAIRE

    Pimiento, Catalina; Ehret, Dana J.; MacFadden, Bruce J.; Hubbell, Gordon

    2010-01-01

    BACKGROUND: As we know from modern species, nursery areas are essential shark habitats for vulnerable young. Nurseries are typically highly productive, shallow-water habitats that are characterized by the presence of juveniles and neonates. It has been suggested that in these areas, sharks can find ample food resources and protection from predators. Based on the fossil record, we know that the extinct Carcharocles megalodon was the biggest shark that ever lived. Previous proposed paleo-nurser...

  4. Improving Orientation Outcomes: Implementation of Phased Orientation Process in an Intermediate Special Care Nursery.

    Science.gov (United States)

    Rivera, Emily K; Shedenhelm, Heidi J; Gibbs, Ardyce L

    2015-01-01

    In response to changing needs of registered nurse orientees, the staff education committee in the Intermediate Special Care Nursery has implemented a phased orientation process. This phased process includes a mentoring experience postorientation to support a new nurse through the first year of employment. Since implementing the phased orientation process in the Intermediate Special Care Nursery, orientee satisfaction and preparation to practice have increased, and length of orientation has decreased.

  5. Emamectin benzoate: new insecticide against Helicoverpa armigera.

    Science.gov (United States)

    Fanigliulo, A; Sacchetti, M

    2008-01-01

    Emamectin benzoate is a new insecticide of Syngenta Crop Protection, with a new mechanism of action and a strong activity against Lepidoptera as well as with and a high selectivity on useful organisms. This molecule acts if swallowed and has some contact action. It penetrates leaf tissues (translaminar activity) and forms a reservoir within the leaf. The mechanism of action is unique in the panorama of insecticides. In facts, it inhibits muscle contraction, causing a continuous flow of chlorine ions in the GABA and H-Glutamate receptor sites. During 2006 and 2007, experimentation was performed by the Bioagritest test facility, according to EPPO guidelines and Principles of Good Experimental Practice (GEP), aiming at establishing the biological efficacy and the selectivity of Emamectin benzoate on industry tomato against Helicoverpa armigera (Lepidoptera: Noctuidoe). The study was performed in Tursi-Policoro (Matera), southern Italy. Experimental design consisted in random blocks, in 4 repetitions. A dosage of 1.5 Kg/ha of the formulate was compared with two commercial formulates: Spinosad 0.2 kg/ha (Laser, Dow Agrosciences Italia) and Indoxacarb 0.125 kg/ha (Steward EC insecticide, Dupont). Three foliage applications were applied every 8 days. The severity of damage induced by H. armigera was evaluated on fruits. Eventual phytotoxic effects were also evaluated. Climatic conditions were optimal for Lepidoptera development, so that the percentage of fruits attacked in 2007 at the first scouting was 68.28%. Emamectin benzoate has shown, in two years of testing, a high control of H. armigera if compared with the standards Indoxacarb and Spinosad. No effect of phytotoxicity was noticed on fruits.

  6. BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY

    Directory of Open Access Journals (Sweden)

    E. V. Matseliukh

    2015-10-01

    Full Text Available The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kherson, Odesa, Mykolaiv and Zaporizhiia regions of Ukraine. Purification of enzymes with elastase activity isolated from above mentioned strains was performed by gel-chromatography and insecticide activity was studied on the 3–4 larvae instar of Colorado beetle. The ability of a number of B. thuringiensis strains to synthesize the proteases with elastase activity has been established. The most active were enzymes obtained from strains IMV B-7465, IMV B-7324 isolated from sea water, and strains 9, 902, Bt-H and 0-239 isolated from Colorado beetles. The study of the physicochemical properties of the partially purified proteases of these strains showed that they belonged to enzymes of the serine type. Peptidases of a number of B. thuringiensis strains (IMV B-7324, IMV B-7465, 902, 0-239, 9 are metal-dependent enzymes. Optimal conditions of action of all tested enzymes are the neutral and alkaline рН values and the temperatures of 30–40 °С. The studies of influence of the complex enzyme preparations and partially purified ones of B. thuringiensis strains on the larvae instar of Colorado beetles indicated that enzymes with elastase activity could be responsible for insecticide action of the tested strains.

  7. Investigation of an outbreak of vomiting in nurseries in South East England, May 2012.

    Science.gov (United States)

    Nicholls, M; Purcell, B; Willis, C; Amar, C F L; Kanagarajah, S; Chamberlain, D; Wooldridge, D; Morgan, J; McLauchlin, J; Grant, K A; Harvey-Vince, L; Padfield, M; Mearkle, R; Chow, J Y

    2016-02-01

    On 30 May 2012, Surrey and Sussex Health Protection Unit was called by five nurseries reporting children and staff with sudden onset vomiting approximately an hour after finishing their lunch that day. Over the following 24 h 50 further nurseries supplied by the same company reported cases of vomiting (182 children, 18 staff affected). Epidemiological investigations were undertaken in order to identify the cause of the outbreak and prevent further cases. Investigations demonstrated a nursery-level attack rate of 55 out of 87 nurseries (63·2%, 95% confidence interval 52·2-73·3). Microbiological tests confirmed the presence of Bacillus cereus in food and environmental samples from the catering company and one nursery. This was considered microbiologically and epidemiologically consistent with toxin from this bacterium causing the outbreak. Laboratory investigations showed that the conditions used by the caterer for soaking of pearl haricot beans (known as navy bean in the USA) used in one of the foods supplied to the nurseries prior to cooking, was likely to have provided sufficient growth and toxin production of B. cereus to cause illness. This large outbreak demonstrates the need for careful temperature control in food preparation.

  8. The South African Experience of Conservation and Social Forestry Outreach Nurseries

    Science.gov (United States)

    Botha, Jenny; Witkowski, Ed T. F.; Cock, Jacklyn

    2006-11-01

    Outreach nurseries are favored conservation and social forestry tools globally, but, as with many integrated conservation and development programs (ICDPs), they do not always produce anticipated results. A synopsis of the experience of South African practitioners is provided in this study of 65 outreach nurseries. South African outreach nurseries frequently include financial objectives, creating additional challenges in simultaneously attaining conservation and socioeconomic goals. Progress was hindered by biophysical problems (e.g., lack of water, poor soils, etc.) as well as the harsh socioeconomic conditions facing most communities in which nurseries had been established. Attaining financial viability was challenging. Business management skills were often restricted, and few viability studies included adequate market research. Costs to community participants were usually high, and benefits were limited. Conservation objectives were frequently lost in the struggle to attain financial viability. The management of social processes also proved challenging. Although small scale and relatively straightforward compared with many ICDPs, nurseries usually require substantial institutional support, including a range of technical, business, and development services. Project time frames need to be reconsidered, as practitioners estimate that it takes 5-10 years for nurseries to start meeting objectives, and donors and implementing agencies often operate on 2-3-year project cycles. Detailed viability studies are essential, incorporating a social probe and an assessment of potential impacts of projects on community participants. Progress needs to be continuously evaluated to enable institutions and community participants to adapt to changing conditions as well as ensure that the spectrum of objectives are being achieved.

  9. Nursery nutrition in Liverpool: an exploration of practice and nutritional analysis of food provided.

    Science.gov (United States)

    Parker, Mike; Lloyd-Williams, Ffion; Weston, Gemma; Macklin, Julie; McFadden, Kate

    2011-10-01

    To explore nutrition and food provision in pre-school nurseries in order to develop interventions to promote healthy eating in pre-school settings. Quantitative data were gathered using questionnaires and professional menu analysis. In the community, at pre-school nurseries. All 130 nurseries across Liverpool were a sent questionnaire (38 % response rate); thirty-four menus were returned for analysis (26 % response rate). Only 21 % of respondents stated they had adequate knowledge on nutrition for pre-school children. Sixty-one per cent of cooks reported having received only a 'little' advice on healthy eating and this was often not specific to under-5 s nutrition. Fifty-seven per cent of nurseries did not regularly assess their menus for nutritional quality. The menu analysis revealed that all menus were deficient in energy, carbohydrate, Fe and Zn. Eighty-five per cent of nurseries had Na/salt levels which exceed guidelines. Nurseries require support on healthy eating at policy, knowledge and training levels. This support should address concerns relating to both menu planning and ingredients used in food provision and meet current guidelines on food provision for the under-5 s.

  10. Genotypic Diversity of Phytophthora cinnamomi and P. plurivora in Maryland's Nurseries and Mid-Atlantic Forests.

    Science.gov (United States)

    Beaulieu, Justine; Ford, Blaine; Balci, Yilmaz

    2017-06-01

    Genetic diversity of two Phytophthora spp.-P. cinnamomi (102 isolates), commonly encountered in Maryland nurseries and forests in the Mid-Atlantic United States, and P. plurivora (186 isolates), a species common in nurseries-was characterized using amplified fragment length polymorphism. Expected heterozygosity and other indices suggested a lower level of diversity among P. cinnamomi than P. plurivora isolates. Hierarchical clustering showed P. cinnamomi isolates separated into four clusters, and two of the largest clusters were closely related, containing 80% of the isolates. In contrast, P. plurivora isolates separated into six clusters, one of which included approximately 40% of the isolates. P. plurivora isolates recovered from the environment (e.g., soil and water) were genotypically more diverse than those found causing lesions. For both species, isolate origin (forest versus nursery or among nurseries) was a significant factor of heterozygosity. Clonal groups existed within P. cinnamomi and P. plurivora and included isolates from both forest and nurseries, suggesting that a pathway from nurseries to forests or vice versa exists.

  11. Effectiveness and profitability of insecticide formulations used for ...

    African Journals Online (AJOL)

    To identify optimal pest control with lower economic risks to farmers, we investigated the effectiveness and profitability of different insecticides and insecticide formulations against bean fly (Ophiomyia spp.) and bean flower thrips (Megalurothrips sjostedtii). Two separate experiments were conducted during 2009 to 2012.

  12. Effects of insecticide spray application on insect pest infestation and ...

    African Journals Online (AJOL)

    USER

    2010-03-15

    Mar 15, 2010 ... This study provides information on the incidence of major insect pests of cowpea as well as the minimum insecticide control intervention necessary for effectively reducing cowpea yield losses on the field. Two insecticide spray regimes (once at flowering and podding) significantly reduced insect population ...

  13. Effects of insecticide spray application on insect pest infestation and ...

    African Journals Online (AJOL)

    Field studies were conducted during the 2008 - 2009 cropping season to determine the minimal insecticide application which can reduce cowpea yield losses on the field due to insect pest infestations in the Transkei region of South Africa. Treatments consisted of five cowpea varieties and four regimes of insecticide spray ...

  14. Design, Synthesis and Insecticidal Activities of Novel Phenyl Substituted Isoxazolecarboxamides

    Institute of Scientific and Technical Information of China (English)

    LIU Peng-fei; ZHANG Ji-feng; YAN Tao; XIONG Li-xia; LI Zheng-ming

    2012-01-01

    Thirteen novel phenyl substituted isoxazolecarboxamides were synthesized,and their structures were characterized by 1H NMR,elementary analysis and high-resolution mass spectrometry(HRMS) techniques.Their evaluated insecticidal activities against oriental armyworm(Mythimna separata) indicate that the phcnyl substituted isoxazolecarboxamides exhibited moderate insecticidal activities,among which compounds 9c and 9k showed comparatively higher activities.

  15. Mechanistic modeling of insecticide risks to breeding birds in ...

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (

  16. Expression of melanin and insecticidal protein from Rhodotorula ...

    African Journals Online (AJOL)

    Both the salmon/red melanin and the insecticidal producing genes of Rhodotorula glutinis was successfully expressed in Escherichia coli using plasmid pZErO-1. This work suggests that in Rhodotorula species melanin and insecticidal toxin are co-expressed and therefore possibly co-evolved. Keywords: Rhodotorula ...

  17. Guide to testing insecticides on coniferous forest defoliators

    Science.gov (United States)

    Carroll B Jr. Williams; David A. Sharpnack; Liz Maxwell; Patrick J. Shea; Mark D. McGregor

    1985-01-01

    This report provides a guide to techniques for designing field tests of candidate insecticides, and for carrying out pilot tests and control projects. It describes experimental designs for testing hypotheses, and for sampling trees to estimate insect population densities and percent reduction after treatments. Directions for applying insecticides by aircraft and for...

  18. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    Administrator

    2011-05-30

    May 30, 2011 ... different, studies done in natural conditions should be favored. Key words: Insecticides ... insecticide was applied on synthetic or natural food of the target insect ..... Pozsgay M, Fast P, Kaplan H, Carey PR (1987). The effect of ...

  19. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  20. Identification and cloning of two insecticidal protein genes from ...

    African Journals Online (AJOL)

    Bacillus thuringiensis (Bt) is the most widely applied type of microbial pesticide due to its high specificity and environmental safety. The activity of Bt is largely attributed to the insecticidal crystal protein encoded by the cry genes. Different insecticidal crystal proteins of Bt have different bioactivity against distinct agricultural ...

  1. Interactions of transgenic Bacillus thuringiensis insecticidal crops with spiders (Araneae)

    Science.gov (United States)

    Genetically modified crops expressing insecticidal proteins from Bacillus thuringiensis (Bt) have dramatically increased in acreage since their introduction in the mid-1990’s. Although the insecticidal mechanisms of Bt target specific pests, concerns persist regarding direct and indirect effects on...

  2. Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.

    Science.gov (United States)

    Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M

    2016-02-01

    Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  3. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Ecotoxicological study of insecticide effects on arthropods in common bean.

    Science.gov (United States)

    de Barros, Emerson Cristi; Ventura, Hudson Vaner; Gontijo, Pablo Costa; Pereira, Renata Ramos; Picanço, Marcelo Coutinho

    2015-01-01

    Arthropods are an important group of macroorganisms that work to maintain ecosystem health. Despite the agricultural benefits of chemical control against arthropod pests, insecticides can cause environmental damage. We examined the effects of one and two applications of the insecticides chlorfenapyr (0.18 liters a.i. ha-1) and methamidophos (0.45 liters a.i. ha-1), both independently and in combination, on arthropods in plots of common bean. The experiment was repeated for two growing seasons. Principal response curve, richness estimator, and Shannon-Wiener diversity index analyses were performed. The insecticides generally affected the frequency, richness, diversity, and relative abundance of the arthropods. In addition, the arthropods did not experience recovery after the insecticide applications. The results suggest that the insecticide impacts were sufficiently drastic to eliminate many taxa from the studied common bean plots. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  5. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  6. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  7. The Value of Reflective: Functioning within an Academic Therapeutic Nursery.

    Science.gov (United States)

    LaLonde, Mary M; Dreier, Mona; Aaronson, Gayle; O'Brien, John

    2015-01-01

    The self begins as a social self and is dependent on the other and the self-other relationship. Furthermore, shortly after birth, the intersubjective self is nurtured and sustained by the reciprocal interactions with the significant other. Recent research suggests that the significant other's reciprocity depends on his or her capacity for mentalization, and this reflective functioning capacity influences not only the child's developing sense of I, other, and we, but also his or her developing attachment pattern. Several studies have demonstrated that parental reflective functioning can be improved with intervention, and enhancing parental reflective functioning can lead to a more secure attachment pattern and better outcomes for the child and parent. Therefore, intervention with toddlers and their families requires us to consider this dynamic two-person psychology. In this paper, we describe an academic parent-child nursery program aimed at enhancing parental reflective functioning. A clinical example from the collaborative treatment of a mother and her two-year-old will demonstrate how reflective functioning can be enhanced in the parent-child dyad and lead to a more secure parent-child relationship. We will also discuss the value of reflective functioning to the interdisciplinary team and how we dealt with countertransference issues that arose during the treatment.

  8. Let’s focus on our Nursery school!

    CERN Multimedia

    Staff Association

    2016-01-01

    In the 241st issue of Echo, the Staff Association shared its concerns about the future of the CERN Nursery school. Indeed, the EVEE ‘Espace de vie Enfantine et École’ has faced significant financial difficulties in the last few years. According to an audit carried out in 2015, overall the management is sound, but the report shows that the potential gains are not sufficient to restore budgetary balance. Naturally, the EVEE is turning to CERN in order for the Organization to increase its commitment to ensure the sustainability of this structure which is crucial for the lives of many CERN families. To this end, a joint working group has been set up by Martin Steinacher, Director for Finance and Human Resources, who has given the mandate (see below) and established the composition of the group. This joint working group being technical in nature, it will also be necessary to hold political discussions between the Staff Association and the Management. An internal working group of t...

  9. Recruitment of flatfish species to an estuarine nursery habitat (Lima estuary, NW Iberian Peninsula)

    Science.gov (United States)

    Ramos, Sandra; Ré, Pedro; Bordalo, Adriano A.

    2010-11-01

    One of the present concerns of fish biologists involves defining and identifying nursery habitats in the context of conservation and resource management strategies. Fish nursery studies usually report upon nursery occupation during the latter juvenile stages, despite the fact that recruitment to nurseries can start early in life, during the larval phase. Here we investigated the use of a temperate estuarine nursery area, the Lima estuary (NW Portugal), by initial development stages of flatfish species before and after metamorphosis, integrating the larval and juvenile phases. The Lima estuarine flatfish community comprised twelve taxa, seven of which were present as pelagic larvae, six as juveniles and three as adults. There was a general trend of increasing spring-summer abundance of both larvae and juveniles, followed by a sharp winter decrease, mainly of larval flatfishes. The Lima estuary was used by Solea senegalensis, Platichthys flesus and Solea solea as a nursery area, with direct settlement for the two first species. In contrast, indirect settlement was suggested for S. solea, with metamorphosis occurring outside the estuarine area. Estuarine recruitment of S. senegalensis varied between years, with young larvae occurring in the estuary throughout a prolonged period that lasted 6-9 months, corroborating the protracted spawning season. P. flesus, the second most abundant species, exhibited a typical spring estuarine recruitment, without inter-annual variations. Developed larvae arrived in the estuary during spring, whereas the 0-group juveniles emerged in the following summer period. The present study contributes new insight to our understanding of the economically important S. senegalensis, and highlights the importance of integrating the planktonic larval phase into traditional flatfish nursery studies.

  10. Disease prevalence among nursery school children after the Great East Japan earthquake.

    Science.gov (United States)

    Ishikuro, Mami; Matsubara, Hiroko; Kikuya, Masahiro; Obara, Taku; Sato, Yuki; Metoki, Hirohito; Isojima, Tsuyoshi; Yokoya, Susumu; Kato, Noriko; Tanaka, Toshiaki; Chida, Shoichi; Ono, Atsushi; Hosoya, Mitsuaki; Yokomichi, Hiroshi; Yamagata, Zentaro; Tanaka, Soichiro; Kure, Shigeo; Kuriyama, Shinichi

    2017-01-01

    To investigate the relationship between personal experience of the Great East Japan Earthquake and various disease types among nursery school children. We conducted a nationwide survey of nursery school children born between 2 April 2006 and 1 April 2007. Nursery school teachers completed questionnaires if they agreed to join the study. Questionnaire items for children consisted of their birth year and month, sex, any history of moving into or out of the current nursery school, presence of diseases diagnosed by a physician at the age of 66-78 months and type of disaster experience. The survey was conducted from September 2012 to December 2012. Japan, nationwide. A total of 60 270 nursery school children were included in the analysis, 840 of whom experienced the disaster on 11 March 2011. The health status of children 1.5 years after the disaster based on nursery school records. Experiencing the disaster significantly affected the prevalence of overall and individual diseases. Furthermore, there was a difference in disease prevalence between boys and girls. In boys, experiencing the tsunami (OR 2.53, 95% CI 1.22 to 5.24) and living in an evacuation centre (OR 2.92, 95% CI 1.46 to 5.83) were remarkably associated with a higher prevalence of atopic dermatitis, but these trends were not observed among girls. Instead, the home being destroyed (OR 3.50, 95% CI 2.02 to 6.07) and moving house (OR 4.19, 95% CI 2.01 to 8.71) were positively associated with a higher prevalence of asthma among girls. Our study indicates that experiencing the disaster may have affected the health status of nursery school children at least up to 1.5 years after the disaster. Continuous monitoring of the health status of children is necessary to develop strategic plans for child health.

  11. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.

  12. Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.

    Science.gov (United States)

    Hua, Jessica; Jones, Devin K; Relyea, Rick A

    2014-04-01

    As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.

  13. Quantitative structure-activity relationship (QSAR) for insecticides: development of predictive in vivo insecticide activity models.

    Science.gov (United States)

    Naik, P K; Singh, T; Singh, H

    2009-07-01

    Quantitative structure-activity relationship (QSAR) analyses were performed independently on data sets belonging to two groups of insecticides, namely the organophosphates and carbamates. Several types of descriptors including topological, spatial, thermodynamic, information content, lead likeness and E-state indices were used to derive quantitative relationships between insecticide activities and structural properties of chemicals. A systematic search approach based on missing value, zero value, simple correlation and multi-collinearity tests as well as the use of a genetic algorithm allowed the optimal selection of the descriptors used to generate the models. The QSAR models developed for both organophosphate and carbamate groups revealed good predictability with r(2) values of 0.949 and 0.838 as well as [image omitted] values of 0.890 and 0.765, respectively. In addition, a linear correlation was observed between the predicted and experimental LD(50) values for the test set data with r(2) of 0.871 and 0.788 for both the organophosphate and carbamate groups, indicating that the prediction accuracy of the QSAR models was acceptable. The models were also tested successfully from external validation criteria. QSAR models developed in this study should help further design of novel potent insecticides.

  14. Insecticidal defenses of Piperaceae from the neotropics.

    Science.gov (United States)

    Bernard, C B; Krishanmurty, H G; Chauret, D; Durst, T; Philogène, B J; Sánchez-Vindas, P; Hasbun, C; Poveda, L; San Román, L; Arnason, J T

    1995-06-01

    Insecticidal and growth-reducing properties of extracts of 14 species of American neotropical Piperaceae were investigated by inclusion in diets of a polyphagous lepidopteran, the European corn borer,Ostrinia nubilalis. Nutritional indices suggested most extracts acted by postdigestive toxicity.Piper aduncum, P. tuberculatum, andP. decurrens were among the most active species and were subjected to bioassay-guided isolation of the active components. Dillapiol was isolated from the active fraction ofP. aduncum, piperlonguminine was isolated fromP. tuberculatum, and a novel neolignan fromP. decurrens. The results support other studies on Asian and AfricanPiper species, which suggest that lignans and isobutyl amides are the active defence compounds in this family.

  15. Insecticidal Constituents from Buddlej aalbiflora Hemsl.

    Science.gov (United States)

    Zhang, Xiu-Yun; Shen, Jing; Zhou, Yu; Wei, Zhi-Ping; Gao, Jin-Ming

    2017-06-01

    Eleven known compounds, deoxymikanolide (1), 1,3-dihydroxyxanthone (2), kumatakenin (3), apigenin (4), chrysin (5), kaempferol (6), Iso-kaempferol (7), luteolin (8), luteolin-3',4'-dimethylether-7-O-β-glucoside (9), luteolin-7-O-β-glucoside (10) and quercetin (11) were identified in MeOH extract of Buddleja albiflora Hemsl (Oleaceae). These compounds (each, 1, 0.5 and 0.25 mg mL -1 ) were tested for insecticidal activity against 3rd and 4th-instar larvae of Plutella xylostella, 3rd-instar larvae of Mythimna separata and 3rd-instar larvae of Macrosiphoniella sanborni. The lowest 50% anti-feedant concentration (AFC 50 ) against P. xylostella and 50% lethal concentration (LC 50 ) against P. xylostella and M. sanborni were observed as 0.0058, 0.0046 and 3.4048 mg L -1 , respectively.

  16. Insecticidal Activity of Cyanohydrin and Monoterpenoid Compounds

    Directory of Open Access Journals (Sweden)

    Joel R. Coats

    2000-04-01

    Full Text Available The insecticidal activities of several cyanohydrins, cyanohydrin esters and monoterpenoid esters (including three monoterpenoid esters of a cyanohydrin were evaluated. Topical toxicity to Musca domestica L. adults was examined, and testing of many compounds at 100 mg/fly resulted in 100% mortality. Topical LD50 values of four compounds for M. domestica were calculated. Testing of many of the reported compounds to brine shrimp (Artemia franciscana Kellog resulted in 100% mortality at 10 ppm, and two compounds caused 100% mortality at 1 ppm. Aquatic LC50 values were calculated for five compounds for larvae of the yellow fever mosquito (Aedes aegypti (L.. Monoterpenoid esters were among the most toxic compounds tested in topical and aquatic bioassays.

  17. Staphylococcus aureus epidemic in a neonatal nursery: a strategy of infection control.

    Science.gov (United States)

    Bertini, Giovanna; Nicoletti, PierLuigi; Scopetti, Franca; Manoocher, Pourshaban; Dani, Carlo; Orefici, Graziella

    2006-08-01

    The risk of nosocomial infection due to Staphylococcus aureus in fullterm newborns is higher under hospital conditions where there are overcrowded nurseries and inadequate infection control techniques. We report on an outbreak of skin infection in a Maternity Nursery (May 21, 2000) and the measures undertaken to bring the epidemic under control. These measures included: separating neonates already present in the nursery on August 23, 2000 from ones newly arriving by creating two different cohorts, one of neonates born before this date and one of neonates born later; restricting healthcare workers caring for S. aureus- infected infants from working with non-infected infants; disallowing carrier healthcare workers from caring for patients; introducing contact and droplet precautions (including the routine use of gowns, gloves, and mask); ensuring appropriate disinfection of potential sources of contamination. A representative number of isolates were typed by genomic DNA restriction length polymorphism analysis by means of pulsed-field gel electrophoresis (PFGE). Among the 227 cases of skin lesions, microbiological laboratory analyses confirmed that 175 were staphylococcal infections. The outbreak showed a gradual reduction in magnitude when the overcrowding of the Nursery was reduced by separating the newborns into the two different Nurseries (two cohorts). The genotyping of the strains by PFGE confirmed the nurse-to-newborn transmission of S. aureus. The measures adopted for controlling the S. aureus outbreak can, in retrospect, be assessed to have been very effective.

  18. Association between distance to nearest supermarket and provision of fruits and vegetables in English nurseries.

    Science.gov (United States)

    Burgoine, Thomas; Gallis, John A; L Penney, Tarra; Monsivais, Pablo; Benjamin Neelon, Sara E

    2017-07-01

    With 796,500 places available for children in England, pre-school nurseries could serve as an important setting for population-wide dietary intervention. It is critical to understand the determinants of healthy food provision in this setting, which may include access to food stores. This study examined the association between objective, GIS-derived supermarket proximity and fruit and vegetable serving frequency, using data from 623 English nurseries. Overall, 116 (18%) nurseries served fruits and vegetables infrequently (supermarket proximity. In adjusted multivariable regression models, nurseries farthest from their nearest supermarket (Q5, 1.7-19.8km) had 2.38 (95% CI 1.01-5.63) greater odds of infrequent provision. Our results suggest that supermarket access may be important for nurseries in meeting fruit and vegetable provision guidelines. We advance a growing body of international literature, for the first time linking the food practices of institutions to their neighbourhood food retail context. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  19. Understanding the workplace culture of a special care nursery.

    Science.gov (United States)

    Wilson, Valerie J; McCormack, Brendan G; Ives, Glenice

    2005-04-01

    This paper presents findings from the first phase of a research study focusing on implementation and evaluation of emancipatory practice development strategies. Understanding the culture of practice is essential to undertaking effective developments in practice. Culture is a dominant feature of discussions about modernizing health care, yet few studies have been undertaken that systematically evaluate the development of effective practice cultures. The study intervention is that of emancipatory practice development with an integrated evaluation approach based on Realistic Evaluation. The aim of Realistic Evaluation is to evaluate relationships between Context (setting), Mechanism (process characteristics) and Outcome (arising from the context-mechanism configuration). This first phase of the study focuses on uncovering the context (in particular the culture) of the Special Care Nursery in order to evaluate the emancipatory practice development processes and outcomes. Data collection methods included survey, participant observation and interview. Cognitive mapping, constant comparative method and coding were used to analyse the data. Findings. Four key categories were identified: Teamwork, Learning in Practice, Inevitability of Change and Family-Centred Care and collectively these formed a central category of Core Values and Beliefs. A number of themes were identified in each category, and reflected tensions that existed between differing values and beliefs within the culture of the unit. Understanding values and beliefs is an important part of understanding a workplace culture. Whilst survey methods are capable of outlining espoused workplace characteristics, observation of staff interactions and perceptions gives an understanding of culture as a living entity manifested through interpersonal relationships. Attempts at changing workplace cultures should start from the clarification of values held among staff in that culture.

  20. Teenage organophosphate insecticide poisoning: An ugly trend in ...

    African Journals Online (AJOL)

    UNIBEN

    is worsened by uncontrolled sale of organophosphorus insecticides on the streets and in open markets. We report ..... Nicotinic activity results in autonomic nervous system .... optimize outcome.23 Oximes are cholinesterase re-activators used ...

  1. Gas Chromaotography-Mass Spectrometry Analysis of Insecticidal ...

    African Journals Online (AJOL)

    Insecticidal Essential Oil Derived from Chinese Ainsliaea fragrans Champ ex Benth ... Methods: The essential oil of A. fragrans aerial parts was obtained by hydrodistillation and analyzed by ..... toxicity than the crude oil. Caryophyllene showed.

  2. Scepticism towards insecticide treated mosquito nets for malaria ...

    African Journals Online (AJOL)

    Scepticism towards insecticide treated mosquito nets for malaria control in rural ... especially among under-five year children and pregnant women in poor rural ... through social marketing strategy for malaria control prior to the introduction of ...

  3. Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives

    Directory of Open Access Journals (Sweden)

    Jialong Sun

    2015-03-01

    Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  4. Neurotoxicological effects and the mode of action of pyrethroid insecticides

    NARCIS (Netherlands)

    Vijverberg, H.P.M.; Bercken, Joep van den

    1990-01-01

    Neuroexcitatory symptoms of acute poisoning of vertebrates by pyrethroids are related to the ability of these insecticides to modify electrical activity in various parts of the nervous system. Repetitive nerve activity, particularly in the sensory nervous system, membrane depolarization, and

  5. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-17

    Jun 17, 2008 ... Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of ... ed the use of natural extracts of Fagonia arabica, Salix ..... Studies on the efficacy of neem products against the aphid Aphis.

  6. Process optimization and insecticidal activity of alkaloids from the ...

    African Journals Online (AJOL)

    Process optimization and insecticidal activity of alkaloids from the root bark of Catalpa ovata G. Don by response surface methodology. ... Tropical Journal of Pharmaceutical Research. Journal Home · ABOUT THIS JOURNAL · Advanced ...

  7. Insect P450 inhibitors and insecticides: challenges and opportunities.

    Science.gov (United States)

    Feyereisen, René

    2015-06-01

    P450 enzymes are encoded by a large number of genes in insects, often over a hundred. They play important roles in insecticide metabolism and resistance, and growing numbers of P450 enzymes are now known to catalyse important physiological reactions, such as hormone metabolism or cuticular hydrocarbon synthesis. Ways to inhibit P450 enzymes specifically or less specifically are well understood, as P450 inhibitors are found as drugs, as fungicides, as plant growth regulators and as insecticide synergists. Yet there are no P450 inhibitors as insecticides on the market. As new modes of action are constantly needed to support insecticide resistance management, P450 inhibitors should be considered because of their high potential for insect selectivity, their well-known mechanisms of action and the increasing ease of rational design and testing. © 2014 Society of Chemical Industry.

  8. Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...

    African Journals Online (AJOL)

    HP

    Original Research Article. Gas Chromatography-Mass Spectrometric Analysis and ... into a natural fumigant/insecticide for the control of stored product insects. Keywords: Mallotus ..... stability as well as reduce cost. ACKNOWLEDGEMENT.

  9. Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research ... apelta aerial parts was analyzed by gas chromatography/mass spectrometric (GC/MS) to determine its composition. ... into a natural fumigant/insecticide for the control of stored product insects.

  10. Federal Insecticide, Fungicide, and Rodenticide Act Section 18 Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — Section 18 of Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) authorizes EPA to allow an unregistered use of a pesticide for a limited time if EPA...

  11. PRN 73-4: Residual Insecticides in Food Handling Establishments

    Science.gov (United States)

    This notice provides a copy of a Federal Register notice published July 6, 1973, regarding certain insecticides used in food-handling establishments. It establishes certain definitions and requirements related to approval for crack and crevice treatment.

  12. Atmospheric emissions of methyl isothiocyanate and chloropicrin following soil fumigation and surface containment treatment in bare-root forest nurseries

    Science.gov (United States)

    D. Wang; J. Juzwik; S.W. Fraedrich; K. Spokas; Y. Zhang; W.C. Koskinen

    2005-01-01

    Methylisothiocyanate (MITC) and chloropicrin (CP) are alternatives to methyl bromide for soil fumigation. However, surface transport of MITC emission has been cited as the cause for seedling damage in adjacent fields at several bare-root forest-tree nurseries. Field experiments were conducted at nurseries to measure air emissions of MITC and CP after fumigation....

  13. General Information about Crisis Nursery Care, ARCH Factsheet Number 1 [and] General Information about Respite Care, ARCH Factsheet Number 2.

    Science.gov (United States)

    North Carolina State Dept. of Human Resources, Raleigh. Div. of Mental Health, Mental Retardation and Substance Abuse Services.

    This document consists of a combination of two separately published fact sheets, one on crisis nursery care for children at risk of abuse or neglect and one on respite care for families of children with disabilities or chronic illness. The fact sheet on crisis nursery care presents background information on the federal role in developing crisis…

  14. Successful stock production for forest regeneration: What foresters should ask nursery managers about their crops (and vice versa)

    Science.gov (United States)

    R.K. Dumroese; D.F. Jacobs; T.D. Landis

    2005-01-01

    Forest regeneration is a cyclic operation. Seeds are collected from mature trees and planted in nurseries so that the resulting seedlings can be outplanted to the forest after the mature trees are harvested. Similarly, the process of deciding upon, and growing, the best seedlings for that site should be a cyclic process between foresters and nursery managers. The ideal...

  15. Evidence of estuarine nursery origin of five coastal fish species along the Portuguese coast through otolith elemental fingerprints

    Science.gov (United States)

    Vasconcelos, Rita P.; Reis-Santos, Patrick; Tanner, Susanne; Maia, Anabela; Latkoczy, Christopher; Günther, Detlef; Costa, Maria José; Cabral, Henrique

    2008-08-01

    Connectivity is a critical property of marine populations, particularly for species with segregated juvenile and adult habitats. Knowledge of this link is fundamental in understanding population structure and dynamics. Young adults of commercially important fish species Solea solea, Solea senegalensis, Platichthys flesus, Diplodus vulgaris and Dicentrarchus labrax were sampled off the Portuguese coast in order to establish preliminary evidence of estuarine nursery origins through otolith elemental fingerprints. Concentrations of Li, Na, Mg, K, Mn, Cu, Zn, Sr, Ba and Pb in the otolith section corresponding to juvenile's nursery life period were determined through laser ablation inductively coupled plasma mass spectrometry. Element: Ca ratios in coastal fish differed significantly amongst collection areas, except for Platichthys flesus, and were compared with the elemental fingerprints previously defined for age 0 juveniles in the main estuarine nurseries of the Portuguese coast. Identification of nursery estuaries was achieved for four of the species. Assigned nursery origins varied amongst species and differences in the spatial scale of fish dispersal were also found. Diplodus vulgaris was not reliably assigned to any of the defined nurseries. Overall, results give evidence of the applicability of estuarine habitat tags in future assessments of estuarine nursery role. Research developments on the links between juvenile and adult habitats should contribute for the integrated management and conservation of nurseries and coastal stocks.

  16. Occurrence of the root-rot pathogen, Fusarium commune, in forest nurseries of the midwestern and western United States

    Science.gov (United States)

    Mee-Sook Kim; Jane E. Stewart; R. Kasten Dumroese; Ned B. Klopfenstein

    2012-01-01

    Fusarium commune can cause damping-off and root rot of conifer seedlings in forest nurseries, and this pathogen has been previously reported from Oregon, Idaho, and Washington, USA. We collected Fusarium isolates from additional nurseries in the midwestern and western USA to more fully determine occurrence of this pathogen. We used DNA sequences of the mitochondrial...

  17. Examining the Effect of Social Values Education Program Being Applied to Nursery School Students upon Acquiring Social Skills

    Science.gov (United States)

    Sapsaglam, Özkan; Ömeroglu, Esra

    2016-01-01

    This study was conducted in an attempt to develop Social Values Education Program aimed at nursery school students and examine the effect of Social Values Education Program upon the social skill acquisition of nursery school students. The effect of the education program that was developed within the scope of the study upon the social skill…

  18. Successes and failures in controlling weeds in hardwood seedbeds at the Arkansas Forestry Commission Baucum Forest Nursery

    Science.gov (United States)

    Allan Murray

    2009-01-01

    Fumigation with methyl bromide is essential in the production of hardwood seedlings in nurseries in the southern United States. However, the proposed rules under the 2008 U.S. Environmental Protection Agency (EPA) Risk Mitigation will further restrict the use of methyl bromide for nursery use.

  19. Growing Shrubs at the George O. White State Forest Nursery: What Has Worked and What Has Not

    Science.gov (United States)

    Gregory Hoss

    2006-01-01

    At the George O. White State Forest Nursery in Licking, MO, we annually grow about 20 species of shrubs. That number has been larger in some years. For most species, we purchase seeds locally and process them at our nursery. Our shrubs are used for wetland restoration, windbreaks, visual screens, riparian buffers, and wildlife plantings.

  20. Relationship between snail population density and infection status of snails and fish with zoonotic trematodes in Vietnamese carp nurseries

    DEFF Research Database (Denmark)

    Clausen, Jesper Hedegaard; Madsen, Henry; Murrell, Kenneth Darwin

    2012-01-01

    ponds. Previous risk assessment on FZT transmission in the Red River Delta of Vietnam identified carp nursery ponds as major sites of transmission. In this study, we analyzed the association between snail population density and heterophyid trematode infection in snails with the rate of FZT transmission...... to juvenile fish raised in carp nurseries....

  1. "Let's Spend More Time Together Like This!": Fussy Baby Network® Infusion in a Baltimore Homeless Nursery Program

    Science.gov (United States)

    Cosgrove, Kim; Norris-Shortle, Carole

    2015-01-01

    The development of babies whose families are homeless can easily be affected by their uncertain living arrangements. The PACT Therapeutic Nursery's attachment-based, trauma-informed, mindfully focused family interventions help these children and families move beyond the trauma of shelter living. In the past year, Nursery clinicians have infused…

  2. An Investigation of Emotional Skills of Six-Year-Old Children Attending Nursery School According to Some Variables

    Science.gov (United States)

    Durmusoglu-Saltali, Neslihan; Arslan, Emel

    2011-01-01

    The purpose of this study is for the emotional skills of six-year-old children attending nursery school according to some variables. The participants were 306 (135 girls and 171 boys) six-year-old children attending nursery school. Data were collected from Assessment of Children's Emotional Skills and personal information form. In order to analyze…

  3. Nursery Cultural Practices and Morphological Attributes of Longleaf Pine Bare-Root Stock as Indicators of Early Field Performance; FINAL

    International Nuclear Information System (INIS)

    Glyndon E. Hatchell, Research Forester, Retired Institute for Mycorrhizal Research and Development Athens, Georgia and H. David Muse, Professor Department of Mathematics University of North Alabama Florence, Alabama

    1990-01-01

    A large study of morphological attributes of longleaf pine nursery stock at the Savannah River site of the various attributes measured, only number of lateral roots and seedling diameters were related to performance. Lateral root pruning in the nursery also improved performance. Both survival and growth during the first two years were strongly correlated with larger stem diameter and larger root system development

  4. National Literacy Trust Survey in Partnership with Nursery World: Investigating Communication, Language and Literacy Development in the Early Years Sector

    Science.gov (United States)

    Halden, Amanda; Clark, Christina; Lewis, Fiona

    2011-01-01

    In May 2011 "Nursery World" and the National Literacy Trust launched its language development survey to celebrate Hello; the national year of communication. The National Literacy Trust teamed up with "Nursery World" to carry out research into the sector's support for children's language and literacy development. Two hundred…

  5. Nursery Schools for the Few or the Many? Childhood, Education and the State in Mid-Twentieth-Century England

    Science.gov (United States)

    Palmer, Amy

    2011-01-01

    Prior to the outbreak of the Second World War, successive presidents and officials at the Board of Education made it clear that they believed there were three types of children in Britain--those who needed nursery schools to rescue them from degradation, those for whom a less expensive nursery class would do the job adequately and those who would…

  6. Freshwater Aquaculture Nurseries and Infection of Fish with Zoonotic Trematodes, Vietnam

    Science.gov (United States)

    Ersbøll, Annette Kjær; Nguyen, Thanh Thi; Nguyen, Khue Viet; Nguyen, Ha Thi; Murrell, Darwin; Dalsgaard, Anders

    2010-01-01

    Residents of the Red River Delta region of northern Vietnam have a long tradition of eating raw fish. Fish-borne zoonotic trematodes (FZTs) are estimated to infect ≈1 million persons in Vietnam. It remains uncertain at what stages in the aquaculture production cycle fish become infected with FZTs. Newly hatched fish (fry) from 8 hatcheries and juveniles from 27 nurseries were therefore examined for FZT infection. No FZTs were found in fry from hatcheries. In nurseries, FZT prevalence in juveniles was 14.1%, 48.6%, and 57.8% after 1 week, 4 weeks, and when overwintered in ponds, respectively. FZT prevalence was higher in grass carp (paquaculture management practices, particularly in nurseries, to minimize the risk of distributing infected juveniles to grow-out ponds and, subsequently, to markets for human consumption. PMID:21122220

  7. Log bioassay of residual effectiveness of insecticides against bark beetles

    Science.gov (United States)

    Richard H. Smith

    1982-01-01

    Residual effectiveness of nine insecticides applied to bark was tested against western, mountain, and Jeffrey pine beetles. Ponderosa and Jeffrey pine trees were treated and logs cut from them 2 to 13 months later, and bioassayed with the three beetles. The insecticides were sprayed at the rate of 1 gal (3.8 l) per 40- or 80-ft² (3.6 or 7.2 m²) bark surface at varying...

  8. The use of insecticides to control insect pests

    OpenAIRE

    M Wojciechowska; P Stepnowski; M Gołębiowski

    2016-01-01

    Pesticides are used as plants protection products. Among those, insecticides serve as agents to control insects. When incorrectly applied, however these substances may negatively affect people's health and natural environment. Administration routes of insecticides depend on many factors and vary from spraying to fertilizers. These different methods influence how insects prey and how pests develop. Additionally, too frequent use of the same chemicals can lead to development of resi...

  9. Insecticidal activity of Trichilia claussenii (Meliaceae) fruits against Spodoptera frugiperda

    International Nuclear Information System (INIS)

    Nebo, Liliane; Matos, Andrea Pereira; Vieira, Paulo Cezar; Fernandes, Joao Batista; Silva, Maria Fatima das Gracas Fernandes da; Rodrigues, Ricardo Ribeiro

    2010-01-01

    An evaluation of the insecticidal activity of the fruits extracts of Trichilia claussenii was carried out and the methanol extract revealed to have strong insecticidal activity. The fractionation of methanol extract of T. claussenii seeds bioassay-guided against Spodoptera frugiperda has led to the identification of the ω-phenylalkyl and alkenyl fatty acids as active compounds in this extract. The structures of the compounds were proposed by spectroscopic analysis and comparison with literature data. (author)

  10. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    Directory of Open Access Journals (Sweden)

    D.C. Pathak

    2011-07-01

    Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.

  11. Plant compounds insecticide activity against Coleoptera pests of stored products

    OpenAIRE

    MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.

    2008-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...

  12. Fungi in roots of nursery grown Pinus sylvestris: ectomycorrhizal colonisation, genetic diversity and spatial distribution.

    Science.gov (United States)

    Menkis, Audrius; Vasaitis, Rimvydas

    2011-01-01

    The aims of this study were to investigate patterns of ectomycorrhizal (ECM) colonisation and community structure on nursery grown seedlings of Pinus sylvestris, spatial distribution of ECMs in the nursery plot and genetic diversity of commonly isolated ECM basidiomycete Hebeloma cavipes. One hundred seedlings were sampled in 225 m(2) area using a systematic grid design. For each seedling, 20 individual root tips were randomly collected, morphotyped, and surface sterilised for fungal isolation in pure culture. Results showed that ECM community was comprised of nine distinct morphotypes among which Thelephora terrestris (39.7%), Hebeloma sp. (17.8%) and Suillus luteus (6.1%) were the most abundant. Spatial distribution of ECMs in the nursery plot was determined by their relative abundance: even in common ECMs and random in rare ones. Fungal isolation yielded 606 pure cultures, representing 71 distinct taxa. The most commonly isolated fungi were the ascomycetes Neonectria macrodidyma (20.3%), Phialocephala fortinii (13.5%), Neonectria radicicola (6.3%) and the ECM basidiomycete H. cavipes (4.5%). Intraspecific genetic diversity within 27 H. cavipes isolates was studied using two methods: restriction digestion of the amplified intergenic spacer of nuclear ribosomal DNA and genealogical concordance of five genetic markers. Five and eight genotypes were revealed by each respective method, but both of those were largely consistent, in particular, in determining the largest genotype (A) composed of 18 isolates. Mapping positions for each H. cavipes isolate and genotype in the field showed that isolates of the A genotype covered a large part of the nursery plot. This suggests that H. cavipes is largely disseminated by vegetative means of local genotypes and that nursery cultivation practices are likely to contribute to the dissemination of this species in the forest nursery soils.

  13. Ancient nursery area for the extinct giant shark megalodon from the Miocene of Panama.

    Directory of Open Access Journals (Sweden)

    Catalina Pimiento

    Full Text Available BACKGROUND: As we know from modern species, nursery areas are essential shark habitats for vulnerable young. Nurseries are typically highly productive, shallow-water habitats that are characterized by the presence of juveniles and neonates. It has been suggested that in these areas, sharks can find ample food resources and protection from predators. Based on the fossil record, we know that the extinct Carcharocles megalodon was the biggest shark that ever lived. Previous proposed paleo-nursery areas for this species were based on the anecdotal presence of juvenile fossil teeth accompanied by fossil marine mammals. We now present the first definitive evidence of ancient nurseries for C. megalodon from the late Miocene of Panama, about 10 million years ago. METHODOLOGY/PRINCIPAL FINDINGS: We collected and measured fossil shark teeth of C. megalodon, within the highly productive, shallow marine Gatun Formation from the Miocene of Panama. Surprisingly, and in contrast to other fossil accumulations, the majority of the teeth from Gatun are very small. Here we compare the tooth sizes from the Gatun with specimens from different, but analogous localities. In addition we calculate the total length of the individuals found in Gatun. These comparisons and estimates suggest that the small size of Gatun's C. megalodon is neither related to a small population of this species nor the tooth position within the jaw. Thus, the individuals from Gatun were mostly juveniles and neonates, with estimated body lengths between 2 and 10.5 meters. CONCLUSIONS/SIGNIFICANCE: We propose that the Miocene Gatun Formation represents the first documented paleo-nursery area for C. megalodon from the Neotropics, and one of the few recorded in the fossil record for an extinct selachian. We therefore show that sharks have used nursery areas at least for 10 millions of years as an adaptive strategy during their life histories.

  14. Defining fish nursery habitats: an application of otolith elemental fingerprinting in Tampa Bay, Florida

    Science.gov (United States)

    Ley, Janet A.; McIvor, Carole C.; Peebles, Ernst B; Rolls, Holly; Cooper, Suzanne T.

    2009-01-01

    Fishing in Tampa Bay enhances the quality of life of the area's residents and visitors. However, people's desire to settle along the Bay's shorelines and tributaries has been detrimental to the very habitat believed to be crucial to prime target fishery species. Common snook (Centropomus undecimalis) and red drum (Sciaenops ocellatus) are part of the suite of estuarine fishes that 1) are economically or ecologically prominent, and 2) have complex life cycles involving movement between open coastal waters and estuarine nursery habitats, including nursery habitats that are located within upstream, low-salinity portions of the Bay?s tidal tributaries. We are using an emerging microchemical technique -- elemental fingerprinting of fish otoliths -- to determine the degree to which specific estuarine locations contribute to adult fished populations in Tampa Bay. In ongoing monitoring surveys, over 1,000 young-of-the-year common snook and red drum have already been collected from selected Tampa Bay tributaries. Using laser ablation-inductively coupled plasma - mass spectrometry (LA-ICP-MS), we are currently processing a subsample of these archived otoliths to identify location-specific fingerprints based on elemental microchemistry. We will then analyze older fish from the local fishery in order to match them to their probable nursery areas, as defined by young-of-the-year otoliths. We expect to find that some particularly favorable nursery locations contribute disproportionately to the fished population. In contrast, other nursery areas may be degraded, or act as 'sinks', thereby decreasing their contribution to the fish population. Habitat managers can direct strategic efforts to protect any nursery locations that are found to be of prime importance in contributing to adult stocks.

  15. Realities and Challenges of Support for Children with Special Needs in Nursery Schools.

    Science.gov (United States)

    Ishiguro, Kaori; Yoshioka, Shin-Ichi

    2016-03-01

    Nursery schools and kindergartens have been struggling to cope with increasing numbers of children with special needs. Hence, we conducted a study on what nursery school teachers (NSTs) will require regarding learning and societal resources for supporting such children in the future. A questionnaire survey was conducted for 2,476 NSTs employed in 154 nursery schools in Shimane and Kochi Prefectures. The questionnaires were sent by post to officials at each nursery school. The completed questionnaires were collected by the school officials and returned by post. In addition to statistical processing of the survey results, the content of the free description responses was analyzed using the KJ method. Responses were obtained from 1,509 NSTs at 118 nursery schools. Of the respondents, 90.7% had experienced difficulties coping with children with special needs, and 83.9% were in charge of caring for such children. Such children were enrolled in every childcare facility participating in the survey. The NSTs primarily needed to learn about specific coping methods, the illness, and skills for supporting parents; concerning the societal resources, they needed the addition of assistant NSTs, the implementation of age-five check-up, and the recruitment of mentors. The free description responses were categorized into the following five categories: demand for child care administration, cooperation with professional staff, support for parents, developmental health checkups, and on-site needs for nursery childcare. One of the specific demands was to develop human resources capable of providing parents with appropriate advice. The results have shown that all NSTs are required to deal with children with special needs. Future challenges for providing support for such children are: ⅰ) to raise awareness of such children; ⅱ) to eliminate regional disparities; ⅲ) to provide professional training for NSTs specializing in developmental disorders; ⅳ) to train and re

  16. Climate mediates hypoxic stress on fish diversity and nursery function at the land–sea interface

    Science.gov (United States)

    Hughes, Brent B.; Levey, Matthew D.; Fountain, Monique C.; Carlisle, Aaron B.; Chavez, Francisco P.; Gleason, Mary G.

    2015-01-01

    Coastal ecosystems provide numerous important ecological services, including maintenance of biodiversity and nursery grounds for many fish species of ecological and economic importance. However, human population growth has led to increased pollution, ocean warming, hypoxia, and habitat alteration that threaten ecosystem services. In this study, we used long-term datasets of fish abundance, water quality, and climatic factors to assess the threat of hypoxia and the regulating effects of climate on fish diversity and nursery conditions in Elkhorn Slough, a highly eutrophic estuary in central California (United States), which also serves as a biodiversity hot spot and critical nursery grounds for offshore fisheries in a broader region. We found that hypoxic conditions had strong negative effects on extent of suitable fish habitat, fish species richness, and abundance of the two most common flatfish species, English sole (Parophrys vetulus) and speckled sanddab (Citharichthys stigmaeus). The estuary serves as an important nursery ground for English sole, making this species vulnerable to anthropogenic threats. We determined that estuarine hypoxia was associated with significant declines in English sole nursery habitat, with cascading effects on recruitment to the offshore adult population and fishery, indicating that human land use activities can indirectly affect offshore fisheries. Estuarine hypoxic conditions varied spatially and temporally and were alleviated by strengthening of El Niño conditions through indirect pathways, a consistent result in most estuaries across the northeast Pacific. These results demonstrate that changes to coastal land use and climate can fundamentally alter the diversity and functioning of coastal nurseries and their adjacent ocean ecosystems. PMID:26056293

  17. Climate mediates hypoxic stress on fish diversity and nursery function at the land-sea interface.

    Science.gov (United States)

    Hughes, Brent B; Levey, Matthew D; Fountain, Monique C; Carlisle, Aaron B; Chavez, Francisco P; Gleason, Mary G

    2015-06-30

    Coastal ecosystems provide numerous important ecological services, including maintenance of biodiversity and nursery grounds for many fish species of ecological and economic importance. However, human population growth has led to increased pollution, ocean warming, hypoxia, and habitat alteration that threaten ecosystem services. In this study, we used long-term datasets of fish abundance, water quality, and climatic factors to assess the threat of hypoxia and the regulating effects of climate on fish diversity and nursery conditions in Elkhorn Slough, a highly eutrophic estuary in central California (United States), which also serves as a biodiversity hot spot and critical nursery grounds for offshore fisheries in a broader region. We found that hypoxic conditions had strong negative effects on extent of suitable fish habitat, fish species richness, and abundance of the two most common flatfish species, English sole (Parophrys vetulus) and speckled sanddab (Citharichthys stigmaeus). The estuary serves as an important nursery ground for English sole, making this species vulnerable to anthropogenic threats. We determined that estuarine hypoxia was associated with significant declines in English sole nursery habitat, with cascading effects on recruitment to the offshore adult population and fishery, indicating that human land use activities can indirectly affect offshore fisheries. Estuarine hypoxic conditions varied spatially and temporally and were alleviated by strengthening of El Niño conditions through indirect pathways, a consistent result in most estuaries across the northeast Pacific. These results demonstrate that changes to coastal land use and climate can fundamentally alter the diversity and functioning of coastal nurseries and their adjacent ocean ecosystems.

  18. Monthly Levels and Criteria Considerations of Nutrient, pH, Alkalinity and Ionic Variables in Runoff Containment Basins in Ornamental Plant Nurseries.

    Science.gov (United States)

    Triplicate water samples were collected monthly from 9 waterways (8 recycling containment basins (RCBs) and 1 stream) on 4 commercial ornamental plant nurseries from February to July, and from 1 RCB and nursery from April to October. Four RCBs, one per nursery, were actively utilized as an irrigatio...

  19. Lady Astor's Campaign for Nursery Schools in Britain, 1930-1939: Attempting to Valorize Cultural Capital in a Male-Dominated Political Field

    Science.gov (United States)

    Brehony, Kevin J.

    2009-01-01

    This article examines the work of Lady Nancy Astor (1879-1964) in campaigning for nursery education and nursery schools in Britain from the late 1920s until the Second World War. Arguably no elected politician in England at any time, including the present, has identified themselves more closely with the cause of nursery schooling in Britain.…

  20. Impact of some selected insecticides application on soil microbial respiration.

    Science.gov (United States)

    Latif, M A; Razzaque, M A; Rahman, M M

    2008-08-15

    The aim of present study was to investigate the impact of selected insecticides used for controlling brinjal shoot and fruit borer on soil microorganisms and to find out the insecticides or nontoxic to soil microorganism the impact of nine selected insecticides on soil microbial respiration was studied in the laboratory. After injection of different insecticides solutions, the soil was incubated in the laboratory at room temperature for 32 days. The amount of CO2 evolved due to soil microbial respiration was determined at 2, 4, 8, 16, 24 and 32 days of incubation. Flubendiamide, nimbicidine, lambda-cyhalothrin, abamectin and thiodicarb had stimulatory effect on microbial respiration during the initial period of incubation. Chlorpyriphos, cartap and carbosulfan had inhibitory effect on microbial respiration and cypermethrin had no remarkable effect during the early stage of incubation. The negative effect of chlorpyriphos, cartap and carbosulfan was temporary, which was disappeared after 4 days of insecticides application. No effect of the selected insecticides on soil microorganisms was observed after 24 or 32 days of incubation.

  1. Synthesis of ectomycorrhizae on northern red oak seedlings in a Michigan nursery

    Energy Technology Data Exchange (ETDEWEB)

    Dixon, R.K.; Johnson, P.S.

    1993-01-01

    Vegetative inoculum of the ectomycorrhizal fungus Suillus luteus was thoroughly mixed into fumigated nursery soil, and northern red oak seedlings of four families were evaluated one and two years after sowing for ectomycorrhizal development, growth, and nutrition. At the end of year one, treated seedlings were successfully inoculated with S. luteus, but the percentage varied significantly with family. Suillus luteus persisted on lateral roots two years following sowing. Two of four seedling families inoculated with S. luteus were significantly larger in size than control plants. These results suggest that the fungal symbiont S. luteus can be successfully introduced into nurseries and that early ectomycorrhizal development improves the growth of northern red oak seedlings.

  2. Ventilation in day-care centres and sick leave among nursery children

    DEFF Research Database (Denmark)

    Kolarik, Barbara; Andersen, Zorana Jovanovic; Ibfelt, Tobias

    2016-01-01

    ventilation in DCCs and sick leave among nursery children. Data on child sick leave within an 11 week period was obtained for 635 children attending 20 DCCs. Ventilation measurements included three proxies of ventilation: air exchange rate (ACR) measured with the decay method, ACR measured...... inverse relationship between the number of sick days and ACR measured with the decay method was found for crude and adjusted analysis, with a 12% decrease in number of sick days per 1 h(-1) increase in ACR measured with the decay method. This study suggests a relationship between sick leave among nursery...

  3. Insecticide mixtures could enhance the toxicity of insecticides in a resistant dairy population of Musca domestica L [corrected].

    Directory of Open Access Journals (Sweden)

    Hafiz Azhar Ali Khan

    Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.

  4. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  5. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  6. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation.

    Directory of Open Access Journals (Sweden)

    Luis Gustavo de Almeida

    Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.

  7. Enzymes and Inhibitors in Neonicotinoid Insecticide Metabolism

    Science.gov (United States)

    Shi, Xueyan; Dick, Ryan A.; Ford, Kevin A.; Casida, John E.

    2009-01-01

    Neonicotinoid insecticide metabolism involves considerable substrate specificity and regioselectivity of the relevant CYP450, aldehyde oxidase, and phase II enzymes. Human CYP450 recombinant enzymes carry out the following conversions: CYP3A4, 2C19 and 2B6 for thiamethoxam (TMX) to clothianidin (CLO); 3A4, 2C19 and 2A6 for CLO to desmethyl-CLO; 2C19 for TMX to desmethyl-TMX. Human liver aldehyde oxidase reduces the nitro substituent of CLO to nitroso much more rapidly than that of TMX. Imidacloprid (IMI), CLO and several of their metabolites do not give detectable N-glucuronides but 5-hydroxy-IMI, 4,5-diol-IMI and 4-hydroxy-thiacloprid are converted to O-glucuronides in vitro with mouse liver microsomes and UDP-glucuronic acid or in vivo in mice. Mouse liver cytosol with S-adenosylmethionine converts desmethyl-CLO to CLO but not desmethyl-TMX to TMX. Two organophosphorus CYP450 inhibitors partially block IMI, thiacloprid and CLO metabolism in vivo in mice, elevating the brain and liver levels of the parent compounds while reducing amounts of the hydroxylated metabolites. PMID:19391582

  8. Azobenzene Modified Imidacloprid Derivatives as Photoswitchable Insecticides: Steering Molecular Activity in a Controllable Manner

    Science.gov (United States)

    Xu, Zhiping; Shi, Lina; Jiang, Danping; Cheng, Jiagao; Shao, Xusheng; Li, Zhong

    2015-10-01

    Incorporating the photoisomerizable azobenzene into imidacloprid produced a photoswitchable insecticidal molecule as the first neonicotinoid example of remote control insecticide performance with spatiotemporal resolution. The designed photoswitchable insecticides showed distinguishable activity against Musca both in vivo and in vitro upon irradiation. Molecular docking study further suggested the binding difference of the two photoisomers. The generation of these photomediated insecticides provides novel insight into the insecticidal activity facilitating further investigation on the functions of insect nicotinic acetylcholine receptors and opens a novel way to control and study insect behavior on insecticide poisoning using light.

  9. Climate change, agricultural insecticide exposure, and risk for freshwater communities.

    Science.gov (United States)

    Kattwinkel, Mira; Kühne, Jan-Valentin; Foit, Kaarina; Liess, Matthias

    2011-09-01

    Climate change exerts direct effects on ecosystems but has additional indirect effects due to changes in agricultural practice. These include the increased use of pesticides, changes in the areas that are cultivated, and changes in the crops cultivated. It is well known that pesticides, and in particular insecticides, affect aquatic ecosystems adversely. To implement effective mitigation measures it is necessary to identify areas that are affected currently and those that will be affected in the future. As a consequence, we predicted potential exposure to insecticide (insecticide runoff potential, RP) under current conditions (1990) and under a model scenario of future climate and land use (2090) using a spatially explicit model on a continental scale, with a focus on Europe. Space-for-time substitution was used to predict future levels of insecticide application, intensity of agricultural land use, and cultivated crops. To assess the indirect effects of climate change, evaluation of the risk of insecticide exposure was based on a trait-based, climate-insensitive indicator system (SPEAR, SPEcies At Risk). To this end, RP and landscape characteristics that are relevant for the recovery of affected populations were combined to estimate the ecological risk (ER) of insecticides for freshwater communities. We predicted a strong increase in the application of, and aquatic exposure to, insecticides under the future scenario, especially in central and northern Europe. This, in turn, will result in a severe increase in ER in these regions. Hence, the proportion of stream sites adjacent to arable land that do not meet the requirements for good ecological status as defined by the EU Water Framework Directive will increase (from 33% to 39% for the EU-25 countries), in particular in the Scandinavian and Baltic countries (from 6% to 19%). Such spatially explicit mapping of risk enables the planning of adaptation and mitigation strategies including vegetated buffer strips and

  10. Slash X Honduras Caribbean pine hybrids: An overview of nursery production systems in Southeast Queensland, Australia

    Science.gov (United States)

    A. G. Baxter

    2002-01-01

    The Queensland Department of Primary Industries (DPI) Forestry has a requirement to produce 4.5 million trees per year for its plantation production program. This stock is raised at DPI Forestry nurseries in the southeast and far north of Queensland. To improve the productivity of its plantation estate, DPI Forestry has invested significant resources in the development...

  11. Colletotrichum fungal pathogens and symbionts of ornamental nursery and landscape plants

    Science.gov (United States)

    Fungi in the ascomycete genus Colletotrichum are ranked by the plant pathology community as one of the ten most economically and scientifically important fungal phytopathogens. Major losses due to Colletotrichum are experienced in almost every crop worldwide, including nursery and landscape plants ...

  12. Advance innovations of an intelligent sprayer for nursery and fruit tree crops

    Science.gov (United States)

    Conventional spray application technology requires excessive amounts of pesticide use to achieve effective pest control in floral, nursery, and other specialty crop productions. This onerous challenge is now overcome by our newly developed automated variable-rate, air-assisted precision sprayer. Thi...

  13. Root Rot Disease of Five Fruit Tree Seedlings in the Nursery ...

    African Journals Online (AJOL)

    The incidence of root rot disease in the nursery of Chrysophyllum albidun Dacryodes edulis, persea Americana, Irvingia gabonensis and Annona muricala was assessed. Ten fungal pathogen were isolated using serial dilution and pathogenicity tests were carried out on the 5 fruit trees with the 10 isolated fungi. The 5 fruit ...

  14. Subirrigation for production of native plants in nurseries - concepts, current knowledge, and implementation

    Science.gov (United States)

    Justin L. Schmal; Kas Dumroese; Anthony S. Davis; Jeremy Pinto; Douglass F. Jacobs

    2011-01-01

    Subirrigation, a method whereby water is allowed to move upward into the growing medium by capillary action, has been the focus of recent research in forest and conservation nurseries growing a wide variety of native plants. Subirrigation reduces the amount of water needed for producing high-quality plants, discharged wastewater, and leaching of nutrients compared with...

  15. root rot disease of five fruit tree seedlings in the nursery

    African Journals Online (AJOL)

    KAMALDEEN

    on them. Our experience in the nursery in Port Harcourt had been that many tree species of the tropical region are susceptible to root rot diseases of fungal origin. The fungal invasion of the succulent root tissues causes the young tree seedlings to dieback; their leaves becomes discoloured, wilted and eventually dead.

  16. Exponential Nutrient Loading as a Means to Optimize Bareroot Nursery Fertility of Oak Species

    Science.gov (United States)

    Zonda K. D. Birge; Douglass F. Jacobs; Francis K. Salifu

    2006-01-01

    Conventional fertilization in nursery culture of hardwoods may involve supply of equal fertilizer doses at regularly spaced intervals during the growing season, which may create a surplus of available nutrients in the beginning and a deficiency in nutrient availability by the end of the growing season. A method of fertilization termed “exponential nutrient loading” has...

  17. What's new with nurseries and reforestation projects at the Missoula Technology and Development Center?

    Science.gov (United States)

    Bob Simonson

    2011-01-01

    The USDA Forest Service Missoula Technology and Development Center (MTDC) offers technical expertise, technology transfer, and new equipment development to federal, state, and private forest nurseries. Current and recently completed projects at MTDC include a front and mid-mount tractor evaluation, ATV-pulled mechanical tree planter, greenhouse snow remover, freeze...

  18. Pathways of spread of Phytophthora ramorum in a simulated nursery setting: an update

    Science.gov (United States)

    Kurt Heungens; Bjorn Gehesqui& egrave; re; Kris Van Poucke; Annelies Vercauteren; Martine. Maes

    2013-01-01

    European phytosanitary measures as applied to nurseries require that potential host plants within a radius of 2 m of a Phytophthora ramorum-infected plant must be destroyed and that remaining host plants within a radius of 10 m cannot be traded until they are inspected and found to be pest free at further specific inspections. Despite the wide...

  19. Effect of fertilization and irrigation on nursery production of hydrangea using alternative containers

    Science.gov (United States)

    Container production of nursery plants using biodegradable containers has been studied in recent years as a sustainable alternative to traditional plastic containers. Plant growth and photosynthetic performance of Hydrangea macrophylla ‘Merritt’s Supreme’ were investigated in this study when they we...

  20. Performance evaluation of a newly developed variable rate sprayer for nursery liner applications

    Science.gov (United States)

    An experimental variable-rate sprayer designed for liner applications was tested by comparing its spray deposit, coverage, and droplet density inside canopies of six nursery liner varieties with constant-rate applications. Spray samplers, including water sensitive papers (WSP) and nylon screens, wer...

  1. Mosaic Stunting in jack pine seedlings in a northern Michigan bareroot nursery

    Science.gov (United States)

    Lynette Potvin; R. Kasten Dumroese; Martin F. Jurgensen; Dana Richter

    2010-01-01

    Mosaic, or patchy, stunting of bareroot conifer seedlings is thought to be caused by deficiencies of mycorrhizal fungi following fumigation, resulting in reduced nutrient uptake, particularly phosphorus. Mosaic stunting of jack pine (Pinus banksiana) seedlings was observed in 2005 at the USDA Forest Service JW Toumey Nursery in Watersmeet, MI. We initiated a study to...

  2. Pelleted biochar: chemical and physical properties show potential use as a substrate in container nurseries

    Science.gov (United States)

    R. Kasten Dumroese; Juha Heiskanen; Karl Englund; Arja Tervahauta

    2011-01-01

    We found that peat moss, amended with various ratios of pellets comprised of equal proportions of biochar and wood flour, generally had chemical and physical properties suitable for service as a substrate during nursery production of plants. High ratios of pellets to peat (>50%) may be less desirable because of high C:N, high bulk density, swelling associated with...

  3. Nursery cultural practices to achieve targets: A case study in western larch irrigation

    Science.gov (United States)

    Anthony S. Davis; Robert F. Keefe

    2011-01-01

    Nursery cultural practices are used to help growers achieve pre-determined size and physiological targets for seedlings. In that regard, irrigation is used to accelerate or slow growth and as a trigger for changing growth phase. In a case study highlighting the effects of irrigation on seedling development, western larch (Larix occidentalis Nutt.) seedlings were grown...

  4. Assessment of the Psychosocial Development of Children Attending Nursery Schools in Karen Refugee Camps in Thailand

    Science.gov (United States)

    Tanaka, Akiko

    2013-01-01

    The Karen, an ethnic minority group in Burma, have experienced a prolonged state of exile in refugee camps in neighboring Thailand because of ethnic conflict in their home country. Nursery schools in the three largest Karen refugee camps aim to promote the psychosocial development of young children by providing a child-centered, creative,…

  5. Recognizing Politics in the Nursery: Early Childhood Education Institutions as Sites of Mundane Politics

    Science.gov (United States)

    Millei, Zsuzsa; Kallio, Kirsi Pauliina

    2018-01-01

    In his inspirational article titled 'Bringing politics into the nursery', Peter Moss argues for early childhood institutions to "become" places of 'democratic political practice'. In this article, the authors add to Moss's call and argue that these institutions are sites of 'mundane political practice', containing various attitudinal…

  6. Detection and control of Fusarium oxysporum and Cylindrocarpon destructans in forest nursery soils

    Science.gov (United States)

    Catherine Crosby; Lynne Carpenter-Boggs; Stewart Higgins; Nabil Khadduri

    2010-01-01

    Fusarium oxysporum and Cylindrocarpon destructans cause root disease that leads to significant crop losses in forest nurseries when not treated. Treatment currently relies on methyl bromide fumigation to eradicate soil pathogens. New environmental protection laws, however, are phasing out methyl bromide. Alternative chemical treatments are being tested, as well as...

  7. Impact of Copper Sulfate on Plankton in Channel Catfish Nursery Ponds

    Science.gov (United States)

    Many fish culturists are interested in applying copper sulfate pentahydrate (CSP) to channel catfish, Ictalurus punctatus, nursery ponds as a prophylactic treatment for trematode infection and proliferative gill disease by killing snails and Dero sp., respectively, before stocking fry. However, copp...

  8. Oxyfluorfen strongly affects Larix occidentalis but minimally affects Sagina procumbens in a bareroot nursery

    Science.gov (United States)

    R. Kasten Dumroese; Jasmine L. Williams; Jeremy R. Pinto; Peng Zhang

    2014-01-01

    Our objective was to evaluate oxyfluorfen for control of birdseye pearlwort (Sagina procumbens L.) in a bareroot nursery crop of western larch (Larix occidentalis Nutt.) seedlings. Oxyfluorfen applied at rates up to 0.56 kg a.i./ha in a split-plot experiment with combinations and frequencies of pre- and postemergence sprays gave minimal control of birdseye pearlwort....

  9. Digestibility of energy and lipids and oxidative stress in nursery pigs fed commercially available lipids

    Science.gov (United States)

    An experiment was conducted to evaluate the impact of lipid source on GE and ether extract (EE) digestibility, oxidative stress, and gut integrity in nursery pigs fed diets containing 10% of soybean oil (SO), choice white grease (CWG), palm oil (PO), or 2 different distillers corn oils (DCO-1 and DC...

  10. Inoculation of fumigated nursery beds and containers with arbuscular mycorrhizal products for eastern redcedar production

    Science.gov (United States)

    Michelle M. Cram; Stephen W. Fraedrich

    2015-01-01

    Commercially available arbuscular mycorrhizal (AM) products were applied at an operational rate to eastern redcedar (Juniperus virginiana L.) nursery beds and containers to evaluate seedling growth and colonization responses. A field study at the Augusta Forestry Center in Crimora, VA, and a companion container study were initiated in the fall of 2012. MycoApply® Endo...

  11. Weed and Pathogen Control with Reduced Methyl Bromide Rates in Open Field Nurseries

    Science.gov (United States)

    Producers of nursery stock in California rely on preplant soil fumigation to meet requirements for nematode free planting stock. Certified clean stock is essential for successful establishment and future productivity of new orchards and vineyards and is a requirement for intra- and interstate as ...

  12. Assessment of the BTEX concentrations and health risk in urban nursery schools in Gliwice, Poland

    Directory of Open Access Journals (Sweden)

    Anna Mainka

    2016-12-01

    Full Text Available Indoor air quality (IAQ in nursery school is believed to be different from elementary school. Moreover, younger children are more vulnerable to air pollution than higher grade children because they spend more time indoors, and their immune systems and bodies are less mature. The purpose of this study was to compare the concentrations of the monoaromatic volatile benzene, toluene, ethylbenzene m,p-xylene and o-xylene (BTEX in urban nursery schools located in Gliwice, Poland. The nursery schools were chosen to include areas with different urbanization and traffic density characteristics in order to gather a more diverse picture of exposure risks in the various regions of the city. BTEX were sampled during winter and spring seasons in older and younger children classrooms. The samples were thermally desorbed (TD and then analyzed with use of gas chromatography (GC. In addition, outdoor measurements were carried out in the playground at each nursery school. BTEX quantification, indoor/outdoor concentration, and correlation coefficients were used to identify pollutant sources. Elevated levels of o-xylene and ethylbenzene were found in all monitored classrooms during the winter season. Outdoor concentrations were lower than indoors for each classroom. Indicators based on health risk assessment for chronic health effects associated with carcinogenic benzene or non-carcinogenic BTEX were proposed to rank sites according to their hazard level.

  13. The Case Against Using Organic Fertilizers in Channel Catfish Ictalurus punctatus Nursery Ponds

    Science.gov (United States)

    This paper reviews the assumed advantages and disadvantages of organic fertilizers and presents the case that the risks outweigh the benefits for channel catfish, Ictalurus punctatus, nursery pond fertilization. Under certain conditions, organic fertilizers may be beneficial to provide forage for z...

  14. External Genital Abnormalities and Inguinal Hernia among Males of Children Nurseries, North West of Iran

    Directory of Open Access Journals (Sweden)

    Hossein Haratipour

    2016-02-01

    Full Text Available Background Abnormalities of external genitalia in male children nurseries and inguinal hernia are the most common congenital disorders in children. We aimed to determine prevalence rate of inguinal hernia and other genital among children nurseries, in Shahrood-Iran. Materials and Methods In this descriptive cross-sectional study, we examined 920 children nurseries boys. Physical examination of children was performed in presence of a parent in a warm room in supine and upright position with and without Valsalva maneuver. A written consent was obtained from parents before examination. Past medical history and history of surgery on inguinal and genital area was taken. Examination was performed 2 interns who were trained about genital system examination.   Results A total of 920 children nurseries boys aged 3 to 6 years were examined which were detected in 88 children and prevalence rate of these abnormalities were 9.6%. The prevalence of abnormalities in the children under study were as follows: Inguinal hernia (5.1%, cryptorchidism (2.1%, Hydrocele (1.5%, hypospadias (0.4%, Varicocele (0.1%, micropenis (0.4%. Conclusion Regarding to relatively high prevalence rate of these abnormalities and low level of people knowledge, seem screening systems for diagnosis and appropriate treatment of these abnormalities to be necessary.

  15. Atlantic Cod (Gadus morhua benefits from the availability of seagrass (Zostera marina nursery habitat

    Directory of Open Access Journals (Sweden)

    Richard J. Lilley

    2014-12-01

    Full Text Available The Atlantic cod (Gadus morhua is a species of significant economic and historic importance but infamous for its decline. Apart from overfishing, the causes of this decline and its subsequent lack of recovery remain largely unresolved. Indeed, the degree to which specific habitats are important for this species remains unquantified at the scale of North Atlantic. Here, the literature on the role of eelgrass meadows (Zostera marina as valuable nursery habitat for the Atlantic cod is reviewed and synthesized. Evidence is presented on relative densities of Atlantic cod in shallow water environments and in eelgrass meadows in comparison to alternative habitats. In addition, evidence pertaining to the ’viability gains’ attributed to the use of eelgrass meadows as nursery habitat (growth and survival by juvenile Atlantic cod is analyzed. Although juvenile Atlantic cod use of Z. marina is found to be facultative, when possible, available literatures indicates that they may select Z. marina as a nursery habitat where they are found in high density (average of at least 246 ha−1. From their use of Z. marina habitat the juvenile Atlantic cod receives viability benefits from it, improving their chances of reaching maturation. This paper provides strong evidence that eelgrass meadows are of significant importance to contributing to Atlantic cod stocks. Keywords: Zostera marina, Eelgrass, Gadus morhua, Fisheries, Juveniles, Nursery habitat

  16. Gender Associations for Musical Instruments in Nursery Children: The Effect of Sound and Image

    Science.gov (United States)

    Marshall, Nigel; Shibazaki, Kagari

    2013-01-01

    This paper reports on the results of a study carried out with 105 children, aged between three and four years in three nursery units in London and Surrey, UK. The aim of this study was to explore the level of association which young children have between various musical instruments, musical styles and a particular gender. However, we also aimed to…

  17. Overt and Relational Aggression in Russian Nursery-School-Age Children: Parenting Style and Marital Linkages.

    Science.gov (United States)

    Hart, Craig H.; Nelson, David A.; Robinson, Clyde C.; Olsen, Susanne Frost; McNeilly-Choque, Mary Kay

    1998-01-01

    Maternal and paternal parenting styles and marital interactions linked to childhood aggressive behavior in Western psychological literature were measured in 207 ethnic Russian families of nursery-school-age children. Results corroborated and extended findings from Western samples. Greater marital conflict (for boys only), greater maternal…

  18. Introduction of filtration systems in container nurseries for nonchemical elimination of Phytophthora spp. from irrigation water

    Science.gov (United States)

    Thorsten Ufer; Heinrich Beltz; Thomas Brand; Katrin Kaminski; Ralf Lüttmann; Martin Posner; Stefan Wagner; Sabine Werres; Hans-Peter Wessels

    2006-01-01

    In a 3-year project the elimination of Phytophthora spp. from the recirculation water with different kinds of filtration systems will be tested under commercial conditions in container nurseries. First results indicate that the filtration systems eliminate Phytophthora spp. from the water.

  19. Effects of Greenhouse Conditions on the Quality and Vase Life of Freesia 'Yvonne'. A Nursery Comparison

    NARCIS (Netherlands)

    Slootweg, G.

    2005-01-01

    Postharvest trials showed marked differences in the length of vase life and in bud opening of Freesia stems of the same cultivar, obtained at a similar time from various nurseries. The factors that cause these differences in vase life and bud opening are yet unknown. We therefore made a detailed

  20. Recommended industry best management practices for the prevention of Phytophthora ramorum introduction in nursery operations

    Science.gov (United States)

    Karen Suslow

    2008-01-01

    The following industry recommended best management practices (BMPs), designed for growers and/or interstate shippers of host and associated host plants of Phytophthora ramorum, consists of biosecurity guidelines created by and for nursery growers in order to reduce the risks associated with P. ramorum. The control of P....

  1. Chemical control of Phytophthora ramorum causing foliar disease in hardy nursery stock in the United Kingdom

    Science.gov (United States)

    Judith Turner; Philip Jennings; Sam McDonough; Debbie Liddell; Jackie Stonehouse

    2006-01-01

    A range of fungicides have been tested for activity against P. ramorum using both in vitro and in vivo tests. All fungicides had proven activity against Phytophthora species and either had full approval for use on hardy ornamental nursery stock in the United Kingdom, or could be used under the Revised Long Term Arrangements for Extension of Use (2002...

  2. Report of the 2016 Uniform Regional Scab Nursery for spring wheat parents

    Science.gov (United States)

    The Uniform Regional Scab Nursery for Spring Wheat Parents (URSN) was grown for the 21st year in 2016. Five locations (Brookings, SD, St. Paul and Crookston, MN, Prosper, ND, and Morden, Canada) reported results. A total of 33 entries was included in the 2016 URSN, in addition to the resistant chec...

  3. Issues in the Development of Children's Centres on Nursery and Primary School Sites

    Science.gov (United States)

    Lewis, Jane; Finnegan, Cathy; West, Anne

    2011-01-01

    This paper explores the development of children's centres in England between 2004 and 2008, focusing on the newly created centres that have been located on primary and nursery school sites. Using both an analysis of policy documents and interview data from three urban local authorities, we examine the use of premises and the differing priorities…

  4. "Row, Row, Row Your Boat": Singing, Identity and Belonging in a Nursery

    Science.gov (United States)

    Niland, Amanda

    2015-01-01

    The concept of belonging is widely recognised as a fundamental part of human development and a key element of early childhood curricula. The research presented here explores the role of singing in the development of children's sense of belonging in a day nursery for children aged from six months to two years. The research design incorporated…

  5. Study on radon concentration in nursery school in the mining region

    International Nuclear Information System (INIS)

    Skowronek, J.; Wysocka, M.; Mielnikow, A.

    1999-01-01

    Study on children exposure from natural radon background has been performed on the example of nursery schools being localized in Piekary Slaskie in the coal mining region of Silesia. Indoor air contamination has been measured as well as soil air and air outside the houses. In none of examined places the exposure do not exceeded the IAEA acceptable level

  6. Transformation and Regulation: A Century of Continuity in Nursery School and Welfare Policy Rhetoric

    Science.gov (United States)

    Read, Jane

    2015-01-01

    This article explores policy development for under-fives and its implementation in nursery schools in the first two decades of the twentieth century and draws parallels with current policy initiatives such as Sure Start and the "Troubled Families" programme. It interrogates how discourse on British racial health shaped policy and…

  7. Playful and Creative ICT Pedagogical Framing: A Nursery School Case Study

    Science.gov (United States)

    Roberts-Holmes, Guy

    2014-01-01

    This article reports on the findings of a one-year qualitative study in which a nursery school used information and communication technology (ICT) and a digital media consultant as a catalyst for cultural change leading to teachers' improved pedagogical framing and children's enhanced learning dispositions. The pedagogic framing included the…

  8. Combining Technical Competence and Stakeholder Impact in Environmental Education: The Gambia All Schools Nursery Competition

    Science.gov (United States)

    Paulete, Francisca E.; Orr, Blair

    2010-01-01

    Under the guidance of the Department of Forestry, the Regional Education Directorate, and Peace Corps/The Gambia, the Gambia All Schools Tree Nursery Competition, an environmental education program, was developed to introduce practical environmental education in The Gambia. Data for this report were collected using a rapid appraisal approach.…

  9. Giants in the Nursery: A Biographical History of Developmentally Appropriate Practice

    Science.gov (United States)

    Elkind, David

    2015-01-01

    "Giants in the Nursery" examines the evolution of developmentally appropriate practice in this biographical history of early childhood education. This book, from David Elkind, explores the theory's progression--from its beginnings in writings of sixteenth- and seventeenth-century philosophers, its experimental implementation by…

  10. Emotion in Nursery Work: Work Discussion as a Model of Critical Professional Reflection

    Science.gov (United States)

    Elfer, Peter

    2012-01-01

    The importance of attention to children's emotions has been emphasised widely in early care and education research and policy. Enabling such attention has been seen as achieved primarily through attachment interactions with nursery staff. However, there is increasing awareness that facilitating such interactions in a way that is optimal for…

  11. Pilot Study on Kindergarten Teachers' Perception of Linguistic and Musical Challenges in Nursery Rhymes

    Science.gov (United States)

    Lefebvre, Pascal; Bolduc, Jonathan; Pirkenne, Christel

    2015-01-01

    Nursery rhymes provide a unique learning context for preschoolers in regard to their emergent literacy and musical development. According to Vygotsky's social constructivist theory (1978), in order for learning to occur, children must face challenges, and adults must provide support to guide them toward mastery of new skills. The current pilot…

  12. An Early Start: WPA Emergency Nursery Schools in Texas, 1934-1943

    Science.gov (United States)

    Burlbaw, Lynn Matthew

    2009-01-01

    This paper begins with an overview of the location and types of nursery schools reported to be operating in Texas between 1934 and 1943. The author reports on the results of the analysis of the photographs used in this study. The analysis is supported and contextualized by the use of references from federal documents and other publications…

  13. Technology Use in Nursery and Primary Education in Two Different Settings

    Science.gov (United States)

    Bueno Alastuey, Mª Camino; García Laborda, Jesús

    2016-01-01

    This article studies which and how Information and Communications Technologies (ICTs) are used by nursery and primary education in-service teachers as reported by their pre-service teacher trainees after observations in their practicum in two provinces in Spain, Alcalá de Henares-Guadalajara and Navarre. Results indicate that in-service teachers…

  14. Effectiveness of Special Nursery Provision for Children with Autism Spectrum Disorders

    Science.gov (United States)

    Reed, Phil; Osborne, Lisa A.; Corness, Mark

    2010-01-01

    The effectiveness of three local authority early teaching interventions for children with autism spectrum disorders (ASDs) was studied. Thirty-three children (2:6 to 4:0 years old) received one of three early teaching interventions: a 1:1 home-based programme, and two different forms of special nursery placement. Measures from the…

  15. Using polymer-coated controlled-release fertilizers in the nursery and after outplanting

    Science.gov (United States)

    Thomas D. Landis; R. Kasten Dumroese

    2009-01-01

    Controlled-release fertilizers (CRF) are the newest and most technically advanced way of supplying mineral nutrients to nursery crops. Compared to conventional fertilizers, their gradual pattern of nutrient release better meets plant needs, minimizes leaching, and therefore improves fertilizer use efficiency. In our review of the literature, we found many terms used...

  16. Compost and vermicompost as nursery pot components: effects on tomato plant growth and morphology

    Energy Technology Data Exchange (ETDEWEB)

    Lazcano, C.; Arnold, J.; Tato, A.; Zaller, J. G.; Dominguez, J.

    2009-07-01

    Abstract Post transplant success after nursery stage is strongly influenced by plant morphology. Cultural practices strongly shape plant morphology, and substrate choice is one of the most determining factors. Peat is the most often used amendment in commercial potting substrates, involving the exploitation of non-renewable resources and the degradation of highly valuable peatland ecosystems and therefore alternative substrates are required. Here the feasibility of replacing peat by compost or vermicompost for the production of tomato plants in nurseries was investigated through the study of the effect of increasing proportions of these substrates (0%, 10%, 20%, 50%, 75% and 100%) in target plant growth and morphological features, indicators of adequate post-transplant growth and yield. Compost and vermicompost showed to be adequate substrates for tomato plant growth. Total replacement of peat by vermicompost was possible while doses of compost higher than 50% caused plant mortality. Low doses of compost (10 and 20%) and high doses of vermicompost produced significant increases in aerial and root biomass of the tomato plants. In addition these treatments improved significantly plant morphology (higher number of leaves and leaf area, and increased root volume and branching). The use of compost and vermicompost constitute an attractive alternative to the use of peat in plant nurseries due to the environmental benefits involved but also due to the observed improvement in plant quality. Additional key words: peat moss, plant nursery, soil-less substrate, Solanum lycopersicum L. (Author) 37 refs.

  17. Factor Analysis of Temperament Category Scores in a Sample of Nursery School Children.

    Science.gov (United States)

    Simonds, John F.; Simonds, M. Patricia

    1982-01-01

    Mothers of children attending nursery schools completed the Behavior Style Questionnaire (BSQ) from which scores for nine temperament categories were derived. Found membership in groups based on factor scores independent of sex, socioeconomic class, age but not ordinal birth position. (Author)

  18. The Container Tree Nursery Manual: Volume 7, Seedling processing, storage, and outplanting

    Science.gov (United States)

    Thomas D. Landis; R. Kasten Dumroese; Diane L. Haase

    2010-01-01

    This manual is based on the best current knowledge of container nursery management and should be used as a general reference. Recommendations were made using the best information available at the time and are, therefore, subject to revision as more knowledge becomes available. Much of the information in this manual was primarily developed from information on growing...

  19. Nursery response of container Pinus palustris seedlings to nitrogen supply and subsequent effects on outplanting performance

    Science.gov (United States)

    D. Paul Jackson; R. Kasten Dumroese; James P. Barnett

    2012-01-01

    Container longleaf pine (Pinus palustris) seedlings often survive and grow better after outplanting than bareroot seedlings. Because of this, most longleaf pine are now produced in containers. Little is known about nursery fertilization effects on the quality of container longleaf pine seedlings and how that influences outplanting performance. We compared various...

  20. Management of nursery practices for efficient ectomycorrhizal fungi application in the production of Quercus ilex

    Czech Academy of Sciences Publication Activity Database

    Oliveira, R. S.; Franco, A. R.; Vosátka, Miroslav; Castro, P. M. L.

    2010-01-01

    Roč. 52, 2-3 (2010), s. 125-131 ISSN 0334-5114 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : forest nursery inoculation * improved plant growht * holm oak Subject RIV: EF - Botanics Impact factor: 1.442, year: 2010

  1. Effects of Nursery Pro-Conditioning on Panicum hemitomon and Sagittaria lancifolia Used for Wetland Restoration

    Science.gov (United States)

    S.R. Pezeshki; P.H. Anderson; R.D. DeLaune

    2000-01-01

    A study was conducted to examine nursery protocols for production of planting stocks used in wetland mitigation projects. Two commercial soil mixtures were tested along with waterlogging, fertilization, and combination treatments. Two marsh species, Punicum hemitomon and Sagittaria lancifolia, were subjected to a two-phase study. During Phase I, watering and...

  2. Tree seed handling, processing, testing, and storage at Hayward State Nursery, Wisconsin Department of Natural Resources

    Science.gov (United States)

    Gordon Christians

    2008-01-01

    The Hayward State Nursery, Wisconsin grows more than 40 species from seeds. Up to 6000 bushels of raw unprocessed tree and shrub seeds are collected each year, and all seeds are collected in Wisconsin or adjacent states. All white spruce (Picea glauca) and some white pine seeds (Pinus strobus) are collected from orchards containing...

  3. Promotion of Preventive Measures in Public Nursery Schools: Lessons From the H1N1 Pandemic.

    Science.gov (United States)

    Michail, Koralia A; Ioannidou, Christina; Galanis, Petros; Tsoumakas, Kostantinos; Pavlopoulou, Ioanna D

    2017-09-01

    Nursery schools serve as reservoirs of transmission of infectious diseases, and teachers should be able to implement and monitor hygiene measures to prevent them. The aim of the present study was to assess the compliance of nursery school teachers on promoting preventive interventions and to identify associated factors, during the novel H1N1 influenza pandemic. A secondary objective was to evaluate their knowledge and vaccination status regarding the novel virus. A cross-sectional study was performed, with the use of a predesigned anonymous, questionnaire, and distributed to all public nursery teachers of Athens, Greece. General etiquette practices were highly acceptable to over 92% of teachers. Those with longer teaching experience promoted simple preventive measures, such as hand washing and use of hand sanitizer, more often while older children were more likely to familiarize with them. However, teachers presented inadequate knowledge concerning the novel virus and their vaccination rates with the pandemic vaccine were unacceptably low (1.1%). Our study showed that promotion of simple preventive measures is feasible and may contribute to the prevention of outbreaks in nursery schools, although knowledge gaps and fear concerning the pandemic vaccine highlight communication issues.

  4. Establishment of northern red oak genetic tests with nursery-graded seedlings

    Science.gov (United States)

    S. A. Lay; M. A. Remaley; S. E. Schlarbaum; P. P. Kormanik; T. Tibbs; R. A. Cox; T. LaFarge; A. M. Saxton

    1997-01-01

    Artificial regeneration of northern red oak (Quercus rubra L.) has had variable success over time. Current nursery practices generally involve the growth of seedlings to a standardized height and form with little regard to seed source, seedling quality, or subsequent field performance. Additionally, there is not an accepted culling criteria for...

  5. A systems approach for detecting sources of Phytophthora contamination in nurseries

    Science.gov (United States)

    Jennifer L. Parke; Niklaus Grünwald; Carrie Lewis; Val Fieland

    2010-01-01

    Nursery plants are also important long-distance vectors of non-indigenous pathogens such as P. ramorum and P. kernoviae. Pre-shipment inspections have not been adequate to ensure that shipped plants are free from Phytophthora, nor has this method informed growers about sources of contamination in their...

  6. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  7. Insecticide mixtures for mosquito net impregnation against malaria vectors

    Directory of Open Access Journals (Sweden)

    Corbel V.

    2002-09-01

    Full Text Available Insecticides belonging to the pyrethroid family are the only compounds currently available for the treatment of mosquito nets. Unfortunately, some malaria vector species have developed resistance to pyrethroids and the lack of alternative chemical categories is a great concern. One strategy for resistance management would be to treat mosquito nets with a mixture associating two insecticides having different modes of action. This study presents the results obtained with insecticide mixtures containing several proportions of bifenthrin (a pyrethroid insecticide and carbosulfan (a carbamate insecticide. The mixtures were sprayed on mosquito net samples and their efficacy were tested against a susceptible strain of Anopheles gambiae, the major malaria vector in Africa. A significant synergism was observed with a mixture containing 25 mg/m2 of bifenthrin (half the recommended dosage for treated nets and 6.25 mg/m2 of carbosulfan (about 2 % of the recommended dosage. The observed mortality was significantly more than expected in the absence of any interaction (80 % vs 41 % and the knock-down effect was maintained, providing an effective barrier against susceptible mosquitoes.

  8. Mass spectrometric analyses of organophosphate insecticide oxon protein adducts.

    Science.gov (United States)

    Thompson, Charles M; Prins, John M; George, Kathleen M

    2010-01-01

    Organophosphate (OP) insecticides continue to be used to control insect pests. Acute and chronic exposures to OP insecticides have been documented to cause adverse health effects, but few OP-adducted proteins have been correlated with these illnesses at the molecular level. Our aim was to review the literature covering the current state of the art in mass spectrometry (MS) used to identify OP protein biomarkers. We identified general and specific research reports related to OP insecticides, OP toxicity, OP structure, and protein MS by searching PubMed and Chemical Abstracts for articles published before December 2008. A number of OP-based insecticides share common structural elements that result in predictable OP-protein adducts. The resultant OP-protein adducts show an increase in molecular mass that can be identified by MS and correlated with the OP agent. Customized OP-containing probes have also been used to tag and identify protein targets that can be identified by MS. MS is a useful and emerging tool for the identification of proteins that are modified by activated organophosphate insecticides. MS can characterize the structure of the OP adduct and also the specific amino acid residue that forms the key bond with the OP. Each protein that is modified in a unique way by an OP represents a unique molecular biomarker that with further research can lead to new correlations with exposure.

  9. Insecticides promote viral outbreaks by altering herbivore competition.

    Science.gov (United States)

    Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun

    2015-09-01

    While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.

  10. The global status of insect resistance to neonicotinoid insecticides.

    Science.gov (United States)

    Bass, Chris; Denholm, Ian; Williamson, Martin S; Nauen, Ralf

    2015-06-01

    The first neonicotinoid insecticide, imidacloprid, was launched in 1991. Today this class of insecticides comprises at least seven major compounds with a market share of more than 25% of total global insecticide sales. Neonicotinoid insecticides are highly selective agonists of insect nicotinic acetylcholine receptors and provide farmers with invaluable, highly effective tools against some of the world's most destructive crop pests. These include sucking pests such as aphids, whiteflies, and planthoppers, and also some coleopteran, dipteran and lepidopteran species. Although many insect species are still successfully controlled by neonicotinoids, their popularity has imposed a mounting selection pressure for resistance, and in several species resistance has now reached levels that compromise the efficacy of these insecticides. Research to understand the molecular basis of neonicotinoid resistance has revealed both target-site and metabolic mechanisms conferring resistance. For target-site resistance, field-evolved mutations have only been characterized in two aphid species. Metabolic resistance appears much more common, with the enhanced expression of one or more cytochrome P450s frequently reported in resistant strains. Despite the current scale of resistance, neonicotinoids remain a major component of many pest control programmes, and resistance management strategies, based on mode of action rotation, are of crucial importance in preventing resistance becoming more widespread. In this review we summarize the current status of neonicotinoid resistance, the biochemical and molecular mechanisms involved, and the implications for resistance management. Copyright © 2015 Elsevier Inc. All rights reserved.

  11. Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives

    Directory of Open Access Journals (Sweden)

    Binh Cao Quan Nguyen

    2015-09-01

    Full Text Available Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively. Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively with 50%–60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C5-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.

  12. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; br, picanco@ufv; br, guedes@ufv; br, mateusc3@yahoo com; br, agronomiasilva@yahoo com

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  13. Plant compounds insecticide activity against Coleoptera pests of stored products

    International Nuclear Information System (INIS)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio; julioufv@yahoo.com.br

    2007-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD 50 from 2.72 to 39.71 mg g -1 a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  14. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  15. Carbon isotopes in otolith amino acids identify residency of juvenile snapper (Family: Lutjanidae) in coastal nurseries

    KAUST Repository

    McMahon, Kelton

    2011-08-26

    This study explored the potential for otolith geochemistry in snapper (Family: Lutjanidae) to identify residency in juvenile nursery habitats with distinctive carbon isotope values. Conventional bulk otolith and muscle stable isotope analyses (SIA) and essential amino acid (AA) SIA were conducted on snapper collected from seagrass beds, mangroves, and coral reefs in the Red Sea, Caribbean Sea, and Pacific coast of Panama. While bulk stable isotope values in otoliths showed regional differences, they failed to distinguish nursery residence on local scales. Essential AA δ13C values in otoliths, on the other hand, varied as a function of habitat type and provided a better tracer of residence in different juvenile nursery habitats than conventional bulk otolith SIA alone. A strong linear relationship was found between paired otolith and muscle essential AA δ13C values regardless of species, geographic region, or habitat type, indicating that otolith AAs recorded the same dietary information as muscle AAs. Juvenile snapper in the Red Sea sheltered in mangroves but fed in seagrass beds, while snapper from the Caribbean Sea and Pacific coast of Panama showed greater reliance on mangrove-derived carbon. Furthermore, compound-specific SIA revealed that microbially recycled detrital carbon, not water-column-based new phytoplankton carbon, was the primary carbon source supporting snapper production on coastal reefs of the Red Sea. This study presented robust tracers of juvenile nursery residence that will be crucial for reconstructing ontogenetic migration patterns of fishes among coastal wetlands and coral reefs. This information is key to determining the importance of nursery habitats to coral reef fish populations and will provide valuable scientific support for the design of networked marine-protected areas. © 2011 Springer-Verlag.

  16. Carbon isotopes in otolith amino acids identify residency of juvenile snapper (Family: Lutjanidae) in coastal nurseries

    KAUST Repository

    McMahon, Kelton; Berumen, Michael L.; Mateo, Ivan; Elsdon, Travis S.; Thorrold, Simon R.

    2011-01-01

    This study explored the potential for otolith geochemistry in snapper (Family: Lutjanidae) to identify residency in juvenile nursery habitats with distinctive carbon isotope values. Conventional bulk otolith and muscle stable isotope analyses (SIA) and essential amino acid (AA) SIA were conducted on snapper collected from seagrass beds, mangroves, and coral reefs in the Red Sea, Caribbean Sea, and Pacific coast of Panama. While bulk stable isotope values in otoliths showed regional differences, they failed to distinguish nursery residence on local scales. Essential AA δ13C values in otoliths, on the other hand, varied as a function of habitat type and provided a better tracer of residence in different juvenile nursery habitats than conventional bulk otolith SIA alone. A strong linear relationship was found between paired otolith and muscle essential AA δ13C values regardless of species, geographic region, or habitat type, indicating that otolith AAs recorded the same dietary information as muscle AAs. Juvenile snapper in the Red Sea sheltered in mangroves but fed in seagrass beds, while snapper from the Caribbean Sea and Pacific coast of Panama showed greater reliance on mangrove-derived carbon. Furthermore, compound-specific SIA revealed that microbially recycled detrital carbon, not water-column-based new phytoplankton carbon, was the primary carbon source supporting snapper production on coastal reefs of the Red Sea. This study presented robust tracers of juvenile nursery residence that will be crucial for reconstructing ontogenetic migration patterns of fishes among coastal wetlands and coral reefs. This information is key to determining the importance of nursery habitats to coral reef fish populations and will provide valuable scientific support for the design of networked marine-protected areas. © 2011 Springer-Verlag.

  17. NURSERY ENGLISH” IN THE LIGHT OF UNIVERSAL LANGUAGE TENDENCIES

    Directory of Open Access Journals (Sweden)

    Skrebneva Tamara Grigoryevna

    2014-11-01

    Full Text Available The article analyzes "nursery English" in its substandard manifestations. It aims at classifying lexical units of the chosen colloquial area. Grouping the words is based on the comparison of neutral patterns and their specific ('nursery' counterparts. The results of the analysis demonstrate the two main tendencies of the language – redundancy and insufficiency – in their diverse expressions on the level of lexis of the researched field. The investigation discloses the basic models of "nursery English" (the English used by children registered in fiction (A. Milne's prose and poetry have been chosen for the analysis. It points out the mechanisms, both, phonetic and morphological, used to create the specific nature of the language of the chosen area. The word reduction and extension is registered in the initial, medium, and final positions. Both linguistic phenomena may be caused by simplifying a complex sound structure, when a child is trying to overcome the difficulty of pronouncing the word; or they may arise in the event of eliminating or adding semantically insignificant word components, or be the consequence of insufficient knowledge of grammar. In most cases, the new formations of nursery English are quite clear to the speakers due to the context or speech situation. Yet, there appear structures which cause misunderstanding. The investigated stylistic area overlaps the specific scope of substandard English used by grown-up speakers; however, certain samples of the first one may be regarded as strictly "nursery". It is not unlikely that the expansion of the researched resource will reveal other transformations. The findings can benefit the studies of English stylistics and English Language System studies.

  18. Intermediate Syndrome Following Organophosphate Insecticide Poisoning

    Directory of Open Access Journals (Sweden)

    Chen-Chang Yang

    2007-11-01

    Full Text Available Acute organophosphate insecticide poisoning can manifest 3 different phases of toxic effects, namely, acute cholinergic crisis, intermediate syndrome (IMS, and delayed neuropathy. Among them, IMS has been considered as a major contributing factor of organophosphate-related morbidity and mortality because of its frequent occurrence and probable consequence of respiratory failure. Despite a high incidence, the pathophysiology that underlies IMS remains unclear. Previously proposed mechanisms of IMS include different susceptibility of various cholinergic receptors, muscle necrosis, prolonged acetylcholinesterase inhibition, inadequate oxime therapy, downregulation or desensitization of postsynaptic acetylcholine receptors, failure of postsynaptic acetylcholine release, and oxidative stress-related myopathy. The clinical manifestations of IMS typically occur within 24 to 96 hours, affecting conscious patients without cholinergic signs, and involve the muscles of respiration, proximal limb muscles, neck flexors, and muscles innervated by motor cranial nerves. With appropriate therapy that commonly includes artificial respiration, complete recovery develops 5–18 days later. Patients with atypical manifestations of IMS, especially a relapse or a continuum of acute cholinergic crisis, however, were frequently reported in clinical studies of IMS. The treatment of IMS is mainly supportive. Nevertheless, because IMS generally concurs with severe organophosphate toxicity and persistent inhibition of acetylcholinesterase, early aggressive decontamination, appropriate antidotal therapy, and prompt institution of ventilatory support should be helpful in ameliorating the magnitude and/or the incidence of IMS. Although IMS is well recognized as a disorder of neuromuscular junctions, its exact etiology, incidence, and risk factors are not clearly defined because existing studies are largely small-scale case series and do not employ a consistent and rigorous

  19. Influence on sensitivity to insecticides: a case study of a settled area ...

    African Journals Online (AJOL)

    monitoring for successful alternative insecticides. There are currently two ... behaviour or modification avoid landing on insecticide .... aquarium fish food18. When they .... National Statistical Office (NSO) Malawi Government 1998 Census. 16.

  20. Mechanistic modeling of insecticide risks to breeding birds in North American agroecosystems

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of ...

  1. Influence of Pyrethroid Insecticides on Sodium and Calcium Influx in Neocortical Neurons

    Science.gov (United States)

    Pyrethroid insecticides bind to voltage-gated sodium channels and modify their gating kinetics, thereby disrupting neuronal function. Using murine neocortical neurons in primary culture, we have compared the ability of 11 structurally diverse pyrethroid insecticides to evoke Na+ ...

  2. Efficacy of an insecticide paint against insecticide-susceptible and resistant mosquitoes - Part 1: Laboratory evaluation

    Directory of Open Access Journals (Sweden)

    Carnevale Pierre

    2010-11-01

    Full Text Available Abstract Background The main malaria vector Anopheles gambiae and the urban pest nuisance Culex quinquefasciatus are increasingly resistant to pyrethroids in many African countries. There is a need for new products and strategies. Insecticide paint Inesfly 5A IGR™, containing two organophosphates (OPs, chlorpyrifos and diazinon, and insect growth regulator (IGR, pyriproxyfen, was tested under laboratory conditions for 12 months following WHOPES Phase I procedures. Methods Mosquitoes used were laboratory strains of Cx. quinquefasciatus susceptible and resistant to OPs. The paint was applied at two different doses (1 kg/6 m2 and 1 kg/12 m2 on different commonly used surfaces: porous (cement and stucco and non-porous (softwood and hard plastic. Insecticide efficacy was studied in terms of delayed mortality using 30-minute WHO bioassay cones. IGR efficacy on fecundity, fertility and larval development was studied on OP-resistant females exposed for 30 minutes to cement treated and control surfaces. Results After treatment, delayed mortality was high (87-100% even against OP-resistant females on all surfaces except cement treated at 1 kg/12 m2. Remarkably, one year after treatment delayed mortality was 93-100% against OP-resistant females on non-porous surfaces at both doses. On cement, death rates were low 12 months after treatment regardless of the dose and the resistance status. Fecundity, fertility and adult emergence were reduced after treatment even at the lower dose (p -3. A reduction in fecundity was still observed nine months after treatment at both doses (p -3 and adult emergence was reduced at the higher dose (p -3. Conclusions High mortality rates were observed against laboratory strains of the pest mosquito Cx. quinquefasciatus susceptible and resistant to insecticides. Long-term killing remained equally important on non-porous surfaces regardless the resistance status for over 12 months. The paint's effect on fecundity, fertility and

  3. Insecticide Usage and Chemical Contamination Assessment in Asiatic Pennywort

    Science.gov (United States)

    Bumroongsook, S.

    2017-07-01

    The insecticide usage in commercially grown asiatic pennywort plantations in Nakhonpatum and Nonthaburi province, Thailand was surveyed during January-June, 2016. The results showed that asiatic pennywort cuttworms was leaf destructive and caused the most damge to the production. The growers used organophosphate insecticides to control the caterpillars the most, followed by pyrethoid, abamectin, carbamate and organochlorine, respectively. The chemical contaminants of pennywort from 9 fresh markets in Bangkok was monitored, the result indicated that lead was not detected in the samples. The amount of arsenic was less than 0.075 mg / kg. The insecticide residue measurement of dicofol, chlorpyrifos and methidathion was 0.98, 2.84 and 0.46 mg / kg, respectively.

  4. Insecticide resistance in the western flower thrips, Frankliniella occidentalis

    DEFF Research Database (Denmark)

    Jensen, Sten Erik

    of acetylcholinesterase, the target site enzyme for methiocarb. The results from bioassays with synergists included indicated involvement of cytochrome P450- monooxygenases and esterases in methiocarb resistance in the most resistant populations. Selection with methiocarb on one of the populations to increase the level......The western flower thrips, Frankliniella occidentalis (Pergande) is a serious pest on a wide range of crops throughout the world. In Denmark F. occidentalis is a pest in greenhouses. F. occidentalis is difficult to control with insecticides because of its thigmokinetic behaviour and resistance...... to insecticides. Since F. occidentulis spread to become a worldwide pest in 1980’es, resistance to a number of different insecticides has been shown in many populations of F. occidentalis. This flower thrips has the potential of fast development of resistance owing to the short generation time, high fecundity...

  5. POTENTIATION OF COPAÍBA OIL-RESIN WITH SYNTHETIC INSECTICIDES TO CONTROL OF FALL ARMYWORM

    OpenAIRE

    ALMEIDA, WALDIANE ARAÚJO DE; SILVA, IGOR HONORATO LEDUÍNO DA; SANTOS, ANA CLÁUDIA VIEIRA DOS; BARROS JÚNIOR, AURÉLIO PAES; SOUSA, ADALBERTO HIPÓLITO DE

    2017-01-01

    ABSTRACT The control of Spodoptera frugiperda (J. E. SMITH) (Lepidoptera: Noctuidae) has been carried out mainly with pyrethroids and organophosphates insecticides. The continuous and indiscriminate use of synthetic insecticides, for decades, has led to the selection of resistant populations and has caused concerns for human health and the environment. An alternative is the use of botanical insecticides, including through the mixtures with synthetic insecticides. This study aimed to investiga...

  6. Optimal Cotton Insecticide Application Termination Timing: A Meta-Analysis.

    Science.gov (United States)

    Griffin, T W; Zapata, S D

    2016-08-01

    The concept of insecticide termination timing is generally accepted among cotton (Gossypium hirsutum) researchers; however, exact timings are often disputed. Specifically, there is uncertainty regarding the last economic insecticide application to control fruit-feeding pests including tarnished plant bug (Lygus lineolaris (Palisot de Beauvois)), boll weevil (Anthonomus grandis), bollworm (Helicoverpa zea), tobacco budworm (Heliothis virescens), and cotton fleahopper (Pseudatomoscelis seriatus). A systematic review of prior studies was conducted within a meta-analytic framework. Nine publicly available articles were amalgamated to develop an optimal timing principle. These prior studies reported 53 independent multiple means comparison field experiments for a total of 247 trial observations. Stochastic plateau theory integrated with econometric meta-analysis methodology was applied to the meta-database to determine the shape of the functional form of both the agronomic optimal insecticide termination timing and corresponding yield potential. Results indicated that current university insecticide termination timing recommendations are later than overall estimated timing suggested. The estimated 159 heat units (HU) after the fifth position above white flower (NAWF5) was found to be statistically different than the 194 HU termination used as the status quo recommended termination timing. Insecticides applied after 159 HU may have been applied in excess, resulting in unnecessary economic and environmental costs. Empirical results also suggested that extending the insecticide termination time by one unit resulted in a cotton lint yield increase of 0.27 kilograms per hectare up to the timing where the plateau began. Based on economic analyses, profit-maximizing producers may cease application as soon as 124 HU after NAWF5. These results provided insights useful to improve production systems by applying inputs only when benefits were expected to be in excess of the

  7. Insecticide resistance in vector Chagas disease: evolution, mechanisms and management.

    Science.gov (United States)

    Mougabure-Cueto, Gastón; Picollo, María Inés

    2015-09-01

    Chagas disease is a chronic parasitic infection restricted to America. The disease is caused by the protozoa Trypanosoma cruzi, which is transmitted to human through the feces of infected triatomine insects. Because no treatment is available for the chronic forms of the disease, vector chemical control represents the best way to reduce the incidence of the disease. Chemical control has been based principally on spraying dwellings with insecticide formulations and led to the reduction of triatomine distribution and consequent interruption of disease transmission in several areas from endemic region. However, in the last decade it has been repeatedly reported the presence triatomnes, mainly Triatoma infestans, after spraying with pyrethroid insecticides, which was associated to evolution to insecticide resistance. In this paper the evolution of insecticide resistance in triatomines is reviewed. The insecticide resistance was detected in 1970s in Rhodnius prolixus and 1990s in R. prolixus and T. infestans, but not until the 2000s resistance to pyrthroids in T. infestans associated to control failures was described in Argentina and Bolivia. The main resistance mechanisms (i.e. enhanced metabolism, altered site of action and reduced penetration) were described in the T. infestans resistant to pyrethrods. Different resistant profiles were demonstrated suggesting independent origin of the different resistant foci of Argentina and Bolivia. The deltamethrin resistance in T. infestans was showed to be controlled by semi-dominant, autosomally inherited factors. Reproductive and developmental costs were also demonstrated for the resistant T. infestans. A discussion about resistance and tolerance concepts and the persistence of T. infestans in Gran Chaco region are presented. In addition, theoretical concepts related to toxicological, evolutionary and ecological aspects of insecticide resistance are discussed in order to understand the particular scenario of pyrethroid

  8. Field and Laboratory Evaluations of Insecticides for Southern Pine Beetle Control

    Science.gov (United States)

    Felton L. Hastings; Jack E. Coster; [Editors

    1981-01-01

    Reports results of laboratory screenings and field studies of insecticides for use against the southern pine beetle. Preventive as webas remedial efficacywere observed, along with phytotoxicity to pine and understory hardwood species, effects of insecticides on soil microbial and mesofaunal populations, and degradation of insecticides by selected soil microbes.

  9. Dissipation of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb-insecticides used to control codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae) in apples for production of baby food.

    Science.gov (United States)

    Szpyrka, Ewa; Matyaszek, Aneta; Słowik-Borowiec, Magdalena

    2017-05-01

    Dissipations of three insecticides: chlorantraniliprole, chlorpyrifos-methyl and indoxacarb in apples were studied following their foliar application on apples intended for production of baby food. The apples were sprayed with formulations for control of codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae). Six experiments were conducted; each insecticide was applied individually on dessert apples. A validated gas chromatography-based method with simultaneous electron capture and nitrogen-phosphorus detection (GC-ECD/NPD) was used for the residue analysis. The analytical performance of the method was satisfactory, with expanded uncertainties ≤36% (a coverage factor, k = 2, and a confidence level of 95%). The dissipations of insecticides were studied in pseudo-first-order kinetic models (for which the coefficient of determination, R 2 , ranged between 0.9188 and 0.9897). Residues of studied insecticides were below their maximum residue limits of 0.5 mg/kg at an early stage of growth of the fruit. The half-lives of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb were 16-17, 4-6 and 20-24 days, respectively. The initial residue levels declined gradually and reached the level of 0.01 mg/kg in 1 month for chlorpyrifos-methyl, 2 months for chlorantraniliprole and 2.5 months for indoxacarb. To obtain the insecticide residue levels below 0.01 mg/kg, which is the default MRL for food intended for infants and young children, the application of the studied insecticides should be carried out at recommended doses not later then: 1 month before harvest for chlorpyrifos-methyl, 2 months for chlorantraniliprole and 2.5 months for indoxacarb.

  10. Characterizing the insecticide resistance of Anopheles gambiae in Mali.

    Science.gov (United States)

    Cisse, Moussa B M; Keita, Chitan; Dicko, Abdourhamane; Dengela, Dereje; Coleman, Jane; Lucas, Bradford; Mihigo, Jules; Sadou, Aboubacar; Belemvire, Allison; George, Kristen; Fornadel, Christen; Beach, Raymond

    2015-08-22

    The impact of indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs), key components of the national malaria control strategy of Mali, is threatened by vector insecticide resistance. The objective of this study was to assess the level of insecticide resistance in Anopheles gambiae sensu lato populations from Mali against four classes of insecticide recommended for IRS: organochlorines (OCs), pyrethroids (PYs), carbamates (CAs) and organophosphates (OPs). Characterization of resistance was done in 13 sites across southern Mali and assessed presence and distribution of physiological mechanisms that included target-site modifications: knockdown resistance (kdr) and altered acetycholinesterase (AChE), and/or metabolic mechanisms: elevated esterases, glutathione S-transferases (GSTs), and monooxygenases. The World Health Organization (WHO) tube test was used to determine phenotypic resistance of An. gambiae s.l. to: dichlorodiphenyltrichloroethane (DDT) (OC), deltamethrin (PY), lambda-cyhalothrin (PY), bendiocarb (CA), and fenitrothion (OP). Identification of sibling species and presence of the ace-1 (R) and Leu-Phe kdr, resistance-associated mutations, were determined using polymerase chain reaction (PCR) technology. Biochemical assays were conducted to detect increased activity of GSTs, oxidases and esterases. Populations tested showed high levels of resistance to DDT in all 13 sites, as well as increased resistance to deltamethrin and lambda-cyhalothrin in 12 out of 13 sites. Resistance to fenitrothion and bendiocarb was detected in 1 and 4 out of 13 sites, respectively. Anopheles coluzzii, An. gambiae sensu stricto and Anopheles arabiensis were identified with high allelic frequencies of kdr in all sites where each of the species were found (13, 12 and 10 sites, respectively). Relatively low allelic frequencies of ace-1 (R) were detected in four sites where this assessment was conducted. Evidence of elevated insecticide metabolism, based on oxidase

  11. Insecticide applications to soil contribute to the development of Burkholderia mediating insecticide resistance in stinkbugs.

    Science.gov (United States)

    Tago, Kanako; Kikuchi, Yoshitomo; Nakaoka, Sinji; Katsuyama, Chie; Hayatsu, Masahito

    2015-07-01

    Some soil Burkholderia strains are capable of degrading the organophosphorus insecticide, fenitrothion, and establish symbiosis with stinkbugs, making the host insects fenitrothion-resistant. However, the ecology of the symbiotic degrading Burkholderia adapting to fenitrothion in the free-living environment is unknown. We hypothesized that fenitrothion applications affect the dynamics of fenitrothion-degrading Burkholderia, thereby controlling the transmission of symbiotic degrading Burkholderia from the soil to stinkbugs. We investigated changes in the density and diversity of culturable Burkholderia (i.e. symbiotic and nonsymbiotic fenitrothion degraders and nondegraders) in fenitrothion-treated soil using microcosms. During the incubation with five applications of pesticide, the density of the degraders increased from less than the detection limit to around 10(6)/g of soil. The number of dominant species among the degraders declined with the increasing density of degraders; eventually, one species predominated. This process can be explained according to the competitive exclusion principle using V(max) and K(m) values for fenitrothion metabolism by the degraders. We performed a phylogenetic analysis of representative strains isolated from the microcosms and evaluated their ability to establish symbiosis with the stinkbug Riptortus pedestris. The strains that established symbiosis with R. pedestris were assigned to a cluster including symbionts commonly isolated from stinkbugs. The strains outside the cluster could not necessarily associate with the host. The degraders in the cluster predominated during the initial phase of degrader dynamics in the soil. Therefore, only a few applications of fenitrothion could allow symbiotic degraders to associate with their hosts and may cause the emergence of symbiont-mediated insecticide resistance. © 2015 John Wiley & Sons Ltd.

  12. AFSC/RACE/FBEP/Ryer: Polychaete worm tubes modify juvenile northern rock sole Lepidopsetta polyxystra depth distribution in Kodiak nurseries

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset is from a study that evaluates whether inter-annual variability in the depth distribution of juvenile northern rock sole on their nursery grounds around...

  13. First detection in the USA: new plant pathogen, Phytophthora tentaculata, in native plant nurseries and restoration sites in California

    Science.gov (United States)

    S. Rooney-Latham; C. L. Blomquist; T. Swiecki; E. Bernhardt; S.J. Frankel

    2015-01-01

    Phytophthora tentaculata Kröber & Marwitz, has been detected in several native plant nurseries in 4 California counties and in restoration sites on orange sticky monkey flower (Diplacus aurantiacus subsp. aurantiacus (W. Curtis) Jeps. [Scrophulariaceae]), toyon (Heteromeles...

  14. EOP Acoustic tagging and monitorings of cultured and wild juvenile crimson jobfish (Pristipomoides filamentosus) in a nursery habitat

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Raw data from Vemco receivers that monitored the Kaneohe, Oahu nursery grounds while tagged juvenile snapper were released in 2006 (cultured) and 2007 (wild). Also...

  15. Placoderm Assemblage from the Tetrapod-Bearing Locality of Strud (Belgium, Upper Famennian) Provides Evidence for a Fish Nursery

    Science.gov (United States)

    Clément, Gaël; Daeschler, Edward B.; Dupret, Vincent

    2016-01-01

    The placoderm fauna of the upper Famennian tetrapod-bearing locality of Strud, Belgium, includes the antiarch Grossilepis rikiki, the arthrodire groenlandaspidid Turrisaspis strudensis and the phyllolepidid Phyllolepis undulata. Based on morphological and morphometric evidence, the placoderm specimens from Strud are predominantly recognised as immature specimens and this locality as representing a placoderm nursery. The Strud depositional environment corresponds to a channel in an alluvial plain, and the presence of a nursery in such environment could have provided nutrients and protection to the placoderm offspring. This represents one of the earliest pieces of evidence for this sort of habitat partitioning in vertebrate history, with adults living more distantly from the nursery and using the nursery only to spawn or give live birth. PMID:27552196

  16. ["The aim is familiarity with the infant". Work and research in the Jackson Nursery (Vienna 1937/38)].

    Science.gov (United States)

    Krivanek, Roman

    2014-01-01

    The "Jackson Nursery", existing from February 1937 until March 1938, was directed by Anna Freud and financed by Edith Jackson and Dorothy Burlingham. It took care of infants from the poorest strata of Vienna and also gave material support to their families. On the other hand, it was a training institution for psychoanalysts, offering the opportunity of observing children during their first two years, e. g. their feeding habits and social sense. In addition, the Jackson Nursery was a place for research where psychoanalytic theories of infantile development were checked against the findings of direct observation. The work started here was then continued by A. Freud and D. Burlingham on a larger scale in their War Nurseries.--This paper examines the many-sided activities in the nursery mainly on the basis of unpu blished archival documents.

  17. Influence of gamma rays irradiation to chlorphyriphos insecticides residues in grapes (vitis vinifera L.)

    International Nuclear Information System (INIS)

    Chairul, S.M.

    2012-01-01

    Simulation methods to determination of chlorphyriphos insecticides residue in grapes cause effect gamma rays, was done. Fruits of grapes soaked with chlorpyriphos insecticide solution high level concentrated (100 ppm; 200 ppm; and 300 ppm) for 3 (three minutes). The treatment of the sample was direct of extraction after soaks; extract after storage for one week after soak, and extract after soak after storage for one week after irradiation at 0.5 kGy; 1.0 kGy; and 1.5 kGy dose. Extraction methods using ethyl acetate solvent, and using sodium sulphate as to dryed water level in grapes, and then extractan was injected to chromatography gas use electron capture detector. The result indicated that occur of descent of chlorpyrifos residues from eachs soaked consequence at storage for one week was amount 7,55; 8,42; and 18,88% respectively, while of consequence irradiation of gamma ray at 0,5 kGy doses, will be descent of chlorpyrifos residues in amount 13,90; 19,16; and 52,79% respectively, and at 1,0 kGy doses irradiation will be descent in amount 34,45; 36,15 and 49,79%, respectively. (author)

  18. A Study of the Curriculum and Contents in American Progressive Education : Focusing on Castle Kindergarten and Nursery School in Hawaii

    OpenAIRE

    塩路, 晶子

    2010-01-01

    This study aims to show the features of American progressive kindergarten in the early 20th century, through analyzing the curriculum and contents of Henry and Dorothy Castle Memorial Kindergarten and Nursery School in Hawaii. This kindergarten was established by Mary Castle at Honolulu in 1899 and influenced from John Dewey. And in 1927, the nursery school was established because educating younger children was important. Children could select the subject matter based on their own interest. A...

  19. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-02-19

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

  20. Population Structure of Pythium irregulare, P. ultimum, and P. sylvaticum in Forest Nursery Soils of Oregon and Washington.

    Science.gov (United States)

    Weiland, Jerry E; Garrido, Patricia; Kamvar, Zhian N; Espíndola, Andrés S; Marek, Stephen M; Grünwald, Niklaus J; Garzón, Carla D

    2015-05-01

    Pythium species are important soilborne pathogens occurring in the forest nursery industry of the Pacific Northwest. However, little is known about their genetic diversity or population structure and it is suspected that isolates are moved among forest nurseries on seedling stock and shared field equipment. In order to address these concerns, a total of 115 isolates of three Pythium species (P. irregulare, P. sylvaticum, and P. ultimum) were examined at three forest nurseries using simple sequence repeat (SSR) and amplified fragment length polymorphism (AFLP) markers. Analyses revealed distinct patterns of intraspecific variation for the three species. P. sylvaticum exhibited the most diversity, followed by P. irregulare, while substantial clonality was found in P. ultimum. For both P. irregulare and P. sylvaticum, but not P. ultimum, there was evidence for significant variation among nurseries. However, all three species also exhibited at least two distinct lineages not associated with the nursery of origin. Finally, evidence was found that certain lineages and clonal genotypes, including fungicide-resistant isolates, are shared among nurseries, indicating that pathogen movement has occurred.

  1. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth

    OpenAIRE

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-01-01

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementat...

  2. Insecticidal Potential of an Orally Administered Metabolic Extract of ...

    African Journals Online (AJOL)

    The insecticidal activity of Aspergillus niger IHCS-4 metabolic extract against Chrysomya chloropyga larvae was examined in vitro. The toxicity test revealed that 0.04 mg/g and 0.08 mg/g extract concentration significantly (P>0.05) affected the insect larvae, inducing 20% and 65% mortality respectively, within 24 hours.

  3. Effectiveness of plant based insecticides as a sustainable means of ...

    African Journals Online (AJOL)

    Cucumber (Cucumis sativus) is an important crop in Pakistan. It is affected by many biotic and abiotic factors. Among these, Cucumber mosaic virus is the important disease with economic losses. The purpose of this study was to evaluate the effectiveness of plant based insecticides as a sustainable means to control the ...

  4. Studies .on the efficacy of some biorational insecticides against the ...

    African Journals Online (AJOL)

    W. Tin znara*, C. Na11kinga, l Kashaija & W. Tu.vhemereirwe ... Biorat!onal insecticides obtained from tobacco, ash, urine, pepper and a concoction (mixture) were ... Cultural control ... single components were made by adding I 00 ml of tap.

  5. Risk of transmission of viral haemorrhagic fevers and the insecticide ...

    African Journals Online (AJOL)

    ... of transmission of viral haemorrhagic fevers and the insecticide susceptibility status of Ae. aegypti in some sites in Accra, Ghana. Design: Larval surveys were carried to inspect containers within households and estimate larval indices and adult Aedes mosquitoes were collected using human landing collection technique.

  6. The comparative insecticidal and residual efficacy of sniper and ...

    African Journals Online (AJOL)

    Otoigiakih

    Chemical control is still the main approach for urban pest control (Castle et al., 1999; Rozendaal, 1997; Marrs,. 1993; Lee and Yap, 2003; Tidwell et al., 1994). The use of insecticides is seen as the most effective tool in cockroach control program (WHO, 1996; Chavasse and. Yap, 1997; Lee and Yap, 2003; Tidwell et al., ...

  7. Susceptibility of Adult Mosquitoes to Insecticides in Aqueous Sucrose Baits

    Science.gov (United States)

    2011-06-01

    Lee, and A.H. Azahari. 2005. Adult and larval insecticide susceptibility status of Culex quinquefasciatus (Say) mosquitoes in Kuala Lumpur Malaysia ...Trop. Biomed. 22: 63-68. Nayar, J.K. and D.M. Sauerman, Jr. 1971. The effects of diet on life-span, fecundity and flight potential of Aedes

  8. Efficacy of some synthetic insecticides for control of cotton bollworms ...

    African Journals Online (AJOL)

    ... and Betsulfan at 3.2 l ha-1 recorded the highest and lowest yields, respectively. For effective control of cotton bollworms for maximum yield in the ecology, Thionex applied at 2.8 l ha-1 is recommended. Keywords: Control, cotton bollworms, efficacy, Ghana, synthetic insecticides. African Crop Science Journal, Vol. 20, No.

  9. Insecticide use and practices among cotton farmers in northern ...

    African Journals Online (AJOL)

    Cotton (Gossypium hirsutum L.) is an important cash crop in Uganda. Insecticide application practices among cotton growers in northern Uganda were examined to determine the pests targeted and the compliance of control measures with the standards recommended by the Uganda's Cotton Development Organization ...

  10. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    Energy Technology Data Exchange (ETDEWEB)

    Weston, D.P., E-mail: dweston@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Asbell, A.M., E-mail: aasbell@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Hecht, S.A., E-mail: scott.hecht@noaa.gov [NOAA Fisheries, Office of Protected Resources, 510 Desmond Drive S.E., Lacey, WA 98503 (United States); Scholz, N.L., E-mail: nathaniel.scholz@noaa.gov [NOAA Fisheries, Northwest Fisheries Science Center, 2725 Montlake Blvd. E., Seattle, WA 98112 (United States); Lydy, M.J., E-mail: mlydy@siu.edu [Fisheries and Illinois Aquaculture Center and Department of Zoology, Southern Illinois University, 171 Life Sciences II, Carbondale, IL 62901 (United States)

    2011-10-15

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: > Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. > Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. > Two creeks contained concentrations acutely lethal to sensitive invertebrates. > Bifenthrin was of greatest concern, though less than in prior studies. > Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  11. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    International Nuclear Information System (INIS)

    Weston, D.P.; Asbell, A.M.; Hecht, S.A.; Scholz, N.L.; Lydy, M.J.

    2011-01-01

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: → Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. → Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. → Two creeks contained concentrations acutely lethal to sensitive invertebrates. → Bifenthrin was of greatest concern, though less than in prior studies. → Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  12. Metaflumizone is a novel sodium channel blocker insecticide.

    Science.gov (United States)

    Salgado, V L; Hayashi, J H

    2007-12-15

    Metaflumizone is a novel semicarbazone insecticide, derived chemically from the pyrazoline sodium channel blocker insecticides (SCBIs) discovered at Philips-Duphar in the early 1970s, but with greatly improved mammalian safety. This paper describes studies confirming that the insecticidal action of metaflumizone is due to the state-dependent blockage of sodium channels. Larvae of the moth Spodoptera eridania injected with metaflumizone became paralyzed, concomitant with blockage of all nerve activity. Furthermore, tonic firing of abdominal stretch receptor organs from Spodoptera frugiperda was blocked by metaflumizone applied in the bath, consistent with the block of voltage-dependent sodium channels. Studies on native sodium channels, in primary-cultured neurons isolated from the CNS of the larvae of the moth Manduca sexta and on Para/TipE sodium channels heterologously expressed in Xenopus (African clawed frog) oocytes, confirmed that metaflumizone blocks sodium channels by binding selectively to the slow-inactivated state, which is characteristic of the SCBIs. The results confirm that metaflumizone is a novel sodium channel blocker insecticide.

  13. Insecticide resistance testing in malaria vectors in Tanzania ...

    African Journals Online (AJOL)

    mosquito survived much better and the scientists had a total of 467 mosquitoes to run the insecticide susceptibility tests. Innovative ways are necessary under field conditions for mosquito breeding in susceptibility studies. Key words: Malaria, Anopheles gambiae complex, larvae, fabric, resistance, susceptibility, Tanzania.

  14. Effective utilization period of long-lasting insecticide treated nets ...

    African Journals Online (AJOL)

    The study was conducted to evaluate the bioefficacy of long-lasting insecticide treated nets (LLITNs) (PermaNet®2.0) over time and the species composition of Anopheles mosquitoes around Bahir Dar. The space spray collection method was used to determine the species composition of indoor resting Anopheles ...

  15. Insecticide resistance and glutathione S-transferases in mosquitoes ...

    African Journals Online (AJOL)

    Mosquito glutathione S-transferases (GSTs) have received considerable attention in the last 20 years because of their role in insecticide metabolism producing resistance. Many different compounds, including toxic xenobiotics and reactive products of intracellular processes such as lipid peroxidation, act as GST substrates.

  16. Larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus ...

    African Journals Online (AJOL)

    Purpose: To evaluate the larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus, Foenuculum vulgare and Tagetes minuta leaf extracts against Culex quinquefasciatus mosquitoes. Methods: The leaves of the plants were extracted with distilled water, ethanol (95 %), and hexane and the extracts screened for ...

  17. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    Experiments were carried out to evaluate the effect of water extracts of Fagonia arabica, Salix alba and Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of. Hyalopterus pruni and characters of Armeniaca vulgaris plants and their soils. The data revealed that F.arabica extract at 20% ...

  18. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    The high biologic efficacy, mechanism of action, resistance to water rinsing, high selectivity, and small quantities of application, anticipated a bright future for them. Since results of researches of biological efficacy of insecticides in laboratory and field conditions are statistically different, studies done in natural conditions ...

  19. Insecticide assays against the brown stink bug feeding on pecan

    Science.gov (United States)

    The brown stink bug, Euschistus servus (Say) (Hemiptera: Pentatomidae), is an economic pest of pecan, Carya illinoinensis (Wangenh) K. Koch (Juglandaceae), and other agronomic crops across the southeastern U.S. Management of this pest is mainly via insecticides. Many commercial products indicate o...

  20. Environmental insecticide residues from tsetse fly control measures in Uganda

    International Nuclear Information System (INIS)

    Sserunjoji-Sebalija, J.

    1976-01-01

    Up to June 1974 areas in Uganda totalling 8600km 2 have been successfully reclaimed from tsetse fly infestation by ground spray of 3% dieldrin water emulsions. A search for equally effective but less persistent and toxic compounds against tsetse flies has been unsuccessful. Fourteen insecticide formulations have been tested for their persistence on tree bark surfaces and, therefore, their availability and toxicity to the target tsetse flies. Only those compounds with a high immediate insecticidal activity (some higher than dieldrin) like endosulfan, Chlorfenvinphos and propoxur could merit further consideration in tsetse control. While some were toxic to tsetse as fresh deposits, they lacked sufficient persistence. A study of the environmental implication from the continued use of the highly persistent and toxic dieldrin has provided useful data on residues likely to be found both in terrestrial and aquatic fauna and flora. These are generally low. Moreover, there is evidence of degradation in some fish species (Protopterus aethiopicus and Clarias). Also, dilution factors and adsorption involving the muddy nature of water run-off, etc., and controlled burning of grasses after tsetse eradication would tend to inactivate the residual insecticide and protect aquatic systems. The general findings have indicated less risk than anticipated of the environmental contamination from tsetse control by application of persistent and toxic insecticides. (author)

  1. Ethnobotany of plants used as insecticides, repellents and ...

    African Journals Online (AJOL)

    An ethnobotanical study on plants used for the prevention and treatment of malaria was conducted to document the indigenous knowledge particularly associated with the use and conservation of anti-malarial, insecticide and insect repellent medicinal plants. In this study, five sampling sites were selected based on the ...

  2. Chemical Composition and Insecticidal Activity of the Essential Oil of ...

    African Journals Online (AJOL)

    Purpose: To investigate the chemical composition and insecticidal activity of the essential oil of the aerial parts of Ostericum grosseserratum against the maize weevil, Sitophilus zeamaisD. Methods: Steam distillation of the aerial parts of O. grosseserratum during the flowering stage was carried out using a Clavenger ...

  3. Chemical composition and insecticidal properties of essential oil ...

    African Journals Online (AJOL)

    Purpose: To determine the insecticidal properties of essential oil from Mosla soochowensis aerial parts against two insect pests, Sitophilus zeamais and Tribolium castaneum. Methods: Hydro-distillation of M. soochowensis was used to extract the essential oil. Gas chromatography/mass spectrometry (GC/MS) analysis was ...

  4. Bio-insecticides and mating disruption in cranberries

    Science.gov (United States)

    Surveys of native entomopathogenic nematodes in Wisconsin have produced a new bio-insecticide involving two particular nematode species (Oscheius onirici and Heterorhabditis georgiana). In field studies, these nematodes have shown high virulence against flea beetles; in the laboratory, these nematod...

  5. Insecticide Use Practices in Cocoa Production in Four Regions in ...

    African Journals Online (AJOL)

    Most of the insecticides used are classified as class II under WHO Hazard category, and the farmers used very minimal protective clothing during pesticides application. The results of this study show that there is the need to intensify education on safe handling and use of pesticides to reduce pesticide abuse, especially by ...

  6. Cytotoxic effects of delfin insecticide (Bacillus thuringiensis) on cell ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... In acute exposure cells showed deformities such as swelling of cells, oval shaped deformity, and ... Commercial grade of delfin insecticide used in this study was manufactured by .... exposure to cigarette extracts. Antibiotics caused .... administration of a neem pesticide on rat metabolic enzymes. J. Environ.

  7. Material gain: bednets treated with insecticides improve the lives of ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-07-15

    ... 700 mosquito nets each day, marketed under brand names such as "Health Net" and ... Material gain: bednets treated with insecticides improve the lives of Tanzanians. July 15, 2011. Image ... The kit is one of the key elements of PSI's Social Marketing of ... The national strategy will work to change this by involving the full ...

  8. Flupyradifurone: a brief profile of a new butenolide insecticide

    Science.gov (United States)

    Nauen, Ralf; Jeschke, Peter; Velten, Robert; Beck, Michael E; Ebbinghaus-Kintscher, Ulrich; Thielert, Wolfgang; Wölfel, Katharina; Haas, Matthias; Kunz, Klaus; Raupach, Georg

    2015-01-01

    BACKGROUND The development and commercialisation of new chemical classes of insecticides for efficient crop protection measures against destructive invertebrate pests is of utmost importance to overcome resistance issues and to secure sustainable crop yields. Flupyradifurone introduced here is the first representative of the novel butenolide class of insecticides active against various sucking pests and showing an excellent safety profile. RESULTS The discovery of flupyradifurone was inspired by the butenolide scaffold in naturally occurring stemofoline. Flupyradifurone acts reversibly as an agonist on insect nicotinic acetylcholine receptors but is structurally different from known agonists, as shown by chemical similarity analysis. It shows a fast action on a broad range of sucking pests, as demonstrated in laboratory bioassays, and exhibits excellent field efficacy on a number of crops with different application methods, including foliar, soil, seed treatment and drip irrigation. It is readily taken up by plants and translocated in the xylem, as demonstrated by phosphor imaging analysis. Flupyradifurone is active on resistant pests, including cotton whiteflies, and is not metabolised by recombinantly expressed CYP6CM1, a cytochrome P450 conferring metabolic resistance to neonicotinoids and pymetrozine. CONCLUSION The novel butenolide insecticide flupyradifurone shows unique properties and will become a new tool for integrated pest management around the globe, as demonstrated by its insecticidal, ecotoxicological and safety profile. © 2014 The Authors. Pest Management Science published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry. PMID:25351824

  9. Seed coating with a neonicotinoid insecticide negatively affects wild bees.

    Science.gov (United States)

    Rundlöf, Maj; Andersson, Georg K S; Bommarco, Riccardo; Fries, Ingemar; Hederström, Veronica; Herbertsson, Lina; Jonsson, Ove; Klatt, Björn K; Pedersen, Thorsten R; Yourstone, Johanna; Smith, Henrik G

    2015-05-07

    Understanding the effects of neonicotinoid insecticides on bees is vital because of reported declines in bee diversity and distribution and the crucial role bees have as pollinators in ecosystems and agriculture. Neonicotinoids are suspected to pose an unacceptable risk to bees, partly because of their systemic uptake in plants, and the European Union has therefore introduced a moratorium on three neonicotinoids as seed coatings in flowering crops that attract bees. The moratorium has been criticized for being based on weak evidence, particularly because effects have mostly been measured on bees that have been artificially fed neonicotinoids. Thus, the key question is how neonicotinoids influence bees, and wild bees in particular, in real-world agricultural landscapes. Here we show that a commonly used insecticide seed coating in a flowering crop can have serious consequences for wild bees. In a study with replicated and matched landscapes, we found that seed coating with Elado, an insecticide containing a combination of the neonicotinoid clothianidin and the non-systemic pyrethroid β-cyfluthrin, applied to oilseed rape seeds, reduced wild bee density, solitary bee nesting, and bumblebee colony growth and reproduction under field conditions. Hence, such insecticidal use can pose a substantial risk to wild bees in agricultural landscapes, and the contribution of pesticides to the global decline of wild bees may have been underestimated. The lack of a significant response in honeybee colonies suggests that reported pesticide effects on honeybees cannot always be extrapolated to wild bees.

  10. Fungicidal control of Lophodermium seditiosum on Pinus sylvestris seedlings in Swedish forest nurseries

    Energy Technology Data Exchange (ETDEWEB)

    Stenstroem, Elna [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Mycology and Pathology; Arvidsson, Bernt [Svenska Skogsplantor AB, Joenkoeping (Sweden)

    2001-07-01

    During the 1990s, there were serious outbreaks of the pathogen Lophodermium seditiosum on pine seedlings in Swedish forest nurseries, even though the seedlings had been treated with the fungicide propiconazole. The present experiment was carried out to evaluate two other fungicides, fluazinam and azoxystrobin, as possible alternatives to propiconazole. In the tests, which were all carried out in the same forest nursery, seedlings were treated with either propiconazole, fluazinam. or azoxystrobin, and the proportion of needles with ascocarps of L. seditiosum and the number of ascocarps per needle were recorded over the following 2 yrs. Seedlings treated with azoxystrobin already appeared healthier than control seedlings in September of the first year, and by November all azoxystrobin-treated seedlings had fewer ascocarps per needle compared with control seedlings. In autumn of the second year, there were no ascocarps on seedlings treated with fluazinam or azoxystrobin, whereas seedlings treated with propiconazole had similar numbers of ascocarps to non-treated control seedlings.

  11. Plant bio-stimulator fertilizers can be applied in integrated plant management (IPM in forest nurseries

    Directory of Open Access Journals (Sweden)

    Tkaczyk Miłosz

    2015-12-01

    Full Text Available In the circumstances of only a limited number of pesticides being approved for use in forest nurseries, it is necessary to also examine the efficacy of new products available on the European market that stimulate growth and improve resilience and vitality among seedlings and saplings, with a view to the application of these products forming part of an integrated programme of plant protection. This paper describes trials of the three commercially available fertilizer products Actifos, Zielony Busz and Effective Microorganisms (EM, as carried out in seven Polish nurseries in an attempt to promote the growth of shoots and root systems of seedlings and saplings. In 64% of cases of it being used, Actifos was shown to stimulate growth significantly beyond control levels in the shoots of oak, beech, pine, spruce and alder saplings as well as the roots of young alders and oaks.

  12. Use of the heat dissipation method for sap flow measurement in citrus nursery trees1

    Directory of Open Access Journals (Sweden)

    Eduardo Augusto Girardi

    2010-12-01

    Full Text Available Sap flow could be used as physiological parameter to assist irrigation of screen house citrus nursery trees by continuous water consumption estimation. Herein we report a first set of results indicating the potential use of the heat dissipation method for sap flow measurement in containerized citrus nursery trees. 'Valencia' sweet orange [Citrus sinensis (L. Osbeck] budded on 'Rangpur' lime (Citrus limonia Osbeck was evaluated for 30 days during summer. Heat dissipation probes and thermocouple sensors were constructed with low-cost and easily available materials in order to improve accessibility of the method. Sap flow showed high correlation to air temperature inside the screen house. However, errors due to natural thermal gradient and plant tissue injuries affected measurement precision. Transpiration estimated by sap flow measurement was four times higher than gravimetric measurement. Improved micro-probes, adequate method calibration, and non-toxic insulating materials should be further investigated.

  13. Challenges and opportunities in South Africa’s indigenous plants industry: De Fynne Nursery

    Directory of Open Access Journals (Sweden)

    Edward Mabaya

    2016-04-01

    Full Text Available De Fynne Nursery, a black-owned agribusiness, has cemented a unique position in South Africa’s indigenous plants industry against all odds. With an undying passion for the horticulture industry, Jacky Goliath and Elton Jefthas, De Fynne’s cofounders, continue to live the dream that began in their backyard. Today, they sit in their new 22-hectare farm and muse over strategic decisions as they navigate the challenges of doing business in an emerging economy. This case study focuses on opportunities and challenges for De Fynne as it pushes into its next growth phase by looking at the changing competitive landscape, the balance between marketing existing products and innovating new products, and ways to become operationally efficient and profitable in both its nursery and the farm.

  14. The role of the neonatal nurse practitioner in the community hospital level I nursery.

    Science.gov (United States)

    Hatch, Julie

    2012-01-01

    Neonatal nurse practitioners (NNPs) have played a significant role in providing medical coverage to many of the country's Level III neonatal intensive care units (NICUs). Extensive education and experience are required for a nurse practitioner (NP) to become competent in caring for these critically ill newborns. The NNP can take this competence and experience and expand her role out into the community Level I nurseries. Clinical care of the infants and close communication with parents, pediatricians, and the area tertiary center provide a community service with the goal of keeping parents and babies together in the community hospital without compromising the health of the baby. The NNP service, with 24-hour nursery and delivery coverage, supports an ongoing obstetric service to the community hospital. The NNP's experience enables her to provide a neonatal service that encompasses a multitude of advanced practice nursing roles.

  15. Production of camu camu plants with different organic substrates in conventional nursery bed

    Directory of Open Access Journals (Sweden)

    Carlos Abanto Rodriguez

    2013-12-01

    Full Text Available The aim was to verify the initial development of camu camu plants with different organic substrates in conventional nursery bedding microsprinkler irrigation and shade management Chromatine® mesh with 50% red light. We used genetic material from mother plants Germplasm Bank of INIA-camu camu Iquitos, seeds were germinated in decomposed sawdust and kept for a period of 40 days after subculturing was performed with 10 cm in height in different substrates according treatments in nursery beds with dimensions of 1.20 m wide x 10 m long with a depth of 30 cm. After conducting assessments of height (cm and basal diameter (mm for a period of 120 days, it was found that the substrate manure has become the substrate for greater efficiency in plant development camu camu substrate followed by humus worm.

  16. Novel and viable acetylcholinesterase target site for developing effective and environmentally safe insecticides.

    Science.gov (United States)

    Pang, Yuan-Ping; Brimijoin, Stephen; Ragsdale, David W; Zhu, Kun Yan; Suranyi, Robert

    2012-04-01

    Insect pests are responsible for human suffering and financial losses worldwide. New and environmentally safe insecticides are urgently needed to cope with these serious problems. Resistance to current insecticides has resulted in a resurgence of insect pests, and growing concerns about insecticide toxicity to humans discourage the use of insecticides for pest control. The small market for insecticides has hampered insecticide development; however, advances in genomics and structural genomics offer new opportunities to develop insecticides that are less dependent on the insecticide market. This review summarizes the literature data that support the hypothesis that an insect-specific cysteine residue located at the opening of the acetylcholinesterase active site is a promising target site for developing new insecticides with reduced off-target toxicity and low propensity for insect resistance. These data are used to discuss the differences between targeting the insect-specific cysteine residue and targeting the ubiquitous catalytic serine residue of acetylcholinesterase from the perspective of reducing off-target toxicity and insect resistance. Also discussed is the prospect of developing cysteine-targeting anticholinesterases as effective and environmentally safe insecticides for control of disease vectors, crop damage, and residential insect pests within the financial confines of the present insecticide market.

  17. Effects of nursery preconditioning through mycorrhizal inoculation and drought in Arbutus unedo L. plants.

    Science.gov (United States)

    Navarro García, Alejandra; Del Pilar Bañón Árias, Sebastián; Morte, Asunción; Sánchez-Blanco, María Jesús

    2011-01-01

    The influence of a water deficit treatment and mycorrhizal inoculation with Pisolithus tinctorius (Pers.) Coker and Couch on the water relations, gas exchange, and plant growth in Arbutus unedo L. plants was studied in order to evaluate the hardening process during the nursery period. The ability to withstand the adverse conditions after transplantation was also studied. Mycorrhizal and non-mycorrhizal seedlings of A. unedo were pot-grown for 4 months in a greenhouse (nursery period), during which time two irrigation treatments, well watered (100% water holding capacity, leaching 20% of the applied water) and deficit irrigation (50% of the well watered), were applied. Subsequently, the plants were transplanted to the field and well irrigated (transplanting period), after which and until the end of the experiment they received no water (establishment period). At the end of the nursery period, both water deficit and mycorrhizae were seen to have altered the plant morphology. Mycorrhizal plants had lower leaf area and improved leaf color parameters, while the water deficit increased root dry weight and the root/shoot ratio. Mycorrhizal plants had higher leaf water potential values than non-inoculated plants. Mycorrhizae increased stomatal conductance and photosynthesis values, especially in stressed plants. Drought led to an osmotic adjustment and a decrease in the leaf water potential values at turgor loss point in the mycorrhizal plants. Cell wall rigidity, measured as increased bulk modulus of elasticity, was decreased by the mycorrhizae effect. After transplanting, no differences were found in the water relations or gas exchange values between treatments. During the establishment period, the plants that had been exposed to both drought and mycorrhizae showed a better water status (higher leaf water and turgor potential values) and higher gas exchange values. In conclusion, water deficit and mycorrhizal inoculation of A. unedo plants in nursery produced changes in

  18. Management of genetic resources in the nursery system of wild cherry (Prunus avium L.

    Directory of Open Access Journals (Sweden)

    Proietti R

    2006-01-01

    Full Text Available Knowledge of genetic and adaptive traits of reproductive materials used in the nursery system of wild cherry, could be an useful instrument to improve ecological and economic sustainability of plantation ecosystems. This work reports results from a research which the objectives were: 1 to study the genetic variation of a Prunus avium L. Population, used for seed harvesting, through its multi-locus genotypes detected by starch gel electrophoresis; 2 to analyze the level of genetic variation within and among different steps in a commercial nursery system (basic population and sub-populations, seedlings aged S1T1 and S1T2, plantation. Results showed low genetic variation levels of the basic population, similar to a reference system of other 12 wild cherry Italian populations and to other French and Caucasian materials. The genetic distances among Monte Baldo and some closer Lombardy provenances (Area Garda, Bosco Fontana, Valtellina were smaller than the Venice Region populations (Monti Lessini and Asiago. Number of alleles and percentage of polymorphic loci within the complex of Monte Baldo provenance and multiplication materials were similar, whilst a variable value of Fis was noted. Indeed, along with the nursery system until the plantation, heterozygosis initially (S1T1 increased, then decreased proceeding to the plantation. This fluctuation of FIS values could be determined by seed lots characterized initially by higher levels of variation, due to self-incompatibility. In the following steps, a possible selection pressure can affect randomly the genotypic structure of wild cherry by increasing the homozygosity. There is not among population a well defined geographic characterization, as suggested by genetic distances, therefore homogeneous seed harvest could be established an area larger than geographic and administrative borders. On this way we could have reproductive material with a wide genetic base and environmental adaptability. To

  19. In situ observations of a possible skate nursery off the western Antarctic Peninsula.

    Science.gov (United States)

    Amsler, M O; Smith, K E; McClintock, J B; Singh, H; Thatje, S; Vos, S C; Brothers, C J; Brown, A; Ellis, D; Anderson, J; Aronson, R B

    2015-06-01

    A dense aggregation of skate egg cases was imaged during a photographic survey of the sea floor along the western Antarctic Peninsula in November 2013. Egg cases were noted in a narrow band between 394 and 443 m depth. Although some skate species in other oceans are known to utilize restricted areas to deposit eggs in great numbers, such nurseries have not been described in the Southern Ocean. © 2015 The Fisheries Society of the British Isles.

  20. Attitudes of ornamental trees and shrubs producers towards nursery production of ornamental beech cultivars in Serbia

    Directory of Open Access Journals (Sweden)

    Nonić Marina

    2016-01-01

    Full Text Available European beech (Fagus sylvatica L. is, along with its significance as a forest species, renowned as an ornamental species, due to its numerous cultivars. Ornamental beech cultivars are planted in various green spaces, but a small number of such trees have ascertained in Serbia. For the time being, production of beech cultivars is represented in a very small number of nurseries, with a negligible share of those seedlings in their total assortment. The aim of this research is to study the attitudes of ornamental trees and shrubs producers towards the nursery production of ornamental beech cultivars, and possibilities of its improvements in Serbia. “Door to door” survey and in-depth interviews were used as research techniques. Surveys with the representatives of 65 nurseries in Serbia (in the selected statistical region Šumadija and Western Serbia were conducted in the first stage of data collection. In the second stage of data collection were interviewed the representatives of the 10 nurseries who, during the survey, pointed out that they produce ornamental beech cultivars. Nurserymen’s attitudes suggest that there is a possibility to improve the production of ornamental beech cultivars in Serbia, with the appropriate support measures and increased interest of customers on the market, i.e. with the provision of subsidies for the production of seedlings and greater use of cultivars by utility companies in the cities of Serbia. [Projekat Ministarstva nauke Republike Srbije, br. ТP 31041: Establishment of forest plantations to increase the afforested areas in Serbia

  1. Nursery areas and recruitment variation of Northeast Atlantic mackerel (Scomber scombrus)

    DEFF Research Database (Denmark)

    Jansen, Teunis; Kristensen, Kasper; Van der Kooij, Jeroen

    2015-01-01

    There are currently no dedicated recruitment survey data available in support of the assessment of the abundance and distribution of Northeast Atlantic (NEA) mackerel (Scomber scombrus), one of the most widespread and commercially important fish stocks in the North Atlantic. This is despite the f......, showing that the most important nursery areas are around Ireland, north and west of Scotland, in the northern North Sea north of 598Nand, to some extent, also in the Bay of Biscay....

  2. A secondary nursery area for the copper shark Carcharhinus brachyurus from the late Miocene of Peru

    Science.gov (United States)

    Landini, Walter; Collareta, Alberto; Pesci, Fabio; Di Celma, Claudio; Urbina, Mario; Bianucci, Giovanni

    2017-10-01

    The life history strategies of sharks often include the use of protected nursery areas by young-of-the-year and juveniles. Nursery areas can be primary (i.e., grounds where the sharks are born and spend the very first part of their lives) or secondary (i.e., grounds inhabited by slightly older but not yet mature individuals). Criteria utilized to recognize these strategic habitats include: high concentration of young sharks, high food availability, and low predation risk. Since the fossil record of sharks consists mainly of isolated teeth, identification of paleonurseries involves a series of problems due to difficult application of actualistic criteria. A rich shark tooth-bearing level (ST-low1) has recently been discovered in the upper Miocene deposits of the Pisco Formation exposed at Cerro Colorado (southern coast of Peru). Most of the teeth collected from this level belong to the extant copper shark Carcharhinus brachyurus. These teeth are small and compatible with those of extant juveniles. This observation, coupled with other paleoenvironmental considerations, indicates that the ST-low1 horizon could have represented a nursery ground for juvenile individuals of C. brachyurus. The absence of very small-sized teeth (i.e., referable to young-of-the-year) suggests a secondary nursery ground inhabited by immature copper sharks. Observations on the tooth size of other Lamniformes, Carcharhiniformes, and Myliobatiformes occurring along with C. brachyurus point to a significantly juvenile structure of this elasmobranch assemblage, thus supporting the hypothesis of a communal use of the Cerro Colorado paleonursery.

  3. The use of ethephon and mixtures of ethephon luith inorganic defoliants to defoliate apple nursery trees

    Directory of Open Access Journals (Sweden)

    A. Basak

    2015-06-01

    Full Text Available Ethephon alone and in a mixture with inorganic defoliants was used to defoliate apple nursery trees of three cultivars: Yellow Transparent, McIntosh and Jonathan. The mixture of ethephon with copper sulphate or magnesium chlorate defoliated the trees better than ethophon or inorganic defoliants used seperately in twice as high concentrations as in a mixture. The tress defoliated with the mixtures of defoliants suffered less from frost injury than those treated with only the inorganic defoliants.

  4. Molecular Genetic Methods Implementation for Phytopathogen Identification in Forest Stands and Nurseries of the Russian Federation

    Directory of Open Access Journals (Sweden)

    T. S. Alimova

    2014-08-01

    Full Text Available The results of the application of molecular genetics methods for the analysis of the plant pathogens present in forest plantations and nurseries of the Russian Federation, including doughnut fungus and annosum root rot are presented. The prospects and benefits of using DNA analysis for early diagnosis of plant diseases without isolation of the pathogen in pure culture, shortening time of analysis, and the possibility of mass screening are discussed.

  5. Biological alterations and self-reported symptoms among insecticides-exposed workers in Burkina Faso.

    Science.gov (United States)

    Toe, Adama M; Ilboudo, Sylvain; Ouedraogo, Moustapha; Guissou, Pierre I

    2012-03-01

    Occupationally exposed workers, farm workers and plant protection agents in the Sahel region of Burkina Faso were interviewed to assess adverse health effects of insecticides. The subjects were also examined for changes in both hematological and biochemical parameters. The prevalence of liver and kidney dysfunction was found to be quite high among insecticide applicators, especially among plant protection agents. The prevalence of biochemical alterations seems to be correlated to the frequency of insecticide use. However, no significant differences were found between the hematological parameters among farm workers and plant protection agents. The hematological parameters of all the insecticide applicators were normal. The great majority of insecticide applicators (85%) reported symptoms related to insecticide exposure. The use of insecticides in the agriculture of Burkina Faso is threatening to human health.

  6. Toxicity of some insecticides to the haemocytes of giant honeybee, Apis dorsata F. under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Nighat Perveen

    2017-07-01

    Full Text Available Quantitative studies concerning total and differential haemocyte counts and abnormalities were performed under laboratory conditions for larvae, pupae and adults collected from a wild Apis dorsata colony. Haemolymph samples were observed immediately, thirty and sixty minutes after field recommended concentration exposure of five different insecticides. Total haemocyte counts were significantly higher for larvae and pupae but less for adult bees, however, differential haemocyte counts insignificantly different. Exposure of insecticides showed variable response for tested insecticides with immediate increased change with ethofenprox, diafenthiuron and imidacloprid but decreased for all tested insecticides after sixty minutes. For differential haemocyte counts, plasmatocytes and granulocytes increased with exposure of insecticides. Immune response of haemocytes against insecticides showed different degrees of abnormalities like agglutination, denucleation and cell shape distortion. Such studies may help in possible identification of insect defense mechanisms against their exposure to external hazards for instance insecticide exposure.

  7. Radiation fixation of vinyl chloride in an insecticide aerosol container

    International Nuclear Information System (INIS)

    Kagiya, V.T.; Takemoto, K.

    1975-01-01

    Recently, a large quantity of vinyl chloride has been used as spraying additive for insecticide aerosols. Since January 1974 when the Food and Drug Administration of the United States of America announced that vinyl chloride causes liver cancer, it has been forbidden in Japan and the United States of America to market insecticide aerosol containers containing vinyl chloride. In Japan, following a government order, about 20 million insecticide aerosol containers have been collected and put into storage. A report is given on the radiation fixation of vinyl chloride as polyvinylchloride powder by gamma-ray-induced polymerization in the aerosol container. Insecticide aerosol containers containing vinyl chloride were irradiated by gamma rays from 60 Co at room temperature. Vinyl chloride polymerized to form powdered polymer in the container. Polymerization conversion increased with the irradiation dose, and after 10 Mrad irradiation, vinyl chloride was not found in the sprayed gas. This establishes that vinyl chloride can be fixed by gamma-ray irradiation in the aerosol container. To accelerate the reaction rate, the effect of various additives on the reaction was investigated. It was found that halogenated hydrocarbons, such as chloroform and carbon tetrachloride, accelerated the initiation of the polymerization, and that a vinyl monomer such as vinyl acetate accelerated the reaction rate due to the promotion of the initiation and the high reactivity of the polyvinylacetate radical to vinyl chloride. Consequently, the required irradiation dose for the fixation of vinyl chloride was decreased to less than 5 Mrad by the addition of various kinds of additives. Following the request of the Ministry of Public Welfare, various technical problems for large-scale treatment are being studied with the co-operation of the Federation of Insecticide Aerosols. (author)

  8. Agricultural insecticides threaten surface waters at the global scale.

    Science.gov (United States)

    Stehle, Sebastian; Schulz, Ralf

    2015-05-05

    Compared with nutrient levels and habitat degradation, the importance of agricultural pesticides in surface water may have been underestimated due to a lack of comprehensive quantitative analysis. Increasing pesticide contamination results in decreasing regional aquatic biodiversity, i.e., macroinvertebrate family richness is reduced by ∼30% at pesticide concentrations equaling the legally accepted regulatory threshold levels (RTLs). This study provides a comprehensive metaanalysis of 838 peer-reviewed studies (>2,500 sites in 73 countries) that evaluates, for the first time to our knowledge on a global scale, the exposure of surface waters to particularly toxic agricultural insecticides. We tested whether measured insecticide concentrations (MICs; i.e., quantified insecticide concentrations) exceed their RTLs and how risks depend on insecticide development over time and stringency of environmental regulation. Our analysis reveals that MICs occur rarely (i.e., an estimated 97.4% of analyses conducted found no MICs) and there is a complete lack of scientific monitoring data for ∼90% of global cropland. Most importantly, of the 11,300 MICs, 52.4% (5,915 cases; 68.5% of the sites) exceeded the RTL for either surface water (RTLSW) or sediments. Thus, the biological integrity of global water resources is at a substantial risk. RTLSW exceedances depend on the catchment size, sampling regime, and sampling date; are significantly higher for newer-generation insecticides (i.e., pyrethroids); and are high even in countries with stringent environmental regulations. These results suggest the need for worldwide improvements to current pesticide regulations and agricultural pesticide application practices and for intensified research efforts on the presence and effects of pesticides under real-world conditions.

  9. Insecticide resistance status of Aedes aegypti (L.) from Colombia.

    Science.gov (United States)

    Fonseca-González, Idalyd; Quiñones, Martha L; Lenhart, Audrey; Brogdon, William G

    2011-04-01

    To evaluate the insecticide susceptibility status of Aedes aegypti (L.) in Colombia, and as part of the National Network of Insecticide Resistance Surveillance, 12 mosquito populations were assessed for resistance to pyrethroids, organophosphates and DDT. Bioassays were performed using WHO and CDC methodologies. The underlying resistance mechanisms were investigated through biochemical assays and RT-PCR. All mosquito populations were susceptible to malathion, deltamethrin and cyfluthrin, and highly resistant to DDT and etofenprox. Resistance to lambda-cyhalothrin, permethrin and fenitrothion ranged from moderate to high in some populations from Chocó and Putumayo states. In Antioquia state, the Santa Fe population was resistant to fenitrothion. Biochemical assays showed high levels of both cytochrome P450 monooxygenases (CYP) and non-specific esterases (NSE) in some of the fenitrothion- and pyrethroid-resistant populations. All populations showed high levels of glutathione-S-transferase (GST) activity. GSTe2 gene was found overexpressed in DDT-resistant populations compared with Rockefeller susceptible strain. Differences in insecticide resistance status were observed between insecticides and localities. Although the biochemical assay results suggest that CYP and NSE could play an important role in the pyrethroid and fenitrothion resistance detected, other mechanisms remain to be investigated, including knockdown resistance. Resistance to DDT was high in all populations, and GST activity is probably the main enzymatic mechanism associated with this resistance. The results of this study provide baseline data on insecticide resistance in Colombian A. aegypti populations, and will allow comparison of changes in susceptibility status in this vector over time. Copyright © 2011 Society of Chemical Industry.

  10. Underpinning sustainable vector control through informed insecticide resistance management.

    Directory of Open Access Journals (Sweden)

    Edward K Thomsen

    Full Text Available There has been rapid scale-up of malaria vector control in the last ten years. Both of the primary control strategies, long-lasting pyrethroid treated nets and indoor residual spraying, rely on the use of a limited number of insecticides. Insecticide resistance, as measured by bioassay, has rapidly increased in prevalence and has come to the forefront as an issue that needs to be addressed to maintain the sustainability of malaria control and the drive to elimination. Zambia's programme reported high levels of resistance to the insecticides it used in 2010, and, as a result, increased its investment in resistance monitoring to support informed resistance management decisions.A country-wide survey on insecticide resistance in Zambian malaria vectors was performed using WHO bioassays to detect resistant phenotypes. Molecular techniques were used to detect target-site mutations and microarray to detect metabolic resistance mechanisms. Anopheles gambiae s.s. was resistant to pyrethroids, DDT and carbamates, with potential organophosphate resistance in one population. The resistant phenotypes were conferred by both target-site and metabolic mechanisms. Anopheles funestus s.s. was largely resistant to pyrethroids and carbamates, with potential resistance to DDT in two locations. The resistant phenotypes were conferred by elevated levels of cytochrome p450s.Currently, the Zambia National Malaria Control Centre is using these results to inform their vector control strategy. The methods employed here can serve as a template to all malaria-endemic countries striving to create a sustainable insecticide resistance management plan.

  11. Effects of emotional dissonance and job burnout on the psychological heath of the nursery teachers

    International Nuclear Information System (INIS)

    Choi, Kwang Il; Lee, Won Jae

    2016-01-01

    This study collected data from 467 nursery teachers and it aimed to investigate the association between mental health and emotional dissonance and job burnout of the day care nursery teachers. Measurement tool was developed, most of the questions having 5-point scale. The data were analyzed structural equation model with the statistical package IBM SPSS 23 and AMOS 21 with 5% percent of significance level. Main results are as follows. First, it was found that emotional dissonance of nursery teachers working in day care centers showed significant effect on the mental health such factors as job-stress (relationships with children and parents and work overload). Second, emotional dissonance were found to have a significant effect on job burnout, too. Third, job burnout had a significant effect on the mental health, job stress and psychological wellbeing. Fourth, job burnout was found to mediate partially on mental health and emotional dissonance. These findings suggest the importance of mental health promotion programs for child care teachers working in the day care centers

  12. Value orientations of students, future nursery-school teachers: Stability or change

    Directory of Open Access Journals (Sweden)

    Lazarević Dušanka A.

    2003-01-01

    Full Text Available Results are presented of investigations on value orientations of students future nursery-school teachers, as manifested by preferences of certain lifestyles. The aim was to examine if there is stability or change in the desirability of some lifestyles in three generations of students of Higher School for Nursery-School Teacher Training. Examinations were carried out on preferences of the following lifestyles: hedonistic, utilitarian altruistic, aesthetic, orientation to power and social standing, cognitive self-realization and Promethean activism. The obtained results indicate a certain stability in student value profile throughout the study period but also certain changes. In the value profile of future nursery-school teachers self-realization emerges consistently in the examined generations as the most desirable and accepted lifestyle. Then, the tendency to gradually decline was found in aesthetic, utilitarian, cognitive, altruistic Promethean, hedonistic and orientation to power and social standing lifestyles of which the last one consistently occurred in three generations as the least desirable lifestyle. Changes were manifested in the increasing desirability of utilitarian lifestyle from the first to the third generation as well as in gradual decline of desirability degree in self realization and aesthetic lifestyles. Also, the trend of increasing agreement between lifestyle students prefer and their current lifestyle was noticeable.

  13. Effects of emotional dissonance and job burnout on the psychological heath of the nursery teachers

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Kwang Il; Lee, Won Jae [Gachon University, Sungnam (Korea, Republic of)

    2016-12-15

    This study collected data from 467 nursery teachers and it aimed to investigate the association between mental health and emotional dissonance and job burnout of the day care nursery teachers. Measurement tool was developed, most of the questions having 5-point scale. The data were analyzed structural equation model with the statistical package IBM SPSS 23 and AMOS 21 with 5% percent of significance level. Main results are as follows. First, it was found that emotional dissonance of nursery teachers working in day care centers showed significant effect on the mental health such factors as job-stress (relationships with children and parents and work overload). Second, emotional dissonance were found to have a significant effect on job burnout, too. Third, job burnout had a significant effect on the mental health, job stress and psychological wellbeing. Fourth, job burnout was found to mediate partially on mental health and emotional dissonance. These findings suggest the importance of mental health promotion programs for child care teachers working in the day care centers.

  14. Novel flow-through bioremediation system for removing nitrate from nursery discharge water.

    Science.gov (United States)

    Chris Wilson, P; Albano, Joseph P

    2013-11-30

    Nitrate losses in surface runoff water from nursery production areas can be significant. This study evaluated the potential use of microbial-based (denitrification), flow-through bioreactors for their nitrate-remediation ability. Duplicate bioreactor systems were constructed at a local foliage plant nursery. Each bioreactor system consisted of four 242 L tanks with connections alternating between bottom and top. Each tank was filled with approximately 113 L of Kaldness media to provide surface area for attachment of native microflora. Molasses was supplied as a carbon source for denitrification and water flow rates through the systems ranged from 5 to 18 L min(-1) during tests. Automatic water samplers were used to collect composite samples every 15 min from both the inflow and the exit flow water. Results indicate consistent removal of 80-100% of the nitrate flowing into the systems. Accumulation of ammoniacal and nitrite nitrogen did not occur, indicating that the nitrate-nitrogen was removed from the water, and not simply transformed into another water-soluble species. Occasions where removal rates were less than 80% were usually traced to faulty delivery of the carbon source. Results indicate that modular microbial-based bioremediation systems may be a useful tool for helping water managers meet stringent nitrogen water quality regulations, especially at nurseries with limited space for expansion of water retention facilities. Copyright © 2013 Elsevier Ltd. All rights reserved.

  15. [Work-related stress in nursery school educators in the Venice and Marghera districts].

    Science.gov (United States)

    Camerino, Donatella; Fichera, G P; Punzi, Silvia; Campanini, P; Conway, P M; Prevedello, Laura; Costa, G

    2011-01-01

    Based on an investigation on organizational well-being in the Municipality of Venice (2009), we examined 110 public nursery school and preschool teachers working in the Venice and Marghera districts. The aim of this study was to develop and implement a procedure for work-related stress assessment and management in Municipality of Venice, in the light of Law 81/2008. Occupational stress and its impact on teachers' well-being and health were assessed by means of self-administered questionnaires and semi-structured interviews. Descriptive analyses were conducted to compare teachers' data with those concerning employees operating in other services in the Venice and Marghera districts. According to the results, while nursery school and preschool teachers work with considerable commitment, vigor, dedication and involvement, problems were observed related to: assignment of administrative tasks without appropriate support from the district offices; difficult access to support services; shortage of temporary teachers and auxiliary personnel and, limited to some facilities, lack of adequate physical space devoted to teaching activities. Such adverse conditions result in an increase in vigilance levels required to ensure children's safety. Personnel also suffer from a lack of career prospects, with scarce opportunities for contact with other facilities in the area and inadequate involvement in the decisional processes at Municipality level. Improving such adverse conditions could solve the current marginalization of public nursery school and preschool teachers and encourage mutual exchange of information, which would in turn favour more appropriate methods of managing each single facility.

  16. Morphological and photosynthetic adaptations of Tabebuia aurea seedlings in the nursery

    Directory of Open Access Journals (Sweden)

    Eduardo R Gonçalves

    2013-11-01

    Full Text Available Tabebuia aurea (Benth. & Hook. f. ex S. Moore (Bignoniaceae is a boreal species common in Brazil. It is used for ornamental parks and along sidewalks. Its timber is also used for furniture. The objective of this study was to evaluate the effect of nursery shading on the growth and photosynthesis of T. aurea and their photosynthetic adaptation after being transferred to direct sunlight. The T. aurea seedlings were grown under 0, 50, 70 or 95% shade. The photosynthetic active radiation and leaf gas exchange were measured over two distinct periods: 51 (young seedlings and 70 days after having been sown under each shade treatment. Immediately after the measurements were taken, the seedlings were transferred into full sunlight and the measurements were repeated two times after 15 min and 3 days under ambient sunlight. T. aurea seedlings showed satisfactory growth up to 50% shade in the nursery, which could be verified both by growth measurement and by total biomass accumulation. Shading greater than 70% reduced the number of leaves, the leaf area and the stem diameter in relation to plants exposed to full sunlight. The results suggest that T. aurea seedlings should be grown under full sunlight or under shading up to 50% to maximize their growth in the nursery and to minimize stress when transferring the seedlings to their final planting sites.

  17. Negotiating Care in the Special Care Nursery: Parents' and Nurses' Perceptions of Nurse-Parent Communication.

    Science.gov (United States)

    Jones, Liz; Taylor, Tara; Watson, Bernadette; Fenwick, Jennifer; Dordic, Tatjana

    2015-01-01

    Nursing staff are an important source of support for parents of a hospitalized preterm infant. This study aimed to describe parents' and nurses' perceptions of communicating with each other in the context of the special care nursery. A qualitative descriptive design was employed. Thirty two parents with a newborn admitted to one of two special care nurseries in Queensland, Australia participated, and 12 nurses participated in semi-structured interviews. Thematic analysis was used to analyze the interviews. Nurses and parents focused on similar topics, but their perceptions differed. Provision of information and enabling parenting were central to effective communication, supported by an appropriate interpersonal style by nurses. Parents described difficulties accessing or engaging nurses. Managing enforcement of policies was a specific area of difficulty for both parents and nurses. The findings indicated a tension between providing family-centered care that is individualized and based on family needs and roles, and adhering to systemic nursery policies. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Habitat quality of a subarctic nursery ground for 0-group plaice ( Pleuronectes platessa L.)

    Science.gov (United States)

    Freitas, Vânia; Campos, Joana; Skreslet, Stig; van der Veer, Henk W.

    2010-07-01

    Habitat quality of a subarctic nursery ground in northern Norway for 0-group plaice Pleuronectes platessa was investigated by following settlement, mortality and growth during 2005 and 2006. Newly settled individuals were first observed in the end of May to early June and settlement lasted until mid-July. Densities peaked in early July and were comparable to those reported in temperate nursery grounds. Mortality estimates after settlement differed between 0.062 d -1 in 2005 and 0.025 d -1 in 2006. Potential predators appeared to be rather similar as those reported in other areas: the brown shrimp Crangoncrangon, the shore crab Carcinus maenas and demersal fish species (gadoids). Population mean growth indicated linear growth until August leveling-off afterwards. 0-group plaice reached a lower mean size (5-6 cm) at the end of the growing season than in temperate areas probably due to later settlement timing in combination with lower summer-autumn water temperatures. The comparison of observed growth rates with predictions of maximum growth models indicated a similar pattern as observed in temperate nursery grounds: Growth appeared to be maximal except for the period after summer. Whether or not this was related to changes in food quality throughout the season, to interspecies competition or to emigration remains to be elucidated.

  19. Children using Day Nurseries' Facilities can be Associated with more Risk to Nonnutritive Sucking Habits.

    Science.gov (United States)

    Alves, Fabiana Bt; Wambier, Denise S; Alvarez, Jenny Ha; da Rocha, José Cf; Kummer, Thais R; de Castro, Vanessa C; Cabral, Howard; Kozlowski, Vitoldo A

    2016-09-01

    This study evaluated the expression of nonnutritive sucking habits and the presence of malocclusion in children using day nurseries' facilities. The 195 children (7-40 months) attending 18 public day nurseries were evaluated clinically in Ponta Grossa, Brazil. Statistical package software was used for descriptive, univariate, bivariate, and multiple logistic regressions of the data about the socioeconomic condition, educational family status, malocclusions, and prevalence of nonnutritive sucking habits among the children. The pacifier users had a statistically significant, explanatory association with open bite [odds ratio (OR) = 10.97; 95% confidence interval (CI): 4.95, 24.31; p < 0.0001]. The children older than 25 months had more open bite than younger children (OR = 6.07; 95% CI: 2.81, 13.11; p < 0.0001). Of the children examined, 35.4% had an anterior open bite, 0.51% had posterior cross-bite, and 1.03% showed finger-sucking habits. A high frequency of pacifier-sucking habits was found (52%), with a significant association between this habit and anterior open bite (p < 0.0001, OR = 7.49; 95% CI: 3.71, 15.15). The 126 children without open bite (36.5%) were pacifier users. There was suggestive, though nonsignificant, evidence of a difference in pacifier use by gender (males, 34%; females, 46%; p = 0.07). The 69 children with open bite (81.16%) were pacifier users and (18.84%) nonusers. The boys showed a slightly greater association with open bite (OR = 21.33; 95% CI: 6.12, 74.40; p < 0.0001) than girls (OR = 5.03; 95% CI: 1.26, 20.00; p = 0.02) in the age group of 25 to 40 months; however, it was not observed in younger children. Pacifier use is a predictor for open bite in children from the lower socioeconomic classes using day nurseries' facilities. The parents, guardians, and caregivers working in public day nurseries should be advised to monitor nonnutritive sucking habits in order to avoid or minimize the occurrence of malocclusion. It demonstrates that

  20. Impact of malaria related messages on insecticide-treated net (ITN) use for malaria prevention in Ghana

    OpenAIRE

    Owusu Adjah, Ebenezer S; Panayiotou, Andrie G

    2014-01-01

    Background: Media messages have been used in Ghana to promote insecticide-treated net (ITN)/bed net usage in an effort to impact on malaria prevention. The aim of this study was to assess the effect of such malaria-related messages delivered through electronic/print media and by volunteers/health workers on the use of ITNs by children living in a household. Methods: Data was collected from September to November of 2008 using a structured, interviewer-administered questionnaire by the Ghana St...

  1. Revealing critical mechanisms of BR-mediated apple nursery tree growth using iTRAQ-based proteomic analysis.

    Science.gov (United States)

    Zheng, Liwei; Ma, Juanjuan; Zhang, Lizhi; Gao, Cai; Zhang, Dong; Zhao, Caiping; Han, Mingyu

    2018-02-20

    Brassinosteroid is identified as an important hormone. However, information about brassinosteroid has not been fully elucidated, and few studies concerned its role in apple. The aim of this work was to study the role of brassinosteroid for apple tree growth. In our study, the effect of brassinosteroid on apple nursery tree was analyzed. The biomass, cell size and xylem content of apple nursery tree were obviously evaluated by brassinosteroid treatment; mineral elements contents, photosynthesis indexes, carbohydrate level and hormone contents were significantly high in brassinosteroid treated trees. To explore the molecular mechanisms of these phenotypic differences, iTRAQ-based quantitative proteomics were used to identify the expression profiles of proteins in apple nursery tree shoot tips in response to brassinosteroid at a key period (14days after brassinosteroid treatment). A total of 175 differentially expressed proteins were identified. They were mainly involved in chlorophyII biosynthesis, photosynthesis, carbohydrate metabolism, glycolysis, citric acid cycle, respiratory action, hormone signal, cell growth and ligin metabolism. The findings in this study indicate that brassinosteroid mediating apple nursery tree growth may be mainly through energy metabolism. Important biological processes identified here can be useful theoretical basis and provide new insights into the molecular mechanisms of brassinosteroid. Brassinosteroid is very important for plant growth and development. However, the molecular mechanism of brassinosteroid mediating growth process is not perfectly clear in plant, especially in apple nursery tree. We used a combination of physiological and bioinformatics analysis to investigate the effects of brassinosteroid on apple nursery tree growth and development. The data reported here demonstrated that brassinosteroid regulates apple nursery tree growth mainly through energy metabolism. Therefore it can provide a theoretical basis from energy

  2. Effect of cleaning and disinfection of toys on infectious diseases and micro-organisms in daycare nurseries.

    Science.gov (United States)

    Ibfelt, T; Engelund, E H; Schultz, A C; Andersen, L P

    2015-02-01

    The rising number of children in daycare nurseries increases opportunities for the transmission of infectious diseases. Pathogens may be transmitted directly from child to child via sneezing, coughing and touching, or indirectly via the environment. Toys are among the fomites with the highest pathogen load, but their role in disease transmission is unknown. To determine if washing and disinfection of toys can reduce sickness absence and microbial pathogen load in the nursery environment. Twelve nurseries (caring for 587 children) were randomized to intervention and control groups. The intervention consisted of washing and disinfection of toys and linen every two weeks for three months by a commercial cleaning company. The extent and causes of sickness absence among the children were recorded in both groups before and after introduction of the intervention. Ten sampling points in each nursery were examined for bacteria and respiratory viruses. The presence of respiratory virus DNA/RNA was widespread, but very few pathogenic bacteria were found in the environment. The intervention reduced the presence of adenovirus [odds ratio (OR) 2.4, 95% confidence interval (CI) 1.1-5.0], rhinovirus (OR 5.3, 95% CI 2.3-12.4) and respiratory syncytial virus (OR 4.1, 95% CI 1.5-11.2) compared with the control group, but the intervention had no effect on sickness absence or disease patterns in the nurseries. Although cleaning and disinfection of toys every two weeks can decrease the microbial load in nurseries, it does not appear to reduce sickness absence among nursery children. Copyright © 2014 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  3. Probabilistic risk assessment of insecticide concentrations in agricultural surface waters: a critical appraisal.

    Science.gov (United States)

    Stehle, Sebastian; Knäbel, Anja; Schulz, Ralf

    2013-08-01

    Due to the specific modes of action and application patterns of agricultural insecticides, the insecticide exposure of agricultural surface waters is characterized by infrequent and short-term insecticide concentration peaks of high ecotoxicological relevance with implications for both monitoring and risk assessment. Here, we apply several fixed-interval strategies and an event-based sampling strategy to two generalized and two realistic insecticide exposure patterns for typical agricultural streams derived from FOCUS exposure modeling using Monte Carlo simulations. Sampling based on regular intervals was found to be inadequate for the detection of transient insecticide concentrations, whereas event-triggered sampling successfully detected all exposure incidences at substantially lower analytical costs. Our study proves that probabilistic risk assessment (PRA) concepts in their present forms are not appropriate for a thorough evaluation of insecticide exposure. Despite claims that the PRA approach uses all available data to assess exposure and enhances risk assessment realism, we demonstrate that this concept is severely biased by the amount of insecticide concentrations below detection limits and therefore by the sampling designs. Moreover, actual insecticide exposure is of almost no relevance for PRA threshold level exceedance frequencies and consequential risk assessment outcomes. Therefore, we propose a concept that features a field-relevant ecological risk analysis of agricultural insecticide surface water exposure. Our study quantifies for the first time the environmental and economic consequences of inappropriate monitoring and risk assessment concepts used for the evaluation of short-term peak surface water pollutants such as insecticides.

  4. Occurrence of Indoor VOCs in Nursery School - Case Study

    Science.gov (United States)

    Juhasova Senitkova, Ingrid

    2017-10-01

    Children’s exposure to air pollutants is an important public health challenge. Particular attention should be paid to preschools because younger children are more vulnerable to air pollution than higher grade children and spend more time indoors. The concentrations of volatile organic compounds (VOCs) as well as carbon dioxide (CO2) concentrations in younger and older children’s classrooms during the winter season were studied. An electronic nose based on gas chromatography was used for the analysis of individual VOCs and a photoionization detector with a UV lamp was used for the determination of total volatile organic compounds (TVOC) concentration. Continuous measurements of CO2 concentrations both inside classrooms and outside each building were performed using automatic portable monitors. Improving ventilation, decreasing the occupancy per room and completing cleaning activities following occupancy periods can contribute to alleviating high CO2 and VOCs occurrence levels.

  5. The effects of the pyrethroid insecticide, bifenthrin, on steroid hormone levels and gonadal development of steelhead (Oncorhynchus mykiss) under hypersaline conditions.

    Science.gov (United States)

    Forsgren, Kristy L; Riar, Navneet; Schlenk, Daniel

    2013-06-01

    The San Francisco Bay Estuary and Sacramento-San Joaquin Delta (Bay-Delta) is an important breeding and nursery ground for fish. Of particular interest are salmonids that migrate through fresh and saltwater areas polluted with various contaminants including bifenthrin, a widely used pyrethroid insecticide. Male steelhead (Oncorhynchus mykiss) exposed to bifenthrin (0.1 and 1.5μg/L) for two weeks had a lower gonadosomatic index (GSI) in freshwater but were not affected by concurrent bifenthrin exposure and saltwater acclimation. Plasma estradiol-17β (E2) levels and ovarian follicle diameter of fish exposed to bifenthrin (0.1 and 1.5μg/L) in freshwater significantly increased. Under hypersaline conditions, fish exposed to bifenthrin had significantly reduced E2 levels and smaller follicles, and unhealthy ovarian follicles were observed. Given the occurrence of bifenthrin in surface waters of the Bay Delta, understanding the impact of bifenthrin on wildlife is necessary for improving risk assessments of pyrethroids in this important ecosystem. Copyright © 2013 Elsevier Inc. All rights reserved.

  6. A potential target for organophosphate insecticides leading to spermatotoxicity.

    Science.gov (United States)

    Suzuki, Himiko; Tomizawa, Motohiro; Ito, Yuki; Abe, Keisuke; Noro, Yuki; Kamijima, Michihiro

    2013-10-16

    Organophosphate (OP) insecticides as an anticholinesterase also act on the diverse serine hydrolase targets, thereby revealing secondary or unexpected toxic effects including male reproductive toxicity. The present investigation detects a possible target molecule(s) for OP-induced spermatotoxicity (sperm deformity, underdevelopment, and reduced motility) from a chemical standpoint. The activity-based protein profiling (ABPP) approach with a phosphonofluoridate fluorescent probe pinpointed the molecular target for fenitrothion (FNT, a major OP insecticide) oxon (bioactive metabolite of FNT) in the mouse testicular membrane proteome, i.e., FNT oxon phosphorylates the fatty acid amide hydrolase (FAAH), which plays pivotal roles in spermatogenesis and sperm motility acquirement. Subsequently, mice were treated orally with vehicle or FNT for 10 days, and FAAH activity in testis or epididymis cauda was markedly reduced by the subacute exposure. ABPP analysis revealed that FAAH was selectively inhibited among the FNT-treated testicular membrane proteome. Accordingly, FAAH is a potential target for OP-elicited spermatotoxicity.

  7. Voltage-gated sodium channels as targets for pyrethroid insecticides.

    Science.gov (United States)

    Field, Linda M; Emyr Davies, T G; O'Reilly, Andrias O; Williamson, Martin S; Wallace, B A

    2017-10-01

    The pyrethroid insecticides are a very successful group of compounds that have been used extensively for the control of arthropod pests of agricultural crops and vectors of animal and human disease. Unfortunately, this has led to the development of resistance to the compounds in many species. The mode of action of pyrethroids is known to be via interactions with the voltage-gated sodium channel. Understanding how binding to the channel is affected by amino acid substitutions that give rise to resistance has helped to elucidate the mode of action of the compounds and the molecular basis of their selectivity for insects vs mammals and between insects and other arthropods. Modelling of the channel/pyrethroid interactions, coupled with the ability to express mutant channels in oocytes and study function, has led to knowledge of both how the channels function and potentially how to design novel insecticides with greater species selectivity.

  8. Synthesis and Insecticidal Activities of Novel Phthalic Acid Diamides

    Institute of Scientific and Technical Information of China (English)

    闫涛; 李玉新; 李永强; 王多义; 陈伟; 刘卓; 李正名

    2012-01-01

    In order to discover novel insecticides with the new action mode on ryanodine receptor (RyR), a series of novel phthalic acid diamide derivatives were designed and synthesized. All compounds were characterized by 1H NMR spectra and HRMS. The preliminary results of biological activity assessment indicated that some title compounds exhibited excellent insecticidal activities against Mythimna separata, Spodoptera exigua, and Plutella xylostella. The title compound 3-nitro-N-cyclopropyl-N'-[2-methyl-4-(perfluoropropan-2-yl)phenyl]phthalamidte (4a) was more efficient against diamondback moths than the control (chlorantraniliprole). The effects of some title compounds on intracellular calcium of neurons from the Spodoptera exigua proved that the title compounds were RyR activators.

  9. Sorption and desorption of insecticides in Brazilian soils

    International Nuclear Information System (INIS)

    Luchini, L.C.; Lord, K.A.; Ruegg, E.F.

    1980-01-01

    The sorption from aqueous solution of ten Brazilian soil types of four organochlorine, two organophosphorus and one carbamate insecticide was determined in the laboratory using gas chromatographic and radiometric techniques. Measurements showed that soils richest in organic matter, sorbed all substances except aldrin more strongly than the other soils. DDT was the most and aldrin the least sorbed organochlorine pesticide, being dieldrin sorbed two to four times more strongly than aldrin. Sorption of lindane varied in different soils. The organophosphate insecticides malathion and parathion were strongly sorbed in the soils richest in organic matter and weakly sorbed in the poorest soils heing moderately sorbed by the other soils. Sorption of carbaryl by all soils is small. Lindane was desorbed from the soil richest in organic matter and the extent of desorption was dependent on the sorption time. (Author) [pt

  10. Fipronil insecticide: novel photochemical desulfinylation with retention of neurotoxicity

    International Nuclear Information System (INIS)

    Hainzl, D.; Casida, J.E.

    1996-01-01

    Fipronil is an outstanding new insecticide for crop protection with good selectivity between insects and mammals. The insecticidal action involves blocking the gamma-aminobutyric acid-gated chloride channel with much greater sensitivity of this target in insects than in mammals. Fipronil contains a trifluoromethylsulfinyl moiety that is unique among the agrochemicals and therefore presumably important in its outstanding performance. We find that this substituent unexpectedly undergoes a novel and facile photoextrusion reaction on plants upon exposure to sunlight, yielding the corresponding trifluoromethylpyrazole, i.e., the desulfinyl derivative. The persistence of this photoproduct and its high neuroactivity, resulting from blocking the gamma-aminobutyric acid-gated chloride channel, suggest that it may be a significant contributor to the effectiveness of fipronil. In addition, desulfinylfipronil is not a metabolite in mammals, so the safety evaluations must take into account not only the parent compound but also this completely new environmental product

  11. Effect of cleaning and disinfection of toys on infectious diseases and micro-organisms in daycare nurseries

    DEFF Research Database (Denmark)

    Ibfelt, T.; Engelund, E. H.; Schultz, Anna Charlotte

    2015-01-01

    Background: The rising number of children in daycare nurseries increases opportunities for the transmission of infectious diseases. Pathogens may be transmitted directly from child to child via sneezing, coughing and touching, or indirectly via the environment. Toys are among the fomites with the......Background: The rising number of children in daycare nurseries increases opportunities for the transmission of infectious diseases. Pathogens may be transmitted directly from child to child via sneezing, coughing and touching, or indirectly via the environment. Toys are among the fomites...... with the highest pathogen load, but their role in disease transmission is unknown. Aim: To determine if washing and disinfection of toys can reduce sickness absence and microbial pathogen load in the nursery environment. Methods: Twelve nurseries (caring for 587 children) were randomized to intervention...... sampling points in each nursery were examined for bacteria and respiratory viruses. Results: The presence of respiratory virus DNA/RNA was widespread, but very few pathogenic bacteria were found in the environment. The intervention reduced the presence of adenovirus [odds ratio (OR) 2.4, 95% confidence...

  12. Shallow rocky nursery habitat for fish: Spatial variability of juvenile fishes among this poorly protected essential habitat.

    Science.gov (United States)

    Cheminée, Adrien; Rider, Mary; Lenfant, Philippe; Zawadzki, Audrey; Mercière, Alexandre; Crec'hriou, Romain; Mercader, Manon; Saragoni, Gilles; Neveu, Reda; Ternon, Quentin; Pastor, Jérémy

    2017-06-15

    Coastal nursery habitats are essential for the renewal of adult fish populations. We quantified the availability of a coastal nursery habitat (shallow heterogeneous rocky bottoms) and the spatial variability of its juvenile fish populations along 250km of the Catalan coastline (France and Spain). Nurseries were present in 27% of the coastline, but only 2% of them benefited from strict protection status. For nine taxa characteristic of this habitat, total juvenile densities varied significantly between nursery sites along the coastline, with the highest densities being found on the northern sites. Recruitment level (i.e. a proxy of nursery value) was not explained by protection level, but it was moderately and positively correlated with an anthropization index. Patterns of spatial variations were taxa-specific. Exceptional observations of four juveniles of the protected grouper Epinephelus marginatus were recorded. Our data on habitat availability and recruitment levels provides important informations which help to focus MPA management efforts. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Biosynthesis of zinc oxide nanoparticles using leaf extract of Calotropis gigantea: characterization and its evaluation on tree seedling growth in nursery stage

    Science.gov (United States)

    Chaudhuri, Sadhan Kumar; Malodia, Lalit

    2017-11-01

    Green synthesis of zinc oxide nanoparticles was carried out using Calotropis leaf extract with zinc acetate salt in the presence of 2 M NaOH. The combination of 200 mM zinc acetate salt and 15 ml of leaf extract was ideal for the synthesis of less than 20 nm size of highly monodisperse crystalline nanoparticles. Synthesized nanoparticles were characterized through UV-Vis spectroscopy, dynamic light scattering (DLS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), EDX (energy dispersive X-ray), and AFM (atomic force microscopy). Effects of biogenic zinc oxide (ZnO) nanoparticles on growth and development of tree seedlings in nursery stage were studied in open-air trenches. The UV-Vis absorption maxima showed peak near 350 nm, which is characteristic of ZnO nanoparticles. DLS data showed that single peak is at 11 nm (100%) and Polydispersity Index is 0.245. XRD analysis showed that these are highly crystalline ZnO nanoparticles having an average size of 10 nm. FTIR spectra were recorded to identify the biomolecules involved in the synthesis process, which showed absorption bands at 4307, 3390, 2825, 871, 439, and 420 cm-1. SEM images showed that the particles were spherical in nature. The presence of zinc and oxygen was confirmed by EDX and the atomic % of zinc and oxygen were 33.31 and 68.69, respectively. 2D and 3D images of ZnO nanoparticles were obtained by AFM studies, which indicated that these are monodisperse having size ranges between 1.5 and 8.5 nm. Significant enhancement of growth was observed in Neem ( Azadirachta indica), Karanj ( Pongamia pinnata), and Milkwood-pine ( Alstonia scholaris) seedlings in foliar spraying ZnO nanoparticles to nursery stage of tree seedlings. Out of the three treated saplings, Alstonia scholaris showed maximum height development.

  14. The impact of insecticides to local honey bee colony Apis cerana indica in laboratory condition

    Science.gov (United States)

    Putra, Ramadhani E.; Permana, Agus D.; Nuriyah, Syayidah

    2014-03-01

    Heavy use of insecticides considered as one of common practice at local farming systems. Even though many Indonesian researchers had stated the possible detrimental effect of insecticide on agriculture environment and biodiversity, researches on this subject had been neglected. Therefore, our purpose in this research is observing the impact of insecticides usage by farmer to non target organisme like local honey bee (Apis cerana indica), which commonly kept in area near agriculture system. This research consisted of field observations out at Ciburial, Dago Pakar, Bandung and laboratory tests at School of Life Sciences and Technology, Institut Teknologi Bandung. The field observations recorded visited agriculture corps and types of pollen carried by bees to the nest while laboratory test recorderd the effect of common insecticide to mortality and behavior of honey bees. Three types of insecticides used in this research were insecticides A with active agent Chlorantraniliprol 50 g/l, insecticide B with active agent Profenofos 500 g/l, and insecticides C with active agent Chlorantraniliprol 100 g/l and λ-cyhalotrin 50g/l. The results show that during one week visit, wild flower, Wedelia montana, visited by most honey bees with average visit 60 honey bees followed by corn, Zea mays, with 21 honey bees. The most pollen carried by foragers was Wedelia montana, Calliandra callothyrsus, and Zea mays. Preference test show that honeybees tend move to flowers without insecticides as the preference to insecticides A was 12.5%, insecticides B was 0%, and insecticides was C 4.2%. Mortality test showed that insecticides A has LD50 value 0.01 μg/μl, insecticide B 0.31 μg/μl, and insecticides C 0.09 μg/μl which much lower than suggested dosage recommended by insecticides producer. This research conclude that the use of insecticide could lower the pollination service provide by honey bee due to low visitation rate to flowers and mortality of foraging bees.

  15. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Matowo Pc

    91.5% (n=483) and An. funestus group was 8.5% (n=45). ..... Chitnis, N., Churcher, T., Donnelly, M.J., Ghani, A.C., Godfray, H.C.J., Gould, F., Hastings, ... Efficacy, persistence and vector susceptibility to pirimiphos-methyl (Actellic® 300CS) insecticide ... Macoris, M.L., Andrighetti, M.T.M., Wanderley, D.M.V. & Ribolla, P.E.M. ...

  16. A critical review of neonicotinoid insecticides for developmental neurotoxicity

    Science.gov (United States)

    Sheets, Larry P.; Li, Abby A.; Minnema, Daniel J.; Collier, Richard H.; Creek, Moire R.; Peffer, Richard C.

    2016-01-01

    Abstract A comprehensive review of published and previously unpublished studies was performed to evaluate the neonicotinoid insecticides for evidence of developmental neurotoxicity (DNT). These insecticides have favorable safety profiles, due to their preferential affinity for nicotinic receptor (nAChR) subtypes in insects, poor penetration of the mammalian blood–brain barrier, and low application rates. Nevertheless, examination of this issue is warranted, due to their insecticidal mode of action and potential exposure with agricultural and residential uses. This review identified in vitro, in vivo, and epidemiology studies in the literature and studies performed in rats in accordance with GLP standards and EPA guidelines with imidacloprid, acetamiprid, thiacloprid, clothianidin, thiamethoxam, and dinotefuran, which are all the neonicotinoids currently registered in major markets. For the guideline-based studies, treatment was administered via the diet or gavage to primiparous female rats at three dose levels, plus a vehicle control (≥20/dose level), from gestation day 0 or 6 to lactation day 21. F1 males and females were evaluated using measures of motor activity, acoustic startle response, cognition, brain morphometry, and neuropathology. The principal effects in F1 animals were associated with decreased body weight (delayed sexual maturation, decreased brain weight, and morphometric measurements) and acute toxicity (decreased activity during exposure) at high doses, without neuropathology or impaired cognition. No common effects were identified among the neonicotinoids that were consistent with DNT or the neurodevelopmental effects associated with nicotine. Findings at high doses were associated with evidence of systemic toxicity, which indicates that these insecticides do not selectively affect the developing nervous system. PMID:26513508

  17. Usage Possibilities of Insecticide Effective Biocidals in Organic Agriculture

    OpenAIRE

    Şimşek, Muharrem; Yağcı, Mürşide; Yaşarer, Haluk

    2016-01-01

    In conventional agriculture it is aimed that mainly increase in the amount of products, synthetic chemicals and fertilizers are used extensively to provide it. Today, terms such as safe food, human and environment health have become more important. Therefore, it is necessary to increase the share of organic agriculture which have less negative impacts to human health and environment, and sustainable use of natural resources. Herein environmentally insecticide effective biocidals to pest contr...

  18. Chemical Composition, Antifungal and Insecticidal Activities of Hedychium Essential Oils

    Science.gov (United States)

    2013-04-11

    Hedychiums have been reported to possess antibacterial, antifungal, and insecticidal activities [4,5]. Strawberry anthracnose, caused by the plant...pathogens Colletotrichum species is one of the most important diseases affecting strawberries worldwide [6]. Colletotrichum fragariae Brooks is most...often associated with anthracnose crown rot of strawberries grown in hot, humid areas such as the southeastern United States [7]. The azalea lace bug

  19. Cytochrome P450 monooxygenases and insecticide resistance in insects.

    OpenAIRE

    Bergé, J B; Feyereisen, R; Amichot, M

    1998-01-01

    Cytochrome P450 monooxygenases are involved in many cases of resistance of insects to insecticides. Resistance has long been associated with an increase in monooxygenase activities and with an increase in cytochrome P450 content. However, this increase does not always account for all of the resistance. In Drosophila melanogaster, we have shown that the overproduction of cytochrome P450 can be lost by the fly without a corresponding complete loss of resistance. These results prompted the seque...

  20. Culminating anti-malaria efforts at long lasting insecticidal net?

    Directory of Open Access Journals (Sweden)

    Sunil Dhiman

    2014-11-01

    Full Text Available Summary: Background: Long-lasting insecticidal nets (LLINs are a primary method in malaria control efforts. However, a decline in the biological efficacy and physical integrity over a period of comparatively lesser time than claimed, waning of naturally acquired immunity among regular users and misuse of LLINs are serious concerns. Search and selection of literature: The literature for the current review was searched in PubMed, SCOPUS Database and Google using combined search strings of related key-words. Literature with sufficient data and information on the current subject was selected to reach a valid conclusion. Findings: The World Health Organization (WHO has emphasized that LLINs should be considered a public good for people inhabiting malaria endemic settings. LLINs exhibited a cumulative effect on the vector density and may force anthropophilic mosquito vectors to find alternative animal hosts for blood meal. However, the physical integrity and biological activity of LLINs declines faster than the anticipated time due to different operational conditions and the spread of insecticide resistance. LLINs have been successful in reducing malaria incidences by either reducing or not allowing human exposure to the vector mosquitoes, but at the same time, LLINs debilitate the natural protective immunity against malaria parasite. Misuse of LLINs for deviant purposes is common and is a serious environmental concern, as people believe that traditional methods of prevention against malaria that have enabled them to survive through a long time are effective and sufficient. Moreover, people are often ill-informed regarding the toxic effects of LLINs. Conclusions: Specific criteria for determining the serviceable life and guidelines on the safe washing and disposal of LLINs need to be developed, kept well-informed and closely monitored. Malaria case management, environment management and community awareness to reduce the misuse of LLINs are crucial

  1. Chloride channels as tools for developing selective insecticides.

    Science.gov (United States)

    Bloomquist, Jeffrey R

    2003-12-01

    Ligand-gated chloride channels underlie inhibition in excitable membranes and are proven target sites for insecticides. The gamma-aminobutyric acid (GABA(1)) receptor/chloride ionophore complex is the primary site of action for a number of currently used insecticides, such as lindane, endosulfan, and fipronil. These compounds act as antagonists by stabilizing nonconducting conformations of the chloride channel. Blockage of the GABA-gated chloride channel reduces neuronal inhibition, which leads to hyperexcitation of the central nervous system, convulsions, and death. We recently investigated the mode of action of the silphinenes, plant-derived natural compounds that structurally resemble picrotoxinin. These materials antagonize the action of GABA on insect neurons and block GABA-mediated chloride uptake into mouse brain synaptoneurosomes in a noncompetitive manner. In mammals, avermectins have a blocking action on the GABA-gated chloride channel consistent with a coarse tremor, whereas at longer times and higher concentrations, activation of the channel suppresses neuronal activity. Invertebrates display ataxia, paralysis, and death as the predominant signs of poisoning, with a glutamate-gated chloride channel playing a major role. Additional target sites for the avermectins or other chloride channel-directed compounds might include receptors gated by histamine, serotonin, or acetylcholine.The voltage-sensitive chloride channels form another large gene family of chloride channels. Voltage-dependent chloride channels are involved in a number of physiological processes including: maintenance of electrical excitability, chloride ion secretion and resorption, intravesicular acidification, and cell volume regulation. A subset of these channels is affected by convulsants and insecticides in mammals, although the role they play in acute lethality in insects is unclear. Given the wide range of functions that they mediate, these channels are also potential targets for

  2. Sucrose Improves Insecticide Activity Against Drosophila suzukii (Diptera: Drosophilidae).

    Science.gov (United States)

    Cowles, Richard S; Rodriguez-Saona, Cesar; Holdcraft, Robert; Loeb, Gregory M; Elsensohn, Johanna E; Hesler, Steven P

    2015-04-01

    The addition of sucrose to insecticides targeting spotted wing drosophila, Drosophila suzukii (Matsumura), enhanced lethality in laboratory, semifield, and field tests. In the laboratory, 0.1% sucrose added to a spray solution enhanced spotted wing drosophila feeding. Flies died 120 min earlier when exposed to spinosad residues at label rates enhanced with sucrose. Added sucrose reduced the LC50 for dried acetamiprid residues from 82 to 41 ppm in the spray solution. Laboratory bioassays of spotted wing drosophila mortality followed exposure to grape and blueberry foliage and/or fruit sprayed and aged in the field. On grape foliage, the addition of 2.4 g/liter of sugar with insecticide sprays resulted in an 11 and 6% increase of spotted wing drosophila mortality at 1 and 2 d exposures to residues, respectively, averaged over seven insecticides with three concentrations. In a separate experiment, spinetoram and cyantraniliprole reduced by 95-100% the larval infestation of blueberries, relative to the untreated control, 7 d after application at labeled rates when applied with 1.2 g/liter sucrose in a spray mixture, irrespective of rainfall; without sucrose infestation was reduced by 46-91%. Adding sugar to the organically acceptable spinosyn, Entrust, reduced larval infestation of strawberries by >50% relative to without sugar for five of the six sample dates during a season-long field trial. In a small-plot field test with blueberries, weekly applications in alternating sprays of sucrose plus reduced-risk insecticides, spinetoram or acetamiprid, reduced larval infestation relative to the untreated control by 76%; alternating bifenthrin and phosmet (without sucrose) reduced infestation by 65%. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  3. A critical review of neonicotinoid insecticides for developmental neurotoxicity.

    Science.gov (United States)

    Sheets, Larry P; Li, Abby A; Minnema, Daniel J; Collier, Richard H; Creek, Moire R; Peffer, Richard C

    2016-02-01

    A comprehensive review of published and previously unpublished studies was performed to evaluate the neonicotinoid insecticides for evidence of developmental neurotoxicity (DNT). These insecticides have favorable safety profiles, due to their preferential affinity for nicotinic receptor (nAChR) subtypes in insects, poor penetration of the mammalian blood-brain barrier, and low application rates. Nevertheless, examination of this issue is warranted, due to their insecticidal mode of action and potential exposure with agricultural and residential uses. This review identified in vitro, in vivo, and epidemiology studies in the literature and studies performed in rats in accordance with GLP standards and EPA guidelines with imidacloprid, acetamiprid, thiacloprid, clothianidin, thiamethoxam, and dinotefuran, which are all the neonicotinoids currently registered in major markets. For the guideline-based studies, treatment was administered via the diet or gavage to primiparous female rats at three dose levels, plus a vehicle control (≥20/dose level), from gestation day 0 or 6 to lactation day 21. F1 males and females were evaluated using measures of motor activity, acoustic startle response, cognition, brain morphometry, and neuropathology. The principal effects in F1 animals were associated with decreased body weight (delayed sexual maturation, decreased brain weight, and morphometric measurements) and acute toxicity (decreased activity during exposure) at high doses, without neuropathology or impaired cognition. No common effects were identified among the neonicotinoids that were consistent with DNT or the neurodevelopmental effects associated with nicotine. Findings at high doses were associated with evidence of systemic toxicity, which indicates that these insecticides do not selectively affect the developing nervous system.

  4. Blended Refuge and Insect Resistance Management for Insecticidal Corn

    Science.gov (United States)

    Crespo, Andre L B; Pan, Zaiqi; Crain, Philip R; Thompson, Stephen D; Pilcher, Clinton D; Sethi, Amit

    2018-01-01

    Abstract In this review, we evaluate the intentional mixing or blending of insecticidal seed with refuge seed for managing resistance by insects to insecticidal corn (Zea mays). We first describe the pest biology and farming practices that will contribute to weighing trade-offs between using block refuges and blended refuges. Case studies are presented to demonstrate how the trade-offs will differ in different systems. We compare biological aspects of several abstract models to guide the reader through the history of modeling, which has played a key role in the promotion or denigration of blending in various scientific debates about insect resistance management for insecticidal crops. We conclude that the use of blended refuge should be considered on a case-by-case basis after evaluation of insect biology, environment, and farmer behavior. For Diabrotica virgifera virgifera, Ostrinia nubilalis, and Helicoverpa zea in the United States, blended refuge provides similar, if not longer, delays in the evolution of resistance compared to separate block refuges. PMID:29220481

  5. Efficacy of Selected Insecticides Applied to Hybrid Rice Seed

    Science.gov (United States)

    Adams, A.; Gore, J.; Musser, F.; Cook, D.; Walker, T.; Dobbins, C.

    2016-01-01

    Hybrid rice and insecticide seed treatments targeting rice water weevil, Lissorhoptrus oryzophilus Kuschel, have altered the landscape of rice production. The effect of reduced seeding rates on seed treatment efficacy in hybrid rice has not been studied. During 2011 and 2012, an experiment was conducted at seven locations to determine the relationship between low seeding rates used in hybrid rice and efficacy of selected insecticidal seed treatments as measured by rice water weevil densities and yield. Labeled rates of thiamethoxam, chlorantraniliprole, and clothianidin were compared with higher rates of these products to determine if labeled rates provide an acceptable level of control of the rice water weevil. Study locations were divided into low, moderate, and high groups based on rice water weevil larval densities. All seed treatments and seed treatment rates reduced rice water weevil densities. However, there was no observed yield or economic benefit from the use of an insecticidal seed treatment in areas of low pressure. Differences in yield were observed among seed treatments and seed treatment rates in moderate and high pressure locations, and all seed treatments yielded better than the untreated plots, but these differences were not always economical. All seed treatments showed an economic advantage in areas of high weevil pressure, and there were no differences among seed treatment products or rates, suggesting that currently labeled seed treatment rates in hybrid rice are effective for rice water weevil management. PMID:26537671

  6. Neonicotinoid insecticides can serve as inadvertent insect contraceptives

    Science.gov (United States)

    Villamar-Bouza, Laura; Bruckner, Selina; Chantawannakul, Panuwan; Gauthier, Laurent; Khongphinitbunjong, Kitiphong; Retschnig, Gina; Troxler, Aline; Vidondo, Beatriz; Neumann, Peter; Williams, Geoffrey R.

    2016-01-01

    There is clear evidence for sublethal effects of neonicotinoid insecticides on non-target ecosystem service-providing insects. However, their possible impact on male insect reproduction is currently unknown, despite the key role of sex. Here, we show that two neonicotinoids (4.5 ppb thiamethoxam and 1.5 ppb clothianidin) significantly reduce the reproductive capacity of male honeybees (drones), Apis mellifera. Drones were obtained from colonies exposed to the neonicotinoid insecticides or controls, and subsequently maintained in laboratory cages until they reached sexual maturity. While no significant effects were observed for male teneral (newly emerged adult) body mass and sperm quantity, the data clearly showed reduced drone lifespan, as well as reduced sperm viability (percentage living versus dead) and living sperm quantity by 39%. Our results demonstrate for the first time that neonicotinoid insecticides can negatively affect male insect reproductive capacity, and provide a possible mechanistic explanation for managed honeybee queen failure and wild insect pollinator decline. The widespread prophylactic use of neonicotinoids may have previously overlooked inadvertent contraceptive effects on non-target insects, thereby limiting conservation efforts. PMID:27466446

  7. Dermal insecticide residues from birds inhabiting an orchard

    Science.gov (United States)

    Vyas, N.B.; Spann, J.W.; Hulse, C.S.; Gentry, S.; Borges, S.L.

    2007-01-01

    The US Environmental Protection Agency conducts risk assessments of insecticide applications to wild birds using a model that is limited to the dietary route of exposure. However, free-flying birds are also exposed to insecticides via the inhalation and dermal routes. We measured azinphos-methyl residues on the skin plus feathers and the feet of brown-headed cowbirds (Molothrus ater) in order to quantify dermal exposure to songbirds that entered and inhabited an apple (Malus x domestica) orchard following an insecticide application. Exposure to azinphos-methyl was measured by sampling birds from an aviary that was built around an apple tree. Birds sampled at 36 h and 7-day post-application were placed in the aviary within 1 h after the application whereas birds exposed for 3 days were released into the aviary 4-day post-application. Residues on vegetation and soil were also measured. Azinphos-methyl residues were detected from the skin plus feathers and the feet from all exposure periods. Our results underscore the importance of incorporating dermal exposure into avian pesticide risk assessments.

  8. Evolution of resistance to pyrethroid insecticides in Musca domestica.

    Science.gov (United States)

    Scott, Jeffrey G

    2017-04-01

    Houseflies, Musca domestica L., are a significant pest because of the numerous diseases they transmit. Control of housefly populations, particularly at animal production facilities, is frequently done using pyrethroid insecticides which kill insects by prolonging the open time of the voltage-sensitive sodium channel (VSSC). Houseflies have evolved resistance to pyrethroids owing to mutations in Vssc and by cytochrome-P450-mediated detoxification. Three Vssc mutations are known: kdr (L1014F), kdr-his (L1014H) and super-kdr (M918T + L1014F). Generally, the levels of resistance conferred by these mutations are kdr-his resistance than kdr. P450-mediated resistance can result from overexpression of CYP6D1 or another P450 (unidentified) whose overexpression is linked to autosomes II or V. The initial use of field-stable pyrethroids resulted in different patterns of evolution across the globe, but with time these mutations have become more widespread in their distribution. What is known about the fitness costs of the resistance alleles in the absence of insecticide is discussed, particularly with respect to the current and future utility of pyrethroid insecticides. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  9. Mdr65 decreases toxicity of multiple insecticides in Drosophila melanogaster.

    Science.gov (United States)

    Sun, Haina; Buchon, Nicolas; Scott, Jeffrey G

    2017-10-01

    ABC transporters are ubiquitous membrane-bound proteins, present in both prokaryotes and eukaryotes. The major function of eukaryotic ABC transporters is to mediate the efflux of a variety of substrates (including xenobiotics) out of cells. ABC transporters have been widely investigated in humans, particularly for their involvement in multidrug resistance (MDR). Considerably less is known about their roles in transport and/or excretion in insects. ABC transporters are only known to function as exporters in insects. Drosophila melanogaster has 56 ABC transporter genes, including eight which are phylogenetically most similar to the human Mdr genes (ABCB1 clade). We investigated the role of ABC transporters in the ABCB1 clade in modulating the susceptibility to insecticides. We took advantage of the GAL4/UAS system in D. melanogaster to knockdown the expression levels of Mdr65, Mdr50, Mdr49 and ABCB6 using transgenic UAS-RNAi lines and conditional driver lines. The most notable effects were increased sensitivities to nine different insecticides by silencing of Mdr65. Furthermore, a null mutation of Mdr65 decreased the malathion, malaoxon and fipronil LC 50 values by a factor of 1.9, 2.1 and 3.9, respectively. Altogether, this data demonstrates the critical role of ABC transporters, particularly Mdr65, in altering the toxicity of specific, structurally diverse, insecticides in D. melanogaster. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Substances inertes et plantes à effet insecticide utilisées dans la ...

    African Journals Online (AJOL)

    Les insecticides naturels tels que les plantes à effet insecticide et les substances inertes (sable, cendre, terres à diatomées,…) méritent d'être valorisées afin de réduire l'utilisation des insecticides chimiques et protéger l'environnement. Ce travail basé sur une revue documentaire fouillée et actualisée vise à faire la genèse ...

  11. Determination of insecticides malathion and lambda-cyhalothrin residues in zucchini by gas chromatography

    OpenAIRE

    Lofty, Hayam M.; Abd El-Aleem, Abd El-Aziz A.; Monir, Hany H.

    2013-01-01

    A sensitive gas chromatographic method has been developed for the determination of malathion and lambda-cyhalothrin (λ-cyhalothrin) insecticide residues in zucchini. The developed method consists of extraction with acetone, purification and partitioning with methylene chloride, column chromatographic clean-up, and finally capillary gas chromatographic determination of the insecticides. The recoveries of method were greater than 90% and limit of determination was 0.001 ppm for both insecticide...

  12. Spatio-temporal dynamics of cod nursery areas in the Baltic Sea

    Science.gov (United States)

    Hinrichsen, H.-H.; von Dewitz, B.; Lehmann, A.; Bergström, U.; Hüssy, K.

    2017-06-01

    In this study the drift of eastern Baltic cod larvae and juveniles spawned within the historical eastern Baltic cod spawning grounds was investigated by detailed drift model simulations for the years 1971-2010, to examine the spatio-temporal dynamics of environmental suitability in the nursery areas of juvenile cod settlement. The results of the long-term model scenario runs, where juvenile cod were treated as simulated passively drifting particles, enabled us to find strong indications for long-term variations of settlement and potentially the reproduction success of the historically important eastern Baltic cod nursery grounds. Only low proportions of juveniles hatched in the Arkona Basin and in the Gotland Basin were able to settle in their respective spawning ground. Ocean currents were either unfavorable for the juveniles to reach suitable habitats or transported the juveniles to nursery grounds of neighboring subdivisions. Juveniles which hatched in the Bornholm Basin were most widely dispersed and showed the highest settlement probability, while the second highest settlement probability and horizontal dispersal was observed for juveniles originating from the Gdansk Deep. In a long-term perspective, wind-driven transport of larvae/juveniles positively affected the settlement success predominately in the Bornholm Basin and in the Bay of Gdansk. The Bornholm Basin has the potential to contribute on average 54% and the Bay of Gdansk 11% to the production of juveniles in the Baltic Sea. Furthermore, transport of juveniles surviving to the age of settlement with origin in the Bornholm Basin contributed on average 13 and 11% to the total settlement in the Arkona Basin and in the Gdansk Deep, respectively. The time-series of the simulated occupied juvenile cod habitat in the Bornholm Basin and in the Gdansk Deep showed a similar declining trend as the Fulton's K condition factor of demersal 1-group cod, which may confirm the importance of oxygen-dependent habitat

  13. Nitrate leaching beneath a containerized nursery crop receiving trickle or overhead irrigation.

    Science.gov (United States)

    Colangelo, D J; Brand, M H

    2001-01-01

    Container production of nursery crops is intensive and a potential source of nitrogen release to the environment. This study was conducted to determine if trickle irrigation could be used by container nursery producers as an alternative to standard overhead irrigation to reduce nitrogen release into the environment. The effect of overhead irrigation and trickle irrigation on leachate nitrate N concentration, flow-weighted nitrate N concentration, leachate volume, and plant growth was investigated using containerized rhododendron (Rhododendron catawbiense Michx. 'Album') supplied with a controlled-release fertilizer and grown outdoors on top of soil-monolith lysimeters. Leachate was collected over two growing seasons and overwinter periods, and natural precipitation was allowed as a component of the system. Precipitation accounted for 69% of the water entering the overhead-irrigated system and 80% of the water entering the trickle-irrigated system. Leachate from fertilized plants exceeded the USEPA limit of 10 mg L(-1) at several times and reached a maximum of 26 mg L(-1) with trickle irrigation. Average annual loss of nitrate N in leachate for fertilized treatments was 51.8 and 60.5 kg ha(-1) for the overhead and trickle treatments, respectively. Average annual flow-weighted concentration of nitrate N in leachate of fertilized plants was 7.2 mg L(-1) for overhead irrigation and 12.7 mg L(-1) for trickle irrigation. Trickle irrigation did not reduce the amount of nitrate N leached from nursery containers when compared with overhead irrigation because precipitation nullified the potential benefits of reduced leaching fractions and irrigation inputs provided under trickle irrigation.

  14. Spawning and nursery habitats of neotropical fish species in the tributaries of a regulated river

    Science.gov (United States)

    Makrakis, Maristela Cavicchioli; da Silva, Patrícia S.; Makrakis, Sergio; de Lima, Ariane F.; de Assumpção, Lucileine; de Paula, Salete; Miranda, Leandro E.; Dias, João Henrique Pinheiro

    2012-01-01

    This chapter provides information on ontogenetic patterns of neotropical fish species distribution in tributaries (Verde, Pardo, Anhanduí, and Aguapeí rivers) of the Porto Primavera Reservoir, in the heavily dammed Paraná River, Brazil, identifying key spawning and nursery habitats. Samplings were conducted monthly in the main channel of rivers and in marginal lagoons from October through March during three consecutive spawning seasons in 2007-2010. Most species spawn in December especially in Verde River. Main river channels are spawning habitats and marginal lagoons are nursery areas for most fish, mainly for migratory species. The tributaries have high diversity of larvae species: a total of 56 taxa representing 21 families, dominated by Characidae. Sedentary species without parental care are more abundant (45.7%), and many long-distance migratory fish species are present (17.4%). Migrators included Prochilodus lineatus, Rhaphiodon vulpinus, Hemisorubim platyrhynchos, Pimelodus maculatus, Pseudoplatystoma corruscans, Sorubim lima, two threatened migratory species: Salminus brasiliensis and Zungaro jahu, and one endangered migratory species: Brycon orbignyanus. Most of these migratory species are vital to commercial and recreational fishing, and their stocks have decreased drastically in the last decades, attributed to habitat alteration, especially impoundments. The fish ladder at Porto Primavera Dam appears to be playing an important role in re-establishing longitudinal connectivity among critical habitats, allowing ascent to migratory fish species, and thus access to upstream reaches and tributaries. Establishment of Permanent Conservation Units in tributaries can help preserve habitats identified as essential spawning and nursery areas, and can be key to the maintenance and conservation of the fish species in the Paraná River basin.

  15. The Differential Role of Symptoms of Anxiety and Social Withdrawal in Chinese Children's Dependency on Their Teachers during the Transition to Nursery Care

    Science.gov (United States)

    Zhang, Xiao

    2015-01-01

    Research Findings: Based on a short-term longitudinal sample of Chinese children, the present study examined the role of symptoms of anxiety and social withdrawal in dependency on teachers during the transition to nursery care. Children's dependency on their teachers was assessed first at 3 months after nursery entry (Time 1) and then at the end…

  16. Ergonomic adequacy of the baby nursery of child development center located in UFSC - Florianópolis.

    Science.gov (United States)

    Vergara, Lizandra Garcia Lupi; Ribet, Lucie Elisa

    2012-01-01

    A study in the educators' work station at baby nursery of NDI/UFSC, located in Florianópolis, was conducted using the Work Ergonomic Analysis methodological tool. The demand considered was the educators' physical exhaustion caused by the weight carried when taking care of the babies, the postures assumed during the labor activity and the spatial arrangement of the baby nursery. Thinking ergonomically, the spatial arrangement is directly associated to three factors: the formal aspect of the environment, the esthetic aspect including colors and finish quality and the ease of understanding involved in the baby nursery labor. By the ergonomic adequacy it is possible to assert that if were established better conditions of posture and comfort for the educators, as well as satisfactory technical and operational information to carry out the activities, greater safety and welfare would be provided to the babies, the main focus of the work.

  17. PID temperature controller in pig nursery: improvements in performance, thermal comfort, and electricity use.

    Science.gov (United States)

    de Souza Granja Barros, Juliana; Rossi, Luiz Antonio; Sartor, Karina

    2016-08-01

    The use of smarter temperature control technologies in heating systems can optimize the use of electric power and performance of piglets. Two control technologies of a resistive heating system were assessed in a pig nursery: a PID (proportional, integral, and derivative) controller and a thermostat. The systems were evaluated regarding thermal environment, piglet performance, and use of electric power for 99 days. The heating system with PID controller improved the thermal environment conditions and was significantly (P PID-controlled heating system is more efficient in electricity use and provides better conditions for thermal comfort and animal performance than heating with thermostat.

  18. Impact of rootstocks on columnar apple tree growth in a nursery

    OpenAIRE

    Gelvonauskienė, Dalia; Gelvonauskis, Bronislovas; Sasnauskas, Audrius

    2006-01-01

    There were investigated 24 columnar apple selections and 2 cultivars ‘Arbat’ and ‘Ostankino’ in a nursery at the Lithuanian Institute of Horticulture. The two latter cultivars and selections M38-35, M38-33, M38-2, M38-15, No. 376-100 and No. 385-380 were released in Russia and 16 hybrids (No. 23733, No. 23753, No. 24217, No. 24218, No. 24219, No. 24220, No. 24271, No. 24583, No. 24599, No. 24637, No. 24690, No. 25134, No. 26075, No. 26094 No. 26148, No. 26325) – at the Lithuanian Institute of...

  19. Radiation exposure reduction by use of Kevlar cassettes in the neonatal nursery

    International Nuclear Information System (INIS)

    Herman, M.W.; Mak, H.K.; Lachman, R.S.

    1987-01-01

    A study was performed to determine whether the use of Kevlar cassettes in the neonatal intensive care nursery would reduce radiation exposure to patients. The radiation dose to the neonates was measured by using thermoluminescent dosimeters. In addition, the attenuation of the Kevlar cassettes and the sensitivity of the film-screen combination were compared with the previously used system. The greatest radiation reduction using a mobile X-ray unit was 27%; based on sensitivity measurements, the theoretical reduction averaged 38%. The reduction in radiation exposure resulted from reduced attenuation by the Kevlar cassette

  20. A cluster of Enterovirus 71 subgenogroup C2 in a nursery school, Italy, 2014.

    Science.gov (United States)

    Medici, Maria Cristina; Tummolo, Fabio; Arcangeletti, Maria Cristina; De Conto, Flora; Chezzi, Carlo; Dodi, Icilio; Calderaro, Adriana

    2016-10-01

    During October 2014, enterovirus (EV) RNA was detected in the stools of four children attending the same class in a nursery school, and hospitalized with mild febrile and vomiting disease in Parma, Italy. Upon sequencing, the viruses were characterized as EV71 subgenogroup C2. Phylogenetic analysis of the four EV71 C2 viruses allowed the distinction of a diverging lineage within subgenogroup C2, containing the Italian EV71 C2 strains and viruses detected in France in 2013. The identification of an outbreak of EV71 C2 in Italy extended information on the geographic diffusion and clinical relevance of these viruses in Europe.