Oliver, Jason B; Ranger, Christopher M; Reding, Michael E; Moyseenko, James J; Youssef, Nadeer N; Bray, Alicia M
2013-06-01
Japanese beetle, Popillia japonica Newman (Coleoptera: Scarabaeidae), is an important quarantine pest of nurseries. Nursery plant movement from P. japonica-infested regions is regulated by the U.S. Domestic Japanese Beetle Harmonization Plan (DJHP), which classifies states by risk categories. Treatments for category 2 states include preharvest soil surface treatment of nursery plants grown in field soil using Discus SC, Marathon (1G or 60 WP), or Flagship (0.22G or 25 WG). In this study, Discus, Marathon 60 WP, or Flagship 0.22G DJHP standards were compared with labeled rates of non-DJHP-approved insecticides, including neonicotinoids clothianidin (Arena 50WDG), generic imidacloprid (Quali-Pro Imidacloprid 2 F T&O Insecticide, Mallet 2 F T&O Insecticide, and Lada 2 F Insecticide), and imidacloprid + bifenthrin (Allectus SC), as well as the anthranilic diamide, chlorantraniliprole (Acelepryn Insecticide). Arena provided 100% P. japonica control in May, June, and July over four test years, but had one larva recovered during August in two of those 4 yr. Acelepryn did not provide DJHP-acceptable P. japonica control. During July, Allectus provided 100% P. japonica control in three of four test years, but had four larvae in one test year. Other treatments tested only during July, which provided 100% P. japonica control, included Discus (five tests); Marathon, Quali-Pro, and Mallet (two tests); and Lada and Flagship (one test). Generic imidacloprid 2 F formulations were equivalent in P. japonica control to DJHP-approved insecticides. Insecticides generally performed poorly on other scarabs or curculionid larvae. The study supports Arena, Allectus, and generic imidacloprid 2 F products as suitable candidates for the DJHP.
Management of ambrosia beetles in ornamental nurseries relies, in part, on treatments of insecticides to prevent beetles from boring into trees emitting stress-induced ethanol. However, data on residual efficacy of commonly used pyrethroid insecticides is warranted to gauge the duration that trees ...
Identification of insecticide residues with a conducting-polymer electronic nose
A.D. Wilson
2014-01-01
The identification of insecticide residues on crop foliage is needed to make periodic pest management decisions. Electronic-nose (e-nose) methods were developed and tested as a means of acquiring rapid identifications of insecticide residue types at relatively low cost by detection of headspace volatiles released from inert surfaces in vitro. Detection methods were...
Exotic ambrosia beetles, particularly Xylosandrus crassiusculus (Motschulsky) and Xylosandrus germanus (Blandford), are among the most economically damaging pests of ornamental trees in nurseries. Growers have had few tactics besides insecticide applications to reduce ambrosia beetle attacks but rec...
Getting Started in the Nursery Business: Nursery Production Options
Eaton, Gregory Kent, 1959-; Appleton, Bonnie Lee, 1948-2012
2009-01-01
Summarizes factors, such as nursery design and capitalization, that individuals in Virginia's nursery industry should consider when deciding whether to grow nursery stock in the field verses containers.
Jardin d'enfants
2010-01-01
* * * * * Enrollments 2010-2011 Monday 8, Tuesday 9 and Wednesday 10 March From 8:00 to 10:00 at the Nursery School Registration forms will be available from 5th March onwards: At the Nursery School, from Catherine Regelbrugge, Secretary tel: 73604, Catherine.Regelbrugge@cern.ch At the Nursery School, from Brigitte Pillionnel, Headmistress tel: 77925, Brigitte.Pillionnel@cern.ch On the pages of the Nursery School website http://kindergarten.web.cern.ch/kindergarten/docs/cond%20gales%2010-2011%20EN.pdf
Jardin d'enfant
2012-01-01
Enrollments 2012-2013 Monday 5, Tuesday 6 and Wednesday 7 March From 8.00 to 10.00 at the Nursery School Registration forms will be available from 2nd March onwards: – At the Nursery School, from Catherine Regelbrugge, Secretary Catherine.Regelbrugge@cern.ch, tel : 73604. – At the Nursery School, from Brigitte Pillionnel, Headmistress Brigitte.Pillionnel@cern.ch, tel : 77925. – On the pages of the Nursery School website http://kindergarten.web.cern.ch/kindergarten/docs/cond%20gales%2012-2013%20EN.pdf
The Influence of Neonatal Nursery Design on Mothers' Interactions in the Nursery.
Jones, Liz; Peters, Kathryn; Rowe, Jennifer; Sheeran, Nicola
2016-01-01
This study examined the influence of neonatal nursery design on interactions between nurses and mothers of infants in the nursery. We used a natural quasi-experimental design, using semi-structured interviews and a structured measure of mothers' and nurses' perceptions of nursing care, to compare mothers (n=26 and n=40) and nurses (n=22 and n=29) in an open-bay (OB) nursery and a single family room (SFR) nursery. Thematic analysis was used to generate key themes from the interviews. Mothers and nurses in both nursery designs talked about Valuing interactions; the importance of interactions between mothers and nurses. Mothers and nurses described SFRs as providing a space, My/their room, which enhanced mothers' sense of control and connection with the infant. SFRs were also associated with Changing the norms of interactions with nurses and other mothers, which created challenges in the desired quantity and quality of interactions for mothers and nurses. Nurses in the SFR nursery also reported Enhanced interactions, including improved confidentiality and personalized communication. Mothers in the OB nursery reported more supportive mothering actions from nurses than mothers in the SFR nursery. Both mothers and nurses in the OB nursery also talked about Our nursery community, which captured the value of having other nurses and mothers in the rooms. Mothers and nurses perceived that the SFR nursery enhanced privacy and maternal closeness for mothers compared to the OB nursery. However, the SFR nursery design presented challenges to some interactions of value to nurses and mothers. Copyright © 2016 Elsevier Inc. All rights reserved.
Nursery School
2016-01-01
Enrolments 2016-2017 Enrolments for the school year 2016-2017 to the Nursery, the Nursery school and the school will take place on 7, 8 and 9 March 2016 from 8 to 10 am at the Nursery School. Registration forms will be available from Thursday 3rd March. More information on the website: http://nurseryschool.web.cern.ch/.
Byrne, Frank J; Daugherty, Matthew P; Grafton-Cardwell, Elizabeth E; Bethke, James A; Morse, Joseph G
2017-03-01
Studies were conducted to evaluate uptake and retention of three systemic neonicotinoid insecticides, dinotefuran, imidacloprid and thiamethoxam, in potted citrus nursery plants treated at standard label rates. Infestation of these plants placed at a field site with moderate levels of Asian citrus psyllid (ACP) was monitored for 14 weeks following treatments, and insecticide residues in leaf tissue were quantified using enzyme-linked immunosorbent assay (ELISA). Bioassays were conducted using leaves harvested on various dates post-treatment to compare the efficacies of residues against adult ACP. Residues of the three neonicotinoids were detected in leaf tissues within 1 week after treatment. Peak concentrations established at 1 week for imidacloprid and dinotefuran and at 2 weeks for thiamethoxam. Imidacloprid and thiamethoxam outperformed the control and dinotefuran treatments at protecting trees from infestations by ACP eggs and nymphs. For a given insecticide concentration in leaf tissue, thiamethoxam induced the highest mortality of the three insecticides, and dinotefuran was the least toxic. If the time needed to achieve effective thresholds of a systemic neonicotinoid is known, treatments at production facilities could be scheduled that would minimize unnecessary post-treatment holding periods and ensure maximum retention of effective concentrations after the plants have shipped to retail outlets. The rapid uptake of the insecticides and retention at effective concentrations in containerized citrus suggest that the current 30 day post-treatment shipping restriction from production facilities to retail outlets outside of quarantine could be shortened to 14 days. Thiamethoxam should be added to the list of approved nursery treatments. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Nursery and nursery products in Beijing, Tianjin, Shandong and Shanghai
Post, J.H.; Zhang XiaoYong, Xiaoyong
2003-01-01
The production and demand of nursery products is growing rapidly in China, particularly in big cities as Beijing, Tianjin, Shandong and Shanghai. The report describes the development and the prospects of production and demand of nursery products and the structure of the nursery sector in these
Nursery Product-Related Injuries Treated in United States Emergency Departments.
Gaw, Christopher E; Chounthirath, Thiphalak; Smith, Gary A
2017-04-01
The goal of this study was to determine the epidemiology of injuries associated with nursery products among young children treated in US emergency departments. Data from the National Electronic Injury Surveillance System were retrospectively analyzed for patients aged nursery product from 1991 through 2011. An estimated 1 391 844 (95% confidence interval, 1 169 489-1 614 199) nursery product-related injuries among children aged Nursery product-related injuries were most commonly associated with baby carriers (19.5%), cribs/mattresses (18.6%), strollers/carriages (16.5%), or baby walkers/jumpers/exercisers (16.2%). The most common mechanism of injury was a self-precipitated fall (80.0%), and the most frequently injured body region was the head or neck (47.1%). Although successful injury prevention efforts with baby walkers led to a decline in nursery product-related injuries from 1991 to 2003, the number and rate of these injuries have been increasing since 2003. Greater efforts are warranted to prevent injuries associated with other nursery products, especially baby carriers, cribs, and strollers. Prevention of falls and concussions/closed head injuries associated with nursery products also deserves special attention. Copyright © 2017 by the American Academy of Pediatrics.
Miranda, Marcelo P; Yamamoto, Pedro T; Garcia, Rafael B; Lopes, João Pa; Lopes, João Rs
2016-09-01
Chemical control is the method most used for management of Diaphorina citri, the vector of the phloem-limited bacteria associated with citrus huanglongbing (HLB) disease. The objectives of this study were to determine the influence of soil-drench applications of neonicotinoids (thiamethoxam and imidacloprid) on the probing behaviour of D. citri on citrus nursery trees, using the electrical penetration graph (EPG) technique, and to measure the D. citri settling behaviour after probing on citrus nursery trees that had received these neonicotinoid treatments. The drench applications of neonicotinoids on citrus nursery trees disrupt D. citri probing, mainly for EPG variables related to phloem sap ingestion, with a significant reduction (≈90%) in the duration of this activity compared with untreated plants in all assessment periods (15, 35 and 90 days after application). Moreover, both insecticides have a repellent effect on D. citri, resulting in significant dispersal of psyllids from treated plants. This study clearly demonstrates the interference of soil-applied neonicotinoids on the feeding and settling behaviour of D. citri on citrus nursery trees, mainly during the phloem ingestion phase. These findings reinforce the recommendation of drench application of neonicotinoids before planting nursery trees as a useful strategy for HLB management. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.
Nursery School
2015-01-01
Enrolments 2015-2016 Enrolments for the school year 2015-2016 to the Nursery, the Nursery school and the school will take place on: Monday 2, Tuesday 3 and Thursday 4 March 2015 More information on the website: http://nurseryschool.web.cern.ch/
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Nursery. 701.55 Section 701.55 Agriculture Regulations... ADMINISTERED UNDER THIS PART § 701.55 Nursery. (a) Subject to the other eligibility provisions of this part... under this section for the cost of removing nursery debris such as nursery structures, shade houses, and...
Nursery School - ENROLMENTS 2011-2012
Jardin d'enfants
2011-01-01
Tuesday 8, Wednesday 9 and Thursday 10 March From 8.00 to 10.00 at the Nursery School Registration forms available from 4th March onwards: At the Nursery School, from Catherine Regelbrugge, Secretary, tel: 73604, Catherine.Regelbrugge@cern.ch At the Nursery School, from Brigitte Pillionnel, Headmistress, tel: 77925, Brigitte.Pillionnel@cern.ch On the pages of the Nursery School website
Staff Association
2014-01-01
Registration of school year of 2014-2015 at the Nursery school of Cern Staff Association Dear parents, We would like to inform you that the dates of enrolments will be 3, 4 and 5th March 2014 from 8:00 a.m to 10:00 a.m at the nursery school Bulding 562. Reminder : From 0-2 years, your child goes to the nursery, from 2-4 to the kindergarten, and from 4 years onwards, your child will join the school, following the program of first and second year of primary school (première and deuxième primaire in the Swiss system), which corresponds to the moyenne and grande section in France.
Nursery School - Enrollments 2011-2012
Jardin d'Enfants
2011-01-01
Tuesday 8, Wednesday 9 and Thursday 10 March From 8.00 to 10.00 at the Nursery School Registration forms will be available from 4th March onwards: At the Nursery School, from Catherine Regelbrugge, Secretary tel: 73604, Catherine.Regelbrugge@cern.ch At the Nursery School, from Brigitte Pillionnel, Headmistress tel:77925, Brigitte.Pillionnel@cern.ch On the pages of the Nursery School website
2011-12-19
... Nursery Production, the Nursery and Floriculture Chemical Use, and the Christmas Tree Production Surveys... Agricultural Statistics Service (NASS) to suspend currently approved information collections for all Nursery and Christmas Tree Production Surveys along with the Nursery and Floriculture Chemical Use Survey...
7 CFR 1437.305 - Ornamental nursery.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Ornamental nursery. 1437.305 Section 1437.305... Determining Coverage Using Value § 1437.305 Ornamental nursery. (a) Eligible ornamental nursery stock is a... ornamental nursery stock is limited to field-grown and containerized decorative plants grown in a controlled...
Agriculture: Nurseries and Greenhouses
Nurseries and Greenhouses. Information about environmental requirements specifically relating to the production of many types of agricultural crops grown in nurseries and greenhouses, such as ornamental plants and specialty fruits and vegetables.
Anthony S. Davis
2008-01-01
Concern has been noted over the lack of qualified applicants for vacancies in forest nursery positions. The University of Idaho Center for Forest Nursery and Seedling Research is uniquely qualified to address the issue of training given its faculty, staff, and resources. The keystone resource in this regard is the Franklin H. Pitkin Forest Nursery, a seedling...
29 CFR 780.205 - Nursery activities generally.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Nursery activities generally. 780.205 Section 780.205 Labor... as It Relates to Specific Situations Nursery and Landscaping Operations § 780.205 Nursery activities generally. The employees of a nursery who are engaged in the following activities are employed in...
Frank, Steven D
2012-04-01
Armored scale insects are among the most difficult to manage and economically important arthropod pests in the production and maintenance of urban landscape plants. This is because of morphological traits that protect them from contact insecticides. I compared initial and season-long control of euonymus scale, Unaspis euonymi Comstock (Hemiptera: Diaspidae), by reduced-risk insecticides (insect growth regulators [IGRs], neonicotinoids, spirotetramat) to determine if they controlled scale as well as more toxic insecticides such as the organophosphate, acephate, and pyrethroid, bifenthrin. I also evaluated how these insecticides affected natural enemy abundance on experimental plants and survival when exposed to insecticide residue. All insecticides tested reduced first generation euonymus scale abundance. In 2009, reinfestation by second generation euonymus scale was highest on plants treated with acetamiprid and granular dinotefuran. In 2010, systemic neonicotinoids and spirotetramat prevented cottony cushion scale infestation 133 d after treatment whereas scale readily infested plants treated with bifenthrin and horticultural oil. Encarsia spp. and Cybocephalus spp. abundance was related to scale abundance. These natural enemies were generally less abundant than predicted by scale abundance on granular dinotefuran treated plants and more abundant on granular thiamethoxam treated plants. Bifenthrin residue killed 90-100% of O. insidiosus and E. citrina within 24 h. My results indicate that reduced risk insecticides can provide season-long scale control with less impact on natural enemies than conventional insecticides. This could have economic and environmental benefits by reducing the number of applications necessary to protect nursery and landscape plants from scale.
The Nursery Worker. Teacher Guide. Revised.
Welch, A. W.
This teacher's guide is designed for use in a vocational horticulture course designed to prepare students for jobs as nursery workers. Addressed in the individual units of the guide are the following topics: the nursery industry; soils; plant growth; plant nutrition; plant propagation methods; nursery field practices; pest control; techniques for…
Case studies of nurseries in Malawi
DEFF Research Database (Denmark)
Namoto, M.; Likoswe, M.G.
This study of 42 case studies of nurseries was made as part of a major sample survey of 360 nurseries in 6 districts in Malawi. The purpose of the study was to let the small nurseries in the country explain in their own words how they source seed, how and for whom they produce seedlings......, and to explain about their problems and opportunities in the nursery business. The assessment was made within the framework of Improved Seed Supply for Agroforestry in African Countries (ISSAAC), a Danida supported programme implemented in cooperation between Forest & Landscape Denmark and World Agroforestry...
Directory of Open Access Journals (Sweden)
Hernán Salas
2006-12-01
, several foliar sprays insecticides are needed every 10 to 15 days during the growing season. In this paper, CLM control in nursery lemon plants with systemic insecticides imidacloprid and thiametoxam, applied by "drench", is reported. Treatments were imidacloprid at 0.035, 0.105 and 0.175 g a.i. and thiametoxam at 0.025, 0.075 and 0.125 g a.i per plant in a five-liter container. An unsprayed control was included. CLM was effectively controlled from November to March (120 days approximately with medium and high doses, and from 25 to 45 days with low doses of both insecticides. In one of the trials, imidacloprid and thiametoxam low doses did not control CLM. Considering the obtained results, it would be more appropriate to use imidacloprid 35% SC (0,105 g a. i. per plant and thiametoxam 25% WG (0,075 g a. i. per plant for citrus leafminer control in greenhouse plants.
Staff Association
2015-01-01
The CERN Nursery school was founded in 1961 in Meyrin, before it found a new home on the CERN site in 1965. It expanded from a “garderie” in the morning-only with 30 children, to the Crèche/Kindergarten/School with 147 children and 42 staff we have today. Every year the Nursery school makes an art exhibition in the main building. In 2000 the theme was “Monet’s garden” and it was complete, not even the little bridge was missing! This year, the theme of the exhibition was transport. We could see a garbage truck, a train, and much more.
7 CFR 457.164 - Nursery rehabilitation endorsement.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery rehabilitation endorsement. 457.164 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.164 Nursery rehabilitation endorsement. Nursery Crop Insurance Rehabilitation Endorsement If you elect this endorsement and pay the...
Clara, Okoroafor Nnenna
2016-01-01
The present study focuses on nursery school head teacher leadership behaviour as it correlates to nursery school teacher's job satisfaction. Data were collected through a scale and returned by sample of two hundred and fifty nursery school teacher's in Akoko North, Ondo State, Nigeria.Data collected were analyzed using mean and standard deviation…
Pugliese, Massimo; Rettori, Andrea Alberto; Martinis, Roberto; Al-Rohily, Khalid; Velate, Suresh; Moideen, Mohamed Ashraf; Al-Maashi, Ali
2017-08-01
The date palm (Phoenix dactylifera L.), an important economic resource for many nations worldwide, has recently been threatened by the presence of different insect pests, like the red palm weevil (RPW) Rhynchophorus ferrugineus. Two products, a glue (polyvinyl acetate) and an oil (raw linseed oil) were used as coatings and applied together with a repellent and two insecticides (teflutrin and chlorpyrifos) at different dosages on two species of palm (P. dactylifera and P. canariensis). Phytotoxic effects of the treatments were evaluated in a greenhouse on 260 potted palms (130 P. dactylifera and 130 P. canariensis) and no negative effects were observed. Afterwards, a trial lasting 400 days was carried out in a nursery located in Sicily (south Italy), treating 572 potted palm trees (286 P. dactylifera and 286 P. canariensis) with an average diameter at the base of 18-20 cm. After 400 days, 48% of the untreated palms were infested, while only 3% of date palms and 7% of Canary palms treated with insecticide at lower dosages were infested. The application of an insecticide-based coating is a good strategy to control and prevent the red palm weevil infestation, in particular on date palms. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
7 CFR 457.163 - Nursery peak inventory endorsement.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery peak inventory endorsement. 457.163 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.163 Nursery peak inventory endorsement. Nursery Crop Insurance Peak Inventory Endorsement This endorsement is not continuous and must be...
7 CFR 457.162 - Nursery crop insurance provisions.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery crop insurance provisions. 457.162 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.162 Nursery crop insurance provisions. The Nursery Crop Insurance Provisions for the 2006 and succeeding crop years are as follows: FCIC...
Insecticide solvents: interference with insecticidal action.
Brattsten, L B; Wilkinson, C F
1977-06-10
Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.
National Proceedings: Forest and Conservation Nursery Associations-2009
L. E. Riley; J. R. Pinto; R. K. Dumroese
2010-01-01
These proceedings are a compilation of 20 papers that were presented at the regional meetings of the Intertribal Nursery Council and the forest and conservation nursery associations in the United States in 2009. The Intertribal Nursery Council Meeting was held at the Best Western University Inn in Moscow, Idaho, on July 14, 2009. Subject matter for the technical...
Nutrient removal by apple, pear and cherry nursery trees
Giovambattista Sorrenti; Maurizio Quartieri; Silvia Salvi; Moreno Toselli
2017-01-01
Given that nursery is a peculiar environment, the amount of nutrients removed by nursery trees represents a fundamental acquisition to optimise fertilisation strategies, with economic and environmental implications. In this context, we determined nutrient removal by apple, pear and cherry nursery trees at the end of the nursery growing cycle. We randomly removed 5 leafless apple (Golden Delicious/EMLA M9; density of 30,000 trees ha–1), pear (Santa Maria/Adams; density of 30,000 trees ha–1) an...
Forest nursery pest management in Cuba
Rene Alberto Lopez Castilla; Angela Duarte Casanova; Celia Guerra Rivero; Haylett Cruz Escoto; Natividad Triguero Issasi
2002-01-01
A systematic survey of methods to detect pests in forest nurseries before they damage plants was done. These surveys recorded the most important forest nursery pests during 18 years (from 1980 to 1998) and their geographical and temporal distribution in the principal enterprises in Cuba. Approximately a dozen insect species and three fungi species responsible for the...
29 CFR 780.216 - Nursery activities generally and Christmas tree production.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Nursery activities generally and Christmas tree production... Nursery activities generally and Christmas tree production. (a) The employees of a nursery who are engaged... horticultural commodities such as the following are employed in agriculture: (1) Planting seedlings in a nursery...
Particulate matter in rural and urban nursery schools in Portugal
International Nuclear Information System (INIS)
Nunes, R.A.O.; Branco, P.T.B.S.; Alvim-Ferraz, M.C.M.; Martins, F.G.; Sousa, S.I.V.
2015-01-01
Studies have been showing strong associations between exposures to indoor particulate matter (PM) and health effects on children. Urban and rural nursery schools have different known environmental and social differences which make their study relevant. Thus, this study aimed to evaluate indoor PM concentrations on different microenvironments of three rural nursery schools and one urban nursery school, being the only study comparing urban and rural nursery schools considering the PM 1 , PM 2.5 and PM 10 fractions (measured continuously and in terms of mass). Outdoor PM 2.5 and PM 10 were also obtained and I/O ratios have been determined. Indoor PM mean concentrations were higher in the urban nursery than in rural ones, which might have been related to traffic emissions. However, I/O ratios allowed concluding that the recorded concentrations depended more significantly of indoor sources. WHO guidelines and Portuguese legislation exceedances for PM 2.5 and PM 10 were observed mainly in the urban nursery school. - Highlights: • This is the only study comparing urban and rural nurseries considering PM fractions. • A low number of children in classrooms is enough to increase PM concentrations. • Children in urban nurseries are exposed to higher PM concentrations than in rural. • Children were mainly exposed to the finer fractions, which are worse to health. - PM levels were higher in the urban nursery than in the rural ones, which might have been related to traffic emissions. Still concentrations depended more significantly of indoor sources
Peene, F.
2006-01-01
Stage rapport van een leerling van Hogeschool Zeeland, opleiding Aquatische Ecotechnologie. De studie die tijdens deze stage uitgevoerd is, is een literatuurstudie naar systemen voor de nursery van mosselen en systemen voor grootschalige algenkweek ten behoeve van deze nursery. Ook zijn experimenten
Insecticide control of vector-borne diseases: when is insecticide resistance a problem?
Directory of Open Access Journals (Sweden)
Ana Rivero
Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.
Nursery function of tropical back-reef systems
Adams, A.J.; Dahlgren, C.P.; Kellison, G.T.; Kendall, M.S.; Layman, C.A.; Ley, J.A.; Nagelkerken, I.; Serafy, J.E.
2006-01-01
Similar to nearshore systems in temperate latitudes, the nursery paradigm for tropical back-reef systems is that they provide a habitat for juveniles of species that subsequently make ontogenetic shifts to adult populations on coral reefs (we refer to this as the nursery function of back-reef
Rhizoctonia crown and root rot disease nursery
The BSDF cooperative CRR Eastern Evaluation Nursery Rhizoctonia crown and root rot Evaluation Nursery in 2016 was a randomized complete-block design with five replications in 15 feet long, one-row plots (20 in row spacing), at the Saginaw Valley Research and Education Center near Frankenmuth, MI. F...
Gaseous pollutants on rural and urban nursery schools in Northern Portugal
International Nuclear Information System (INIS)
Nunes, R.A.O.; Branco, P.T.B.S.; Alvim-Ferraz, M.C.M.; Martins, F.G.; Sousa, S.I.V.
2016-01-01
Indoor air quality in nursery schools is different from other schools and this has been largely ignored, particularly in rural areas. Urban and rural nursery schools have different environmental characteristics whose knowledge needs improvement. Thus, this study aimed to evaluate continuously the concentrations of CO_2, CO, NO_2, O_3, CH_2O and total VOC in three rural nursery schools and one urban, being the only one comparing urban and rural nurseries with continuous measurements, thus considering occupation and non-occupation periods. Regarding CO_2, urban nursery recorded higher concentrations (739–2328 mg m"−"3) than rural nurseries (653–1078 mg m"−"3). The influence of outdoor air was the main source of CO, NO_2 and O_3 indoor concentrations. CO and NO_2 concentrations were higher in the urban nursery and O_3 concentrations were higher in rural ones. CH_2O and TVOC concentrations seemed to be related to internal sources, such as furniture and flooring finishing and cleaning products. - Highlights: • This is the only study comparing gaseous pollutants continuously measured in urban and rural nurseries. • Children's risk of exposure occurs mainly in the urban nursery school. • Outdoor air was the main determinant of CO, NO_2 and O_3 indoor concentrations. • There is a need to implement measures to reduce critical situations regarding IAQ. - Gaseous pollutant levels were higher in the urban nursery than in rural ones, except for O_3. High concentrations were due to lack of ventilation, outdoor air and internal sources.
Cantey, Joseph B; Vora, Niraj; Sunkara, Mridula
2017-09-01
Prolonged or unnecessary antibiotic use is associated with adverse outcomes in infants. Antibiotic stewardship programs (ASPs) aim to prevent these adverse outcomes and optimize antibiotic prescribing. However, data evaluating ASP coverage of nurseries are limited. The objectives of this study were to describe the characteristics of nurseries with and without ASP coverage and to determine perceptions of and barriers to nursery ASP coverage. The 2014 American Hospital Association annual survey was used to randomly select a level III neonatal intensive care unit from all 50 states. A level I and level II nursery from the same city as the level III nursery were then randomly selected. Hospital, nursery, and ASP characteristics were collected. Nursery and ASP providers (pharmacists or infectious disease providers) were interviewed using a semistructured template. Transcribed interviews were analyzed for themes. One hundred forty-six centers responded; 104 (71%) provided nursery ASP coverage. In multivariate analysis, level of nursery, university affiliation, and number of full-time equivalent ASP staff were the main predictors of nursery ASP coverage. Several themes were identified from interviews: unwanted coverage, unnecessary coverage, jurisdiction issues, need for communication, and a focus on outcomes. Most providers had a favorable view of nursery ASP coverage. Larger, higher-acuity nurseries in university-affiliated hospitals are more likely to have ASP coverage. Low ASP staffing and a perceived lack of importance were frequently cited as barriers to nursery coverage. Most nursery ASP coverage is viewed favorably by providers, but nursery providers regard it as less important than ASP providers. © The Author 2016. Published by Oxford University Press on behalf of the Pediatric Infectious Diseases Society. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Hot spots of Phytophthora in commercial nurseries
Corina Junker; Patrick Goff; Stefan Wagner; Sabine Werres
2017-01-01
Studies have shown that nurseries are an important source for the spread of Phytophthora. Most surveys and studies focusing on the epidemiology of these pathogens in nurseries are based on sampling of symptomatic plants or on samples like water of different sources used for irrigation. There is little knowledge, however, on the survival and...
Reid, Molly C.; McKenzie, F. Ellis
2016-01-01
The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...
Pollution Of Insecticide Residues In PPTN Pasar Jumat Area
International Nuclear Information System (INIS)
Syahrir, Ulfa T.; Chairul, Sofnie M.
2000-01-01
Measurement of insecticide residue pollution from some organochlorin and organo-phosphat in soil and water samples were carried out 1999-2000 periode. The aim of the measurement was to get information about impact of laboratorium activity on insecticide contents in PPTN PASAR JUMAT. Gas chromatograph with electron capture and flame ionization detector were used to measure the pesticide content. Result of the measurement in PPTN area showed that organo-chlorin were alpha BHC, endosulfan band DDT and organo-phosphat were klorphyriphos and malation and were lower than tolerance level
Gaseous pollutants on rural and urban nursery schools in Northern Portugal.
Nunes, R A O; Branco, P T B S; Alvim-Ferraz, M C M; Martins, F G; Sousa, S I V
2016-01-01
Indoor air quality in nursery schools is different from other schools and this has been largely ignored, particularly in rural areas. Urban and rural nursery schools have different environmental characteristics whose knowledge needs improvement. Thus, this study aimed to evaluate continuously the concentrations of CO2, CO, NO2, O3, CH2O and total VOC in three rural nursery schools and one urban, being the only one comparing urban and rural nurseries with continuous measurements, thus considering occupation and non-occupation periods. Regarding CO2, urban nursery recorded higher concentrations (739-2328 mg m(-3)) than rural nurseries (653-1078 mg m(-3)). The influence of outdoor air was the main source of CO, NO2 and O3 indoor concentrations. CO and NO2 concentrations were higher in the urban nursery and O3 concentrations were higher in rural ones. CH2O and TVOC concentrations seemed to be related to internal sources, such as furniture and flooring finishing and cleaning products. Copyright © 2015 Elsevier Ltd. All rights reserved.
Weed management at ArborGen, South Carolina SuperTree Nursery
Mike Arnette
2009-01-01
Weed management is vital to producing healthy hardwood seedlings. Several methods are available to each nursery, and it is common knowledge that what works for one situation may not work for another. The weed control methods used in nursery beds of hardwood species at the South Carolina SuperTree Nursery (Blenheim) are listed below.
Variation effect on the insecticide activity of DDT analogues. A chemometric approach
Itoh, S.; Nagashima, U.
2002-08-01
We investigated a variation effect on the insecticide activity of DDT analogues by using the first principles electronic structure calculations and the neural network analysis. It has been found that the charge distribution at the specific atomic sites in the DDT molecule is related to their toxicity. This approach can contribute to designing a new insecticide and a new harmlessness process of the DDT analogues.
Juvenile nursery colonization patterns for the European flounder (
Martinho, F.; van der Veer, H.W.; Cabral, H.N.; Pardal, M.A.
2013-01-01
In this work, we analysed the latitudinal trends in the nursery habitat colonization processes of the European flounder (Platichthys flesus). This was accomplished by estimating the duration of the pelagic and metamorphic stages, as well as the duration of the spawning period, in several nursery
Recidivism after release from a prison nursery program.
Goshin, Lorie S; Byrne, Mary W; Henninger, Alana M
2014-01-01
To analyze 3-year recidivism after release from a prison nursery, a secure unit that allows imprisoned women to care for their infants. Descriptive study of 139 women who co-resided with their infants between 2001 and 2007 in a New York State prison nursery. Administrative criminal justice data were analyzed along with prospective study data on demographic, mental health, and prison nursery policy-related factors. Results reflect a sample of young women of color with histories of clinically significant depressive symptoms and substance dependence, who were convicted of nonviolent crimes and had multiple prior arrests. Three years after release 86.3% remained in the community. Only 4% of women returned to prison for new crimes. Survival modeling indicated that women who had previously violated parole had a significantly shorter mean return to prison time than those who were in the nursery for a new crime. Women released from a prison nursery have a low likelihood of recidivism. Innovative interventions are needed to address incarceration's public health effects. Nurses can partner with criminal justice organizations to develop, implement, and evaluate programs to ensure the health needs of criminal justice involved people and their families are met. © 2013 Wiley Periodicals, Inc.
Development of an intertidal mangrove nursery and afforestation techniques
Digital Repository Service at National Institute of Oceanography (India)
Untawale, A.G.
The development of an intertidal mangrove nursery and afforestation technique for regeneration and restoration of mangroves of Goa is described. Site selection, source of plant material, nursery plantation, season of transplantation, technique...
Reid, Molly C; McKenzie, F Ellis
2016-02-19
The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.
How to test herbicides at forest tree nurseries.
Roger E. Sandquist; Peyton W. Owston; Stephen E. McDonald
1981-01-01
Procedures developed in a cooperative westwide study of weed control in forest tree nurseries are described in a form modified for use by nursery managers. The proven, properly designed test and evaluation methods can be used to generate data needed for evaluation and registration of herbicides.
A series of bioassays were conducted to test the systemic activity of clothianidin, chlorantraniliprole, dinotefuran, and thiamethoxam against adult black vine weevils (Otiorhynchus sulcatus F.) on Taxus, Heuchera, Astilbe, Sedum, Euonymus, and Rhododendron grown in containers. The insecticides wer...
A short history of insecticides
Directory of Open Access Journals (Sweden)
Oberemok Volodymyr Volodymyrovych
2015-07-01
Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.
Proactive approach to containment of enterovirus infection in the nursery.
Fuchs, Inbal; Golan, Agneta; Borer, Abraham; Shemer-Avni, Yonat; Dagan, Ron; Greenberg, David
2013-07-01
Administration of prophylactic intravenous immunoglobulins to contacts of infants actively shedding enterovirus during a hospital nursery outbreak may attenuate severity of disease in those contacts and aid in containment of the outbreak. Four cases of neonatal enteroviral disease were treated in our hospital nursery in July and August 2011; 3 were presumed or proven vertical transmission cases and 1 was a presumed horizontal transmission. We aimed to prevent development of severe illness in contacts of affected neonates following a ministry of health advisory during the summer of 2011 warning of increased neonatal enteroviral morbidity and mortality in Israel. Strict infection control measures were implemented, including meticulous decontamination of the nursery environment and administration of intravenous immunoglobulin prophylaxis to contacts. No further horizontal transmission occurred after infection control interventions. Immunoglobulin prophylaxis to control enteroviral infection in the nursery should be considered as an auxiliary infection control intervention during a nursery outbreak.
Pedagogy with Babies: Perspectives of Eight Nursery Managers
Elfer, Peter; Page, Jools
2015-01-01
The last 30 years have seen a significant increase in babies attending nursery, with corresponding questions about the aims and organisation of practice. Research broadly agrees on the importance of emotionally consistent, sensitive and responsive interactions between staff and babies. Policy objectives for nursery and expectations of parents and…
Srinivasan, Mythili; Hamvas, Corrine; Coplen, Douglas
2015-10-01
To determine rates of complications after newborn circumcision by performing a retrospective chart review of patients circumcised at a well-baby nursery, neonatal intensive care units (NICU), and special care nursery (SCN) from 2007 to 2012. A total of 5129 babies (73%) were circumcised at the well-baby nursery and 1909 babies (27%) at the NICU and SCN. Forty-seven patients (0.67%, 95% CI 0.49% to 0.89%) had circumcision-related complications: 5 (0.07%) patients with acute and 42 (0.6%) with late complications. Babies in the NICU/SCN had increased odds of complication (OR 4.00, 95% CI 2.23 to 7.19) compared with those in well-baby nursery. There were increased odds of complications in babies with Caucasian ethnicity (OR 2.60, 95% CI 1.48 to 4.89) compared with African American babies and in babies with private insurance (OR 4.0, 95% CI 2.1 to 7.5) compared with nonprivate insurance. The rates of complications after newborn circumcisions were low. Babies in the NICU/SCN had increased odds of complication. © The Author(s) 2015.
MEANING AND FORM IN NURSERY RHYMES TRANSLATION
Directory of Open Access Journals (Sweden)
Ikke Dewi Pratama
2017-07-01
Full Text Available Abstract MAKNA DAN BENTUK DALAM PENERJEMAHAN LAGU-LAGU ANAK Abstract Translating nursery rhymes is not an easy task. The problems of equivalence in meaning and form as well as in the harmony between the translated lyrics and the music are aspects that need to be considered by the translators. By considering nursery rhyme lyric as poetry text, this research analyzes the equivalence of meaning and form in nursery rhymes translation. This research focuses on five nursery rhymes. The meaning analysis was done by conducting particular procedures on translation quality assessment. Meanwhile, the analysis of the form was conducted by comparing the two versions of the nursery rhymes focusing on the sound values. From the equivalence of meaning, the result shows that most nursery rhymes are translated less accurately. On the other hand, the finding of the equivalence in form shows that most of the auditory devices are deleted while most of the rhymes are shifted. This research is expected to give a contribution to song translation activities especially those involving children as the target listeners. Keywords: equivalence, accuracy, sound values, auditory devices, rhymes Abstrak Menerjemahkan lagu anak bukanlah hal yang mudah. Masalah kesepadanan makna dan bentuk, serta harmonisasi antara lirik terjemahan dan musik adalah aspek-aspek yang harus dipertimbangkan oleh penerjemah. Dengan mempertimbangkan lirik lagu anak sebagai teks puisi, penelitian ini menganalisis kesepadanan antara makna dan bentuk dalam terjemahan lagu anak. Dengan menggunakan teknik sampling, penelitian ini berfokus kepada lima lagu anak. Analisis makna dilakukan dengan prosedur penelitian kualitas terjemahan sedangkan analisis bentuk dilakukan dengan membandingkan dua versi lagu anak dengan fokus kepada sound values (bunyi. Analisis kesepadanan makna menunjukkan bahwa sebagian besar lagu anak diterjemahkan dengan kurang akurat. Dari segi bentuk, sebagian besar auditory devices
Desert bighorn sheep lambing habitat: Parturition, nursery, and predation sites
Karsch, Rebekah C.; Cain, James W.; Rominger, Eric M.; Goldstein, Elise J.
2016-01-01
Fitness of female ungulates is determined by neonate survival and lifetime reproductive success. Therefore, adult female ungulates should adopt behaviors and habitat selection patterns that enhance survival of neonates during parturition and lactation. Parturition site location may play an important role in neonatal mortality of desert bighorn sheep (Ovis canadensis mexicana) when lambs are especially vulnerable to predation, but parturition sites are rarely documented for this species. Our objectives were to assess environmental characteristics at desert bighorn parturition, lamb nursery, and predation sites and to assess differences in habitat characteristics between parturition sites and nursery group sites, and predation sites and nursery group sites. We used vaginal implant transmitters (VITs) to identify parturition sites and capture neonates. We then compared elevation, slope, terrain ruggedness, and visibility at parturition, nursery, and lamb predation sites with paired random sites and compared characteristics of parturition sites and lamb predation sites to those of nursery sites. When compared to random sites, odds of a site being a parturition site were highest at intermediate slopes and decreased with increasing female visibility. Odds of a site being a predation site increased with decreasing visibility. When compared to nursery group sites, odds of a site being a parturition site had a quadratic relationship with elevation and slope, with odds being highest at intermediate elevations and intermediate slopes. When we compared predation sites to nursery sites, odds of a site being a predation were highest at low elevation areas with high visibility and high elevation areas with low visibility likely because of differences in hunting strategies of coyote (Canis latrans) and puma (Puma concolor). Parturition sites were lower in elevation and slope than nursery sites. Understanding selection of parturition sites by adult females and how habitat
Michelle M. Cram; Michelle S. Frank; Katy M. Mallams
2012-01-01
This edition of Forest Nursery Pests, Agriculture Handbook No. 680, was made possible by the work of many people from around the country. Contributing authors include U.S. Department of Agriculture, Forest Service and Agricultural Research Service entomologists and pathologists, university professors and researchers, State extension specialists, consultants, and plant...
Signing In: Knowledge and Action in Nursery Teaching
Plum, Maja
2018-01-01
Based on fieldwork conducted in two day care centres in Denmark, this paper explores knowledge and action as relational and intertwined phenomena in nursery teaching. Engaging with perspectives from actor network theory, emphasis is put on the socio-material distribution of knowing and acting. That is, how the nursery teacher becomes part of…
New, Karen; Bogossian, Fiona; East, Christine; Davies, Mark William
2010-06-01
The incubator environment is essential for optimal physiological functioning and development of the premature infant but the infant is ultimately required to make a successful transfer from incubator to open cot in order to be discharged from hospital. Criteria for transfer lack a systematic approach because no clear, specific guideline predominates in clinical practice. Practice variation exists between continents, regions and nurseries in the same countries, but there is no recent review of current practices utilised for transferring premature infants from incubators to open cots. To document current practice for transferring premature infants to open cots in neonatal nurseries. A descriptive, cross-sectional survey. Twenty-two neonatal intensive care units and fifty-six high dependency special care baby units located in public hospitals in Australia and New Zealand. A sample of 78 key clinical nursing leaders (nurse unit managers, clinical nurse consultants or clinical nurse specialists) within neonatal nurseries identified through email or telephone contact. Data were collected using a web-based survey on practice, decision-making and strategies utilised for transferring premature infants from incubators to open cots. Descriptive statistics (frequencies and crosstabs) were used to analyse data. Comparisons between groups were tested for statistical significance using Chi-squared or Fisher's exact test. Significant practice variation between countries was found for only one variable, nursing infants clothed (p=0.011). Processes and practices undertaken similarly in both countries include use of incubator air control mode, current weight criterion, thermal challenging, single-walled incubators and heated mattress systems. Practice variation was significant between neonatal intensive care units and special care baby units for weight range (p=0.005), evidence-based practice (p=0.004), historical nursery practice (p=0.029) and incubator air control mode (p=0
Nagelkerken, Ivan; Grol, Monique G G; Mumby, Peter J
2012-01-01
No-take marine fishery reserves sustain commercial stocks by acting as buffers against overexploitation and enhancing fishery catches in adjacent areas through spillover. Likewise, nursery habitats such as mangroves enhance populations of some species in adjacent habitats. However, there is lack of understanding of the magnitude of stock enhancement and the effects on community structure when both protection from fishing and access to nurseries concurrently act as drivers of fish population dynamics. In this study we test the separate as well as interactive effects of marine reserves and nursery habitat proximity on structure and abundance of coral reef fish communities. Reserves had no effect on fish community composition, while proximity to nursery habitat only had a significant effect on community structure of species that use mangroves or seagrass beds as nurseries. In terms of reef fish biomass, proximity to nursery habitat by far outweighed (biomass 249% higher than that in areas with no nursery access) the effects of protection from fishing in reserves (biomass 21% lower than non-reserve areas) for small nursery fish (≤ 25 cm total length). For large-bodied individuals of nursery species (>25 cm total length), an additive effect was present for these two factors, although fish benefited more from fishing protection (203% higher biomass) than from proximity to nurseries (139% higher). The magnitude of elevated biomass for small fish on coral reefs due to proximity to nurseries was such that nursery habitats seem able to overrule the usually positive effects on fish biomass by reef reserves. As a result, conservation of nursery habitats gains importance and more consideration should be given to the ecological processes that occur along nursery-reef boundaries that connect neighboring ecosystems.
Directory of Open Access Journals (Sweden)
Ivan Nagelkerken
Full Text Available No-take marine fishery reserves sustain commercial stocks by acting as buffers against overexploitation and enhancing fishery catches in adjacent areas through spillover. Likewise, nursery habitats such as mangroves enhance populations of some species in adjacent habitats. However, there is lack of understanding of the magnitude of stock enhancement and the effects on community structure when both protection from fishing and access to nurseries concurrently act as drivers of fish population dynamics. In this study we test the separate as well as interactive effects of marine reserves and nursery habitat proximity on structure and abundance of coral reef fish communities. Reserves had no effect on fish community composition, while proximity to nursery habitat only had a significant effect on community structure of species that use mangroves or seagrass beds as nurseries. In terms of reef fish biomass, proximity to nursery habitat by far outweighed (biomass 249% higher than that in areas with no nursery access the effects of protection from fishing in reserves (biomass 21% lower than non-reserve areas for small nursery fish (≤ 25 cm total length. For large-bodied individuals of nursery species (>25 cm total length, an additive effect was present for these two factors, although fish benefited more from fishing protection (203% higher biomass than from proximity to nurseries (139% higher. The magnitude of elevated biomass for small fish on coral reefs due to proximity to nurseries was such that nursery habitats seem able to overrule the usually positive effects on fish biomass by reef reserves. As a result, conservation of nursery habitats gains importance and more consideration should be given to the ecological processes that occur along nursery-reef boundaries that connect neighboring ecosystems.
Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian
2014-08-01
The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.
Energy Technology Data Exchange (ETDEWEB)
Brattset, O; Hestnes, A G
1985-02-01
Dragvoll nursery school in Trondheim (Norway) is designed with a central winter garden built up by glazed walls and a glass roof, and surrounded by classrooms. The ventilating air is preheated in a heat exchanger, and then postheated in the said garden by the solar flux before entering the air conditioning system. A comparative evaluation of the energy consumption with the total floor area of about 57 m/sup 2/ is done in relation to a conventionally built nursery school with a floor area of about 520 m/sup 2/. The saving potential is found to 52%. 9 drawing.
Caribou nursery site habitat characteristics in two northern Ontario parks
Directory of Open Access Journals (Sweden)
Natasha L. Carr
2007-04-01
Full Text Available To prevent further range recession, habitat features essential to the life-history requisites of woodland caribou (Rangifer tarandus caribou such as calving and nursery sites need to be protected for the persistence of the species. Woodland caribou may minimize predation risk during calving by either spacing out or spacing away from predators in the forest to calve on islands, wetlands, or shorelines. Our objective was to determine the characteristics of shoreline habitats used as calving and nursery sites by female woodland caribou in northern Ontario. Detailed vegetation and other site characteristics were measured at nursery sites used by cow-calf pairs in Wabakimi and Woodland Caribou Provincial Parks for comparison with shoreline sites that were not used by caribou within each park. Differences in habitat variables selected by female caribou in the two study areas reflect broad ecoregional differences in vegetation and topography. In Wabakimi Provincial Park, understorey tree density and ground detection distance played key roles in distinguishing nursery sites from sites that were not used. In Woodland Caribou Provincial Park, groundcover vegetation and shrub density were important in the selection of nursery sites by female caribou. Generally, female caribou in both parks selected nursery sites with greater slope, lower shrub density but thicker groundcover vegetation, including greater lichen abundance, and higher densities of mature trees than shoreline sites that were not used. The identification of these important features for caribou nursery sites provides a basis for improving their protection in future management policies and legislation.
National Proceedings: Forest and Conservation Nursery Associations-2007
Kas Dumroese; L. E. Riley
2008-01-01
These proceedings are a compilation of the papers that were presented at the regional meetings of the forest and conservation nursery associations in the United States and Canada in 2007. The Northeastern Forest and Conservation Nursery Association meeting was held July 16 to 19 at the Grappone Conference Center in Concord, NH. The meeting was hosted by the New...
National Proceedings: Forest and Conservation Nursery Associations - 2013
K. M. Wilkinson; D. L. Haase; J. R. Pinto
2014-01-01
These proceedings are a compilation of 14 papers that were presented at the regional meetings of the forest and conservation nursery associations in the United States in 2013. The Joint Northeast and Southern Forest Nursery Conference was held at the Holiday Inn City Centre, Lafayette, Indiana, July 22 to 25, 2013. Subject matter for the technical sections included...
Development of Two Intelligent Spray Systems for Ornamental Nurseries
Current application technology for floral, nursery, and other specialty crop production wastes significant amounts of pesticides. Two different real-time variable-rate sprayer prototypes for ornamental nursery and tree crops were developed to deliver chemicals on target areas as needed. The first pr...
Heroes and villains: Research identifies harmful and beneficial microbes in nursery soil
Phytophthora and Pythium species are common pathogens in nursery systems that can cause rhododendron root rot. Plants with root rot are often stunted, and may wilt and die, thus directly reducing nursery profit. Rhododendrons are an important crop in Pacific Northwest nurseries, but are highly susc...
7 CFR 301.75-17 - Funds for the replacement of certified citrus nursery stock.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Funds for the replacement of certified citrus nursery... nursery stock. Subject to the availability of appropriated funds, a commercial citrus nursery may be eligible to receive funds to replace certified citrus nursery stock in accordance with the provisions of...
Optimaal en efficient voeren van mosselbroed in een nursery
Hiele, van der T.M.
2007-01-01
Stage verslag van een student van de hogeschool Zeeland, opleiding aquatische Ecotechnologie. Bij dit onderzoek is gekeken naar optimaal en efficient voeren van mosselbroed in een nursery. Geconcludeerd wordt dat de beste manier om mosselbroed in een nursery te voeren is door de algen toe te dienen
29 CFR 780.209 - Packing, storage, warehousing, and sale of nursery products.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Packing, storage, warehousing, and sale of nursery products... FAIR LABOR STANDARDS ACT Agriculture as It Relates to Specific Situations Nursery and Landscaping Operations § 780.209 Packing, storage, warehousing, and sale of nursery products. Employees of a grower of...
Nursery words and hypocorisms among Germanic kinship terms
DEFF Research Database (Denmark)
Hansen, Bjarne Simmelkjær Sandgaard
2018-01-01
By using Jakobson’s (1960: 127-130) criteria for determining the nursery-word sta-tus of a given lexeme, I argue in this article that, even if we should no longer re-gard PG *aiþīn-/-ōn- ‘mother’ (Goth. aiþei), *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ as nursery words...
Botanical Insecticides in Plant Protection
Grdiša, Martina; Gršić, Kristina
2013-01-01
Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....
Japanese beetles, Popillia japonica Newman, are a nursery regulatory pest. Immersion of field-grown plants harvested as balled and burlapped (B&B) or container plants grown in pine bark substrates in a solution of chlorpyrifos or bifenthrin is allowed for certification in the Domestic Japanese Beet...
Nurseries surveyed in Southern California adopt best practices for water quality
Mangiafico, Salvatore S; Newman, Julie; Mochizuki, Maren; Zurawski, Dale; Merhaut, Donald J.; Faber, Ben
2010-01-01
A variety of good management practices have been recommended to minimize the impact of water runoff from production nurseries. However, studies have not been conducted to gauge which management practices nursery producers are most likely to adopt in response to education and increased government oversight. We surveyed 85 production nurseries in Southern California about their existing practices to limit the impacts of runoff from their facilities. Of these, 65 in Ventura County were resurveye...
Genetic bottlenecks in agroforestry systems: results of tree nursery surveys in East Africa
Lengkeek, A.G.; Jaenicke, H.; Dawson, I.K.
2005-01-01
Seedlings sourced through tree nurseries are expected to form an important component of future tree cover on farms. As such, the genetic composition of nursery seedlings is expected to impact on the productivity and sustainability of agroforestry ecosystems. By surveying current practices of nursery
Jane E. Stewart; Mee-Sook Kim; Robert L. James; R. Kasten Dumroese; Ned B. Klopfenstein
2006-01-01
Fusarium species can cause severe root disease and damping-off in conifer nurseries. Fusarium inoculum is commonly found in most container and bareroot nurseries on healthy and diseased seedlings, in nursery soils, and on conifer seeds. Isolates of Fusarium spp. can differ in virulence; however, virulence and...
Using organic fertilizers in forest and native plant nurseries
Thomas D. Landis; R. Kasten Dumroese
2012-01-01
Since World War II, synthetic fertilizers have been used almost exclusively to grow forest and native plant nursery crops because they are quickly soluble and readily taken up by crops, producing the rapid growth rates that are necessary in nursery culture. In recent years, however, a wide variety of new organic fertilizers have become available. We divided these...
Investigations of Fusarium diseases within Inland Pacific Northwest forest nurseries
Robert L. James; R. Kasten Dumroese
2007-01-01
Fusarium spp. cause important diseases that limit production of seedlings in forest nurseries worldwide. Several aspects of these diseases have been investigated for many years within Inland Pacific Northwest nurseries to better understand disease etiology, pathogen inoculum sources, and epidemiology. Investigations have also involved improving...
J.L. Parke; B.J. Knaus; V.J. Fieland; C. Lewis; N.J. Grünwald
2014-01-01
Nursery plants are important vectors for plant pathogens. Understanding what pathogens occur in nurseries in different production stages can be useful to the development of integrated systems approaches. Four horticultural nurseries in Oregon were sampled every 2 months for 4 years to determine the identity and community structure of Phytophthora...
Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen
2016-02-24
The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.
Nursery management [Chapter 16
Kim M. Wilkinson
2009-01-01
This handbook provides an overview of the factors that go into starting and operating a native plant nursery. Management includes all aspects of working with plants in all their phases of growth as described in Chapter 3, Crop Planning and Developing Propagation Protocols. Management also includes working with the community; organizing materials and infrastructure;...
Investigation of Nursery Rhymes According to the Classification of Semantic Fields and Values
Dinçel, Betül Keray
2017-01-01
Nursery rhymes are quite important in terms of developing children's language skills. It was observed that there is a paucity of research looking at semantic fields and value regarding nursery rhymes; therefore, this study was intended to fill that gap in the literature by investigating nursery rhymes in terms of semantic fields and value. In this…
Emotional Aspects of Nursery Policy and Practice--Progress and Prospect
Elfer, Peter
2015-01-01
This article argues for a turn in early years policy towards more serious attention to the emotional dimensions of nursery organisation and practice. The article describes three developing bodies of research on emotion in nursery, each taking a different theoretical perspective. The central argument of the article is that these three bodies of…
A canteen for the Nursery School A project for CERN
Association du personnel
2007-01-01
For a number of years a minimum service has been offered at lunchtime between 12.15 and 13.30 for children enrolled for the full day at the CERN Nursery School. This service is provided by qualified staff at the Nursery School, on the premises, the meals being supplied by the parents.
Parke, Jennifer L; Knaus, Brian J; Fieland, Valerie J; Lewis, Carrie; Grünwald, Niklaus J
2014-10-01
Nursery plants are important vectors for plant pathogens. Understanding what pathogens occur in nurseries in different production stages can be useful to the development of integrated systems approaches. Four horticultural nurseries in Oregon were sampled every 2 months for 4 years to determine the identity and community structure of Phytophthora spp. associated with different sources and stages in the nursery production cycle. Plants, potting media, used containers, water, greenhouse soil, and container yard substrates were systematically sampled from propagation to the field. From 674 Phytophthora isolates recovered, 28 different species or taxa were identified. The most commonly isolated species from plants were Phytophthora plurivora (33%), P. cinnamomi (26%), P. syringae (19%), and P. citrophthora (11%). From soil and gravel substrates, P. plurivora accounted for 25% of the isolates, with P. taxon Pgchlamydo, P. cryptogea, and P. cinnamomi accounting for 18, 17, and 15%, respectively. Five species (P. plurivora, P. syringae, P. taxon Pgchlamydo, P. gonapodyides, and P. cryptogea) were found in all nurseries. The greatest diversity of taxa occurred in irrigation water reservoirs (20 taxa), with the majority of isolates belonging to internal transcribed spacer clade 6, typically including aquatic opportunists. Nurseries differed in composition of Phytophthora communities across years, seasons, and source within the nursery. These findings suggest likely contamination hazards and target critical control points for management of Phytophthora disease using a systems approach.
Recirculation nursery systems for bivalves
Kamermans, P.; Blanco Garcia, A.; Joaquim, Sandra; Matias, Domitilia; Magnesen, Thorolf; Nicolas, J.; Petten, Bruno; Robert, Rene
2016-01-01
n order to increase production of bivalves in hatcheries and nurseries, the development of new technology and its integration into commercial bivalve hatcheries is important. Recirculation aquaculture systems (RASs) have several advantages: high densities of the species can be cultured resulting in
T. Ufer; M. Posner; H.-P. Wessels; S. Wagner; K. Kaminski; T. Brand; Werres S.
2008-01-01
In a four year project, three different filtration systems were tested under commercial nursery conditions to eliminate Phytophthora spp. from irrigation water. Five nurseries were involved in the project. Slow sand filtration systems were tested in three nurseries. In the fourth nursery, a filtration system with lava grains (Shieer® Bio filtration)...
The South African Experience of Conservation and Social Forestry Outreach Nurseries
Botha, Jenny; Witkowski, Ed T. F.; Cock, Jacklyn
2006-11-01
Outreach nurseries are favored conservation and social forestry tools globally, but, as with many integrated conservation and development programs (ICDPs), they do not always produce anticipated results. A synopsis of the experience of South African practitioners is provided in this study of 65 outreach nurseries. South African outreach nurseries frequently include financial objectives, creating additional challenges in simultaneously attaining conservation and socioeconomic goals. Progress was hindered by biophysical problems (e.g., lack of water, poor soils, etc.) as well as the harsh socioeconomic conditions facing most communities in which nurseries had been established. Attaining financial viability was challenging. Business management skills were often restricted, and few viability studies included adequate market research. Costs to community participants were usually high, and benefits were limited. Conservation objectives were frequently lost in the struggle to attain financial viability. The management of social processes also proved challenging. Although small scale and relatively straightforward compared with many ICDPs, nurseries usually require substantial institutional support, including a range of technical, business, and development services. Project time frames need to be reconsidered, as practitioners estimate that it takes 5-10 years for nurseries to start meeting objectives, and donors and implementing agencies often operate on 2-3-year project cycles. Detailed viability studies are essential, incorporating a social probe and an assessment of potential impacts of projects on community participants. Progress needs to be continuously evaluated to enable institutions and community participants to adapt to changing conditions as well as ensure that the spectrum of objectives are being achieved.
Improvements for energy conservation at the Coeur d'Alene Nursery
Aram Eramian
2009-01-01
In 2002, the USDA Forest Service Coeur d'Alene Nursery in Idaho began to evaluate ways to reduce energy consumption in lighting, refrigeration, and heating and cooling of facility workspace. The primary factor leading up to this was the inefficiency of the nursery's Freon(R)-based refrigeration system. Energy costs and maintenance of the system were becoming...
Impact of Nursery Rhymes on Iranian EFL Learners’ Listening Comprehension Skill Improvement-A Study
Directory of Open Access Journals (Sweden)
Omid Pourkalhor
2017-06-01
Full Text Available The present study was an attempt to investigate the effect of nursery rhymes on the young language learners listening comprehension ability. To do so, 30 elementary learners were selected as the potential participants of the study. The learners’ perceptions about using nursery rhymes in teaching listening as well as teachers’ perceptions about teaching listening comprehension through nursery rhymes were taken into account. The listening pre- and post-tests and teachers and learners’ interviews were employed for data collection procedures. Quantitative as well as qualitative methodologies were adapted for data analysis. Findings showed that the young learners could improve their listening comprehension ability as a result of using nursery rhymes. Interview data also indicated that the learners’ perceptions about nursery rhymes were found to be positive since the rhymes provided an interesting atmosphere for the learners to improve their listening comprehension while benefiting from peer interaction and teacher’s support in the listening classroom. Teachers’ perceptions were also realistic regarding using nursery rhymes in teaching listening, especially for young learners. As to the implication side, finding can contribute to the positive application of nursery rhymes in paving the way for young learners to improve their listening comprehension ability.
Emission and soil distribution of fumigants in forest tree nurseries
Dong Wang; Jennifer Juzwik; Stephen Fraedrich
2005-01-01
Production of tree seedlings in the majority of forest nurseries in the USA has relied on soil fumigation with methyl bromide (MeBr) to control soil-borne plant pathogens, weeds, parasitic nematodes and insects. Since the announcement of the scheduled MeBr phase-out, a number of nurseries throughout the United States have participated in research programs on MeBr...
Insecticide-induced hormesis and arthropod pest management.
Guedes, Raul Narciso C; Cutler, G Christopher
2014-05-01
Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.
Disease prevalence among nursery school children after the Great East Japan earthquake.
Ishikuro, Mami; Matsubara, Hiroko; Kikuya, Masahiro; Obara, Taku; Sato, Yuki; Metoki, Hirohito; Isojima, Tsuyoshi; Yokoya, Susumu; Kato, Noriko; Tanaka, Toshiaki; Chida, Shoichi; Ono, Atsushi; Hosoya, Mitsuaki; Yokomichi, Hiroshi; Yamagata, Zentaro; Tanaka, Soichiro; Kure, Shigeo; Kuriyama, Shinichi
2017-01-01
To investigate the relationship between personal experience of the Great East Japan Earthquake and various disease types among nursery school children. We conducted a nationwide survey of nursery school children born between 2 April 2006 and 1 April 2007. Nursery school teachers completed questionnaires if they agreed to join the study. Questionnaire items for children consisted of their birth year and month, sex, any history of moving into or out of the current nursery school, presence of diseases diagnosed by a physician at the age of 66-78 months and type of disaster experience. The survey was conducted from September 2012 to December 2012. Japan, nationwide. A total of 60 270 nursery school children were included in the analysis, 840 of whom experienced the disaster on 11 March 2011. The health status of children 1.5 years after the disaster based on nursery school records. Experiencing the disaster significantly affected the prevalence of overall and individual diseases. Furthermore, there was a difference in disease prevalence between boys and girls. In boys, experiencing the tsunami (OR 2.53, 95% CI 1.22 to 5.24) and living in an evacuation centre (OR 2.92, 95% CI 1.46 to 5.83) were remarkably associated with a higher prevalence of atopic dermatitis, but these trends were not observed among girls. Instead, the home being destroyed (OR 3.50, 95% CI 2.02 to 6.07) and moving house (OR 4.19, 95% CI 2.01 to 8.71) were positively associated with a higher prevalence of asthma among girls. Our study indicates that experiencing the disaster may have affected the health status of nursery school children at least up to 1.5 years after the disaster. Continuous monitoring of the health status of children is necessary to develop strategic plans for child health.
Maternal Separations During the Reentry Years for 100 Infants Raised in a Prison Nursery
Byrne, Mary W.; Goshin, Lorie; Blanchard-Lewis, Barbara
2011-01-01
Prison nurseries prevent maternal separations related to incarceration for the small subset of children whose pregnant mothers are incarcerated in states with such programs. For a cohort of 100 children accepted by corrections into one prison nursery, subsequent separation patterns are analyzed. The largest numbers are caused by corrections’ removal of infants from the nursery and infants reaching a one-year age limit. Criminal recidivism and substance abuse relapse threaten continued mothering during reentry. Focused and coordinated services are needed during prison stay and reentry years to sustain mothering for women and children accepted into prison nursery programs. PMID:22328865
[Stress and Burnout Risk in Nursery School Teachers: Results from a Survey].
Jungbauer, J; Ehlen, S
2015-06-01
This article presents results from a study of 834 nursery school teachers in Germany, investigating working conditions, stress, and stress-related health problems. In order to evaluate the extent of mental and psychosomatic troubles, as well as the risk of burnout, we used the standardised questionnaire "Burnout Screening Scales" (BOSS I). Data analysis yielded a high percentage of nursery school teachers who reported a remarkably high stress level; nearly 20% can be considered as a high-risk group for burnout. Poor staff conditions in many nurseries turned out to be the crucial stress source, along with large groups, insufficient teacher-child ratio, time pressure and multitasking. In the concluding discussion of the study results, we consider possible measures to reduce stress and to improve working conditions for nursery school teachers. © Georg Thieme Verlag KG Stuttgart · New York.
Weevil x Insecticide: Does 'Personality' Matter?
Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C
2013-01-01
An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be
Beaulieu, Justine; Ford, Blaine; Balci, Yilmaz
2017-06-01
Genetic diversity of two Phytophthora spp.-P. cinnamomi (102 isolates), commonly encountered in Maryland nurseries and forests in the Mid-Atlantic United States, and P. plurivora (186 isolates), a species common in nurseries-was characterized using amplified fragment length polymorphism. Expected heterozygosity and other indices suggested a lower level of diversity among P. cinnamomi than P. plurivora isolates. Hierarchical clustering showed P. cinnamomi isolates separated into four clusters, and two of the largest clusters were closely related, containing 80% of the isolates. In contrast, P. plurivora isolates separated into six clusters, one of which included approximately 40% of the isolates. P. plurivora isolates recovered from the environment (e.g., soil and water) were genotypically more diverse than those found causing lesions. For both species, isolate origin (forest versus nursery or among nurseries) was a significant factor of heterozygosity. Clonal groups existed within P. cinnamomi and P. plurivora and included isolates from both forest and nurseries, suggesting that a pathway from nurseries to forests or vice versa exists.
Children's Exposure to Radon in Nursery and Primary Schools.
Branco, Pedro T B S; Nunes, Rafael A O; Alvim-Ferraz, Maria C M; Martins, Fernando G; Sousa, Sofia I V
2016-03-30
The literature proves an evident association between indoor radon exposure and lung cancer, even at low doses. This study brings a new approach to the study of children's exposure to radon by aiming to evaluate exposure to indoor radon concentrations in nursery and primary schools from two districts in Portugal (Porto and Bragança), considering different influencing factors (occupation patterns, classroom floor level, year of the buildings' construction and soil composition of the building site), as well as the comparison with IAQ standard values for health protection. Fifteen nursery and primary schools in the Porto and Bragança districts were considered: five nursery schools for infants and twelve for pre-schoolers (seven different buildings), as well as eight primary schools. Radon measurements were performed continuously. The measured concentrations depended on the building occupation, classroom floor level and year of the buildings' construction. Although they were in general within the Portuguese legislation for IAQ, exceedances to international standards were found. These results point out the need of assessing indoor radon concentrations not only in primary schools, but also in nursery schools, never performed in Portugal before this study. It is important to extend the study to other microenvironments like homes, and in time to estimate the annual effective dose and to assess lifetime health risks.
Investigation of an outbreak of vomiting in nurseries in South East England, May 2012.
Nicholls, M; Purcell, B; Willis, C; Amar, C F L; Kanagarajah, S; Chamberlain, D; Wooldridge, D; Morgan, J; McLauchlin, J; Grant, K A; Harvey-Vince, L; Padfield, M; Mearkle, R; Chow, J Y
2016-02-01
On 30 May 2012, Surrey and Sussex Health Protection Unit was called by five nurseries reporting children and staff with sudden onset vomiting approximately an hour after finishing their lunch that day. Over the following 24 h 50 further nurseries supplied by the same company reported cases of vomiting (182 children, 18 staff affected). Epidemiological investigations were undertaken in order to identify the cause of the outbreak and prevent further cases. Investigations demonstrated a nursery-level attack rate of 55 out of 87 nurseries (63·2%, 95% confidence interval 52·2-73·3). Microbiological tests confirmed the presence of Bacillus cereus in food and environmental samples from the catering company and one nursery. This was considered microbiologically and epidemiologically consistent with toxin from this bacterium causing the outbreak. Laboratory investigations showed that the conditions used by the caterer for soaking of pearl haricot beans (known as navy bean in the USA) used in one of the foods supplied to the nurseries prior to cooking, was likely to have provided sufficient growth and toxin production of B. cereus to cause illness. This large outbreak demonstrates the need for careful temperature control in food preparation.
Parker, Mike; Lloyd-Williams, Ffion; Weston, Gemma; Macklin, Julie; McFadden, Kate
2011-10-01
To explore nutrition and food provision in pre-school nurseries in order to develop interventions to promote healthy eating in pre-school settings. Quantitative data were gathered using questionnaires and professional menu analysis. In the community, at pre-school nurseries. All 130 nurseries across Liverpool were a sent questionnaire (38 % response rate); thirty-four menus were returned for analysis (26 % response rate). Only 21 % of respondents stated they had adequate knowledge on nutrition for pre-school children. Sixty-one per cent of cooks reported having received only a 'little' advice on healthy eating and this was often not specific to under-5 s nutrition. Fifty-seven per cent of nurseries did not regularly assess their menus for nutritional quality. The menu analysis revealed that all menus were deficient in energy, carbohydrate, Fe and Zn. Eighty-five per cent of nurseries had Na/salt levels which exceed guidelines. Nurseries require support on healthy eating at policy, knowledge and training levels. This support should address concerns relating to both menu planning and ingredients used in food provision and meet current guidelines on food provision for the under-5 s.
7 CFR 301.75-6 - Interstate movement of regulated nursery stock from a quarantined area.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Interstate movement of regulated nursery stock from a... Citrus Canker Notice of Quarantine and Regulations § 301.75-6 Interstate movement of regulated nursery stock from a quarantined area. (a) Regulated nursery stock may not be moved interstate from a...
Alleged nursery words and hypocorisms among Germanic kinship terms
DEFF Research Database (Denmark)
Hansen, Bjarne Simmelkjær Sandgaard
2017-01-01
By (re-)evaluating the etymologies of the three Proto-Germanic kinship terms *aiþīn-/-ōn- ‘mother’, *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ that are all claimed by at least some etymological handbooks to be nursery words or hypocorisms, I contend that we must abandon their nurs......By (re-)evaluating the etymologies of the three Proto-Germanic kinship terms *aiþīn-/-ōn- ‘mother’, *aiþma- ‘daughter’s husband’ and *faþōn- ‘father’s sister’ that are all claimed by at least some etymological handbooks to be nursery words or hypocorisms, I contend that we must abandon...... their nursery-word interpretations and rather regard them as inherited words derived from known Indo-European lexical material in a way that reveals important information on the Old Germanic society and its family pattern....
Carroll, Fran E; Rooshenas, Leila; Owen-Smith, Amanda; Al-Janabi, Hareth; Hollinghurst, Sandra; Hay, Alastair D
2016-06-01
Many families rely on formal day care provision, which can be problematic when children are unwell. Attendance in these circumstances may impact on the transmission of infections in both day care and the wider community. Thirty-one semi-structured interviews were conducted to investigate how parents make decisions about nursery care when children are unwell. Topics for discussion included: illness attitudes, current practice during childhood illness and potential nursery policy changes that could affect decision-making. A combination of illness perceptions and external factors affected decision-making. Parents: (i) considered the severity of respiratory and non-respiratory symptoms differently, and stated that while most other contagious illnesses required nursery exclusion, coughs/colds did not; (ii) said decisions were not solely based on nursery policy, but on practical challenges such as work absences, financial penalties and alternative care availability; (iii) identified modifiable nursery policy factors that could potentially help parents keep unwell children at home, potentially reducing transmission of infectious illness. Decision-making is a complex interaction between the child's illness, personal circumstance and nursery policy. Improving our understanding of the modifiable aspects of nursery policies and the extent to which these factors affect decision-making could inform the design and implementation of interventions to reduce the transmission of infectious illness and the associated burden on NHS services. © The Author 2015. Published by Oxford University Press on behalf of Faculty of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Evaluation of different compound fertilizers for use in oil palm nursery
African Journals Online (AJOL)
The standard NPKMg 12:12:17:2 compound fertilizer (SF) for oil palm nurseries is not always available when needed. Evaluation of other compound fertilizers – NKP 15:15:15 and NPK 20:10:10 – compared with the SF were carried out in the main nursery at NIFOR to ascertain their suitability and rates of application.
Malaria Vector Control Still Matters despite Insecticide Resistance.
Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna
2017-08-01
Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.
A renaissance for botanical insecticides?
Isman, Murray B
2015-12-01
Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.
Photodegradation of neonicotinoid insecticides in water by semiconductor oxides.
Fenoll, José; Garrido, Isabel; Hellín, Pilar; Flores, Pilar; Navarro, Simón
2015-10-01
The photocatalytic degradation of three neonicotinoid insecticides (NIs), thiamethoxam (TH), imidacloprid (IM) and acetamiprid (AC), in pure water has been studied using zinc oxide (ZnO) and titanium dioxide (TiO2) as photocatalysts under natural sunlight and artificial light irradiation. Photocatalytic experiments showed that the addition of these chalcogenide oxides in tandem with the electron acceptor (Na2S2O8) strongly enhances the degradation rate of these compounds in comparison with those carried out with ZnO and TiO2 alone and photolytic tests. Comparison of catalysts showed that ZnO is the most efficient for the removal of such insecticides in optimal conditions and at constant volumetric rate of photon absorption. Thus, the complete disappearance of all the studied compounds was achieved after 10 and 30 min of artificial light irradiation, in the ZnO/Na2S2O8 and TiO2/Na2S2O8 systems, respectively. The highest degradation rate was noticed for IM, while the lowest rate constant was obtained for AC under artificial light irradiation. In addition, solar irradiation was more efficient compared to artificial light for the removal of these insecticides from water. The main photocatalytic intermediates detected during the degradation of NIs were identified.
“NURSERY ENGLISH” IN THE LIGHT OF UNIVERSAL LANGUAGE TENDENCIES
Directory of Open Access Journals (Sweden)
Skrebneva Tamara Grigoryevna
2014-11-01
Full Text Available The article analyzes "nursery English" in its substandard manifestations. It aims at classifying lexical units of the chosen colloquial area. Grouping the words is based on the comparison of neutral patterns and their specific ('nursery' counterparts. The results of the analysis demonstrate the two main tendencies of the language – redundancy and insufficiency – in their diverse expressions on the level of lexis of the researched field. The investigation discloses the basic models of "nursery English" (the English used by children registered in fiction (A. Milne's prose and poetry have been chosen for the analysis. It points out the mechanisms, both, phonetic and morphological, used to create the specific nature of the language of the chosen area. The word reduction and extension is registered in the initial, medium, and final positions. Both linguistic phenomena may be caused by simplifying a complex sound structure, when a child is trying to overcome the difficulty of pronouncing the word; or they may arise in the event of eliminating or adding semantically insignificant word components, or be the consequence of insufficient knowledge of grammar. In most cases, the new formations of nursery English are quite clear to the speakers due to the context or speech situation. Yet, there appear structures which cause misunderstanding. The investigated stylistic area overlaps the specific scope of substandard English used by grown-up speakers; however, certain samples of the first one may be regarded as strictly "nursery". It is not unlikely that the expansion of the researched resource will reveal other transformations. The findings can benefit the studies of English stylistics and English Language System studies.
A systems approach for management of pests and pathogens of nursery crops
Jennifer L. Parke; Niklaus J. Grünwald
2012-01-01
Horticultural nurseries are heterogeneous and spatially complex agricultural systems, which present formidable challenges to management of diseases and pests. Moreover, nursery plants shipped interstate and internationally can serve as important vectors for pathogens and pests that threaten both agriculture and forestry. Current regulatory strategies to prevent this...
Modeling global distribution of agricultural insecticides in surface waters
International Nuclear Information System (INIS)
Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias
2015-01-01
Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects
Hegde, Archana V.; Sugita, Chisato; Crane-Mitchell, Linda; Averett, Paige
2014-01-01
This study explored Japanese day nursery and kindergarten teachers' beliefs and practices regarding developmentally appropriate practices. Data were collected using in-depth interviews. Teacher interviews provided insights into the merger of the childcare and education systems of Japan. Six themes emerged from the analysis of the day nursery and…
Modeling global distribution of agricultural insecticides in surface waters.
Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias
2015-03-01
Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.
2010-08-19
... CONSUMER PRODUCT SAFETY COMMISSION [Docket No. CPSC-2010-0088] Agency Information Collection Activities; Proposed Collection; Comment Request; Durable Nursery Products Exposure Survey AGENCY: Consumer... efforts on durable infant and toddler products. The draft Durable Nursery Products Exposure Survey...
Preschool Outcomes of Children Who Lived as Infants in a Prison Nursery
Goshin, Lorie S.; Byrne, Mary W.; Blanchard-Lewis, Barbara
2015-01-01
This study examined long-term outcomes of children who spent their first one to eighteen months in a US prison nursery. Behavioral development in 47 preschool children who lived in a prison nursery was compared with 64 children from a large national dataset who were separated from their mothers because of incarceration. Separation was associated with significantly worse anxious/depressed scores, even after controlling for risks in the caregiving environment. Findings suggest that prison nursery co-residence with developmental support confers some resilience in children who experience early maternal incarceration. Co-residence programs should be promoted as a best practice for incarcerated childbearing women. PMID:26609188
Nursery temperature as a factor in root elongation of ponderosa pine seedlings
Gilbert H. Schubert; Frank J. Baron
1965-01-01
Greenhouse and nursery studies suggest that graphs of "effective" day and night temperatures provide a convenient method to compare nursery sites and to evaluate the effects of temperature on seedling root growth. Comparisons of root response under different natural temperature regimes should provide inforrnation use ful 'for the production of higher...
Voices from Nursery : A Crack of Intervention to Child Abuse and Neglect in Japan
Ishikawa, Hiroaki
2008-01-01
Purpose: This article aims to describe the status quo of abuse and neglected children in nursery school, and to analyze the factors affecting the conditions of those abused and neglected children. Method: Intensive interview to the directors of 9 nursery schools were conducted and data of 32 cases were collected. Results: 5 modified case episodes edited from collected data were presented to show the typical conditions of abused and neglected children in nursery schools. Some common characteri...
de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso
2017-01-01
The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907
Directory of Open Access Journals (Sweden)
Luis Gustavo de Almeida
Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.
Converging Streams of Opportunity for Prison Nursery Programs in the United States
Goshin, Lorie Smith; Byrne, Mary Woods
2009-01-01
Prison nursery programs allow departments of correction to positively intervene in the lives of both incarcerated mothers and their infant children. The number of prison nurseries in the United States has risen dramatically in the past decade, yet there remains a significant gap between predominant correctional policy in this area and what is…
Anticholinesterase insecticide retrospective.
Casida, John E; Durkin, Kathleen A
2013-03-25
The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down
Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.
Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés
2017-06-01
The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.
Jiaxi Wang; Guolei Li; Jeremiah R. Pinto; Jiajia Liu; Wenhui Shi; Yong Liu
2015-01-01
Optimum fertilization levels are often determined solely from nursery growth responses. However, it is the performance of the seedling on the outplanting site that is the most important. For Pinus species seedlings, little information is known about the field performance of plants cultured with different nutrient rates, especially with exponential fertilization. In...
Freshwater Aquaculture Nurseries and Infection of Fish with Zoonotic Trematodes, Vietnam
Ersbøll, Annette Kjær; Nguyen, Thanh Thi; Nguyen, Khue Viet; Nguyen, Ha Thi; Murrell, Darwin; Dalsgaard, Anders
2010-01-01
Residents of the Red River Delta region of northern Vietnam have a long tradition of eating raw fish. Fish-borne zoonotic trematodes (FZTs) are estimated to infect ≈1 million persons in Vietnam. It remains uncertain at what stages in the aquaculture production cycle fish become infected with FZTs. Newly hatched fish (fry) from 8 hatcheries and juveniles from 27 nurseries were therefore examined for FZT infection. No FZTs were found in fry from hatcheries. In nurseries, FZT prevalence in juveniles was 14.1%, 48.6%, and 57.8% after 1 week, 4 weeks, and when overwintered in ponds, respectively. FZT prevalence was higher in grass carp (paquaculture management practices, particularly in nurseries, to minimize the risk of distributing infected juveniles to grow-out ponds and, subsequently, to markets for human consumption. PMID:21122220
Recruitment of flatfish species to an estuarine nursery habitat (Lima estuary, NW Iberian Peninsula)
Ramos, Sandra; Ré, Pedro; Bordalo, Adriano A.
2010-11-01
One of the present concerns of fish biologists involves defining and identifying nursery habitats in the context of conservation and resource management strategies. Fish nursery studies usually report upon nursery occupation during the latter juvenile stages, despite the fact that recruitment to nurseries can start early in life, during the larval phase. Here we investigated the use of a temperate estuarine nursery area, the Lima estuary (NW Portugal), by initial development stages of flatfish species before and after metamorphosis, integrating the larval and juvenile phases. The Lima estuarine flatfish community comprised twelve taxa, seven of which were present as pelagic larvae, six as juveniles and three as adults. There was a general trend of increasing spring-summer abundance of both larvae and juveniles, followed by a sharp winter decrease, mainly of larval flatfishes. The Lima estuary was used by Solea senegalensis, Platichthys flesus and Solea solea as a nursery area, with direct settlement for the two first species. In contrast, indirect settlement was suggested for S. solea, with metamorphosis occurring outside the estuarine area. Estuarine recruitment of S. senegalensis varied between years, with young larvae occurring in the estuary throughout a prolonged period that lasted 6-9 months, corroborating the protracted spawning season. P. flesus, the second most abundant species, exhibited a typical spring estuarine recruitment, without inter-annual variations. Developed larvae arrived in the estuary during spring, whereas the 0-group juveniles emerged in the following summer period. The present study contributes new insight to our understanding of the economically important S. senegalensis, and highlights the importance of integrating the planktonic larval phase into traditional flatfish nursery studies.
Detection of Phytophthora ramorum at retail nurseries in the southeastern United States
Steven N. Jeffers; Jaesoon Hwang; Yeshi A. Wamishe; Steven W. Oak
2010-01-01
Many nursery plants are known to be hosts of Phytophthora ramorum or to be associated with this pathogen. These plants can be infected or merely infested by P. ramorum and with or without symptoms. The pathogen has been detected most frequently on container-grown nursery plants, and occasionally has been found in the container...
Burgoine, Thomas; Gallis, John A; L Penney, Tarra; Monsivais, Pablo; Benjamin Neelon, Sara E
2017-07-01
With 796,500 places available for children in England, pre-school nurseries could serve as an important setting for population-wide dietary intervention. It is critical to understand the determinants of healthy food provision in this setting, which may include access to food stores. This study examined the association between objective, GIS-derived supermarket proximity and fruit and vegetable serving frequency, using data from 623 English nurseries. Overall, 116 (18%) nurseries served fruits and vegetables infrequently (supermarket proximity. In adjusted multivariable regression models, nurseries farthest from their nearest supermarket (Q5, 1.7-19.8km) had 2.38 (95% CI 1.01-5.63) greater odds of infrequent provision. Our results suggest that supermarket access may be important for nurseries in meeting fruit and vegetable provision guidelines. We advance a growing body of international literature, for the first time linking the food practices of institutions to their neighbourhood food retail context. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Fumigant distribution in forest nursery soils
Dong Wang; Stephen W. Fraedrich; Jennifer Juzwik; Kurt Spokas; Yi Zhang; William C. Koskinen
2006-01-01
Adequate concentration, exposure time and distribution uniformity of activated fumigant gases are prerequisites for successful soil fumigation. Field experiments were conducted to evaluate gas phase distributions of methyl isothiocyanate (MITC) and chloropicrin (CP) in two forest-tree nurseries. Concentrations of MITC and CP in soil air were measured from replicated...
Staphylococcus aureus epidemic in a neonatal nursery: a strategy of infection control.
Bertini, Giovanna; Nicoletti, PierLuigi; Scopetti, Franca; Manoocher, Pourshaban; Dani, Carlo; Orefici, Graziella
2006-08-01
The risk of nosocomial infection due to Staphylococcus aureus in fullterm newborns is higher under hospital conditions where there are overcrowded nurseries and inadequate infection control techniques. We report on an outbreak of skin infection in a Maternity Nursery (May 21, 2000) and the measures undertaken to bring the epidemic under control. These measures included: separating neonates already present in the nursery on August 23, 2000 from ones newly arriving by creating two different cohorts, one of neonates born before this date and one of neonates born later; restricting healthcare workers caring for S. aureus- infected infants from working with non-infected infants; disallowing carrier healthcare workers from caring for patients; introducing contact and droplet precautions (including the routine use of gowns, gloves, and mask); ensuring appropriate disinfection of potential sources of contamination. A representative number of isolates were typed by genomic DNA restriction length polymorphism analysis by means of pulsed-field gel electrophoresis (PFGE). Among the 227 cases of skin lesions, microbiological laboratory analyses confirmed that 175 were staphylococcal infections. The outbreak showed a gradual reduction in magnitude when the overcrowding of the Nursery was reduced by separating the newborns into the two different Nurseries (two cohorts). The genotyping of the strains by PFGE confirmed the nurse-to-newborn transmission of S. aureus. The measures adopted for controlling the S. aureus outbreak can, in retrospect, be assessed to have been very effective.
Rice Production without Insecticide in Smallholder Farmer's Field
Directory of Open Access Journals (Sweden)
M. P. Ali
2017-05-01
Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even
CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram
Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.
CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram
Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.
Benthic food webs support the production of sympatric flatfish larvae in estuarine nursery habitat
Identifying nursery habitats is of paramount importance to define proper management and conservation strategies for flatfish species. Flatfish nursery studies usually report upon habitat occupation, but few attempted to quantify the importance of those habitats to larvae developm...
An Operational Framework for Insecticide Resistance Management Planning.
Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael
2016-05-01
Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.
Create a pollinator garden at your nursery: An emphasis on monarch butterflies
Thomas D. Landis; R. Kasten Dumroese; Matthew E. Horning
2014-01-01
We realize that this type of article is a departure for FNN readers but feel that it is important for forest, conservation, and native plant nurseries to be good environmental stewards. In addition, establishing a pollinator garden at your nursery can be good for business, too. Demonstrating the role and beauty of native plants and their pollinators, particulary in a...
Insecticide susceptibility status of human biting mosquitoes in ...
African Journals Online (AJOL)
Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...
Radioactive 32P fertilizing experiment in a vegetative tea nursery
International Nuclear Information System (INIS)
Darmawijaya, M.I.
1979-01-01
To support the Indonesian tea replanting programme, Vegetative Propagation (VP) clonal tea plants of a high-yielding and high-quality variety are prepared. For a quick start of growth in the nursery and eventual good crop, the soils filled into polythene sleeves should have optimum conditions for rooting. The VP nursery manuring recommendation in Indonesia is 135 g N+72 g P 2 O 5 +70 g K 2 O per cubic metre of topsoil. Uptake of phosphorus by young VP tea plants in the nursery was studied by using 32 P-labelled superphosphate. A specific activity of 0.3 mCi/g (11 MBq/g) P 2 O 2 was still detectable 12 weeks after treatment of manuring. The laboratory analytical data proved that the P-fertilizer utilization by young VP tea plant was less than 1%. The best time for P-fertilizer application was the time of planting. It seems that the P uptake in the VP tea nursery starts with the early growth of the tea cutting. To increase the efficiency of P manuring in relation to the slower and lesser phosphate adsorption by the young VP tea plants, the best application is effected at 10 cm depth of soil. Mixing P fertilizers with soil also gives higher uptake of fertilizer P. So tea plants can use phosphate efficiently when placed as close to active roots as possible. (author)
Ryan, Diarmuid; Wögerbauer, Ciara; Roche, William
2016-12-01
The ability to determine connectivity between juveniles in nursery estuaries and adult populations is an important tool for fisheries management. Otoliths of juvenile fish contain geochemical tags, which reflect the variation in estuarine elemental chemistry, and allow discrimination of their natal and/or nursery estuaries. These tags can be used to investigate connectivity patterns between juveniles and adults. However, inter-annual variability of geochemical tags may limit the accuracy of nursery origin determinations. Otolith elemental composition was used to assign a single cohort of 0-group sea bass Dicentrarchus labrax to their nursery estuary thus establishing an initial baseline for stocks in waters around Ireland. Using a standard LDFA model, high classification accuracies to nursery sites (80-88%) were obtained. Temporal stability of otolith geochemical tags was also investigated to assess if annual sampling is required for connectivity studies. Geochemical tag stability was found to be strongly estuary dependent.
Bisset, Juan Andrés; Rodríguez, María Magdalena; French, Leydis; Severson, David W; Gutiérrez, Gladys; Hurtado, Daymi; Fuentes, Ilario
2014-12-01
Studies were conducted to compare levels of insecticide resistance and to determine the metabolic resistance mechanisms in larval and adult stages of Aedes aegypti from Cuba. Three insecticide-resistant reference strains of Ae. aegypti from Cuba were examined. These strains were derived from a Santiago de Cuba strain isolated in 1997; it was previously subjected to a strong selection for resistance to temephos (SAN-F6), deltamethrin (SAN-F12), and propoxur (SAN-F13) and routinely maintained in the laboratory under selection pressure up to the present time, when the study was carried out. In addition, an insecticide-susceptible strain was used for comparison. The insecticide resistance in larvae and adults was determined using standard World Health Organization methodologies. Insecticide resistance mechanisms were determined by biochemical assays. The esterases (α EST and β EST) and mixed function oxidase (MFO) activities were significantly higher in adults than in the larvae of the three resistant strains studied. The association of resistance level with the biochemical mechanism for each insecticide was established for each stage. The observed differences between larval and adult stages of Ae. aegypti in their levels of insecticide resistance and the biochemical mechanisms involved should be included as part of monitoring and surveillance activities in Ae. aegypti vector control programs.
Is Apis mellifera more sensitive to insecticides than other insects?
Hardstone, Melissa C; Scott, Jeffrey G
2010-11-01
Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.
Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin
2013-01-01
House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758
2010-12-02
... Collection; Update of Nursery Stock Regulations AGENCY: Animal and Plant Health Inspection Service, USDA... regulations for the importation of nursery stock into the United States. DATES: We will consider all comments... . FOR FURTHER INFORMATION CONTACT: For information on regulations for the importation of nursery stock...
Vasconcelos, Rita P.; Reis-Santos, Patrick; Tanner, Susanne; Maia, Anabela; Latkoczy, Christopher; Günther, Detlef; Costa, Maria José; Cabral, Henrique
2008-08-01
Connectivity is a critical property of marine populations, particularly for species with segregated juvenile and adult habitats. Knowledge of this link is fundamental in understanding population structure and dynamics. Young adults of commercially important fish species Solea solea, Solea senegalensis, Platichthys flesus, Diplodus vulgaris and Dicentrarchus labrax were sampled off the Portuguese coast in order to establish preliminary evidence of estuarine nursery origins through otolith elemental fingerprints. Concentrations of Li, Na, Mg, K, Mn, Cu, Zn, Sr, Ba and Pb in the otolith section corresponding to juvenile's nursery life period were determined through laser ablation inductively coupled plasma mass spectrometry. Element: Ca ratios in coastal fish differed significantly amongst collection areas, except for Platichthys flesus, and were compared with the elemental fingerprints previously defined for age 0 juveniles in the main estuarine nurseries of the Portuguese coast. Identification of nursery estuaries was achieved for four of the species. Assigned nursery origins varied amongst species and differences in the spatial scale of fish dispersal were also found. Diplodus vulgaris was not reliably assigned to any of the defined nurseries. Overall, results give evidence of the applicability of estuarine habitat tags in future assessments of estuarine nursery role. Research developments on the links between juvenile and adult habitats should contribute for the integrated management and conservation of nurseries and coastal stocks.
Directory of Open Access Journals (Sweden)
RA Mandour
2011-12-01
Full Text Available Background: The environmental degradation products of pesticides may enter drinking water and result in serious health problems. Objective: To evaluate the occurrence of insecticides in drinking surface and ground water in Dakahlyia Governorate, northern Egypt in 2011. Methods: We studied blood samples collected from 36 consecutive patients diagnosed with pesticides poisoning and 36 tap drinking water (surface and ground. Blood and water samples were analyzed for pesticides using gas chromatography-electron captured detector (GC-ECD. In addition, blood samples were analyzed for plasma pseudo-cholinesterase level (PChE and red blood cells acetyl cholinesterase activity (AChE. Results: The results confirmed the presence of high concentrations of insecticides, including organonitrogenous and organochlorine in tap drinking surface and ground water. Conclusion: Drinking water contaminated with insecticides constitutes an important health concern in Dakahlyia governorate, Egypt.
Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.
Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M
2016-02-01
Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.
Nutrient removal by apple, pear and cherry nursery trees
Directory of Open Access Journals (Sweden)
Giovambattista Sorrenti
2017-06-01
Full Text Available Given that nursery is a peculiar environment, the amount of nutrients removed by nursery trees represents a fundamental acquisition to optimise fertilisation strategies, with economic and environmental implications. In this context, we determined nutrient removal by apple, pear and cherry nursery trees at the end of the nursery growing cycle. We randomly removed 5 leafless apple (Golden Delicious/EMLA M9; density of 30,000 trees ha–1, pear (Santa Maria/Adams; density of 30,000 trees ha–1 and cherry (AlexTM/Gisela 6®; density of 40,000 trees ha–1 trees from a commercial nursery. Trees were divided into roots (below the root collar, rootstock (above-ground wood between root collar and grafting point and variety (1-year-old wood above the grafting point. For each organ we determined biomass, macro- (N, P, K, Ca, Mg, S, and micro- (Fe, Mn, Zn, Cu, and B nutrient concentration. Pear trees were the most developed (650 g (dw tree–1, equal to 1.75 and 2.78 folds than apple and cherry trees, respectively whereas, independently of the species, variety mostly contributed (>50% to the total tree biomass, followed by roots and then above-ground rootstock. However, the dry biomass and nutrient amount measured in rootstocks (including roots represent the cumulative amount of 2 and 3 seasons, for Gisela® 6 (tissue culture and pome fruit species (generated by mound layering, respectively. Macro and micronutrients were mostly concentrated in roots, followed by variety and rootstock, irrespective of the species. Independently of the tissue, macronutrients concentration hierarchy was N>Ca>K> P>Mg>S. Removed N by whole tree accounted for 6.58, 3.53 and 2.49 g tree–1 for pear, apple and cherry, respectively, corresponding to almost 200, 107 and 100 kg N ha–1, respectively. High amounts of K and Ca were used by pear (130-140 kg ha–1 and apple trees (~50 and 130 kg ha–1 of K and Ca, respectively, while ~25 kg K ha–1 and 55 kg Ca ha–1 were
Kimirei, Ismael A; Nagelkerken, Ivan; Mgaya, Yunus D; Huijbers, Chantal M
2013-01-01
Mangroves and seagrass beds have long been perceived as important nurseries for many fish species. While there is growing evidence from the Western Atlantic that mangrove habitats are intricately connected to coral reefs through ontogenetic fish migrations, there is an ongoing debate of the value of these coastal ecosystems in the Indo-Pacific. The present study used natural tags, viz. otolith stable carbon and oxygen isotopes, to investigate for the first time the degree to which multiple tropical juvenile habitats subsidize coral reef fish populations in the Indo Pacific (Tanzania). Otoliths of three reef fish species (Lethrinus harak, L. lentjan and Lutjanus fulviflamma) were collected in mangrove, seagrass and coral reef habitats and analyzed for stable isotope ratios in the juvenile and adult otolith zones. δ(13)C signatures were significantly depleted in the juvenile compared to the adult zones, indicative of different habitat use through ontogeny. Maximum likelihood analysis identified that 82% of adult reef L. harak had resided in either mangrove (29%) or seagrass (53%) or reef (18%) habitats as juveniles. Of adult L. fulviflamma caught from offshore reefs, 99% had passed through mangroves habitats as juveniles. In contrast, L. lentjan adults originated predominantly from coral reefs (65-72%) as opposed to inshore vegetated habitats (28-35%). This study presents conclusive evidence for a nursery role of Indo-Pacific mangrove habitats for reef fish populations. It shows that intertidal habitats that are only temporarily available can form an important juvenile habitat for some species, and that reef fish populations are often replenished by multiple coastal habitats. Maintaining connectivity between inshore vegetated habitats and coral reefs, and conserving habitat mosaics rather than single nursery habitats, is a major priority for the sustainability of various Indo Pacific fish populations.
Directory of Open Access Journals (Sweden)
Ismael A Kimirei
Full Text Available Mangroves and seagrass beds have long been perceived as important nurseries for many fish species. While there is growing evidence from the Western Atlantic that mangrove habitats are intricately connected to coral reefs through ontogenetic fish migrations, there is an ongoing debate of the value of these coastal ecosystems in the Indo-Pacific. The present study used natural tags, viz. otolith stable carbon and oxygen isotopes, to investigate for the first time the degree to which multiple tropical juvenile habitats subsidize coral reef fish populations in the Indo Pacific (Tanzania. Otoliths of three reef fish species (Lethrinus harak, L. lentjan and Lutjanus fulviflamma were collected in mangrove, seagrass and coral reef habitats and analyzed for stable isotope ratios in the juvenile and adult otolith zones. δ(13C signatures were significantly depleted in the juvenile compared to the adult zones, indicative of different habitat use through ontogeny. Maximum likelihood analysis identified that 82% of adult reef L. harak had resided in either mangrove (29% or seagrass (53% or reef (18% habitats as juveniles. Of adult L. fulviflamma caught from offshore reefs, 99% had passed through mangroves habitats as juveniles. In contrast, L. lentjan adults originated predominantly from coral reefs (65-72% as opposed to inshore vegetated habitats (28-35%. This study presents conclusive evidence for a nursery role of Indo-Pacific mangrove habitats for reef fish populations. It shows that intertidal habitats that are only temporarily available can form an important juvenile habitat for some species, and that reef fish populations are often replenished by multiple coastal habitats. Maintaining connectivity between inshore vegetated habitats and coral reefs, and conserving habitat mosaics rather than single nursery habitats, is a major priority for the sustainability of various Indo Pacific fish populations.
Realities and Challenges of Support for Children with Special Needs in Nursery Schools.
Ishiguro, Kaori; Yoshioka, Shin-Ichi
2016-03-01
Nursery schools and kindergartens have been struggling to cope with increasing numbers of children with special needs. Hence, we conducted a study on what nursery school teachers (NSTs) will require regarding learning and societal resources for supporting such children in the future. A questionnaire survey was conducted for 2,476 NSTs employed in 154 nursery schools in Shimane and Kochi Prefectures. The questionnaires were sent by post to officials at each nursery school. The completed questionnaires were collected by the school officials and returned by post. In addition to statistical processing of the survey results, the content of the free description responses was analyzed using the KJ method. Responses were obtained from 1,509 NSTs at 118 nursery schools. Of the respondents, 90.7% had experienced difficulties coping with children with special needs, and 83.9% were in charge of caring for such children. Such children were enrolled in every childcare facility participating in the survey. The NSTs primarily needed to learn about specific coping methods, the illness, and skills for supporting parents; concerning the societal resources, they needed the addition of assistant NSTs, the implementation of age-five check-up, and the recruitment of mentors. The free description responses were categorized into the following five categories: demand for child care administration, cooperation with professional staff, support for parents, developmental health checkups, and on-site needs for nursery childcare. One of the specific demands was to develop human resources capable of providing parents with appropriate advice. The results have shown that all NSTs are required to deal with children with special needs. Future challenges for providing support for such children are: ⅰ) to raise awareness of such children; ⅱ) to eliminate regional disparities; ⅲ) to provide professional training for NSTs specializing in developmental disorders; ⅳ) to train and re
Prevalence of Autism Spectrum Disorder in Nurseries in Lebanon: A Cross Sectional Study
Chaaya, Monique; Saab, Dahlia; Maalouf, Fadi T.; Boustany, Rose-Mary
2016-01-01
In Lebanon, no estimate for autism prevalence exists. This cross-sectional study examines the prevalence of Autism spectrum disorder (ASD) in toddlers in nurseries in Beirut and Mount-Lebanon. The final sample included 998 toddlers (16-48 months) from 177 nurseries. We sent parents the Modified Checklist for Autism in Toddlers (M-CHAT) for…
Cactus Nurseries and Conservation in a Biosphere Reserve in Mexico
Directory of Open Access Journals (Sweden)
María T. Pulido
2013-09-01
Full Text Available Documenting how socio-ecosystem conservation knowledge and practice arise and are modified are issues of ethnobiological interest. In the Barranca de Metztitlán Biosphere Reserve (RBBM, plant nurseries, some of which were created as Environmental Management Units (UMAs, have been established to grow and conserve cacti. This paper describes these nurseries, their role in cactus conservation, and the benefits and limitations for the people managing them. The nurseries have helped decrease illegal traffic in cacti and have enabled ex situ conservation of 22 cacti species. Cactus management has changed from extraction to cultivation, as a result of the knowledge and actions of multiple actors. The main limitation is marketing, a recurring problem for non-timber forest products (NTFP. Greater coordination among stakeholders is recommended, such as involvement by non-governmental organizations to improve their probability of success, as well as learning from the experience of other cactus UMAs. Improving the market for cacti is an issue that needs an immediate solution; otherwise conservation efforts could relapse.
Mixture for Controlling Insecticide-Resistant Malaria Vectors
Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc
2008-01-01
The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...
Radioligand Recognition of Insecticide Targets.
Casida, John E
2018-04-04
Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.
Botanical insecticides inspired by plant-herbivore chemical interactions.
Miresmailli, Saber; Isman, Murray B
2014-01-01
Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.
Ong, Song-Quan; Ab Majid, Abdul Hafiz; Ahmad, Hamdan
2016-04-01
It is crucial to understand the degradation pattern of insecticides when designing a sustainable control program for the house fly, Musca domestica (L.), on poultry farms. The aim of this study was to determine the half-life and degradation rates of cyromazine, chlorpyrifos, and cypermethrin by spiking these insecticides into poultry manure, and then quantitatively analyzing the insecticide residue using ultra-performance liquid chromatography. The insecticides were later tested in the field in order to study the appropriate insecticidal treatment intervals. Bio-assays on manure samples were later tested at 3, 7, 10, and 15 d for bio-efficacy on susceptible house fly larvae. Degradation analysis demonstrated that cyromazine has the shortest half-life (3.01 d) compared with chlorpyrifos (4.36 d) and cypermethrin (3.75 d). Cyromazine also had a significantly greater degradation rate compared with chlorpyrifos and cypermethrin. For the field insecticidal treatment interval study, 10 d was the interval that had been determined for cyromazine due to its significantly lower residue; for ChCy (a mixture of chlorpyrifos and cypermethrin), the suggested interval was 7 d. Future work should focus on the effects of insecticide metabolites on targeted pests and the poultry manure environment.
Laffargue, P.; Lagardere, F.; Rijnsdorp, A.D.; Fillon, A.; Amara, R.
2007-01-01
Tidal embayments in the Bay of Biscay (France) host nursery grounds where common sole, Solea solea, is the most abundant flatfish species. This study aimed to appraise the way those habitats function as nurseries through juvenile sole's responses in somatic growth and condition (Fulton's K) during
Cooperative Atlantic States Shark Pupping and Nursery (COASTSPAN)
National Oceanic and Atmospheric Administration, Department of Commerce — Survey of inshore areas used by sharks for pupping and nurseries. Various locations have been surveyed, from the U.S. Virgin Islands to Massachusetts, most in...
Irrigation water sources and irrigation application methods used by U.S. plant nursery producers
Paudel, Krishna P.; Pandit, Mahesh; Hinson, Roger
2016-02-01
We examine irrigation water sources and irrigation methods used by U.S. nursery plant producers using nested multinomial fractional regression models. We use data collected from the National Nursery Survey (2009) to identify effects of different firm and sales characteristics on the fraction of water sources and irrigation methods used. We find that regions, sales of plants types, farm income, and farm age have significant roles in what water source is used. Given the fraction of alternative water sources used, results indicated that use of computer, annual sales, region, and the number of IPM practices adopted play an important role in the choice of irrigation method. Based on the findings from this study, government can provide subsidies to nursery producers in water deficit regions to adopt drip irrigation method or use recycled water or combination of both. Additionally, encouraging farmers to adopt IPM may enhance the use of drip irrigation and recycled water in nursery plant production.
2002-01-01
Almost an iceberg 'nursery,' icebergs continue to break away from the Ross Ice Shelf in Antarctica. This image from the MODerate-resolution Imaging Spectroradiometer (MODIS) aboard the Terra spacecraft, shows the level of activity along the shelf near Ross Island on September 21, 2000. The B-15 fragments are remnants of the huge iceberg (nearly 4,250 sqare miles) which broke away from the Antarctic shelf in late March 2000. Slightly visible is the line where iceberg B-20 broke away from the shelf in the last week of September. Cracks in the Antarctic ice shelf are closely observed by satellite and are of interest to scientists studying the potential effects of global warming. This true-color image was produced using MODIS bands 1, 3, and 4. Image by Brian Montgomery, NASA GSFC; data courtesy MODIS Science Team
Godfray, H Charles J; Blacquière, Tjeerd; Field, Linda M; Hails, Rosemary S; Petrokofsky, Gillian; Potts, Simon G; Raine, Nigel E; Vanbergen, Adam J; McLean, Angela R
2014-07-07
There is evidence that in Europe and North America many species of pollinators are in decline, both in abundance and distribution. Although there is a long list of potential causes of this decline, there is concern that neonicotinoid insecticides, in particular through their use as seed treatments are, at least in part, responsible. This paper describes a project that set out to summarize the natural science evidence base relevant to neonicotinoid insecticides and insect pollinators in as policy-neutral terms as possible. A series of evidence statements are listed and categorized according to the nature of the underlying information. The evidence summary forms the appendix to this paper and an annotated bibliography is provided in the electronic supplementary material.
Directory of Open Access Journals (Sweden)
Hafiz Azhar Ali Khan
Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.
Ley, Janet A.; McIvor, Carole C.; Peebles, Ernst B; Rolls, Holly; Cooper, Suzanne T.
2009-01-01
Fishing in Tampa Bay enhances the quality of life of the area's residents and visitors. However, people's desire to settle along the Bay's shorelines and tributaries has been detrimental to the very habitat believed to be crucial to prime target fishery species. Common snook (Centropomus undecimalis) and red drum (Sciaenops ocellatus) are part of the suite of estuarine fishes that 1) are economically or ecologically prominent, and 2) have complex life cycles involving movement between open coastal waters and estuarine nursery habitats, including nursery habitats that are located within upstream, low-salinity portions of the Bay?s tidal tributaries. We are using an emerging microchemical technique -- elemental fingerprinting of fish otoliths -- to determine the degree to which specific estuarine locations contribute to adult fished populations in Tampa Bay. In ongoing monitoring surveys, over 1,000 young-of-the-year common snook and red drum have already been collected from selected Tampa Bay tributaries. Using laser ablation-inductively coupled plasma - mass spectrometry (LA-ICP-MS), we are currently processing a subsample of these archived otoliths to identify location-specific fingerprints based on elemental microchemistry. We will then analyze older fish from the local fishery in order to match them to their probable nursery areas, as defined by young-of-the-year otoliths. We expect to find that some particularly favorable nursery locations contribute disproportionately to the fished population. In contrast, other nursery areas may be degraded, or act as 'sinks', thereby decreasing their contribution to the fish population. Habitat managers can direct strategic efforts to protect any nursery locations that are found to be of prime importance in contributing to adult stocks.
DEFF Research Database (Denmark)
Ibfelt, T.; Engelund, E. H.; Schultz, Anna Charlotte
2015-01-01
Background: The rising number of children in daycare nurseries increases opportunities for the transmission of infectious diseases. Pathogens may be transmitted directly from child to child via sneezing, coughing and touching, or indirectly via the environment. Toys are among the fomites with the......Background: The rising number of children in daycare nurseries increases opportunities for the transmission of infectious diseases. Pathogens may be transmitted directly from child to child via sneezing, coughing and touching, or indirectly via the environment. Toys are among the fomites...... with the highest pathogen load, but their role in disease transmission is unknown. Aim: To determine if washing and disinfection of toys can reduce sickness absence and microbial pathogen load in the nursery environment. Methods: Twelve nurseries (caring for 587 children) were randomized to intervention...... sampling points in each nursery were examined for bacteria and respiratory viruses. Results: The presence of respiratory virus DNA/RNA was widespread, but very few pathogenic bacteria were found in the environment. The intervention reduced the presence of adenovirus [odds ratio (OR) 2.4, 95% confidence...
Weiland, Jerry E; Garrido, Patricia; Kamvar, Zhian N; Espíndola, Andrés S; Marek, Stephen M; Grünwald, Niklaus J; Garzón, Carla D
2015-05-01
Pythium species are important soilborne pathogens occurring in the forest nursery industry of the Pacific Northwest. However, little is known about their genetic diversity or population structure and it is suspected that isolates are moved among forest nurseries on seedling stock and shared field equipment. In order to address these concerns, a total of 115 isolates of three Pythium species (P. irregulare, P. sylvaticum, and P. ultimum) were examined at three forest nurseries using simple sequence repeat (SSR) and amplified fragment length polymorphism (AFLP) markers. Analyses revealed distinct patterns of intraspecific variation for the three species. P. sylvaticum exhibited the most diversity, followed by P. irregulare, while substantial clonality was found in P. ultimum. For both P. irregulare and P. sylvaticum, but not P. ultimum, there was evidence for significant variation among nurseries. However, all three species also exhibited at least two distinct lineages not associated with the nursery of origin. Finally, evidence was found that certain lineages and clonal genotypes, including fungicide-resistant isolates, are shared among nurseries, indicating that pathogen movement has occurred.
Ibfelt, T; Engelund, E H; Schultz, A C; Andersen, L P
2015-02-01
The rising number of children in daycare nurseries increases opportunities for the transmission of infectious diseases. Pathogens may be transmitted directly from child to child via sneezing, coughing and touching, or indirectly via the environment. Toys are among the fomites with the highest pathogen load, but their role in disease transmission is unknown. To determine if washing and disinfection of toys can reduce sickness absence and microbial pathogen load in the nursery environment. Twelve nurseries (caring for 587 children) were randomized to intervention and control groups. The intervention consisted of washing and disinfection of toys and linen every two weeks for three months by a commercial cleaning company. The extent and causes of sickness absence among the children were recorded in both groups before and after introduction of the intervention. Ten sampling points in each nursery were examined for bacteria and respiratory viruses. The presence of respiratory virus DNA/RNA was widespread, but very few pathogenic bacteria were found in the environment. The intervention reduced the presence of adenovirus [odds ratio (OR) 2.4, 95% confidence interval (CI) 1.1-5.0], rhinovirus (OR 5.3, 95% CI 2.3-12.4) and respiratory syncytial virus (OR 4.1, 95% CI 1.5-11.2) compared with the control group, but the intervention had no effect on sickness absence or disease patterns in the nurseries. Although cleaning and disinfection of toys every two weeks can decrease the microbial load in nurseries, it does not appear to reduce sickness absence among nursery children. Copyright © 2014 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.
Microbes as interesting source of novel insecticides: A review ...
African Journals Online (AJOL)
... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...
Mechanistic modeling of insecticide risks to breeding birds in ...
Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (
Ecdysone Agonist: New Insecticides with Novel Mode of Action
Directory of Open Access Journals (Sweden)
Y. Andi Trisyono
2002-12-01
Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists
Cheminée, Adrien; Rider, Mary; Lenfant, Philippe; Zawadzki, Audrey; Mercière, Alexandre; Crec'hriou, Romain; Mercader, Manon; Saragoni, Gilles; Neveu, Reda; Ternon, Quentin; Pastor, Jérémy
2017-06-15
Coastal nursery habitats are essential for the renewal of adult fish populations. We quantified the availability of a coastal nursery habitat (shallow heterogeneous rocky bottoms) and the spatial variability of its juvenile fish populations along 250km of the Catalan coastline (France and Spain). Nurseries were present in 27% of the coastline, but only 2% of them benefited from strict protection status. For nine taxa characteristic of this habitat, total juvenile densities varied significantly between nursery sites along the coastline, with the highest densities being found on the northern sites. Recruitment level (i.e. a proxy of nursery value) was not explained by protection level, but it was moderately and positively correlated with an anthropization index. Patterns of spatial variations were taxa-specific. Exceptional observations of four juveniles of the protected grouper Epinephelus marginatus were recorded. Our data on habitat availability and recruitment levels provides important informations which help to focus MPA management efforts. Copyright © 2017 Elsevier Ltd. All rights reserved.
Kas Dumroese; David L. Wenny
1992-01-01
The University of Idaho Forest Research Nursery was established in 1909 to grow bareroot (field-grown) tree and shrub seedlings for conservation. In 1982, the bareroot production was phased out and replaced by growing seedlings in containers in greenhouses. The nursery emphasizes teaching, research and service. Students learn about forest planting; scientists...
Climate mediates hypoxic stress on fish diversity and nursery function at the land–sea interface
Hughes, Brent B.; Levey, Matthew D.; Fountain, Monique C.; Carlisle, Aaron B.; Chavez, Francisco P.; Gleason, Mary G.
2015-01-01
Coastal ecosystems provide numerous important ecological services, including maintenance of biodiversity and nursery grounds for many fish species of ecological and economic importance. However, human population growth has led to increased pollution, ocean warming, hypoxia, and habitat alteration that threaten ecosystem services. In this study, we used long-term datasets of fish abundance, water quality, and climatic factors to assess the threat of hypoxia and the regulating effects of climate on fish diversity and nursery conditions in Elkhorn Slough, a highly eutrophic estuary in central California (United States), which also serves as a biodiversity hot spot and critical nursery grounds for offshore fisheries in a broader region. We found that hypoxic conditions had strong negative effects on extent of suitable fish habitat, fish species richness, and abundance of the two most common flatfish species, English sole (Parophrys vetulus) and speckled sanddab (Citharichthys stigmaeus). The estuary serves as an important nursery ground for English sole, making this species vulnerable to anthropogenic threats. We determined that estuarine hypoxia was associated with significant declines in English sole nursery habitat, with cascading effects on recruitment to the offshore adult population and fishery, indicating that human land use activities can indirectly affect offshore fisheries. Estuarine hypoxic conditions varied spatially and temporally and were alleviated by strengthening of El Niño conditions through indirect pathways, a consistent result in most estuaries across the northeast Pacific. These results demonstrate that changes to coastal land use and climate can fundamentally alter the diversity and functioning of coastal nurseries and their adjacent ocean ecosystems. PMID:26056293
Climate mediates hypoxic stress on fish diversity and nursery function at the land-sea interface.
Hughes, Brent B; Levey, Matthew D; Fountain, Monique C; Carlisle, Aaron B; Chavez, Francisco P; Gleason, Mary G
2015-06-30
Coastal ecosystems provide numerous important ecological services, including maintenance of biodiversity and nursery grounds for many fish species of ecological and economic importance. However, human population growth has led to increased pollution, ocean warming, hypoxia, and habitat alteration that threaten ecosystem services. In this study, we used long-term datasets of fish abundance, water quality, and climatic factors to assess the threat of hypoxia and the regulating effects of climate on fish diversity and nursery conditions in Elkhorn Slough, a highly eutrophic estuary in central California (United States), which also serves as a biodiversity hot spot and critical nursery grounds for offshore fisheries in a broader region. We found that hypoxic conditions had strong negative effects on extent of suitable fish habitat, fish species richness, and abundance of the two most common flatfish species, English sole (Parophrys vetulus) and speckled sanddab (Citharichthys stigmaeus). The estuary serves as an important nursery ground for English sole, making this species vulnerable to anthropogenic threats. We determined that estuarine hypoxia was associated with significant declines in English sole nursery habitat, with cascading effects on recruitment to the offshore adult population and fishery, indicating that human land use activities can indirectly affect offshore fisheries. Estuarine hypoxic conditions varied spatially and temporally and were alleviated by strengthening of El Niño conditions through indirect pathways, a consistent result in most estuaries across the northeast Pacific. These results demonstrate that changes to coastal land use and climate can fundamentally alter the diversity and functioning of coastal nurseries and their adjacent ocean ecosystems.
Insecticide Resistance Reducing Effectiveness of Malaria Control
Centers for Disease Control (CDC) Podcasts
Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.
Ancient nursery area for the extinct giant shark megalodon from the Miocene of Panama.
Directory of Open Access Journals (Sweden)
Catalina Pimiento
Full Text Available BACKGROUND: As we know from modern species, nursery areas are essential shark habitats for vulnerable young. Nurseries are typically highly productive, shallow-water habitats that are characterized by the presence of juveniles and neonates. It has been suggested that in these areas, sharks can find ample food resources and protection from predators. Based on the fossil record, we know that the extinct Carcharocles megalodon was the biggest shark that ever lived. Previous proposed paleo-nursery areas for this species were based on the anecdotal presence of juvenile fossil teeth accompanied by fossil marine mammals. We now present the first definitive evidence of ancient nurseries for C. megalodon from the late Miocene of Panama, about 10 million years ago. METHODOLOGY/PRINCIPAL FINDINGS: We collected and measured fossil shark teeth of C. megalodon, within the highly productive, shallow marine Gatun Formation from the Miocene of Panama. Surprisingly, and in contrast to other fossil accumulations, the majority of the teeth from Gatun are very small. Here we compare the tooth sizes from the Gatun with specimens from different, but analogous localities. In addition we calculate the total length of the individuals found in Gatun. These comparisons and estimates suggest that the small size of Gatun's C. megalodon is neither related to a small population of this species nor the tooth position within the jaw. Thus, the individuals from Gatun were mostly juveniles and neonates, with estimated body lengths between 2 and 10.5 meters. CONCLUSIONS/SIGNIFICANCE: We propose that the Miocene Gatun Formation represents the first documented paleo-nursery area for C. megalodon from the Neotropics, and one of the few recorded in the fossil record for an extinct selachian. We therefore show that sharks have used nursery areas at least for 10 millions of years as an adaptive strategy during their life histories.
An Examination of the Role of Nursery Education on Primary School Pupils in Nigeria
Oniwon, H. O. Evelyn
2015-01-01
This study examines the role of Nursery education among primary school pupils. The sole objective of the study was to find out the differences in academic achievement between primary school pupils who received nursery education and those who did not. Descriptive survey research design was adopted to achieve the study objective. Consequently, 20…
David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham
2013-02-19
The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.
Dr. A.L. van Staa; O.K. Helder; J.C.M. Verweij
2011-01-01
To explore parents' and nurses' experiences with the transition of infants from the neonatal intensive care unit to a special care nursery. Qualitative explorative study in two phases. Level IIID neonatal intensive care unit in a university hospital and special care nurseries (level II) in five
Biochar effects on the nursery propagation of 4 northern Rocky Mountain native plant species
Clarice P. Matt; Christopher R. Keyes; R. Kasten Dumroese
2018-01-01
Biochar has emerged as a promising potential amendment of soilless nursery media for plant propagation. With this greenhouse study we used biochar to displace standard soilless nursery media at 4 rates (0, 15, 30, and 45% [v:v]) and then examined media chemistry, irrigation frequency, and the growth of 4 northern Rocky Mountain native plant species: Clarkia pulchella...
Effect of selected insecticides on SF9 insect cell line
International Nuclear Information System (INIS)
Saleh, M.; Rahmo, A.; Hajjar, J.
2013-01-01
The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)
Energy Technology Data Exchange (ETDEWEB)
Catrina, I.; Popa, A.; Constantinesco, V.; Constantinesco, O.; Constantinesco, El.; Hulula, C. [Institut de Recherches Forestieres de Bucarest, Bucharest (Romania)
1963-09-15
The organophosphoric insecticides having systemic properties due to their ability to penetrate into the sap flow of plants act on insects which spend part of their lives either in the cambial region between wood and bark, or in the wood itself. Until the introduction of these new insecticides chemical control of xylophagous insects in tree-trunks was almost impossible. The mechanism of absorption, diffusion and concentration of systemic insecticides in species of poplar and willow, which are frequently attacked by xylophagous insects, was studied using labelled Dipterex on the poplai Robusta R20. The insecticide was labelled in the reactor, using powdered Dipterex (1.5 g) as target, at a flux {Phi}= 10{sup 11} n/cm{sup 2} s and at a temperature of 30-40{sup o}C. Irradiation was carried on until an absolute target activity of {approx_equal} 1 mc was obtained. The insecticide was administered, in the form of a solution, by pouring it on to the soil, except in one case in which the insecticide was sprayed on to the leaves. One series of experiments was conducted in the laboratory using seedlings grown in pots, and another series was performed in a nursery, using one- and two-year-old saplings. One to two months after administration of the labelled insecticide solutions the trees were subjected to radiometric analysis. In the laboratory experiments the insecticide accumulated in considerable quantities in the leaves, and in smaller amounts in the wood. Both in the laboratory and in the nursery a greater amount of insecticide accumulated in the leaves. In the nursery experiment, however, a considerable increase was observed in the accumulation in the branches and in the wood of the stem, especially at the extremities. The mean accumulation of insecticide amounted to 1.65 mg/g green matter in the'nursery as against 0.24 mg/g in pots. It was shown that under field conditions, in dry weather, two-year-old Robusta saplings take up Dipterex administered in an aqueous
DEFF Research Database (Denmark)
Græsbøll, Kaare; Damborg, Peter; Mellerup, Anders
2017-01-01
This study describes the results of a randomized clinical trial investigating the effect of oxytetracycline treatment dose and mode of administration on the selection of antibiotic-resistant coliform bacteria in fecal samples from nursery pigs. Nursery pigs (pigs of 4 to 7 weeks of age) in five pig...... by the time that the pigs left the nursery unit. The counts and proportions of tetracyclineresistant coliforms did not vary significantly between treatment groups, except immediately after treatment, when the highest treatment dose resulted in the highest number of resistant coliforms. A control group treated...
Tazouti, Youssef; Viriot-Goeldel, Caroline; Matter, Cornelie; Geiger-Jaillet, Anemone; Carol, Rita; Deviterne, Dominique
2011-01-01
The present article investigates the effects of individual and contextual variables on children's early learning in French nursery schools and German kindergartens. Our study of 552 children at preschools in France (299 children from French nursery schools) and Germany (253 children from German kindergartens) measured skills that facilitate the…
Control of grapevine wood fungi in commercial nurseries
Directory of Open Access Journals (Sweden)
C. Rego
2009-05-01
Full Text Available Previous surveys conducted in commercial nurseries found that different wood fungi, namely Cylindrocarpon spp., Botryosphaeriaceae, Phomopsis viticola and Phaeomoniella chlamydospora infect grapevine cuttings. Two field trials were carried out to evaluate the effectiveness of cyprodinil + fludioxonil, pyraclostrobin + metiram, fludioxonil and cyprodinil to prevent or reduce natural infections caused by such fungi. Rootstock and scion cuttings were soaked in fungicidal suspensions for 50 min prior to grafting. After callusing, the grafted cuttings were planted in two commercial field nurseries with and without a previous history of grapevine cultivation. After nine months in the nursery, the plants were uprooted and analysed for the incidence and severity of the wood fungi. Plants uprooted from the field without a previous history of grapevine cultivation were generally less strongly infected by wood fungi. Under this condition, only the mixture cyprodinil + fludioxonil simultaneously reduced the incidence of Cylindrocarpon and Botryosphaeriaceae fungi, as well as the severity of Cylindrocarpon infections. Treatments did not produce significant differences in the incidence and severity of P. viticola, and Pa. chlamydospora. For plants grown in the field with a grapevine history, all fungicides except cyprodinil significantly reduced the incidence and severity of Cylindrocarpon fungi. Also, the incidence and severity of Botryosphaeriaceae pathogens were significantly decreased both by cyprodinil + fludioxonil and by cyprodinil. No significant differences were noticed for P. viticola incidence and severity, and Pa. chlamydospora was not detected again. These results suggest that the practice of soaking grapevine cuttings in selected fungicides prior to grafting significantly reduces Cylindrocarpon spp. and Botryosphaeriaceae infections, thus improving the quality of planting material.
Directory of Open Access Journals (Sweden)
Edwin J. Niklitschek
2016-10-01
Full Text Available Background Mixture models (MM can be used to describe mixed stocks considering three sets of parameters: the total number of contributing sources, their chemical baseline signatures and their mixing proportions. When all nursery sources have been previously identified and sampled for juvenile fish to produce baseline nursery-signatures, mixing proportions are the only unknown set of parameters to be estimated from the mixed-stock data. Otherwise, the number of sources, as well as some/all nursery-signatures may need to be also estimated from the mixed-stock data. Our goal was to assess bias and uncertainty in these MM parameters when estimated using unconditional maximum likelihood approaches (ML-MM, under several incomplete sampling and nursery-signature separation scenarios. Methods We used a comprehensive dataset containing otolith elemental signatures of 301 juvenile Sparus aurata, sampled in three contrasting years (2008, 2010, 2011, from four distinct nursery habitats. (Mediterranean lagoons Artificial nursery-source and mixed-stock datasets were produced considering: five different sampling scenarios where 0–4 lagoons were excluded from the nursery-source dataset and six nursery-signature separation scenarios that simulated data separated 0.5, 1.5, 2.5, 3.5, 4.5 and 5.5 standard deviations among nursery-signature centroids. Bias (BI and uncertainty (SE were computed to assess reliability for each of the three sets of MM parameters. Results Both bias and uncertainty in mixing proportion estimates were low (BI ≤ 0.14, SE ≤ 0.06 when all nursery-sources were sampled but exhibited large variability among cohorts and increased with the number of non-sampled sources up to BI = 0.24 and SE = 0.11. Bias and variability in baseline signature estimates also increased with the number of non-sampled sources, but tended to be less biased, and more uncertain than mixing proportion ones, across all sampling scenarios (BI < 0.13, SE < 0
Darnaude, Audrey M.
2016-01-01
Background Mixture models (MM) can be used to describe mixed stocks considering three sets of parameters: the total number of contributing sources, their chemical baseline signatures and their mixing proportions. When all nursery sources have been previously identified and sampled for juvenile fish to produce baseline nursery-signatures, mixing proportions are the only unknown set of parameters to be estimated from the mixed-stock data. Otherwise, the number of sources, as well as some/all nursery-signatures may need to be also estimated from the mixed-stock data. Our goal was to assess bias and uncertainty in these MM parameters when estimated using unconditional maximum likelihood approaches (ML-MM), under several incomplete sampling and nursery-signature separation scenarios. Methods We used a comprehensive dataset containing otolith elemental signatures of 301 juvenile Sparus aurata, sampled in three contrasting years (2008, 2010, 2011), from four distinct nursery habitats. (Mediterranean lagoons) Artificial nursery-source and mixed-stock datasets were produced considering: five different sampling scenarios where 0–4 lagoons were excluded from the nursery-source dataset and six nursery-signature separation scenarios that simulated data separated 0.5, 1.5, 2.5, 3.5, 4.5 and 5.5 standard deviations among nursery-signature centroids. Bias (BI) and uncertainty (SE) were computed to assess reliability for each of the three sets of MM parameters. Results Both bias and uncertainty in mixing proportion estimates were low (BI ≤ 0.14, SE ≤ 0.06) when all nursery-sources were sampled but exhibited large variability among cohorts and increased with the number of non-sampled sources up to BI = 0.24 and SE = 0.11. Bias and variability in baseline signature estimates also increased with the number of non-sampled sources, but tended to be less biased, and more uncertain than mixing proportion ones, across all sampling scenarios (BI nursery signatures improved reliability
Trifluoromethylphenyl amides as novel insecticides and fungicides
Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...
Indoor/outdoor elemental concentration relationships at a nursery school
International Nuclear Information System (INIS)
Lannefors, H.; Hansson, H.C.
1981-01-01
Indoor and outdoor concentrations of lead and bromine have been measured at a nursery school, using streaker samplers with 2.4 h resolution. The observed variations in concentration were well-correlated with traffic intensity variations. In addition to their closely related time-variation curves, the bromine to lead ratios pointed to the emissions from leaded gasoline-powered vehicles as the main source of these elements both in and outdoors. Time-variation patterns on weekdays and during weekends indicated that the lead and bromine containing particles entered the nursery school mainly by leaking. Only a minor fraction seemed to be brought in and resuspended by the staff and children. The indoor concentrations of the elements studied were about 5 times lower than the outdoor levels thus considerably reducing the indoor exposure. (orig.)
Ventilation in day-care centres and sick leave among nursery children
DEFF Research Database (Denmark)
Kolarik, Barbara; Andersen, Zorana Jovanovic; Ibfelt, Tobias
2016-01-01
ventilation in DCCs and sick leave among nursery children. Data on child sick leave within an 11 week period was obtained for 635 children attending 20 DCCs. Ventilation measurements included three proxies of ventilation: air exchange rate (ACR) measured with the decay method, ACR measured...... inverse relationship between the number of sick days and ACR measured with the decay method was found for crude and adjusted analysis, with a 12% decrease in number of sick days per 1 h(-1) increase in ACR measured with the decay method. This study suggests a relationship between sick leave among nursery...
D. Paul Jackson; Scott A. Enebak; James West; Drew Hinnant
2015-01-01
Renewed efforts in longleaf pine (Pinus palustris Mill.) ecosystem restoration has increased interest in the commercial production of understory herbaceous species. Successful establishment of understory herbaceous species is enhanced when using quality nursery-grown plants that have a better chance of survival after outplanting. Nursery growing practices have not been...
An insecticidal toxin from Nephila clavata spider venom.
Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong
2017-07-01
Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.
Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun
2014-01-01
Abstract Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC 50 values were higher for Lab-Q than for Lab-B; avermectin LC 50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. PMID:25434040
Insecticides suppress natural enemies and increase pest damage in cabbage.
Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer
2011-06-01
Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy
Protective effect and economic impact of insecticide application methods on barley
Directory of Open Access Journals (Sweden)
Alfred Stoetzer
2014-03-01
Full Text Available The objective of this work was to evaluate the protective effect of different forms of insecticide application on the transmission of yellow dwarf disease in barley cultivars, as well as to determine the production costs and the net profit of these managements. The experiments were carried out during 2011 and 2012 growing seasons, using the following managements at main plots: T1, seed treatment with insecticide (ST + insecticide on shoots at 15-day interval; T2, just ST; T3, insecticide applied on shoots, when aphid control level (CL was reached; T4, without insecticide; and T5, ST + insecticide on shoots when CL was reached. Different barley cultivars - BRS Cauê, BRS Brau and MN 6021 - were arranged in the subplots. Insecticides lambda cyhalothrin (pyrethroid and thiamethoxam (neonicotinoid were used. There were differences on yellow dwarf disease index in both seasons for the different treatments, while damage to grain yield was influenced by year and aphid population. Production costs and net profit were different among treatments. Seed treatment with insecticide is sufficient to reduce the transmission of yellow dwarf disease in years with low aphid population pressure, while in years with larger populations, the application of insecticide on shoots is also required.
Frank, Steven D; Anderson, Amanda L; Ranger, Christopher M
2017-12-08
Exotic ambrosia beetles, particularly Xylosandrus crassiusculus (Motschulsky) (Coleoptera: Curculionidae: Scolytinae) and Xylosandrus germanus (Blandford) (Coleoptera: Curculionidae: Scolytinae), are among the most damaging pests of ornamental trees in nurseries. Growers have had few tactics besides insecticide applications to reduce ambrosia beetle attacks but recent research has shown that attacks may be reduced by maintaining media moisture below a 50% threshold thereby reducing flood stress. We compared the efficacy of managing media moisture and insecticide applications for reducing ambrosia beetle attacks on three ornamental tree species in North Carolina. During trials in spring 2013 and 2015, flooded Cornus florida and Cornus kousa were heavily attacked despite sprays with permethrin, but nonflooded C. kousa or C. florida were not attacked. In spring 2015 trials, both nonflooded and flooded Styrax japonicus were heavily attacked regardless of permethrin applications. Although ethanol emissions were not measured, the apparently healthy nonflooded S. japonicus trees may have been exposed to an unknown physiological stress, such as low temperature injury, the previous winter, which predisposed them to beetle attack. However, ethanol levels within host tissues were not measured as part of the current study. X. crassiusculus (75%), Xyloborinus saxesenii Ratzburg (13%), and X. germanus (9%) were the most abundant species collected in ethanol baited traps deployed in 2015, while X. crassiusculus (63%) and X. germanus (36%) were the predominant species reared from attacked trees. Results indicate that managing media moisture levels at or below 50%, and maximizing tree health overall, may provide significant protection against Xylosandrus spp. attacks in flood intolerant tree species. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Menkis, Audrius; Vasaitis, Rimvydas
2011-01-01
The aims of this study were to investigate patterns of ectomycorrhizal (ECM) colonisation and community structure on nursery grown seedlings of Pinus sylvestris, spatial distribution of ECMs in the nursery plot and genetic diversity of commonly isolated ECM basidiomycete Hebeloma cavipes. One hundred seedlings were sampled in 225 m(2) area using a systematic grid design. For each seedling, 20 individual root tips were randomly collected, morphotyped, and surface sterilised for fungal isolation in pure culture. Results showed that ECM community was comprised of nine distinct morphotypes among which Thelephora terrestris (39.7%), Hebeloma sp. (17.8%) and Suillus luteus (6.1%) were the most abundant. Spatial distribution of ECMs in the nursery plot was determined by their relative abundance: even in common ECMs and random in rare ones. Fungal isolation yielded 606 pure cultures, representing 71 distinct taxa. The most commonly isolated fungi were the ascomycetes Neonectria macrodidyma (20.3%), Phialocephala fortinii (13.5%), Neonectria radicicola (6.3%) and the ECM basidiomycete H. cavipes (4.5%). Intraspecific genetic diversity within 27 H. cavipes isolates was studied using two methods: restriction digestion of the amplified intergenic spacer of nuclear ribosomal DNA and genealogical concordance of five genetic markers. Five and eight genotypes were revealed by each respective method, but both of those were largely consistent, in particular, in determining the largest genotype (A) composed of 18 isolates. Mapping positions for each H. cavipes isolate and genotype in the field showed that isolates of the A genotype covered a large part of the nursery plot. This suggests that H. cavipes is largely disseminated by vegetative means of local genotypes and that nursery cultivation practices are likely to contribute to the dissemination of this species in the forest nursery soils.
Schneider, Christof W.; Tautz, Jürgen; Grünewald, Bernd; Fuchs, Stefan
2012-01-01
The development of insecticides requires valid risk assessment procedures to avoid causing harm to beneficial insects and especially to pollinators such as the honeybee Apis mellifera. In addition to testing according to current guidelines designed to detect bee mortality, tests are needed to determine possible sublethal effects interfering with the animal's vitality and behavioral performance. Several methods have been used to detect sublethal effects of different insecticides under laboratory conditions using olfactory conditioning. Furthermore, studies have been conducted on the influence insecticides have on foraging activity and homing ability which require time-consuming visual observation. We tested an experimental design using the radiofrequency identification (RFID) method to monitor the influence of sublethal doses of insecticides on individual honeybee foragers on an automated basis. With electronic readers positioned at the hive entrance and at an artificial food source, we obtained quantifiable data on honeybee foraging behavior. This enabled us to efficiently retrieve detailed information on flight parameters. We compared several groups of bees, fed simultaneously with different dosages of a tested substance. With this experimental approach we monitored the acute effects of sublethal doses of the neonicotinoids imidacloprid (0.15–6 ng/bee) and clothianidin (0.05–2 ng/bee) under field-like circumstances. At field-relevant doses for nectar and pollen no adverse effects were observed for either substance. Both substances led to a significant reduction of foraging activity and to longer foraging flights at doses of ≥0.5 ng/bee (clothianidin) and ≥1.5 ng/bee (imidacloprid) during the first three hours after treatment. This study demonstrates that the RFID-method is an effective way to record short-term alterations in foraging activity after insecticides have been administered once, orally, to individual bees. We contribute further information on
Directory of Open Access Journals (Sweden)
Christof W Schneider
Full Text Available The development of insecticides requires valid risk assessment procedures to avoid causing harm to beneficial insects and especially to pollinators such as the honeybee Apis mellifera. In addition to testing according to current guidelines designed to detect bee mortality, tests are needed to determine possible sublethal effects interfering with the animal's vitality and behavioral performance. Several methods have been used to detect sublethal effects of different insecticides under laboratory conditions using olfactory conditioning. Furthermore, studies have been conducted on the influence insecticides have on foraging activity and homing ability which require time-consuming visual observation. We tested an experimental design using the radiofrequency identification (RFID method to monitor the influence of sublethal doses of insecticides on individual honeybee foragers on an automated basis. With electronic readers positioned at the hive entrance and at an artificial food source, we obtained quantifiable data on honeybee foraging behavior. This enabled us to efficiently retrieve detailed information on flight parameters. We compared several groups of bees, fed simultaneously with different dosages of a tested substance. With this experimental approach we monitored the acute effects of sublethal doses of the neonicotinoids imidacloprid (0.15-6 ng/bee and clothianidin (0.05-2 ng/bee under field-like circumstances. At field-relevant doses for nectar and pollen no adverse effects were observed for either substance. Both substances led to a significant reduction of foraging activity and to longer foraging flights at doses of ≥0.5 ng/bee (clothianidin and ≥1.5 ng/bee (imidacloprid during the first three hours after treatment. This study demonstrates that the RFID-method is an effective way to record short-term alterations in foraging activity after insecticides have been administered once, orally, to individual bees. We contribute further
Experiences in the containerized tree seedlings forest nurseries production
Directory of Open Access Journals (Sweden)
Eduardo González-Izquierdo
2014-12-01
Full Text Available The work summarizes the results of the research carried out by the team of forest nurseries at Sustainable Forest Management Group in Pinar del Río University Forest Research Centre in the last 25 years. The characteristics of seedlings quality are presented, the best growing media, the water management to harden the forest species under the ecological conditions of more and more lingering periods of drought. The studied forest species were: Talipariti elatum (Sw. Fryxell, Pinus tropicalis Morelet , Swietenia mahagon(L.Jacq. Swietenia macrophylla King, Caesalpinia violacea (Mill. Stand, Genipa americana L, Gerascanthus gerascanthoides (Kunth Borhidi y Cedrela odorata L. y Eucalyptus grandis Hill ex Maiden. The main results can be summarized in the following way: the size of the containers oscillates between 90 and 300 cubic centimeters; the growing media combines organic and composted components fundamentally of Pinus caribaea and Eucalyptus ssp bark., with proportions that they vary according to the species and the disposability of these components in the nurseries where the plants take place; for the water management hardening procedures were used by watering in last month of the cultivation. In general the economic analyses demonstrated the decrease of the production costs for seedlings with the employment of this novel technology, the same as their advantages on the traditional technology of seedlings production in polybags: humanization of manpower work in forest nursery, reduction of costs production, improvement of produced seedling quality and productivity increase of their workers.
Improved ventilation and temperature control in a nursery
Jacobs, P.
2011-01-01
We performed an intervention study in a nursery. We have measured the air quality with as indicator CO2 and temperature in the original configuration. The maximum observed CO2 concentration during a three week monitoring period was 1834 ppm. The average CO2 concentration during the sleeping period
Seagraves, Bonny L; Redmond, Carl T; Potter, Daniel A
2013-01-01
Maples (Acer spp.) in production nurseries are vulnerable to numerous arthropod pests that can stunt or even kill the young trees. Seventeen cultivars representing various Acer species and hybrids were evaluated for extent of infestation or injury by shoot and trunk borers (Proteoteras aesculana, Chrysobothris femorata), potato leafhopper (Empoasca fabae), Japanese beetle (Popillia japonica), maple spider mite (Oligonychus aceris) and calico scale (Eulecanium cerasorum). Evaluations were done in replicated field plots in central and western Kentucky. All of the maples were susceptible, to varying degrees, to one or more key pest(s). Red maples (A. rubrum) were relatively vulnerable to potato leafhopper injury and borers but nearly free of Japanese beetle feeding and spider mites. Sugar maples sustained conspicuous Japanese beetle damage but had very low mite populations, whereas the opposite was true for Freeman maples (A. × freemanii). A. campestre was heavily infested by calico scale. Within each species or hybrid there were cultivar differences in degree of infestation or damage by particular pests. The results should help growers to focus pest management efforts on those plantings at greatest risk from particular pests, and to choose cultivars requiring fewer insecticide inputs to produce a quality tree. Copyright © 2012 Society of Chemical Industry.
Clément, Gaël; Daeschler, Edward B.; Dupret, Vincent
2016-01-01
The placoderm fauna of the upper Famennian tetrapod-bearing locality of Strud, Belgium, includes the antiarch Grossilepis rikiki, the arthrodire groenlandaspidid Turrisaspis strudensis and the phyllolepidid Phyllolepis undulata. Based on morphological and morphometric evidence, the placoderm specimens from Strud are predominantly recognised as immature specimens and this locality as representing a placoderm nursery. The Strud depositional environment corresponds to a channel in an alluvial plain, and the presence of a nursery in such environment could have provided nutrients and protection to the placoderm offspring. This represents one of the earliest pieces of evidence for this sort of habitat partitioning in vertebrate history, with adults living more distantly from the nursery and using the nursery only to spawn or give live birth. PMID:27552196
Krivanek, Roman
2014-01-01
The "Jackson Nursery", existing from February 1937 until March 1938, was directed by Anna Freud and financed by Edith Jackson and Dorothy Burlingham. It took care of infants from the poorest strata of Vienna and also gave material support to their families. On the other hand, it was a training institution for psychoanalysts, offering the opportunity of observing children during their first two years, e. g. their feeding habits and social sense. In addition, the Jackson Nursery was a place for research where psychoanalytic theories of infantile development were checked against the findings of direct observation. The work started here was then continued by A. Freud and D. Burlingham on a larger scale in their War Nurseries.--This paper examines the many-sided activities in the nursery mainly on the basis of unpu blished archival documents.
Zheng, Liwei; Ma, Juanjuan; Zhang, Lizhi; Gao, Cai; Zhang, Dong; Zhao, Caiping; Han, Mingyu
2018-02-20
Brassinosteroid is identified as an important hormone. However, information about brassinosteroid has not been fully elucidated, and few studies concerned its role in apple. The aim of this work was to study the role of brassinosteroid for apple tree growth. In our study, the effect of brassinosteroid on apple nursery tree was analyzed. The biomass, cell size and xylem content of apple nursery tree were obviously evaluated by brassinosteroid treatment; mineral elements contents, photosynthesis indexes, carbohydrate level and hormone contents were significantly high in brassinosteroid treated trees. To explore the molecular mechanisms of these phenotypic differences, iTRAQ-based quantitative proteomics were used to identify the expression profiles of proteins in apple nursery tree shoot tips in response to brassinosteroid at a key period (14days after brassinosteroid treatment). A total of 175 differentially expressed proteins were identified. They were mainly involved in chlorophyII biosynthesis, photosynthesis, carbohydrate metabolism, glycolysis, citric acid cycle, respiratory action, hormone signal, cell growth and ligin metabolism. The findings in this study indicate that brassinosteroid mediating apple nursery tree growth may be mainly through energy metabolism. Important biological processes identified here can be useful theoretical basis and provide new insights into the molecular mechanisms of brassinosteroid. Brassinosteroid is very important for plant growth and development. However, the molecular mechanism of brassinosteroid mediating growth process is not perfectly clear in plant, especially in apple nursery tree. We used a combination of physiological and bioinformatics analysis to investigate the effects of brassinosteroid on apple nursery tree growth and development. The data reported here demonstrated that brassinosteroid regulates apple nursery tree growth mainly through energy metabolism. Therefore it can provide a theoretical basis from energy
Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun
2014-01-01
Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC50 values were higher for Lab-Q than for Lab-B; avermectin LC50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.
Insecticides promote viral outbreaks by altering herbivore competition.
Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun
2015-09-01
While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.
Pang, Yuan-Ping; Brimijoin, Stephen; Ragsdale, David W; Zhu, Kun Yan; Suranyi, Robert
2012-04-01
Insect pests are responsible for human suffering and financial losses worldwide. New and environmentally safe insecticides are urgently needed to cope with these serious problems. Resistance to current insecticides has resulted in a resurgence of insect pests, and growing concerns about insecticide toxicity to humans discourage the use of insecticides for pest control. The small market for insecticides has hampered insecticide development; however, advances in genomics and structural genomics offer new opportunities to develop insecticides that are less dependent on the insecticide market. This review summarizes the literature data that support the hypothesis that an insect-specific cysteine residue located at the opening of the acetylcholinesterase active site is a promising target site for developing new insecticides with reduced off-target toxicity and low propensity for insect resistance. These data are used to discuss the differences between targeting the insect-specific cysteine residue and targeting the ubiquitous catalytic serine residue of acetylcholinesterase from the perspective of reducing off-target toxicity and insect resistance. Also discussed is the prospect of developing cysteine-targeting anticholinesterases as effective and environmentally safe insecticides for control of disease vectors, crop damage, and residential insect pests within the financial confines of the present insecticide market.
Triplicate water samples were collected monthly from 9 waterways (8 recycling containment basins (RCBs) and 1 stream) on 4 commercial ornamental plant nurseries from February to July, and from 1 RCB and nursery from April to October. Four RCBs, one per nursery, were actively utilized as an irrigatio...
Rivera, Emily K; Shedenhelm, Heidi J; Gibbs, Ardyce L
2015-01-01
In response to changing needs of registered nurse orientees, the staff education committee in the Intermediate Special Care Nursery has implemented a phased orientation process. This phased process includes a mentoring experience postorientation to support a new nurse through the first year of employment. Since implementing the phased orientation process in the Intermediate Special Care Nursery, orientee satisfaction and preparation to practice have increased, and length of orientation has decreased.
2 Assessmen of the Efficiency of Insecticide
African Journals Online (AJOL)
Administrator
malaria vectors and nuisance in West Africa – a-part. 2. Field evaluation. Malar J. 9: 341. Mosqueira B., Duchon S., Chandre F., Hougard, J. M., Carnevale P. and Mas-Coma S. (2010). Efficacy of an insecticide paint against insecticide- susceptible and resistant mosquitoes – b- Part 1: Laboratory evaluation. Malar J. 9: 340.
Insecticide Resistance Reducing Effectiveness of Malaria Control
Centers for Disease Control (CDC) Podcasts
2007-01-24
Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field. Created: 1/24/2007 by Emerging Infectious Diseases. Date Released: 3/13/2007.
Szpyrka, Ewa; Matyaszek, Aneta; S?owik-Borowiec, Magdalena
2017-01-01
Dissipations of three insecticides: chlorantraniliprole, chlorpyrifos-methyl and indoxacarb in apples were studied following their foliar application on apples intended for production of baby food. The apples were sprayed with formulations for control of codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae). Six experiments were conducted; each insecticide was applied individually on dessert apples. A validated gas chromatography-based method with simultaneous electron capture and n...
Directory of Open Access Journals (Sweden)
Samantha A. Radford
2018-02-01
Full Text Available Since urinary insecticide metabolites are commonly used as biomarkers of exposure, it is important that we quantify whether insecticides degrade in food and beverages in order to better perform risk assessment. This study was designed to quantify degradation of organophosphorus and pyrethroid insecticides in beverages. Purified water, white grape juice, orange juice, and red wine were fortified with 500 ng/mL diazinon, malathion, chlorpyrifos, permethrin, cyfluthrin, cypermethrin, and deltamethrin, and aliquots were extracted several times over a 15-day storage period at 2.5 °C. Overall, statistically significant loss of at least one insecticide was observed in each matrix, and at least five out of seven insecticides demonstrated a statistically significant loss in all matrices except orange juice. An investigation of an alternative mechanism of insecticide loss—adsorption onto the glass surface of the storage jars—was carried out, which indicated that this mechanism of loss is insignificant. Results of this work suggest that insecticides degrade in these beverages, and this degradation may lead to pre-existing insecticide degradates in the beverages, suggesting that caution should be exercised when using urinary insecticide metabolites to assess exposure and risk.
Biological efficacy of the ecotoxically favourable insecticides and ...
African Journals Online (AJOL)
Administrator
2011-05-30
May 30, 2011 ... different, studies done in natural conditions should be favored. Key words: Insecticides ... insecticide was applied on synthetic or natural food of the target insect ..... Pozsgay M, Fast P, Kaplan H, Carey PR (1987). The effect of ...
Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.
Hua, Jessica; Jones, Devin K; Relyea, Rick A
2014-04-01
As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.
The Emotional Complexity of Attachment Interactions in Nursery
Page, Jools; Elfer, Peter
2013-01-01
In a single intensive nursery case study, using in depth interviews, group discussion and self completed daily diaries, this article reports on staff accounts of the emotional aspects of their interactions with young children. The findings show how much the staff achieved through their empathy for children and families and the establishment of…
Decaleside: a new class of natural insecticide targeting tarsal gustatory sites
Rajashekar, Yallappa; Rao, Lingamallu J. M.; Shivanandappa, Thimmappa
2012-10-01
Natural sources for novel insecticide molecules hold promise in view of their eco-friendly nature, selectivity, and mammalian safety. Recent progress in understanding the biology of insect olfaction and taste offers new strategies for developing selective pest control agents. We have isolated two natural insecticidal molecules from edible roots of Decalepis hamiltonii named Decalesides I and II, which are novel trisaccharides, highly toxic to household insect pests and stored-product insects. We have experimentally shown that insecticidal activity requires contact with tarsi on the legs but is not toxic orally. The insecticidal activity of molecules is lost by hydrolysis, and various sugars modify toxic response, showing that the insecticidal activity is via gustatory sites on the tarsi. Selective toxicity to insects by virtue of their gustatory site of action and the mammalian safety of the new insecticides is inherent in their chemical structure with 1-4 or 1-1 α linkage that is easily hydrolyzed by digestive enzymes of mammals. Decalesides represent a new chemical class of natural insecticides with a unique mode of action targeting tarsal chemosensory/gustatory system of insects.
Marine nurseries and effective juvenile habitats: concepts and applications.
Dahlgren, C.P.; Kellison, G.T.; Adams, A.J.; Gillanders, B.M.; Kendall, M.S.; Layman, C.A.; Ley, J.A.; Nagelkerken, I.; Serafy, J.E.
2006-01-01
Much recent attention has been focused on juvenile fish and invertebrate habitat use, particularly defining and identifying marine nurseries. The most significant advancement in this area has been the development of a standardized framework for assessing the relative importance of juvenile habitats
Impact of some selected insecticides application on soil microbial respiration.
Latif, M A; Razzaque, M A; Rahman, M M
2008-08-15
The aim of present study was to investigate the impact of selected insecticides used for controlling brinjal shoot and fruit borer on soil microorganisms and to find out the insecticides or nontoxic to soil microorganism the impact of nine selected insecticides on soil microbial respiration was studied in the laboratory. After injection of different insecticides solutions, the soil was incubated in the laboratory at room temperature for 32 days. The amount of CO2 evolved due to soil microbial respiration was determined at 2, 4, 8, 16, 24 and 32 days of incubation. Flubendiamide, nimbicidine, lambda-cyhalothrin, abamectin and thiodicarb had stimulatory effect on microbial respiration during the initial period of incubation. Chlorpyriphos, cartap and carbosulfan had inhibitory effect on microbial respiration and cypermethrin had no remarkable effect during the early stage of incubation. The negative effect of chlorpyriphos, cartap and carbosulfan was temporary, which was disappeared after 4 days of insecticides application. No effect of the selected insecticides on soil microorganisms was observed after 24 or 32 days of incubation.
Effectiveness and profitability of insecticide formulations used for ...
African Journals Online (AJOL)
To identify optimal pest control with lower economic risks to farmers, we investigated the effectiveness and profitability of different insecticides and insecticide formulations against bean fly (Ophiomyia spp.) and bean flower thrips (Megalurothrips sjostedtii). Two separate experiments were conducted during 2009 to 2012.
Impact of reduced-risk insecticides on soybean aphid and associated natural enemies.
Ohnesorg, Wayne J; Johnson, Kevin D; O'Neal, Matthew E
2009-10-01
Insect predators in North America suppress Aphis glycines Matsumura (Hemiptera: Aphididae) populations; however, insecticides are required when populations reach economically damaging levels. Currently, insecticides used to manage A. glycines are broad-spectrum (pyrethroids and organophosphates), and probably reduce beneficial insect abundance in soybean, Glycine max (L.) Merr. Our goal was to determine whether insecticides considered reduced-risk by the Environmental Protection Agency could protect soybean yield from A. glycines herbivory while having a limited impact on the aphid's natural enemies. We compared three insecticides (imidacloprid, thiamethoxam, and pymetrozine,) to a broad-spectrum insecticide (lamda-cyhalothrin) and an untreated control using two application methods. We applied neonicotinoid insecticides to seeds (imidacloprid and thiamethoxam) as well as foliage (imidacloprid); pymetrozine and lamda-cyhalothrin were applied only to foliage. Foliage-applied insecticides had lower A. glycines populations and higher yields than the seed-applied insecticides. Among foliage-applied insecticides, pymetrozine and imidacloprid had an intermediate level of A. glycines population and yield protection compared with lamda-cyhalothrin and the untreated control. We monitored natural enemies with yellow sticky cards, sweep-nets, and direct observation. Before foliar insecticides were applied (i.e., before aphid populations developed) seed treatments had no observable effect on the abundance of natural enemies. After foliar insecticides were applied, differences in natural enemy abundance were observed when sampled with sweep-nets and direct observation but not with yellow sticky cards. Based on the first two sampling methods, pymetrozine and the foliage-applied imidacloprid had intermediate abundances of natural enemies compared with the untreated control and lamda-cyhalothrin.
Ancient Nursery Area for the Extinct Giant Shark Megalodon from the Miocene of Panama
Pimiento, Catalina; Ehret, Dana J.; MacFadden, Bruce J.; Hubbell, Gordon
2010-01-01
BACKGROUND: As we know from modern species, nursery areas are essential shark habitats for vulnerable young. Nurseries are typically highly productive, shallow-water habitats that are characterized by the presence of juveniles and neonates. It has been suggested that in these areas, sharks can find ample food resources and protection from predators. Based on the fossil record, we know that the extinct Carcharocles megalodon was the biggest shark that ever lived. Previous proposed paleo-nurser...
Froeschke, John T.; Stunz, Gregory W.; Sterba-Boatwright, Blair; Wildhaber, Mark L.
2010-01-01
Using a long-term fisheries-independent data set, we tested the 'shark nursery area concept' proposed by Heupel et al. (2007) with the suggested working assumptions that a shark nursery habitat would: (1) have an abundance of immature sharks greater than the mean abundance across all habitats where they occur; (2) be used by sharks repeatedly through time (years); and (3) see immature sharks remaining within the habitat for extended periods of time. We tested this concept using young-of-the-year (age 0) and juvenile (age 1+ yr) bull sharks Carcharhinus leucas from gill-net surveys conducted in Texas bays from 1976 to 2006 to estimate the potential nursery function of 9 coastal bays. Of the 9 bay systems considered as potential nursery habitat, only Matagorda Bay satisfied all 3 criteria for young-of-the-year bull sharks. Both Matagorda and San Antonio Bays met the criteria for juvenile bull sharks. Through these analyses we examined the utility of this approach for characterizing nursery areas and we also describe some practical considerations, such as the influence of the temporal or spatial scales considered when applying the nursery role concept to shark populations.
Allan Murray
2009-01-01
Fumigation with methyl bromide is essential in the production of hardwood seedlings in nurseries in the southern United States. However, the proposed rules under the 2008 U.S. Environmental Protection Agency (EPA) Risk Mitigation will further restrict the use of methyl bromide for nursery use.
David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham
2013-01-01
The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementat...
Insecticide Exposure in Parkinsonism
National Research Council Canada - National Science Library
Bloomquist, Jeffrey
2002-01-01
Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...
Insecticide Exposure in Parkinsonism
National Research Council Canada - National Science Library
Bloomquist, Jeffrey
2001-01-01
Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...
Hand hygiene in the nursery during diaper changing.
Phang, Koh Ni; Maznin, Nur Liyanna; Yip, Wai Kin
2012-12-01
This project aimed to improve hand hygiene practice during diaper changing among nurses working in the nursery. This project was conducted in one of the nurseries in a 935-bed acute care hospital with a sample of 15 nurses. A pre- and post-intervention audit was conducted utilising the Joanna Briggs Institute Practical Application of Clinical Evidence System and Getting Research into Practice module. A revised written workflow, which specified the occasions and process for hand hygiene during diaper changing, was introduced. Modifications to the baby bassinets and nursery were made after barriers to good hand hygiene were identified. The project was carried out over 4 months, from March to June 2011. The post-intervention audit results show an improvement in performing hand washing after changing diapers (20%) and performing the correct steps of hand rubbing (25%). However, the compliance rates decreased for the other criteria that measured whether hand rubbing or hand washing was performed prior to contacting the infant and after wrapping the infant, and whether hand washing was performed correctly. The improvement in compliance with hand washing--the main focus of the new workflow--after changing diapers was especially significant. The results indicated that having a workflow on the occasions and process for hand hygiene during diaper changing was useful in standardising practice. Pre- and post-implementation audits were effective methods for evaluating the effect of translating evidence into practice. However, this project had limited success in improving compliance with hand hygiene. This suggested that more effort is needed to reinforce the importance of hand hygiene and compliance to the proposed workflow. In addition, this project showed that for change to take place successfully, environmental modifications, increased awareness and adequate communication to every staff member are essential. © 2012 The Authors. International Journal of Evidence
Water management in container nurseries to minimize pests
R. Kasten Dumroese; Diane L. Haase
2018-01-01
Water is the most important and most common chemical used in plant nurseries. It is also the most dangerous chemical used. Insufficient water, excessive water, and poorly timed irrigation can all lead to poor-quality crops and unacceptable mortality. Anticipated future declines of water availability, higher costs to use it, and continuing concerns about irrigation...
Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives
Directory of Open Access Journals (Sweden)
Binh Cao Quan Nguyen
2015-09-01
Full Text Available Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively. Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively with 50%–60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C5-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.
Piano instruction for nursery school trainees
新海, 節; Makoto, SHINKAI; 藤女子大学人間生活学部保育学科
2012-01-01
It is important piano instruction in childcare training schools be viewed primarily as "music for childcare". To this end,it is also important that the view of piano instruction for nursery school trainees be switched from one mainly focused on the technical aspects of performance using many etudes to a form of instruction based on developing the musicality of the trainees and their ability to display emotion through music. Further, through this instruction, the trainees need to develop the a...
Development of Intelligent Spray Systems for Nursery Crop Production
Two intelligent sprayer prototypes were developed to increase pesticide application efficiency in nursery production. The first prototype was a hydraulic vertical boom system using ultrasonic sensors to detect tree size and volume for liner-sized trees and the second prototype was an air-assisted sp...
Nursery school at Vincennes: O.P.R.I. investigation
International Nuclear Information System (INIS)
Pasquier, J.L.; Fouquet, G.; Linden, G.
2001-01-01
After five children neoplasms at the nursery of Vincennes, the O.P.R.I. has realised two measurement campaigns during the year 2001. The track of a radioactive contamination, based on the private laboratory analysis has been denied by O.P.R.I. (N.C.)
[Nursery Teacher's Stress Scale (NTSS): reliability and validity].
Akada, Taro
2010-06-01
This study describes the development and evaluation of the Nursery Teacher's Stress Scale (NTSS), which explores the relation between daily hassles at work and work-related stress. In Analysis 1, 29 items were chosen to construct the NTSS. Six factors were identified: I. Stress relating to child care; II. Stress from human relations at work; III. Stress from staff-parent relations; IV. Stress from lack of time; V. Stress relating to compensation; and VI. Stress from the difference between individual beliefs and school policy. All these factors had high degrees of internal consistency. In Analysis 2, the concurrent validity of the NTSS was examined. The results showed that the NTSS total scores were significantly correlated with the Job Stress Scale-Revised Version (job stressor scale, r = .68), the Pre-school Teacher-efficacy Scale (r = -.21), and the WHO-five Well-Being Index Japanese Version (r = -.40). Work stresses are affected by several daily hassles at work. The NTSS has acceptable reliability and validity, and can be used to improve nursery teacher's mental health.
Brehony, Kevin J.
2009-01-01
This article examines the work of Lady Nancy Astor (1879-1964) in campaigning for nursery education and nursery schools in Britain from the late 1920s until the Second World War. Arguably no elected politician in England at any time, including the present, has identified themselves more closely with the cause of nursery schooling in Britain.…
Insecticide mixtures for mosquito net impregnation against malaria vectors
Directory of Open Access Journals (Sweden)
Corbel V.
2002-09-01
Full Text Available Insecticides belonging to the pyrethroid family are the only compounds currently available for the treatment of mosquito nets. Unfortunately, some malaria vector species have developed resistance to pyrethroids and the lack of alternative chemical categories is a great concern. One strategy for resistance management would be to treat mosquito nets with a mixture associating two insecticides having different modes of action. This study presents the results obtained with insecticide mixtures containing several proportions of bifenthrin (a pyrethroid insecticide and carbosulfan (a carbamate insecticide. The mixtures were sprayed on mosquito net samples and their efficacy were tested against a susceptible strain of Anopheles gambiae, the major malaria vector in Africa. A significant synergism was observed with a mixture containing 25 mg/m2 of bifenthrin (half the recommended dosage for treated nets and 6.25 mg/m2 of carbosulfan (about 2 % of the recommended dosage. The observed mortality was significantly more than expected in the absence of any interaction (80 % vs 41 % and the knock-down effect was maintained, providing an effective barrier against susceptible mosquitoes.
Value orientations of students, future nursery-school teachers: Stability or change
Directory of Open Access Journals (Sweden)
Lazarević Dušanka A.
2003-01-01
Full Text Available Results are presented of investigations on value orientations of students future nursery-school teachers, as manifested by preferences of certain lifestyles. The aim was to examine if there is stability or change in the desirability of some lifestyles in three generations of students of Higher School for Nursery-School Teacher Training. Examinations were carried out on preferences of the following lifestyles: hedonistic, utilitarian altruistic, aesthetic, orientation to power and social standing, cognitive self-realization and Promethean activism. The obtained results indicate a certain stability in student value profile throughout the study period but also certain changes. In the value profile of future nursery-school teachers self-realization emerges consistently in the examined generations as the most desirable and accepted lifestyle. Then, the tendency to gradually decline was found in aesthetic, utilitarian, cognitive, altruistic Promethean, hedonistic and orientation to power and social standing lifestyles of which the last one consistently occurred in three generations as the least desirable lifestyle. Changes were manifested in the increasing desirability of utilitarian lifestyle from the first to the third generation as well as in gradual decline of desirability degree in self realization and aesthetic lifestyles. Also, the trend of increasing agreement between lifestyle students prefer and their current lifestyle was noticeable.
Gut Microbiota Mediate Insecticide Resistance in the Diamondback Moth, Plutella xylostella (L.).
Xia, Xiaofeng; Sun, Botong; Gurr, Geoff M; Vasseur, Liette; Xue, Minqian; You, Minsheng
2018-01-01
The development of insecticide resistance in insect pests is a worldwide concern and elucidating the underlying mechanisms is critical for effective crop protection. Recent studies have indicated potential links between insect gut microbiota and insecticide resistance and these may apply to the diamondback moth, Plutella xylostella (L.), a globally and economically important pest of cruciferous crops. We isolated Enterococcus sp. (Firmicutes), Enterobacter sp. (Proteobacteria), and Serratia sp. (Proteobacteria) from the guts of P. xylostella and analyzed the effects on, and underlying mechanisms of insecticide resistance. Enterococcus sp. enhanced resistance to the widely used insecticide, chlorpyrifos, in P. xylostella , while in contrast, Serratia sp. decreased resistance and Enterobacter sp. and all strains of heat-killed bacteria had no effect. Importantly, the direct degradation of chlorpyrifos in vitro was consistent among the three strains of bacteria. We found that Enterococcus sp., vitamin C, and acetylsalicylic acid enhanced insecticide resistance in P. xylostella and had similar effects on expression of P. xylostella antimicrobial peptides. Expression of cecropin was down-regulated by the two compounds, while gloverin was up-regulated. Bacteria that were not associated with insecticide resistance induced contrasting gene expression profiles to Enterococcus sp. and the compounds. Our studies confirmed that gut bacteria play an important role in P. xylostella insecticide resistance, but the main mechanism is not direct detoxification of insecticides by gut bacteria. We also suggest that the influence of gut bacteria on insecticide resistance may depend on effects on the immune system. Our work advances understanding of the evolution of insecticide resistance in this key pest and highlights directions for research into insecticide resistance in other insect pest species.
Gut Microbiota Mediate Insecticide Resistance in the Diamondback Moth, Plutella xylostella (L.
Directory of Open Access Journals (Sweden)
Xiaofeng Xia
2018-01-01
Full Text Available The development of insecticide resistance in insect pests is a worldwide concern and elucidating the underlying mechanisms is critical for effective crop protection. Recent studies have indicated potential links between insect gut microbiota and insecticide resistance and these may apply to the diamondback moth, Plutella xylostella (L., a globally and economically important pest of cruciferous crops. We isolated Enterococcus sp. (Firmicutes, Enterobacter sp. (Proteobacteria, and Serratia sp. (Proteobacteria from the guts of P. xylostella and analyzed the effects on, and underlying mechanisms of insecticide resistance. Enterococcus sp. enhanced resistance to the widely used insecticide, chlorpyrifos, in P. xylostella, while in contrast, Serratia sp. decreased resistance and Enterobacter sp. and all strains of heat-killed bacteria had no effect. Importantly, the direct degradation of chlorpyrifos in vitro was consistent among the three strains of bacteria. We found that Enterococcus sp., vitamin C, and acetylsalicylic acid enhanced insecticide resistance in P. xylostella and had similar effects on expression of P. xylostella antimicrobial peptides. Expression of cecropin was down-regulated by the two compounds, while gloverin was up-regulated. Bacteria that were not associated with insecticide resistance induced contrasting gene expression profiles to Enterococcus sp. and the compounds. Our studies confirmed that gut bacteria play an important role in P. xylostella insecticide resistance, but the main mechanism is not direct detoxification of insecticides by gut bacteria. We also suggest that the influence of gut bacteria on insecticide resistance may depend on effects on the immune system. Our work advances understanding of the evolution of insecticide resistance in this key pest and highlights directions for research into insecticide resistance in other insect pest species.
Expression of melanin and insecticidal protein from Rhodotorula ...
African Journals Online (AJOL)
Both the salmon/red melanin and the insecticidal producing genes of Rhodotorula glutinis was successfully expressed in Escherichia coli using plasmid pZErO-1. This work suggests that in Rhodotorula species melanin and insecticidal toxin are co-expressed and therefore possibly co-evolved. Keywords: Rhodotorula ...
Brunelli, Rebecca L; Blake, Jennifer; Willits, Neil; Rommeck, Ina; McCowan, Brenda
2014-01-01
Nursery-reared infants have several behavioral and physiologic differences from their mother-reared counterparts. We investigated whether a response-contingent surrogate mitigated some of those differences by decreasing fearfulness and partner-clinging and increasing environmental exploration in nursery-reared infants continuously paired with a peer. Six nursery-reared infant rhesus macaques (in pairs) were given a mechanical responsive surrogate (RS), and 6 (in pairs) were given an identical but nonresponsive surrogate (NRS). The 2 treatment groups were compared and then combined into a single group of all 12 of surrogate-exposed animals (CS) that was compared with a nonsurrogate control group (NS) of 10 nursery-reared infants. Results showed significant differences between CS and NS infants but no significant differences between the RS and NRS infants. As compared with NS infants, CS infants showed less partner-clinging, less affiliation directed toward only partner, and more foraging and tactile–oral exploration of the environment. These advantageous effects support additional research to develop improved surrogate and the implementation of surrogate programs for nursery-reared infants. PMID:25255068
Metaflumizone is a novel sodium channel blocker insecticide.
Salgado, V L; Hayashi, J H
2007-12-15
Metaflumizone is a novel semicarbazone insecticide, derived chemically from the pyrazoline sodium channel blocker insecticides (SCBIs) discovered at Philips-Duphar in the early 1970s, but with greatly improved mammalian safety. This paper describes studies confirming that the insecticidal action of metaflumizone is due to the state-dependent blockage of sodium channels. Larvae of the moth Spodoptera eridania injected with metaflumizone became paralyzed, concomitant with blockage of all nerve activity. Furthermore, tonic firing of abdominal stretch receptor organs from Spodoptera frugiperda was blocked by metaflumizone applied in the bath, consistent with the block of voltage-dependent sodium channels. Studies on native sodium channels, in primary-cultured neurons isolated from the CNS of the larvae of the moth Manduca sexta and on Para/TipE sodium channels heterologously expressed in Xenopus (African clawed frog) oocytes, confirmed that metaflumizone blocks sodium channels by binding selectively to the slow-inactivated state, which is characteristic of the SCBIs. The results confirm that metaflumizone is a novel sodium channel blocker insecticide.
Insecticide Exposure in Parkinsonism
National Research Council Canada - National Science Library
Bloomquist, Jeffrey
2003-01-01
Behavioral, neurochemical, and immunocytochemical studies are characterizing the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and/or permethrin (PM...
Insecticides and Biological Control
Furness, G. O.
1972-01-01
Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)
Developing native plant nurseries in emerging market areas
Elliott Duemler
2012-01-01
The importance of developing a market for quality native plant materials in a region prior to the establishment of a nursery is crucial to ensure its success. Certain tactics can be applied to help develop a demand for native plant materials in a region. Using these tactics will help create a new market for native plant materials.
Provenance variability in nursery growth of subalpine fir
Charlie Cartwright; Cheng Ying
2011-01-01
Subalpine fir (Abies lasiocarpa [Hook] Nutt.) is a wide-ranging, high-elevation species in the interior of British Columbia. It is commonly harvested for lumber, but replanting of it is limited. Some reticence is based upon wood quality and rate of growth, but there are also seed and nursery culturing difficulties. This study investigated seedling growth traits of 111...
Ecotoxicity of binary mixtures of Microcystis aeruginosa and insecticides to Daphnia pulex
International Nuclear Information System (INIS)
Asselman, J.; Janssen, C.R.; Smagghe, G.; De Schamphelaere, K.A.C.
2014-01-01
In aquatic ecosystems, mixtures of chemical and natural stressors can occur which may significantly complicate risk assessment approaches. Here, we show that effects of binary combinations of four different insecticides and Microcystis aeruginosa, a toxic cyanobacteria, on Daphnia pulex exhibited distinct interaction patterns. Combinations with chlorpyrifos and tetradifon caused non-interactive effects, tebufenpyrad caused an antagonistic interaction and fenoyxcarb yielded patterns that depended on the reference model used (i.e. synergistic with independent action, additive with concentration addition). Our results demonstrate that interactive effects cannot be generalised across different insecticides, not even for those targeting the same biological pathway (i.e. tebufenpyrad and tetradifon both target oxidative phosphorylation). Also, the concentration addition reference model provided conservative predictions of effects in all investigated combinations for risk assessment. These predictions could, in absence of a full mechanistic understanding, provide a meaningful solution for managing water quality in systems impacted by both insecticides and cyanobacterial blooms. - Highlights:: • 2 of 4 insecticide-Microcystis combinations showed no interactive effect on Daphnia. • One insecticide showed antagonistic deviation patterns. • For one other insecticide the results depended on the reference model used. • Interactive effects between insecticides and Microcystis cannot be generalized. • The concentration addition model provides conservative estimates of mixture effects. - Interactive effects between insecticides and cyanobacterial stressors cannot be generalized, not even for insecticides with closely related known modes of action
Oxborough, Richard M; N'Guessan, Raphael; Jones, Rebecca; Kitau, Jovin; Ngufor, Corine; Malone, David; Mosha, Franklin W; Rowland, Mark W
2015-03-24
The rapid selection of pyrethroid resistance throughout sub-Saharan Africa is a serious threat to malaria vector control. Chlorfenapyr is a pyrrole insecticide which shows no cross resistance to insecticide classes normally used for vector control and is effective on mosquito nets under experimental hut conditions. Unlike neurotoxic insecticides, chlorfenapyr owes its toxicity to disruption of metabolic pathways in mitochondria that enable cellular respiration. A series of experiments explored whether standard World Health Organization (WHO) guidelines for evaluation of long-lasting insecticidal nets, developed through testing of pyrethroid insecticides, are suitable for evaluation of non-neurotoxic insecticides. The efficacy of WHO recommended cone, cylinder and tunnel tests was compared for pyrethroids and chlorfenapyr. To establish bioassay exposure times predictive of insecticide-treated net (ITN) efficacy in experimental hut trials, standard three-minute bioassays of pyrethroid and chlorfenapyr ITNs were compared with longer exposures. Mosquito behaviour and response to chlorfenapyr ITN in bioassays conducted at night were compared to day and across a range of temperatures representative of highland and lowland transmission. Standard three-minute bioassay of chlorfenapyr produced extremely low levels of mortality compared to pyrethroids. Thirty-minute day-time bioassay produced mortality closer to hut efficacy of chlorfenapyr ITN but still fell short of the WHO threshold. Overnight tunnel test with chlorfenapyr produced 100% mortality and exceeded the WHO threshold of 80%. The endogenous circadian activity rhythm of anophelines results in inactivity by day and raised metabolism and flight activity by night. A model which explains improved toxicity of chlorfenapyr ITN when tested at night, and during the day at higher ambient temperature, is that activation of chlorfenapyr and disruption of respiratory pathways is enhanced when the insect is more metabolically
Directory of Open Access Journals (Sweden)
Richard J. Lilley
2014-12-01
Full Text Available The Atlantic cod (Gadus morhua is a species of significant economic and historic importance but infamous for its decline. Apart from overfishing, the causes of this decline and its subsequent lack of recovery remain largely unresolved. Indeed, the degree to which specific habitats are important for this species remains unquantified at the scale of North Atlantic. Here, the literature on the role of eelgrass meadows (Zostera marina as valuable nursery habitat for the Atlantic cod is reviewed and synthesized. Evidence is presented on relative densities of Atlantic cod in shallow water environments and in eelgrass meadows in comparison to alternative habitats. In addition, evidence pertaining to the ’viability gains’ attributed to the use of eelgrass meadows as nursery habitat (growth and survival by juvenile Atlantic cod is analyzed. Although juvenile Atlantic cod use of Z. marina is found to be facultative, when possible, available literatures indicates that they may select Z. marina as a nursery habitat where they are found in high density (average of at least 246 ha−1. From their use of Z. marina habitat the juvenile Atlantic cod receives viability benefits from it, improving their chances of reaching maturation. This paper provides strong evidence that eelgrass meadows are of significant importance to contributing to Atlantic cod stocks. Keywords: Zostera marina, Eelgrass, Gadus morhua, Fisheries, Juveniles, Nursery habitat
Field and Laboratory Evaluations of Insecticides for Southern Pine Beetle Control
Felton L. Hastings; Jack E. Coster; [Editors
1981-01-01
Reports results of laboratory screenings and field studies of insecticides for use against the southern pine beetle. Preventive as webas remedial efficacywere observed, along with phytotoxicity to pine and understory hardwood species, effects of insecticides on soil microbial and mesofaunal populations, and degradation of insecticides by selected soil microbes.
Forsgren, Kristy L; Riar, Navneet; Schlenk, Daniel
2013-06-01
The San Francisco Bay Estuary and Sacramento-San Joaquin Delta (Bay-Delta) is an important breeding and nursery ground for fish. Of particular interest are salmonids that migrate through fresh and saltwater areas polluted with various contaminants including bifenthrin, a widely used pyrethroid insecticide. Male steelhead (Oncorhynchus mykiss) exposed to bifenthrin (0.1 and 1.5μg/L) for two weeks had a lower gonadosomatic index (GSI) in freshwater but were not affected by concurrent bifenthrin exposure and saltwater acclimation. Plasma estradiol-17β (E2) levels and ovarian follicle diameter of fish exposed to bifenthrin (0.1 and 1.5μg/L) in freshwater significantly increased. Under hypersaline conditions, fish exposed to bifenthrin had significantly reduced E2 levels and smaller follicles, and unhealthy ovarian follicles were observed. Given the occurrence of bifenthrin in surface waters of the Bay Delta, understanding the impact of bifenthrin on wildlife is necessary for improving risk assessments of pyrethroids in this important ecosystem. Copyright © 2013 Elsevier Inc. All rights reserved.
African Journals Online (AJOL)
Administrator
500,000 metric tonnes in the 1964/1965 season. Problems ... insecticides on the open market. ... effective in the management of insect pests of cocoa. .... Effectiveness and profitability of pest ... Youth in Agriculture; Programme Policy, Strategy.
Toe, Adama M; Ilboudo, Sylvain; Ouedraogo, Moustapha; Guissou, Pierre I
2012-03-01
Occupationally exposed workers, farm workers and plant protection agents in the Sahel region of Burkina Faso were interviewed to assess adverse health effects of insecticides. The subjects were also examined for changes in both hematological and biochemical parameters. The prevalence of liver and kidney dysfunction was found to be quite high among insecticide applicators, especially among plant protection agents. The prevalence of biochemical alterations seems to be correlated to the frequency of insecticide use. However, no significant differences were found between the hematological parameters among farm workers and plant protection agents. The hematological parameters of all the insecticide applicators were normal. The great majority of insecticide applicators (85%) reported symptoms related to insecticide exposure. The use of insecticides in the agriculture of Burkina Faso is threatening to human health.
Naik, P K; Singh, T; Singh, H
2009-07-01
Quantitative structure-activity relationship (QSAR) analyses were performed independently on data sets belonging to two groups of insecticides, namely the organophosphates and carbamates. Several types of descriptors including topological, spatial, thermodynamic, information content, lead likeness and E-state indices were used to derive quantitative relationships between insecticide activities and structural properties of chemicals. A systematic search approach based on missing value, zero value, simple correlation and multi-collinearity tests as well as the use of a genetic algorithm allowed the optimal selection of the descriptors used to generate the models. The QSAR models developed for both organophosphate and carbamate groups revealed good predictability with r(2) values of 0.949 and 0.838 as well as [image omitted] values of 0.890 and 0.765, respectively. In addition, a linear correlation was observed between the predicted and experimental LD(50) values for the test set data with r(2) of 0.871 and 0.788 for both the organophosphate and carbamate groups, indicating that the prediction accuracy of the QSAR models was acceptable. The models were also tested successfully from external validation criteria. QSAR models developed in this study should help further design of novel potent insecticides.
Nursery Pest Management of Phytolyma lata Walker (Scott) Attack ...
African Journals Online (AJOL)
The establishment of plantations of Milicia excelsa has been constrained by the gall-forming psyllid Phytolyma lata Walker (Scott) that causes extensive damage to young plants. We present findings of an experiment aimed at preventing Phytolyma attack on Milicia seedlings in the nursery using chemical control and ...
Nursery Rhyme Knowledge and Phonological Awareness in Preschool Children
Harper, Laurie J.
2011-01-01
Phonological awareness is an important precursor in learning to read. This awareness of phonemes fosters a child's ability to hear and blend sounds, encode and decode words, and to spell phonetically. This quantitative study assessed pre-K children's existing Euro-American nursery rhyme knowledge and phonological awareness literacy, provided…
Ecotoxicological study of insecticide effects on arthropods in common bean.
de Barros, Emerson Cristi; Ventura, Hudson Vaner; Gontijo, Pablo Costa; Pereira, Renata Ramos; Picanço, Marcelo Coutinho
2015-01-01
Arthropods are an important group of macroorganisms that work to maintain ecosystem health. Despite the agricultural benefits of chemical control against arthropod pests, insecticides can cause environmental damage. We examined the effects of one and two applications of the insecticides chlorfenapyr (0.18 liters a.i. ha-1) and methamidophos (0.45 liters a.i. ha-1), both independently and in combination, on arthropods in plots of common bean. The experiment was repeated for two growing seasons. Principal response curve, richness estimator, and Shannon-Wiener diversity index analyses were performed. The insecticides generally affected the frequency, richness, diversity, and relative abundance of the arthropods. In addition, the arthropods did not experience recovery after the insecticide applications. The results suggest that the insecticide impacts were sufficiently drastic to eliminate many taxa from the studied common bean plots. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.
Evaluation of the Insecticidal Efficacy of Wild Type and Recombinant Baculoviruses.
Popham, Holly J R; Ellersieck, Mark R; Li, Huarong; Bonning, Bryony C
2016-01-01
A considerable amount of work has been undertaken to genetically enhance the efficacy of baculovirus insecticides. Following construction of a genetically altered baculovirus, laboratory bioassays are used to quantify various parameters of insecticidal activity such as the median lethal concentration (or dose) required to kill 50 % of infected larvae (LC50 or LD50), median survival of larvae infected (ST50), and feeding damage incurred by infected larvae. In this chapter, protocols are described for a variety of bioassays and the corresponding data analyses for assessment of the insecticidal activity of baculovirus insecticides.
Directory of Open Access Journals (Sweden)
Hossein Haratipour
2016-02-01
Full Text Available Background Abnormalities of external genitalia in male children nurseries and inguinal hernia are the most common congenital disorders in children. We aimed to determine prevalence rate of inguinal hernia and other genital among children nurseries, in Shahrood-Iran. Materials and Methods In this descriptive cross-sectional study, we examined 920 children nurseries boys. Physical examination of children was performed in presence of a parent in a warm room in supine and upright position with and without Valsalva maneuver. A written consent was obtained from parents before examination. Past medical history and history of surgery on inguinal and genital area was taken. Examination was performed 2 interns who were trained about genital system examination. Results A total of 920 children nurseries boys aged 3 to 6 years were examined which were detected in 88 children and prevalence rate of these abnormalities were 9.6%. The prevalence of abnormalities in the children under study were as follows: Inguinal hernia (5.1%, cryptorchidism (2.1%, Hydrocele (1.5%, hypospadias (0.4%, Varicocele (0.1%, micropenis (0.4%. Conclusion Regarding to relatively high prevalence rate of these abnormalities and low level of people knowledge, seem screening systems for diagnosis and appropriate treatment of these abnormalities to be necessary.
Guide to testing insecticides on coniferous forest defoliators
Carroll B Jr. Williams; David A. Sharpnack; Liz Maxwell; Patrick J. Shea; Mark D. McGregor
1985-01-01
This report provides a guide to techniques for designing field tests of candidate insecticides, and for carrying out pilot tests and control projects. It describes experimental designs for testing hypotheses, and for sampling trees to estimate insect population densities and percent reduction after treatments. Directions for applying insecticides by aircraft and for...
Insecticide resistance, control failure likelihood and the First Law of Geography.
Guedes, Raul Narciso C
2017-03-01
Insecticide resistance is a broadly recognized ecological backlash resulting from insecticide use and is widely reported among arthropod pest species with well-recognized underlying mechanisms and consequences. Nonetheless, insecticide resistance is the subject of evolving conceptual views that introduces a different concept useful if recognized in its own right - the risk or likelihood of control failure. Here we suggest an experimental approach to assess the likelihood of control failure of an insecticide allowing for consistent decision-making regarding management of insecticide resistance. We also challenge the current emphasis on limited spatial sampling of arthropod populations for resistance diagnosis in favor of comprehensive spatial sampling. This necessarily requires larger population sampling - aiming to use spatial analysis in area-wide surveys - to recognize focal points of insecticide resistance and/or control failure that will better direct management efforts. The continuous geographical scale of such surveys will depend on the arthropod pest species, the pattern of insecticide use and many other potential factors. Regardless, distance dependence among sampling sites should still hold, following the maxim that the closer two things are, the more they resemble each other, which is the basis of Tobler's First Law of Geography. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives
Directory of Open Access Journals (Sweden)
Jialong Sun
2015-03-01
Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.
Insect P450 inhibitors and insecticides: challenges and opportunities.
Feyereisen, René
2015-06-01
P450 enzymes are encoded by a large number of genes in insects, often over a hundred. They play important roles in insecticide metabolism and resistance, and growing numbers of P450 enzymes are now known to catalyse important physiological reactions, such as hormone metabolism or cuticular hydrocarbon synthesis. Ways to inhibit P450 enzymes specifically or less specifically are well understood, as P450 inhibitors are found as drugs, as fungicides, as plant growth regulators and as insecticide synergists. Yet there are no P450 inhibitors as insecticides on the market. As new modes of action are constantly needed to support insecticide resistance management, P450 inhibitors should be considered because of their high potential for insect selectivity, their well-known mechanisms of action and the increasing ease of rational design and testing. © 2014 Society of Chemical Industry.
Promotion of Preventive Measures in Public Nursery Schools: Lessons From the H1N1 Pandemic.
Michail, Koralia A; Ioannidou, Christina; Galanis, Petros; Tsoumakas, Kostantinos; Pavlopoulou, Ioanna D
2017-09-01
Nursery schools serve as reservoirs of transmission of infectious diseases, and teachers should be able to implement and monitor hygiene measures to prevent them. The aim of the present study was to assess the compliance of nursery school teachers on promoting preventive interventions and to identify associated factors, during the novel H1N1 influenza pandemic. A secondary objective was to evaluate their knowledge and vaccination status regarding the novel virus. A cross-sectional study was performed, with the use of a predesigned anonymous, questionnaire, and distributed to all public nursery teachers of Athens, Greece. General etiquette practices were highly acceptable to over 92% of teachers. Those with longer teaching experience promoted simple preventive measures, such as hand washing and use of hand sanitizer, more often while older children were more likely to familiarize with them. However, teachers presented inadequate knowledge concerning the novel virus and their vaccination rates with the pandemic vaccine were unacceptably low (1.1%). Our study showed that promotion of simple preventive measures is feasible and may contribute to the prevention of outbreaks in nursery schools, although knowledge gaps and fear concerning the pandemic vaccine highlight communication issues.
Kleinschmidt, Immo; Bradley, John; Knox, Tessa Bellamy; Mnzava, Abraham Peter; Kafy, Hmooda Toto; Mbogo, Charles; Ismail, Bashir Adam; Bigoga, Jude D; Adechoubou, Alioun; Raghavendra, Kamaraju; Cook, Jackie; Malik, Elfatih M; Nkuni, Zinga José; Macdonald, Michael; Bayoh, Nabie; Ochomo, Eric; Fondjo, Etienne; Awono-Ambene, Herman Parfait; Etang, Josiane; Akogbeto, Martin; Bhatt, Rajendra M; Chourasia, Mehul Kumar; Swain, Dipak K; Kinyari, Teresa; Subramaniam, Krishanthi; Massougbodji, Achille; Okê-Sopoh, Mariam; Ogouyemi-Hounto, Aurore; Kouambeng, Celestin; Abdin, Mujahid Sheikhedin; West, Philippa; Elmardi, Khalid; Cornelie, Sylvie; Corbel, Vincent; Valecha, Neena; Mathenge, Evan; Kamau, Luna; Lines, Jonathan; Donnelly, Martin James
2018-04-09
Scale-up of insecticide-based interventions has averted more than 500 million malaria cases since 2000. Increasing insecticide resistance could herald a rebound in disease and mortality. We aimed to investigate whether insecticide resistance was associated with loss of effectiveness of long-lasting insecticidal nets and increased malaria disease burden. This WHO-coordinated, prospective, observational cohort study was done at 279 clusters (villages or groups of villages in which phenotypic resistance was measurable) in Benin, Cameroon, India, Kenya, and Sudan. Pyrethroid long-lasting insecticidal nets were the principal form of malaria vector control in all study areas; in Sudan this approach was supplemented by indoor residual spraying. Cohorts of children from randomly selected households in each cluster were recruited and followed up by community health workers to measure incidence of clinical malaria and prevalence of infection. Mosquitoes were assessed for susceptibility to pyrethroids using the standard WHO bioassay test. Country-specific results were combined using meta-analysis. Between June 2, 2012, and Nov 4, 2016, 40 000 children were enrolled and assessed for clinical incidence during 1·4 million follow-up visits. 80 000 mosquitoes were assessed for insecticide resistance. Long-lasting insecticidal net users had lower infection prevalence (adjusted odds ratio [OR] 0·63, 95% CI 0·51-0·78) and disease incidence (adjusted rate ratio [RR] 0·62, 0·41-0·94) than did non-users across a range of resistance levels. We found no evidence of an association between insecticide resistance and infection prevalence (adjusted OR 0·86, 0·70-1·06) or incidence (adjusted RR 0·89, 0·72-1·10). Users of nets, although significantly better protected than non-users, were nevertheless subject to high malaria infection risk (ranging from an average incidence in net users of 0·023, [95% CI 0·016-0·033] per person-year in India, to 0·80 [0·65-0·97] per person
Synthesis and Insecticidal Activities of New Ester-Derivatives of Celangulin-V
Directory of Open Access Journals (Sweden)
Wenjun Wu
2011-12-01
Full Text Available In order to develop new biorational pesticides, ten new 6-substituted ester derivatives of Celangulin-V were designed and synthesized. The structures of the new derivatives were confirmed by IR, 1H-NMR, 13C-NMR and ESI-MS spectral analysis. Insecticidal activities of these compounds were tested against the third-instar larvae of Mythimna separata. Two derivatives (1.1, 1.2 showed higher insecticidal activities than Celangulin-V, with mortality of 75.0% and 83.3%, respectively. While four compounds (1.3, 1.4, 1.7, 1.8 denoted lower insecticidal activities, the others (1.5, 1.6, 1.9, 1.10 revealed no activities at a concentration of 10 mg.mL−1. The results suggest that C-6 substitutions of Celangulin-V are very important in determining the insecticidal activities of its ester-derivatives. That the acetyl (1.1 and propionyl (1.2 derivatives possessed much higher insecticidal activities than Celangulin-V itself supported the view that Celangulin-V has the potential to be a lead structure of semi-synthetic green insecticides.
Nursery growing of some apple varieties using different grafting ...
African Journals Online (AJOL)
This study was carried out at the Eğirdir Horticultural Research Institute, between the years 2006 and 2007. The aim of this study was to investigate the advantages of apple nursery growing greenhouse rather than outdoor medium. Scions of Red Chief (dwarf), Braeburn (semi dwarf) and Mondial Gala (vigorous) apple ...
Early selection of Eucalyptus clones in retrospective nursery test ...
African Journals Online (AJOL)
Within the framework of the eucalyptus breeding programme in the Congo, two retrospective tests were conducted using mature clones in the field and young cuttings under nursery conditions with two hybrids: 13 clones of Eucalyptus tereticornis* Eucalyptus grandis for the test TC 82-1B and 17 clones of Eucalyptus ...
Growing Shrubs at the George O. White State Forest Nursery: What Has Worked and What Has Not
Gregory Hoss
2006-01-01
At the George O. White State Forest Nursery in Licking, MO, we annually grow about 20 species of shrubs. That number has been larger in some years. For most species, we purchase seeds locally and process them at our nursery. Our shrubs are used for wetland restoration, windbreaks, visual screens, riparian buffers, and wildlife plantings.
Durmusoglu-Saltali, Neslihan; Arslan, Emel
2011-01-01
The purpose of this study is for the emotional skills of six-year-old children attending nursery school according to some variables. The participants were 306 (135 girls and 171 boys) six-year-old children attending nursery school. Data were collected from Assessment of Children's Emotional Skills and personal information form. In order to analyze…
Sousa, Nadine R; Franco, Albina R; Oliveira, Rui S; Castro, Paula M L
2012-03-01
Addition of fertilisers is a common practice in nursery production of conifer seedlings. The aim of this study was to evaluate whether ectomycorrhizal (ECM) fungi can be an alternative to the use of chemical fertilisers in the nursery production of Pinus pinaster. A greenhouse nursery experiment was conducted by inoculating seedlings obtained from seeds of P. pinaster plus trees with a range of compatible ECM fungi: (1) Thelephora terrestris, (2) Rhizopogon vulgaris, (3) a mixture of Pisolithus tinctorius and Scleroderma citrinum, and (4) a mixture of Suillus bovinus, Laccaria laccata and Lactarius deterrimus, using forest soil as substrate. Plant development was assessed at two levels of N-P-K fertiliser (0 or 600 mg/seedling). Inoculation with a mixture of mycelium from S. bovinus, L. laccata and L. deterrimus and with a mixture of spores of P. tinctorius and S. citrinum improved plant growth and nutrition, without the need of fertiliser. Results indicate that selected ECM fungi can be a beneficial biotechnological tool in nursery production of P. pinaster. Copyright © 2010 Elsevier Ltd. All rights reserved.
Morphological and photosynthetic adaptations of Tabebuia aurea seedlings in the nursery
Directory of Open Access Journals (Sweden)
Eduardo R Gonçalves
2013-11-01
Full Text Available Tabebuia aurea (Benth. & Hook. f. ex S. Moore (Bignoniaceae is a boreal species common in Brazil. It is used for ornamental parks and along sidewalks. Its timber is also used for furniture. The objective of this study was to evaluate the effect of nursery shading on the growth and photosynthesis of T. aurea and their photosynthetic adaptation after being transferred to direct sunlight. The T. aurea seedlings were grown under 0, 50, 70 or 95% shade. The photosynthetic active radiation and leaf gas exchange were measured over two distinct periods: 51 (young seedlings and 70 days after having been sown under each shade treatment. Immediately after the measurements were taken, the seedlings were transferred into full sunlight and the measurements were repeated two times after 15 min and 3 days under ambient sunlight. T. aurea seedlings showed satisfactory growth up to 50% shade in the nursery, which could be verified both by growth measurement and by total biomass accumulation. Shading greater than 70% reduced the number of leaves, the leaf area and the stem diameter in relation to plants exposed to full sunlight. The results suggest that T. aurea seedlings should be grown under full sunlight or under shading up to 50% to maximize their growth in the nursery and to minimize stress when transferring the seedlings to their final planting sites.
Xu, Zhiping; Shi, Lina; Jiang, Danping; Cheng, Jiagao; Shao, Xusheng; Li, Zhong
2015-10-01
Incorporating the photoisomerizable azobenzene into imidacloprid produced a photoswitchable insecticidal molecule as the first neonicotinoid example of remote control insecticide performance with spatiotemporal resolution. The designed photoswitchable insecticides showed distinguishable activity against Musca both in vivo and in vitro upon irradiation. Molecular docking study further suggested the binding difference of the two photoisomers. The generation of these photomediated insecticides provides novel insight into the insecticidal activity facilitating further investigation on the functions of insect nicotinic acetylcholine receptors and opens a novel way to control and study insect behavior on insecticide poisoning using light.
Characterizing the insecticide resistance of Anopheles gambiae in Mali.
Cisse, Moussa B M; Keita, Chitan; Dicko, Abdourhamane; Dengela, Dereje; Coleman, Jane; Lucas, Bradford; Mihigo, Jules; Sadou, Aboubacar; Belemvire, Allison; George, Kristen; Fornadel, Christen; Beach, Raymond
2015-08-22
The impact of indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs), key components of the national malaria control strategy of Mali, is threatened by vector insecticide resistance. The objective of this study was to assess the level of insecticide resistance in Anopheles gambiae sensu lato populations from Mali against four classes of insecticide recommended for IRS: organochlorines (OCs), pyrethroids (PYs), carbamates (CAs) and organophosphates (OPs). Characterization of resistance was done in 13 sites across southern Mali and assessed presence and distribution of physiological mechanisms that included target-site modifications: knockdown resistance (kdr) and altered acetycholinesterase (AChE), and/or metabolic mechanisms: elevated esterases, glutathione S-transferases (GSTs), and monooxygenases. The World Health Organization (WHO) tube test was used to determine phenotypic resistance of An. gambiae s.l. to: dichlorodiphenyltrichloroethane (DDT) (OC), deltamethrin (PY), lambda-cyhalothrin (PY), bendiocarb (CA), and fenitrothion (OP). Identification of sibling species and presence of the ace-1 (R) and Leu-Phe kdr, resistance-associated mutations, were determined using polymerase chain reaction (PCR) technology. Biochemical assays were conducted to detect increased activity of GSTs, oxidases and esterases. Populations tested showed high levels of resistance to DDT in all 13 sites, as well as increased resistance to deltamethrin and lambda-cyhalothrin in 12 out of 13 sites. Resistance to fenitrothion and bendiocarb was detected in 1 and 4 out of 13 sites, respectively. Anopheles coluzzii, An. gambiae sensu stricto and Anopheles arabiensis were identified with high allelic frequencies of kdr in all sites where each of the species were found (13, 12 and 10 sites, respectively). Relatively low allelic frequencies of ace-1 (R) were detected in four sites where this assessment was conducted. Evidence of elevated insecticide metabolism, based on oxidase
Stehle, Sebastian; Knäbel, Anja; Schulz, Ralf
2013-08-01
Due to the specific modes of action and application patterns of agricultural insecticides, the insecticide exposure of agricultural surface waters is characterized by infrequent and short-term insecticide concentration peaks of high ecotoxicological relevance with implications for both monitoring and risk assessment. Here, we apply several fixed-interval strategies and an event-based sampling strategy to two generalized and two realistic insecticide exposure patterns for typical agricultural streams derived from FOCUS exposure modeling using Monte Carlo simulations. Sampling based on regular intervals was found to be inadequate for the detection of transient insecticide concentrations, whereas event-triggered sampling successfully detected all exposure incidences at substantially lower analytical costs. Our study proves that probabilistic risk assessment (PRA) concepts in their present forms are not appropriate for a thorough evaluation of insecticide exposure. Despite claims that the PRA approach uses all available data to assess exposure and enhances risk assessment realism, we demonstrate that this concept is severely biased by the amount of insecticide concentrations below detection limits and therefore by the sampling designs. Moreover, actual insecticide exposure is of almost no relevance for PRA threshold level exceedance frequencies and consequential risk assessment outcomes. Therefore, we propose a concept that features a field-relevant ecological risk analysis of agricultural insecticide surface water exposure. Our study quantifies for the first time the environmental and economic consequences of inappropriate monitoring and risk assessment concepts used for the evaluation of short-term peak surface water pollutants such as insecticides.
Cosgrove, Kim; Norris-Shortle, Carole
2015-01-01
The development of babies whose families are homeless can easily be affected by their uncertain living arrangements. The PACT Therapeutic Nursery's attachment-based, trauma-informed, mindfully focused family interventions help these children and families move beyond the trauma of shelter living. In the past year, Nursery clinicians have infused…
Compost and vermicompost as nursery pot components: effects on tomato plant growth and morphology
Energy Technology Data Exchange (ETDEWEB)
Lazcano, C.; Arnold, J.; Tato, A.; Zaller, J. G.; Dominguez, J.
2009-07-01
Abstract Post transplant success after nursery stage is strongly influenced by plant morphology. Cultural practices strongly shape plant morphology, and substrate choice is one of the most determining factors. Peat is the most often used amendment in commercial potting substrates, involving the exploitation of non-renewable resources and the degradation of highly valuable peatland ecosystems and therefore alternative substrates are required. Here the feasibility of replacing peat by compost or vermicompost for the production of tomato plants in nurseries was investigated through the study of the effect of increasing proportions of these substrates (0%, 10%, 20%, 50%, 75% and 100%) in target plant growth and morphological features, indicators of adequate post-transplant growth and yield. Compost and vermicompost showed to be adequate substrates for tomato plant growth. Total replacement of peat by vermicompost was possible while doses of compost higher than 50% caused plant mortality. Low doses of compost (10 and 20%) and high doses of vermicompost produced significant increases in aerial and root biomass of the tomato plants. In addition these treatments improved significantly plant morphology (higher number of leaves and leaf area, and increased root volume and branching). The use of compost and vermicompost constitute an attractive alternative to the use of peat in plant nurseries due to the environmental benefits involved but also due to the observed improvement in plant quality. Additional key words: peat moss, plant nursery, soil-less substrate, Solanum lycopersicum L. (Author) 37 refs.
Synthesis of ectomycorrhizae on northern red oak seedlings in a Michigan nursery
Energy Technology Data Exchange (ETDEWEB)
Dixon, R.K.; Johnson, P.S.
1993-01-01
Vegetative inoculum of the ectomycorrhizal fungus Suillus luteus was thoroughly mixed into fumigated nursery soil, and northern red oak seedlings of four families were evaluated one and two years after sowing for ectomycorrhizal development, growth, and nutrition. At the end of year one, treated seedlings were successfully inoculated with S. luteus, but the percentage varied significantly with family. Suillus luteus persisted on lateral roots two years following sowing. Two of four seedling families inoculated with S. luteus were significantly larger in size than control plants. These results suggest that the fungal symbiont S. luteus can be successfully introduced into nurseries and that early ectomycorrhizal development improves the growth of northern red oak seedlings.
Occurrence of soil-transmitted helminths on playgrounds of nursery ...
African Journals Online (AJOL)
STHs are prevalent on play grounds of nursery and primary schools in Plateau State. Improved hygiene and sanitation, fencing of school premises and the regulation of school population will help to reduce environmental contamination and human infections. Présence d'helminthes transmis par le sol sur les terrains de jeux ...
Scopece, Giovanni; Campese, Lucia; Duffy, Karl J; Cozzolino, Salvatore
2018-02-01
Plants involved in specialized pollinator interactions, such as nursery pollination, may experience trade-offs in their female fitness, as the larvae of their pollinators may also consume seeds produced by the flowers they pollinate. These interactions could potentially shift between mutualism and parasitism, depending on the presence and abundance of both the nursery pollinator and of other pollinators. We investigated the fitness trade-off in a Mediterranean plant ( Silene latifolia ), which has a specialist nocturnal nursery pollinator moth ( Hadena bicruris ) and is also visited by several diurnal pollinators. We estimated the pollination rates and fecundity of S. latifolia in both natural and experimental populations in the Mediterranean. We estimated natural pollination rates in different flowering times and with presence/absence of the H. bicruis moth. Then by exposing plants to each pollinator group either during the day or at night, we quantified the contribution of other diurnal pollinators and the specialized nocturnal nursery pollinator to plant female fitness. We found no difference in plant fruit set mediated by diurnal versus nocturnal pollinators, indicating that non-specialist pollinators contribute to plant female fitness. However, in both natural and experimental populations, H. bicruris was the most efficient pollinator in terms of seeds produced per fruit. These results suggest that the female fitness costs generated by nursery pollination can be overcome through higher fertilization rates relative to predation rates, even in the presence of co-pollinators. Quantifying such interactions is important for our understanding of the selective pressures that promote highly specialized mutualisms, such as nursery pollination, in the Mediterranean region, a centre of diversification of the carnation family.
The impact of insecticides to local honey bee colony Apis cerana indica in laboratory condition
Putra, Ramadhani E.; Permana, Agus D.; Nuriyah, Syayidah
2014-03-01
Heavy use of insecticides considered as one of common practice at local farming systems. Even though many Indonesian researchers had stated the possible detrimental effect of insecticide on agriculture environment and biodiversity, researches on this subject had been neglected. Therefore, our purpose in this research is observing the impact of insecticides usage by farmer to non target organisme like local honey bee (Apis cerana indica), which commonly kept in area near agriculture system. This research consisted of field observations out at Ciburial, Dago Pakar, Bandung and laboratory tests at School of Life Sciences and Technology, Institut Teknologi Bandung. The field observations recorded visited agriculture corps and types of pollen carried by bees to the nest while laboratory test recorderd the effect of common insecticide to mortality and behavior of honey bees. Three types of insecticides used in this research were insecticides A with active agent Chlorantraniliprol 50 g/l, insecticide B with active agent Profenofos 500 g/l, and insecticides C with active agent Chlorantraniliprol 100 g/l and λ-cyhalotrin 50g/l. The results show that during one week visit, wild flower, Wedelia montana, visited by most honey bees with average visit 60 honey bees followed by corn, Zea mays, with 21 honey bees. The most pollen carried by foragers was Wedelia montana, Calliandra callothyrsus, and Zea mays. Preference test show that honeybees tend move to flowers without insecticides as the preference to insecticides A was 12.5%, insecticides B was 0%, and insecticides was C 4.2%. Mortality test showed that insecticides A has LD50 value 0.01 μg/μl, insecticide B 0.31 μg/μl, and insecticides C 0.09 μg/μl which much lower than suggested dosage recommended by insecticides producer. This research conclude that the use of insecticide could lower the pollination service provide by honey bee due to low visitation rate to flowers and mortality of foraging bees.
Insights from agriculture for the management of insecticide resistance in disease vectors.
Sternberg, Eleanore D; Thomas, Matthew B
2018-04-01
Key to contemporary management of diseases such as malaria, dengue, and filariasis is control of the insect vectors responsible for transmission. Insecticide-based interventions have contributed to declines in disease burdens in many areas, but this progress could be threatened by the emergence of insecticide resistance in vector populations. Insecticide resistance is likewise a major concern in agriculture, where insect pests can cause substantial yield losses. Here, we explore overlaps between understanding and managing insecticide resistance in agriculture and in public health. We have used the Global Plan for Insecticide Resistance Management in malaria vectors, developed under the auspices of the World Health Organization Global Malaria Program, as a framework for this exploration because it serves as one of the few cohesive documents for managing a global insecticide resistance crisis. Generally, this comparison highlights some fundamental differences between insect control in agriculture and in public health. Moreover, we emphasize that the success of insecticide resistance management strategies is strongly dependent on the biological specifics of each system. We suggest that the biological, operational, and regulatory differences between agriculture and public health limit the wholesale transfer of knowledge and practices from one system to the other. Nonetheless, there are some valuable insights from agriculture that could assist in advancing the existing Global Plan for Insecticide Resistance Management framework.
Insecticide use in hybrid onion seed production affects pre- and postpollination processes.
Gillespie, Sandra; Long, Rachael; Seitz, Nicola; Williams, Neal
2014-02-01
Research on threats to pollination service in agro-ecosystems has focused primarily on the negative impacts of land use change and agricultural practices such as insecticide use on pollinator populations. Insecticide use could also affect the pollination process, through nonlethal impacts on pollinator attraction and postpollination processes such as pollen viability or pollen tube growth. Hybrid onion seed (Allium cepa L., Alliaceae) is an important pollinator-dependent crop that has suffered yield declines in California, concurrent with increased insecticide use. Field studies suggest that insecticide use reduces pollination service in this system. We conducted a field experiment manipulating insecticide use to examine the impacts of insecticides on 1) pollinator attraction, 2) pollen/stigma interactions, and 3) seed set and seed quality. Select insecticides had negative impacts on pollinator attraction and pollen/stigma interactions, with certain products dramatically reducing pollen germination and pollen tube growth. Decreased pollen germination was not associated with reduced seed set; however, reduced pollinator attraction was associated with lower seed set and seed quality, for one of the two female lines examined. Our results highlight the importance of pesticide effects on the pollination process. Overuse may lead to yield reductions through impacts on pollinator behavior and postpollination processes. Overall, in hybrid onion seed production, moderation in insecticide use is advised when controlling onion thrips, Thrips tabaci, on commercial fields.
Assessment of the BTEX concentrations and health risk in urban nursery schools in Gliwice, Poland
Directory of Open Access Journals (Sweden)
Anna Mainka
2016-12-01
Full Text Available Indoor air quality (IAQ in nursery school is believed to be different from elementary school. Moreover, younger children are more vulnerable to air pollution than higher grade children because they spend more time indoors, and their immune systems and bodies are less mature. The purpose of this study was to compare the concentrations of the monoaromatic volatile benzene, toluene, ethylbenzene m,p-xylene and o-xylene (BTEX in urban nursery schools located in Gliwice, Poland. The nursery schools were chosen to include areas with different urbanization and traffic density characteristics in order to gather a more diverse picture of exposure risks in the various regions of the city. BTEX were sampled during winter and spring seasons in older and younger children classrooms. The samples were thermally desorbed (TD and then analyzed with use of gas chromatography (GC. In addition, outdoor measurements were carried out in the playground at each nursery school. BTEX quantification, indoor/outdoor concentration, and correlation coefficients were used to identify pollutant sources. Elevated levels of o-xylene and ethylbenzene were found in all monitored classrooms during the winter season. Outdoor concentrations were lower than indoors for each classroom. Indicators based on health risk assessment for chronic health effects associated with carcinogenic benzene or non-carcinogenic BTEX were proposed to rank sites according to their hazard level.
Light-emitting diode lighting for forest nursery seedling production
R. Kasten Dumroese; Jeremiah R. Pinto; Anthony S. Davis
2015-01-01
Crop lighting is an energy-intensive necessity for nursery production of high-quality native plants and forest tree seedlings. During the winter months (especially in northern USA latitudes) or overcast or cloudy days, the amount of solar radiation reaching greenhouse crops is insufficient resulting in growth cessation, early terminal bud formation, and failure of...
Posttreatment Feeding Affects Mortality of Bed Bugs (Hemiptera: Cimicidae) Exposed to Insecticides.
Singh, Narinderpal; Wang, Changlu; Cooper, Richard
2016-02-01
Insecticide sprays and dusts are used for controlling bed bugs, Cimex lectularius L. In natural environments, bed bugs have daily access to hosts after they are exposed to insecticides. The established laboratory insecticide bioassay protocols do not provide feeding after insecticide treatments, which can result in inflated mortality compared with what would be encountered in the field. We evaluated the effect of posttreatment feeding on mortality of bed bugs treated with different insecticides. None of the insecticides tested had a significant effect on the amount of blood consumed and percent feeding. The effect of posttreatment feeding on bed bug mortality varied among different insecticides. Feeding significantly reduced mortality in bed bugs exposed to deltamethrin spray, an essential oil mixture (Bed Bug Fix) spray, and diatomaceous earth dust. Feeding increased the mean survival time for bed bugs treated with chlorfenapyr spray and a spray containing an essential oil mixture (Ecoraider), but did not affect the final mortality. First instars hatched from eggs treated with chlorfenapyr liquid spray had reduced feeding compared with nymphs hatched from nontreated eggs. Those nymphs hatched from eggs treated with chlorfenapyr liquid spray and successfully fed had reduced mortality and a higher mean survival time than those without feeding. We conclude that the availability of a bloodmeal after insecticide exposure has a significant effect on bed bug mortality. Protocols for insecticide efficacy testing should consider offering a bloodmeal to the treated bed bugs within 1 to 3 d after treatment. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Ihara, Makoto; Buckingham, Steven D; Matsuda, Kazuhiko; Sattelle, David B
2017-01-01
Nicotinic acetylcholine receptors (nAChRs) of insects play a key role in fast excitatory neurotransmission. Several classes of insecticides target insect nAChRs, which are composed of subunit members of a family of multiple subunit encoding genes. Alternative splicing and RNA A-to-I editing can add further to receptor diversity. Native and recombinant receptors have been explored as sites of insecticide action using radioligands, electrophysiology and site-directed mutagenesis. We have reviewed the properties of native and recombinant insect nAChRs, the challenges of functional recombinant insect nAChR expression, nAChR interactions with ligands acting at orthosteric and allosteric sites and in particular their interactions with insecticides. Actions on insect nAChRs of cartap, neonicotinoids, spinosyns, sulfoxamines, butenolides and mesoionic insecticides are reviewed and current knowledge of their modes of action are addressed. Mutations that add to our understanding of insecticide action and those leading to resistance are discussed. Co-crystallisation of neonicotinoids with the acetylcholine binding protein (AChBP), a surrogate for the nAChR ligand binding domain, has proved instructive. Toxicity issues relating to insecticides targeting nAChRs are also considered. An overview of insecticide classes targeting insect nAChRs has enhanced our understanding of these important receptors and their insecticide binding sites. However, the subunit composition of native nAChRs remains poorly understood and functional expression still presents difficulties. These topics together with improved understanding of the precise sites of insecticide actions on insect nAChRs will be the subject of future research. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
McMahon, Kelton; Berumen, Michael L.; Mateo, Ivan; Elsdon, Travis S.; Thorrold, Simon R.
2011-01-01
This study explored the potential for otolith geochemistry in snapper (Family: Lutjanidae) to identify residency in juvenile nursery habitats with distinctive carbon isotope values. Conventional bulk otolith and muscle stable isotope analyses (SIA) and essential amino acid (AA) SIA were conducted on snapper collected from seagrass beds, mangroves, and coral reefs in the Red Sea, Caribbean Sea, and Pacific coast of Panama. While bulk stable isotope values in otoliths showed regional differences, they failed to distinguish nursery residence on local scales. Essential AA δ13C values in otoliths, on the other hand, varied as a function of habitat type and provided a better tracer of residence in different juvenile nursery habitats than conventional bulk otolith SIA alone. A strong linear relationship was found between paired otolith and muscle essential AA δ13C values regardless of species, geographic region, or habitat type, indicating that otolith AAs recorded the same dietary information as muscle AAs. Juvenile snapper in the Red Sea sheltered in mangroves but fed in seagrass beds, while snapper from the Caribbean Sea and Pacific coast of Panama showed greater reliance on mangrove-derived carbon. Furthermore, compound-specific SIA revealed that microbially recycled detrital carbon, not water-column-based new phytoplankton carbon, was the primary carbon source supporting snapper production on coastal reefs of the Red Sea. This study presented robust tracers of juvenile nursery residence that will be crucial for reconstructing ontogenetic migration patterns of fishes among coastal wetlands and coral reefs. This information is key to determining the importance of nursery habitats to coral reef fish populations and will provide valuable scientific support for the design of networked marine-protected areas. © 2011 Springer-Verlag.
McMahon, Kelton
2011-08-26
This study explored the potential for otolith geochemistry in snapper (Family: Lutjanidae) to identify residency in juvenile nursery habitats with distinctive carbon isotope values. Conventional bulk otolith and muscle stable isotope analyses (SIA) and essential amino acid (AA) SIA were conducted on snapper collected from seagrass beds, mangroves, and coral reefs in the Red Sea, Caribbean Sea, and Pacific coast of Panama. While bulk stable isotope values in otoliths showed regional differences, they failed to distinguish nursery residence on local scales. Essential AA δ13C values in otoliths, on the other hand, varied as a function of habitat type and provided a better tracer of residence in different juvenile nursery habitats than conventional bulk otolith SIA alone. A strong linear relationship was found between paired otolith and muscle essential AA δ13C values regardless of species, geographic region, or habitat type, indicating that otolith AAs recorded the same dietary information as muscle AAs. Juvenile snapper in the Red Sea sheltered in mangroves but fed in seagrass beds, while snapper from the Caribbean Sea and Pacific coast of Panama showed greater reliance on mangrove-derived carbon. Furthermore, compound-specific SIA revealed that microbially recycled detrital carbon, not water-column-based new phytoplankton carbon, was the primary carbon source supporting snapper production on coastal reefs of the Red Sea. This study presented robust tracers of juvenile nursery residence that will be crucial for reconstructing ontogenetic migration patterns of fishes among coastal wetlands and coral reefs. This information is key to determining the importance of nursery habitats to coral reef fish populations and will provide valuable scientific support for the design of networked marine-protected areas. © 2011 Springer-Verlag.
Predicting movement of nursery hosts using a linear network model
Steve McKelvey; Frank Koch; Bill Smith
2008-01-01
There is widespread concern among scientists and land managers that Phytophthora ramorum may be accidentally introduced into oak-dominated eastern U.S. forests through the transfer of the pathogen from infected nursery plants to susceptible understory forest species (for example, Rhododendron spp.) at the forest-urban interface....
Jones, Liz; Taylor, Tara; Watson, Bernadette; Fenwick, Jennifer; Dordic, Tatjana
2015-01-01
Nursing staff are an important source of support for parents of a hospitalized preterm infant. This study aimed to describe parents' and nurses' perceptions of communicating with each other in the context of the special care nursery. A qualitative descriptive design was employed. Thirty two parents with a newborn admitted to one of two special care nurseries in Queensland, Australia participated, and 12 nurses participated in semi-structured interviews. Thematic analysis was used to analyze the interviews. Nurses and parents focused on similar topics, but their perceptions differed. Provision of information and enabling parenting were central to effective communication, supported by an appropriate interpersonal style by nurses. Parents described difficulties accessing or engaging nurses. Managing enforcement of policies was a specific area of difficulty for both parents and nurses. The findings indicated a tension between providing family-centered care that is individualized and based on family needs and roles, and adhering to systemic nursery policies. Copyright © 2015 Elsevier Inc. All rights reserved.
Taylor, Matthew D; Fry, Brian; Becker, Alistair; Moltschaniwskyj, Natalie
2017-04-15
Estuaries provide a diverse mosaic of habitats which support both juveniles and adults of exploited species. In particular, estuaries play an important role in the early life history of many penaeid prawn species. This study used a combination of stable isotope ecology and quantitative sampling to examine recruitment and the nursery function of seagrass habitats for Eastern King Prawn (Penaeus [Melicertus] plebejus), and the processes that contributed to this nursery role. Stable isotopes were used to assign prawns joining the adult stock to putative nursery habitat areas within the estuary. Emigrating prawns originated from only 11 of the 20 sites surveyed. Of these, 8 sites were designated as Effective Juvenile Habitat (EJH), and 5 sites designated as Nursery Habitat (NH). The contribution of individuals from different nursery areas to the adult stock was related to both the abundance of prawns within an area and the distance to the mouth of the estuary, and with the exception of 1 site all EJH and NH were located in the northern section of the estuary. Quantitative sampling in this area indicated that prawns were present at an average density of 165±11 per 100m 2 , and density formed non-linear relationships with the distance to the mouth of the estuary, seagrass cover and temperature. Prawn size also formed non-linear relationships with prawn density and seagrass cover. Spatial patterns in abundance were consistent with wind-driven recruitment patterns, which in turn affected the nursery role of particular areas within the system. These findings have implications for targeted fishery restoration efforts for both Eastern King Prawn and other ocean spawned species in wave dominated estuaries where circulation is primarily wind-driven. Crown Copyright © 2017. Published by Elsevier B.V. All rights reserved.
Hulvey, Jon; Gobena, Daniel; Finley, Ledare; Lamour, Kurt
2010-01-01
In 2008 statewide surveys of symptomatic foliage of nursery plants from Tennessee resulted in isolation of 43 isolates of Phytophthora spp. This sample set includes four described species (P. citrophthora, P. citricola, P. nicotianae, P. syringae), and a provisional species of Phytophthora ('P. hydropathica'). At the same time a stream-baiting survey was initiated to recover Phytophthora from eight watersheds in eastern Tennessee, some of which are near plant nurseries. Baiting was accomplished by submerging healthy Rhododendron leaves approximately 1 wk and isolation onto selective media. Six baiting periods were completed, and in total 98 Phytophthora isolates and 45 isolates of Pythium spp. were recovered. Three described species (P. citrophthora, P. citricola and P. irrigata) and the provisional species 'P. hydropathica' were obtained as well as three undescribed Phytophthora taxa and Pythium litorale. Isolates from both surveys were identified to species with morphology and the internal transcribed spacer (ITS) sequence. Isolates from species co-occurring in streams and nurseries (P. citricola, P. citrophthora and 'P. hydropathica') were characterized further with amplified fragment length polymorphism (AFLP) analyses and mefenoxam tolerance assays. Isolates representing a putative clonal genotype of P. citricola were obtained from both environmental and nursery sample sets.
Sapsaglam, Özkan; Ömeroglu, Esra
2016-01-01
This study was conducted in an attempt to develop Social Values Education Program aimed at nursery school students and examine the effect of Social Values Education Program upon the social skill acquisition of nursery school students. The effect of the education program that was developed within the scope of the study upon the social skill…
Development of Environment-Friendly Insecticides Based on Enantioselectivity: Bifenthrin as a Case.
Qian, Yi; Zhou, Peixue; Zhang, Quan
2017-01-01
Chiral insecticides significantly contribute to the environmental pollutions recently. As the development of industry and agriculture, increasing number of chiral insecticides are to be introduced into the market. However, their enantioselective toxicology to ecosystem still remains uncertain. In this review, we embarked on a structured search of bibliographic databases for peer-reviewed articles regarding the enantioselective effects of bifenthrin, a typical chiral insecticide, on both target and non-target species. With this enantioselective property of chiral insecticides, they often exhibit adverse effects on non-target species enantioselectively. Specifically, the enantioselective effects of bifenthrin on target and non-target organisms were discussed. In target species, R-bifenthrin exerts more significant activities in deinsectization, compared with S-bifenthrin. On the other hand, Sbifenthrin is more toxic to non-target species than R-bifenthrin, which suggests that the application of sole enantiomer is more efficient and environment-friendly than that of racemate. This review confirms the choice of environment-friendly insecticides from the perspective of the enantioselectivity of chiral insecticides. To make insecticides more efficient to target species and less toxic to non-target species, further research should be done to investigated the potential effects of targetactive enantiomers on non-target organisms as well as the enantioselective fate of enantiomers in multiple environmental matrix.
Identification and cloning of two insecticidal protein genes from ...
African Journals Online (AJOL)
Bacillus thuringiensis (Bt) is the most widely applied type of microbial pesticide due to its high specificity and environmental safety. The activity of Bt is largely attributed to the insecticidal crystal protein encoded by the cry genes. Different insecticidal crystal proteins of Bt have different bioactivity against distinct agricultural ...
Insecticide-mediated apparent displacement between two invasive species of leafminer fly.
Directory of Open Access Journals (Sweden)
Yulin Gao
Full Text Available BACKGROUND: Closely related invasive species may often displace one another, but it is often difficult to determine mechanisms because of the historical nature of these events. The leafmining flies Liriomyza sativae and Liriomyza trifolii have become serious invasive agricultural pests throughout the world. Where both species have invaded the same region, one predominates over the other. Although L. sativae invaded Hainan Island of China first, it recently has been displaced by the newly invasive L. trifolii. We hypothesized that differential susceptibilities to insecticides could be causing this demographic shift. METHODOLOGY/PRINCIPAL FINDINGS: Avermectin and cyromazine are the most commonly used insecticides to manage leafminers, with laboratory bioassays demonstrating that L. trifolii is significantly less susceptible to these key insecticides than is L. sativae. In trials where similar numbers of larvae of both species infested plants, which subsequently were treated with the insecticides, the eclosing adults were predominately L. trifolii, yet similar numbers of adults of both species eclosed from control plants. The species composition was then surveyed in two regions where L. trifolii has just begun to invade and both species are still common. In field trials, both species occurred in similar proportions before insecticide treatments began. Following applications of avermectin and cyromazine, almost all eclosing adults were L. trifolii in those treatment plots. In control plots, similar numbers of adults of the two species eclosed, lending further credence to the hypothesis that differential insecticide susceptibilities could be driving the ongoing displacement of L. sativae by L. trifolii. CONCLUSIONS/SIGNIFICANCE: Our results show that differential insecticide susceptibility can lead to rapid shifts in the demographics of pest complexes. Thus, successful pest management requires the identification of pest species to understand the
International Nuclear Information System (INIS)
Bustamante, M.; Sabillon, A.; Velasquez, C.; Ordonez, J.; Baquedano, F.
1999-01-01
Insecticides are commonly used by Honduran farmers to control pest insects in agricultural crops such as corn, melons and tomatoes. However, the insecticides have the potential for toxicity to the natural enemies of the pest insects also. Therefore, efforts are being made to identify insecticides which, when used within the Inegerated Pest Management (IPM) programme, are selectively more toxic to the pest insects than their natural enemies. A number of selected chemical insecticides and a biological insecticide (NPV) were tested in three different tests to determine toxicity to two beneficial insects: Telenomus remus Nixon (Hymenoptera: Scelionidae) and Chrysoperla carnea Steph. (Neuroptera: Chrysopidae). All insecticides were toxic to T. remus which suffered high mortality. There was no significant difference in mortality of the insect due to the method of exposure to the insecticides. There were some differences in the toxicity of the insecticides to C. carnea, and abamectin, bifenthrin, cypermethrin, diafenthiuron, imidacloprid and fenpropathrin were relatively less toxic and could be used in IPM for the control of pest insects. (author)
Climate change, agricultural insecticide exposure, and risk for freshwater communities.
Kattwinkel, Mira; Kühne, Jan-Valentin; Foit, Kaarina; Liess, Matthias
2011-09-01
Climate change exerts direct effects on ecosystems but has additional indirect effects due to changes in agricultural practice. These include the increased use of pesticides, changes in the areas that are cultivated, and changes in the crops cultivated. It is well known that pesticides, and in particular insecticides, affect aquatic ecosystems adversely. To implement effective mitigation measures it is necessary to identify areas that are affected currently and those that will be affected in the future. As a consequence, we predicted potential exposure to insecticide (insecticide runoff potential, RP) under current conditions (1990) and under a model scenario of future climate and land use (2090) using a spatially explicit model on a continental scale, with a focus on Europe. Space-for-time substitution was used to predict future levels of insecticide application, intensity of agricultural land use, and cultivated crops. To assess the indirect effects of climate change, evaluation of the risk of insecticide exposure was based on a trait-based, climate-insensitive indicator system (SPEAR, SPEcies At Risk). To this end, RP and landscape characteristics that are relevant for the recovery of affected populations were combined to estimate the ecological risk (ER) of insecticides for freshwater communities. We predicted a strong increase in the application of, and aquatic exposure to, insecticides under the future scenario, especially in central and northern Europe. This, in turn, will result in a severe increase in ER in these regions. Hence, the proportion of stream sites adjacent to arable land that do not meet the requirements for good ecological status as defined by the EU Water Framework Directive will increase (from 33% to 39% for the EU-25 countries), in particular in the Scandinavian and Baltic countries (from 6% to 19%). Such spatially explicit mapping of risk enables the planning of adaptation and mitigation strategies including vegetated buffer strips and
Gilinsky, A; Swanson, V; Merrett, M; Power, K; Marley, L
2012-03-01
Investigate the effect of a theory-based intervention on oral-health knowledge, attitudes and behaviours of early years staff (EYS), parents and nursery children. Qualitative research with staff and parents from eight nurseries through interviews/focus groups. An intervention was developed and piloted using pre-posttest design. Nurseries in deprived communities in Dundee, Scotland. 111 children aged 3-5 years attending nursery, including 79 parents and 8 nursery staff. Staff session targeted outcome expectancies, subjective norms and self-efficacy for tooth-brushing in nursery using information provision, modelling and goal-setting, followed by a three-week intervention. Parent-child dyads received a leaflet with instructions for goal-setting, planning and monitoring home brushing. Tooth-brushing self-monitoring materials (e.g. two-minute timer, diaries) were used and certificates provided in the nursery as rewards. EYS knowledge, attitudes and behaviours were assessed before and after the intervention using self-report questionnaires. Parents completed interviews assessing beliefs about tooth-brushing and their children's tooth-brushing behaviour at baseline and post-intervention follow-up. Significant improvements in staff knowledge, but not attitudes, self-efficacy, or nursery tooth-brushing were reported. Parent-child dyads completing the intervention were not more likely to report their child carried out twice-daily tooth-brushing at home. The intervention did not improve parents' intentions to brush their child's teeth twice a day or beliefs about the ease of twice-daily tooth-brushing. Only past behaviour significantly predicted posttest brushing. Parents who found brushing easier at baseline were more likely to complete the intervention. Recommendations are made regarding implementing psychological theory and methods into oral-health interventions.
Mass spectrometric analyses of organophosphate insecticide oxon protein adducts.
Thompson, Charles M; Prins, John M; George, Kathleen M
2010-01-01
Organophosphate (OP) insecticides continue to be used to control insect pests. Acute and chronic exposures to OP insecticides have been documented to cause adverse health effects, but few OP-adducted proteins have been correlated with these illnesses at the molecular level. Our aim was to review the literature covering the current state of the art in mass spectrometry (MS) used to identify OP protein biomarkers. We identified general and specific research reports related to OP insecticides, OP toxicity, OP structure, and protein MS by searching PubMed and Chemical Abstracts for articles published before December 2008. A number of OP-based insecticides share common structural elements that result in predictable OP-protein adducts. The resultant OP-protein adducts show an increase in molecular mass that can be identified by MS and correlated with the OP agent. Customized OP-containing probes have also been used to tag and identify protein targets that can be identified by MS. MS is a useful and emerging tool for the identification of proteins that are modified by activated organophosphate insecticides. MS can characterize the structure of the OP adduct and also the specific amino acid residue that forms the key bond with the OP. Each protein that is modified in a unique way by an OP represents a unique molecular biomarker that with further research can lead to new correlations with exposure.
Rix, Rachel R; Cutler, G Christopher
2018-02-01
Hormetic preconditioning, whereby exposure to mild stress primes an organism to better tolerate subsequent stress, is well documented. It is unknown if exposure to hormetic concentrations of insecticide can trans-generationally prime insects to better tolerate insecticide exposure, or whether exposure to hormetic concentrations of insecticide can induce mutations in genes responsible for insecticide resistance. Using the aphid Myzus persicae (Sulzer) and the insecticide imidacloprid as a model, we examined if exposure to mildly toxic and hormetic concentrations of imidacloprid reduced aphid susceptibility to insecticides across four generations, and whether such exposures induced mutations in the imidacloprid binding site in post-synaptic nicotinic acetylcholine receptors. Chronic, multigenerational exposure of aphids to hormetic concentrations of imidacloprid primed offspring to better survive exposure to certain concentrations of imidacloprid, but not exposure to spirotetramat, an insecticide with a different mode of action. Exposure to hormetic and mildly toxic concentrations of imidacloprid did not result in mutations in any of the examined nicotinic acetylcholine receptor subunits. Our findings demonstrate that exposure to hormetic concentrations of insecticide can prime insects to better withstand subsequent chemical stress, but this is dependent upon the insecticide exposure scenario, and may be subtle over generations. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Owusu, Henry F; Chitnis, Nakul; Müller, Pie
2017-06-16
Insecticide resistance threatens the success achieved through vector control in reducing the burden of malaria. An understanding of insecticide resistance mechanisms would help to develop novel tools and strategies to restore the efficacy of insecticides. Although we have substantially improved our understanding of the genetic basis of insecticide resistance over the last decade, we still know little of how environmental variations influence the mosquito phenotype. Here, we measured how variations in larval rearing conditions change the insecticide susceptibility phenotype of adult Anopheles mosquitoes. Anopheles gambiae and A. stephensi larvae were bred under different combinations of temperature, population density and nutrition, and the emerging adults were exposed to permethrin. Mosquitoes bred under different conditions showed considerable changes in mortality rates and body weight, with nutrition being the major factor. Weight is a strong predictor of insecticide susceptibility and bigger mosquitoes are more likely to survive insecticide treatment. The changes can be substantial, such that the same mosquito colony may be considered fully susceptible or highly resistant when judged by World Health Organization discriminatory concentrations. The results shown here emphasise the importance of the environmental background in developing insecticide resistance phenotypes, and caution for the interpretation of data generated by insecticide susceptibility assays.
R.K. Dumroese; D.F. Jacobs; T.D. Landis
2005-01-01
Forest regeneration is a cyclic operation. Seeds are collected from mature trees and planted in nurseries so that the resulting seedlings can be outplanted to the forest after the mature trees are harvested. Similarly, the process of deciding upon, and growing, the best seedlings for that site should be a cyclic process between foresters and nursery managers. The ideal...
Mee-Sook Kim; Jane E. Stewart; R. Kasten Dumroese; Ned B. Klopfenstein
2012-01-01
Fusarium commune can cause damping-off and root rot of conifer seedlings in forest nurseries, and this pathogen has been previously reported from Oregon, Idaho, and Washington, USA. We collected Fusarium isolates from additional nurseries in the midwestern and western USA to more fully determine occurrence of this pathogen. We used DNA sequences of the mitochondrial...
Palmer, Amy
2011-01-01
Prior to the outbreak of the Second World War, successive presidents and officials at the Board of Education made it clear that they believed there were three types of children in Britain--those who needed nursery schools to rescue them from degradation, those for whom a less expensive nursery class would do the job adequately and those who would…
Limonene--A Natural Insecticide.
Beatty, Joseph H.
1986-01-01
Describes a high school chemistry student's research project in which limonene was isolated from the oil of lemons and oranges. Outlines the students' tests on the use of this chemical as an insecticide. Discusses possible extensions of the exercises based on questions generated by the students. (TW)
Insecticide Exposures on Commercial Aircraft: A Literature Review and Screening Level Assessment
Energy Technology Data Exchange (ETDEWEB)
Maddalena, Randy I.; McKone, Thomas E.
2008-10-01
The objective of this project was to provide initial estimates of the relationship between insecticide use on passenger aircraft and exposure levels present in the cabin environment. The work was initially divided into three tasks including 1) a review of insecticide application practices in commercial aircraft, 2) exploratory measurements of insecticide concentrations in treated aircraft and 3) screening level exposure modeling. Task 1 gathered information that is needed to assess the time-concentration history of insecticides in the airline cabin. The literature review focused on application practices, information about the cabin environment and existing measurements of exposure concentrations following treatment. Information from the airlines was not available for estimating insecticide application rates in the U.S. domestic fleet or for understanding how frequently equipment rotate into domestic routes following insecticide treatment. However, the World Health Organization (WHO) recommends several methods for treating aircraft with insecticide. Although there is evidence that these WHO guidelines may not always be followed, and that practices vary by airline, destination, and/or applicator company, the guidelines in combination with information related to other indoor environments provides a plausible basis for estimating insecticide loading rates on aircraft. The review also found that while measurements of exposure concentrations following simulated aerosol applications are available, measurements following residual treatment of aircraft or applications in domestic aircraft are lacking. Task 2 focused on developing an approach to monitor exposure concentrations in aircraft using a combination of active and passive sampling methods. An existing active sampling approach was intended to provide data immediately following treatment while a passive sampler was developed to provide wider coverage of the fleet over longer sampling periods. The passive sampler, based
Do nursery habitats provide shelter from flow for juvenile fish?
Directory of Open Access Journals (Sweden)
Darren M Parsons
Full Text Available Juvenile fish nurseries are an essential life stage requirement for the maintenance of many fish populations. With many inshore habitats globally in decline, optimising habitat management by increasing our understanding of the relationship between juvenile fish and nursery habitats may be a prudent approach. Previous research on post-settlement snapper (Chrysophrys auratus has suggested that structure may provide a water flow refuge, allowing snapper to access high water flow sites that will also have a high flux of their pelagic prey. We investigated this hypothesis by describing how Artificial Seagrass Units (ASUs modified water flow while also using a multi-camera set up to quantify snapper position in relation to this water flow environment. Horizontal water flow was reduced on the down-current side of ASUs, but only at the height of the seagrass canopy. While the highest abundance of snapper did occur down-current of the ASUs, many snapper also occupied other locations or were too high in the water column to receive any refuge from water flow. The proportion of snapper within the water column was potentially driven by strategy to access zooplankton prey, being higher on the up-current side of ASUs and on flood tides. It is possible that post-settlement snapper alternate position to provide opportunities for both feeding and flow refuging. An alternative explanation relates to an observed interaction between post-settlement snapper and a predator, which demonstrated that snapper can utilise habitat structure when threatened. The nature of this relationship, and its overall importance in determining the value of nursery habitats to post-settlement snapper remains an elusive next step.
Do nursery habitats provide shelter from flow for juvenile fish?
Parsons, Darren M; MacDonald, Iain; Buckthought, Dane; Middleton, Crispin
2018-01-01
Juvenile fish nurseries are an essential life stage requirement for the maintenance of many fish populations. With many inshore habitats globally in decline, optimising habitat management by increasing our understanding of the relationship between juvenile fish and nursery habitats may be a prudent approach. Previous research on post-settlement snapper (Chrysophrys auratus) has suggested that structure may provide a water flow refuge, allowing snapper to access high water flow sites that will also have a high flux of their pelagic prey. We investigated this hypothesis by describing how Artificial Seagrass Units (ASUs) modified water flow while also using a multi-camera set up to quantify snapper position in relation to this water flow environment. Horizontal water flow was reduced on the down-current side of ASUs, but only at the height of the seagrass canopy. While the highest abundance of snapper did occur down-current of the ASUs, many snapper also occupied other locations or were too high in the water column to receive any refuge from water flow. The proportion of snapper within the water column was potentially driven by strategy to access zooplankton prey, being higher on the up-current side of ASUs and on flood tides. It is possible that post-settlement snapper alternate position to provide opportunities for both feeding and flow refuging. An alternative explanation relates to an observed interaction between post-settlement snapper and a predator, which demonstrated that snapper can utilise habitat structure when threatened. The nature of this relationship, and its overall importance in determining the value of nursery habitats to post-settlement snapper remains an elusive next step.
Country-level operational implementation of the Global Plan for Insecticide Resistance Management.
Hemingway, Janet; Vontas, John; Poupardin, Rodolphe; Raman, Jaishree; Lines, Jo; Schwabe, Chris; Matias, Abrahan; Kleinschmidt, Immo
2013-06-04
Malaria control is reliant on the use of long-lasting pyrethroid-impregnated nets and/or indoor residual spraying (IRS) of insecticide. The rapid selection and spread of operationally significant pyrethroid resistance in African malaria vectors threatens our ability to sustain malaria control. Establishing whether resistance is operationally significant is technically challenging. Routine monitoring by bioassay is inadequate, and there are limited data linking resistance selection with changes in disease transmission. The default is to switch insecticides when resistance is detected, but limited insecticide options and resistance to multiple insecticides in numerous locations make this approach unsustainable. Detailed analysis of the resistance situation in Anopheles gambiae on Bioko Island after pyrethroid resistance was detected in this species in 2004, and the IRS program switched to carbamate bendiocarb, has now been undertaken. The pyrethroid resistance selected is a target-site knock-down resistance kdr-form, on a background of generally elevated metabolic activity, compared with insecticide-susceptible A. gambiae, but the major cytochrome P450-based metabolic pyrethroid resistance mechanisms are not present. The available evidence from bioassays and infection data suggests that the pyrethroid resistance mechanisms in Bioko malaria vectors are not operationally significant, and on this basis, a different, long-lasting pyrethroid formulation is now being reintroduced for IRS in a rotational insecticide resistance management program. This will allow control efforts to be sustained in a cost-effective manner while reducing the selection pressure for resistance to nonpyrethroid insecticides. The methods used provide a template for evidence-based insecticide resistance management by malaria control programs.
Impact of Copper Sulfate on Plankton in Channel Catfish Nursery Ponds
Many fish culturists are interested in applying copper sulfate pentahydrate (CSP) to channel catfish, Ictalurus punctatus, nursery ponds as a prophylactic treatment for trematode infection and proliferative gill disease by killing snails and Dero sp., respectively, before stocking fry. However, copp...
Meher, Prabina Kumar; Sahu, Tanmaya Kumar; Banchariya, Anjali; Rao, Atmakuri Ramakrishna
2017-03-24
Insecticide resistance is a major challenge for the control program of insect pests in the fields of crop protection, human and animal health etc. Resistance to different insecticides is conferred by the proteins encoded from certain class of genes of the insects. To distinguish the insecticide resistant proteins from non-resistant proteins, no computational tool is available till date. Thus, development of such a computational tool will be helpful in predicting the insecticide resistant proteins, which can be targeted for developing appropriate insecticides. Five different sets of feature viz., amino acid composition (AAC), di-peptide composition (DPC), pseudo amino acid composition (PAAC), composition-transition-distribution (CTD) and auto-correlation function (ACF) were used to map the protein sequences into numeric feature vectors. The encoded numeric vectors were then used as input in support vector machine (SVM) for classification of insecticide resistant and non-resistant proteins. Higher accuracies were obtained under RBF kernel than that of other kernels. Further, accuracies were observed to be higher for DPC feature set as compared to others. The proposed approach achieved an overall accuracy of >90% in discriminating resistant from non-resistant proteins. Further, the two classes of resistant proteins i.e., detoxification-based and target-based were discriminated from non-resistant proteins with >95% accuracy. Besides, >95% accuracy was also observed for discrimination of proteins involved in detoxification- and target-based resistance mechanisms. The proposed approach not only outperformed Blastp, PSI-Blast and Delta-Blast algorithms, but also achieved >92% accuracy while assessed using an independent dataset of 75 insecticide resistant proteins. This paper presents the first computational approach for discriminating the insecticide resistant proteins from non-resistant proteins. Based on the proposed approach, an online prediction server DIRProt has
Interactions of transgenic Bacillus thuringiensis insecticidal crops with spiders (Araneae)
Genetically modified crops expressing insecticidal proteins from Bacillus thuringiensis (Bt) have dramatically increased in acreage since their introduction in the mid-1990’s. Although the insecticidal mechanisms of Bt target specific pests, concerns persist regarding direct and indirect effects on...
The use of insecticides to control insect pests
M Wojciechowska; P Stepnowski; M Gołębiowski
2016-01-01
Pesticides are used as plants protection products. Among those, insecticides serve as agents to control insects. When incorrectly applied, however these substances may negatively affect people's health and natural environment. Administration routes of insecticides depend on many factors and vary from spraying to fertilizers. These different methods influence how insects prey and how pests develop. Additionally, too frequent use of the same chemicals can lead to development of resi...
The response of natural enemies to selective insecticides applied to soybean.
Varenhorst, A J; O'Neal, M E
2012-12-01
Natural enemies of the invasive pest Aphis glycines Matsumura can prevent its establishment and population growth. However, current A. glycines management practices include the application of broad-spectrum insecticides that affect pests and natural enemies that are present in the field at the time of application. An alternative is the use of selective insecticides that affect the targeted pest species, although having a reduced impact on the natural enemies. We tested the effects of esfenvalerate, spirotetramat, imidacloprid, and a combination of spirotetramat and imidacloprid on the natural enemies in soybean during the 2009 and 2010 field season. The natural enemy community that was tested differed significantly between 2009 and 2010 (F = 87.41; df = 1, 598; P natural enemy in 2009 was Harmonia axyridis (Pallas) (56.0%) and in 2010 was Orius insidiosus (Say) (41.0%). During 2009, the abundance of natural enemies did not vary between the broad-spectrum and selective insecticides; however, the abundance of natural enemies was reduced by all insecticide treatments when compared with the untreated control. In 2010, the selective insecticide imidacloprid had more natural enemies than the broad-spectrum insecticide. Although we did not observe a difference in the abundance of the total natural enemy community in 2009, we did observe more H. axyridis in plots treated with spirotetramat. In 2010, we observed more O. insidiosus in plots treated with imidacloprid. We suggest a couple of mechanisms to explain how the varying insecticides have different impacts on separate components of the natural enemy community.
Ergonomic adequacy of the baby nursery of child development center located in UFSC - Florianópolis.
Vergara, Lizandra Garcia Lupi; Ribet, Lucie Elisa
2012-01-01
A study in the educators' work station at baby nursery of NDI/UFSC, located in Florianópolis, was conducted using the Work Ergonomic Analysis methodological tool. The demand considered was the educators' physical exhaustion caused by the weight carried when taking care of the babies, the postures assumed during the labor activity and the spatial arrangement of the baby nursery. Thinking ergonomically, the spatial arrangement is directly associated to three factors: the formal aspect of the environment, the esthetic aspect including colors and finish quality and the ease of understanding involved in the baby nursery labor. By the ergonomic adequacy it is possible to assert that if were established better conditions of posture and comfort for the educators, as well as satisfactory technical and operational information to carry out the activities, greater safety and welfare would be provided to the babies, the main focus of the work.
Optimal Cotton Insecticide Application Termination Timing: A Meta-Analysis.
Griffin, T W; Zapata, S D
2016-08-01
The concept of insecticide termination timing is generally accepted among cotton (Gossypium hirsutum) researchers; however, exact timings are often disputed. Specifically, there is uncertainty regarding the last economic insecticide application to control fruit-feeding pests including tarnished plant bug (Lygus lineolaris (Palisot de Beauvois)), boll weevil (Anthonomus grandis), bollworm (Helicoverpa zea), tobacco budworm (Heliothis virescens), and cotton fleahopper (Pseudatomoscelis seriatus). A systematic review of prior studies was conducted within a meta-analytic framework. Nine publicly available articles were amalgamated to develop an optimal timing principle. These prior studies reported 53 independent multiple means comparison field experiments for a total of 247 trial observations. Stochastic plateau theory integrated with econometric meta-analysis methodology was applied to the meta-database to determine the shape of the functional form of both the agronomic optimal insecticide termination timing and corresponding yield potential. Results indicated that current university insecticide termination timing recommendations are later than overall estimated timing suggested. The estimated 159 heat units (HU) after the fifth position above white flower (NAWF5) was found to be statistically different than the 194 HU termination used as the status quo recommended termination timing. Insecticides applied after 159 HU may have been applied in excess, resulting in unnecessary economic and environmental costs. Empirical results also suggested that extending the insecticide termination time by one unit resulted in a cotton lint yield increase of 0.27 kilograms per hectare up to the timing where the plateau began. Based on economic analyses, profit-maximizing producers may cease application as soon as 124 HU after NAWF5. These results provided insights useful to improve production systems by applying inputs only when benefits were expected to be in excess of the
Directory of Open Access Journals (Sweden)
Sorana BOLBOACĂ
2005-01-01
Full Text Available The neonicotinoids are the newest major class of insecticides modeled after the basic nicotine molecule having improved insecticide activity and generally low toxicity. The insecticidal activities of neonicotinoids were previous studied using 3D and standard partial least squares regression models. The paper describes the ability of the MDF SAR methodology in prediction of insecticidal activities of neonicotinoid compounds. The best MDF SAR bi-varied model was validated on training and test sets and its ability on prediction of insecticidal activity was compared with previous reported models. Even if the MDF SAR methodology is complex and time consuming the results worth the effort because they are statistical significant better then previous reported results.
Qualitative evaluation of same insecticides sold in Kinshasa and users behavior survey
International Nuclear Information System (INIS)
Basilua, K.; Essassi El, M.; Himmi, O.; Said Gmouh; Watsenga, T.
2009-01-01
Malaria is a serious public health problem in the tropical countries and particularly into Kinshasa. Anopheles gambiae sl. is the mean vector of this illness. The use of impregnated bednets is the national strategy; the chemical insecticides are used too in figthing the malaria vectors. The survey carried out on 144 households randomly selected in Kinshasa have showed that 61,1% are favourable with using bednets insecticide impregnated and 96,5% of these households use too chemical insecticides, meanly the pyrethroids one (90,5%) and the organophosphates (9,5%). Mass spectrometer analysis revealed that 87,5% of identified insecticides, essentially pyrethroinids have tetramethrine as active substance; the dichlorvos is the only one to be detected as organophosphate and that in some insecticides, the detected molecules are not avowed or different from those avowed or different from those avowed by the manufacturer.
Directory of Open Access Journals (Sweden)
Laritza Raquel del Risco López
2017-01-01
Full Text Available The paper refers the impact of psychological counseling on improving nursery school management. By studying the actual practices of these professionals and institutions, constructing a theoretical framework, and exchanging with specialists, the authors attain to rethink, improve and update educational practice. The researchers make extensive use of theoretical methods for constructing a framework, observe psychologist performance at nursery schools, and conduct interviews and survey on related issues. The effectiveness of the proposal was assessed on the basis of experts’ criteria (nursery school professionals and psychologists. The findings include a description of psychological counseling in nursery schools viewing the process as a dynamic interchange of ideas and mutual professional support. Likewise, the highlights of the process of articulating psychologists and principal performances are given. ,
Growing media alternatives for forest and native plant nurseries
Thomas D. Landis; Nancy Morgan
2009-01-01
The choice of growing medium, along with container type, is one of the critical decisions that must be made when starting a nursery. The first growing medium was called "compost" and was developed in the 1930s at the John Innes Horticultural Institute in Great Britain. It consisted of a loam soil that was amended with peat moss, sand, and fertilizers (Bunt...
Neurotoxicology of insecticides and pheromones
National Research Council Canada - National Science Library
Narahashi, Toshio
1979-01-01
The purpose of this symposium was to provide a forum where a variety of scientists who were interested in the interactions of insecticides and pheromones with the nervous system got together to exchange their views...
Insecticide Usage and Chemical Contamination Assessment in Asiatic Pennywort
Bumroongsook, S.
2017-07-01
The insecticide usage in commercially grown asiatic pennywort plantations in Nakhonpatum and Nonthaburi province, Thailand was surveyed during January-June, 2016. The results showed that asiatic pennywort cuttworms was leaf destructive and caused the most damge to the production. The growers used organophosphate insecticides to control the caterpillars the most, followed by pyrethoid, abamectin, carbamate and organochlorine, respectively. The chemical contaminants of pennywort from 9 fresh markets in Bangkok was monitored, the result indicated that lead was not detected in the samples. The amount of arsenic was less than 0.075 mg / kg. The insecticide residue measurement of dicofol, chlorpyrifos and methidathion was 0.98, 2.84 and 0.46 mg / kg, respectively.
DEFF Research Database (Denmark)
Clausen, Jesper Hedegaard; Madsen, Henry; Murrell, Kenneth Darwin
2012-01-01
ponds. Previous risk assessment on FZT transmission in the Red River Delta of Vietnam identified carp nursery ponds as major sites of transmission. In this study, we analyzed the association between snail population density and heterophyid trematode infection in snails with the rate of FZT transmission...... to juvenile fish raised in carp nurseries....
Directory of Open Access Journals (Sweden)
Leopoldo Palma
2017-05-01
Full Text Available The Vip3 proteins produced during vegetative growth by strains of the bacterium Bacillus thuringiensis show insecticidal activity against lepidopteran insects with a mechanism of action that may involve pore formation and apoptosis. These proteins are promising supplements to our arsenal of insecticidal proteins, but the molecular details of their activity are not understood. As a first step in the structural characterisation of these proteins, we have analysed their secondary structure and resolved the surface topology of a tetrameric complex of the Vip3Ag4 protein by transmission electron microscopy. Sites sensitive to proteolysis by trypsin are identified and the trypsin-cleaved protein appears to retain a similar structure as an octomeric complex comprising four copies each of the ~65 kDa and ~21 kDa products of proteolysis. This processed form of the toxin may represent the active toxin. The quality and monodispersity of the protein produced in this study make Vip3Ag4 a candidate for more detailed structural analysis using cryo-electron microscopy.
Colletotrichum fungal pathogens and symbionts of ornamental nursery and landscape plants
Fungi in the ascomycete genus Colletotrichum are ranked by the plant pathology community as one of the ten most economically and scientifically important fungal phytopathogens. Major losses due to Colletotrichum are experienced in almost every crop worldwide, including nursery and landscape plants ...
Giants in the Nursery: A Biographical History of Developmentally Appropriate Practice
Elkind, David
2015-01-01
"Giants in the Nursery" examines the evolution of developmentally appropriate practice in this biographical history of early childhood education. This book, from David Elkind, explores the theory's progression--from its beginnings in writings of sixteenth- and seventeenth-century philosophers, its experimental implementation by…
Miarinjara, Adélaïde; Boyer, Sébastien
2016-02-01
Plague is a rodent disease transmissible to humans by infected flea bites, and Madagascar is one of the countries with the highest plague incidence in the world. This study reports the susceptibility of the main plague vector Xenopsylla cheopis to 12 different insecticides belonging to 4 insecticide families (carbamates, organophosphates, pyrethroids and organochlorines). Eight populations from different geographical regions of Madagascar previously resistant to deltamethrin were tested with a World Health Organization standard bioassay. Insecticide susceptibility varied amongst populations, but all of them were resistant to six insecticides belonging to pyrethroid and carbamate insecticides (alphacypermethrin, lambdacyhalothrin, etofenprox, deltamethrin, bendiocarb and propoxur). Only one insecticide (dieldrin) was an efficient pulicide for all flea populations. Cross resistances were suspected. This study proposes at least three alternative insecticides (malathion, fenitrothion and cyfluthrin) to replace deltamethrin during plague epidemic responses, but the most efficient insecticide may be different for each population studied. We highlight the importance of continuous insecticide susceptibility surveillance in the areas of high plague risk in Madagascar.
The global status of insect resistance to neonicotinoid insecticides.
Bass, Chris; Denholm, Ian; Williamson, Martin S; Nauen, Ralf
2015-06-01
The first neonicotinoid insecticide, imidacloprid, was launched in 1991. Today this class of insecticides comprises at least seven major compounds with a market share of more than 25% of total global insecticide sales. Neonicotinoid insecticides are highly selective agonists of insect nicotinic acetylcholine receptors and provide farmers with invaluable, highly effective tools against some of the world's most destructive crop pests. These include sucking pests such as aphids, whiteflies, and planthoppers, and also some coleopteran, dipteran and lepidopteran species. Although many insect species are still successfully controlled by neonicotinoids, their popularity has imposed a mounting selection pressure for resistance, and in several species resistance has now reached levels that compromise the efficacy of these insecticides. Research to understand the molecular basis of neonicotinoid resistance has revealed both target-site and metabolic mechanisms conferring resistance. For target-site resistance, field-evolved mutations have only been characterized in two aphid species. Metabolic resistance appears much more common, with the enhanced expression of one or more cytochrome P450s frequently reported in resistant strains. Despite the current scale of resistance, neonicotinoids remain a major component of many pest control programmes, and resistance management strategies, based on mode of action rotation, are of crucial importance in preventing resistance becoming more widespread. In this review we summarize the current status of neonicotinoid resistance, the biochemical and molecular mechanisms involved, and the implications for resistance management. Copyright © 2015 Elsevier Inc. All rights reserved.
Children's exposure to indoor air in urban nurseries-part I: CO2 and comfort assessment
International Nuclear Information System (INIS)
Branco, P.T.B.S.; Alvim-Ferraz, M.C.M.; Martins, F.G.; Sousa, S.I.V.
2015-01-01
Indoor air quality (IAQ) in nurseries is an emerging case-study. Thus, this study, as the Part I of the larger study “Children's exposure to indoor air in urban nurseries”, aimed to: i) evaluate nurseries’ indoor concentrations of carbon dioxide (CO 2 ), a global IAQ indicator, in class and lunch rooms; ii) assess indoor comfort parameters–temperature (T) and relative humidity (RH); and iii) analyse them according to guidelines and references for IAQ, comfort and children's health. Indoor continuous measurements were performed. Non-compliances with guidelines were found in comfort parameters, which could cause discomfort situations and also microbial proliferation. Exceedances in CO 2 concentrations were also found and they were caused by poor ventilation and high classroom occupation. More efficient ventilation and control of comfort parameters, as well as to reduce occupation by reviewing Portuguese legislation on that matter, would certainly improve IAQ and comfort in nurseries and consequently safeguard children's health. - Highlights: • High occupation and poor ventilation were main determinants of IAQ in nurseries. • T and RH indoor values found in nurseries are likely to cause thermal discomfort. • Building characteristics and an inadequate ventilation determined T and RH values. • High CO 2 concentrations found could indicate accumulation of other air pollutants
Plant compounds insecticide activity against Coleoptera pests of stored products
Energy Technology Data Exchange (ETDEWEB)
Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; br, picanco@ufv; br, guedes@ufv; br, mateusc3@yahoo com; br, agronomiasilva@yahoo com
2007-07-15
The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)
Plant compounds insecticide activity against Coleoptera pests of stored products
International Nuclear Information System (INIS)
Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio; julioufv@yahoo.com.br
2007-01-01
The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD 50 from 2.72 to 39.71 mg g -1 a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)
Effect on nursery and field performance of Pinus patula seedlings ...
African Journals Online (AJOL)
Fusarium circinatum is an important fungal pathogen of Pinus species. In South Africa, it is the most significant pathogen of Pinus patula seedlings in forestry nurseries where it presents a substantial constraint to productivity and can continue to cause mortality in-field for up to two years after establishment. This study ...
D. Wang; J. Juzwik; S.W. Fraedrich; K. Spokas; Y. Zhang; W.C. Koskinen
2005-01-01
Methylisothiocyanate (MITC) and chloropicrin (CP) are alternatives to methyl bromide for soil fumigation. However, surface transport of MITC emission has been cited as the cause for seedling damage in adjacent fields at several bare-root forest-tree nurseries. Field experiments were conducted at nurseries to measure air emissions of MITC and CP after fumigation....
Investigation of insecticide-resistance status of Cydia pomonella in Chinese populations.
Yang, X-Q; Zhang, Y-L
2015-06-01
The codling moth Cydia pomonella (L.) is an economically important fruit pest and it has been directly targeted by insecticides worldwide. Serious resistance to insecticides has been reported in many countries. As one of the most serious invasive pest, the codling moth has populated several areas in China. However, resistance to insecticides has not been reported in China. We investigated the insecticide-resistance status of four field populations from Northwestern China by applying bioassays, enzyme activities, and mutation detections. Diagnostic concentrations of lambda-cyhalothrin, chlorpyrifos-ethyl, carbaryl, and imidacloprid were determined and used in bioassays. Field populations were less susceptible to chlorpyrifos-ethyl and carbaryl than laboratory strain. Insensitive populations displayed an elevated glutathione S-transferases (GSTs) activity. Reduced carboxylesterase (CarE) activity was observed in some insecticide insensitive populations and reduced acetylcholinesterase activity was observed only in the Wuw population. The cytochrome P450 polysubstrate monooxygenases activities in four field populations were not found to be different from susceptible strains. Neither the known-resistance mutation F399V in the acetylcholinesterase (AChE) gene, ace1, nor mutations in CarE gene CpCE-1 were found in adult individuals from our field populations. Native-PAGE revealed that various CarE isozymes and AChE insensitivity were occurring among Chinese populations. Our results indicate that codling moth populations from Northwestern China were insensitivity to chlorpyrifos-ethyl and carbaryl. Increased GST activity was responsible for insecticides insensitivity. Decreased CarE activity, as well as the presence of CarE and AChE polymorphisms might also be involved in insecticides insensitivity. New management strategies for managing this pest are discussed.
POTENTIATION OF COPAÍBA OIL-RESIN WITH SYNTHETIC INSECTICIDES TO CONTROL OF FALL ARMYWORM
ALMEIDA, WALDIANE ARAÚJO DE; SILVA, IGOR HONORATO LEDUÍNO DA; SANTOS, ANA CLÁUDIA VIEIRA DOS; BARROS JÚNIOR, AURÉLIO PAES; SOUSA, ADALBERTO HIPÓLITO DE
2017-01-01
ABSTRACT The control of Spodoptera frugiperda (J. E. SMITH) (Lepidoptera: Noctuidae) has been carried out mainly with pyrethroids and organophosphates insecticides. The continuous and indiscriminate use of synthetic insecticides, for decades, has led to the selection of resistant populations and has caused concerns for human health and the environment. An alternative is the use of botanical insecticides, including through the mixtures with synthetic insecticides. This study aimed to investiga...
Status of insecticide resistance in high-risk malaria provinces in Afghanistan.
Ahmad, Mushtaq; Buhler, Cyril; Pignatelli, Patricia; Ranson, Hilary; Nahzat, Sami Mohammad; Naseem, Mohammad; Sabawoon, Muhammad Farooq; Siddiqi, Abdul Majeed; Vink, Martijn
2016-02-18
Insecticide resistance seriously threatens the efficacy of vector control interventions in malaria endemic countries. In Afghanistan, the status of insecticide resistance is largely unknown while distribution of long-lasting insecticidal nets has intensified in recent years. The main objective of this study was thus to measure the level of resistance to four classes of insecticides in provinces with medium to high risk of malaria transmission. Adult female mosquitoes were reared from larvae successively collected in the provinces of Nangarhar, Kunar, Badakhshan, Ghazni and Laghman from August to October 2014. WHO insecticide susceptibility tests were performed with DDT (4 %), malathion (5 %), bendiocarb (0.1 %), permethrin (0.75 %) and deltamethrin (0.05 %). In addition, the presence of kdr mutations was investigated in deltamethrin resistant and susceptible Anopheles stephensi mosquitoes collected in the eastern provinces of Nangarhar and Kunar. Analyses of mortality rates revealed emerging resistance against all four classes of insecticides in the provinces located east and south of the Hindu Kush mountain range. Resistance is observed in both An. stephensi and Anopheles culicifacies, the two dominant malaria vectors in these provinces. Anopheles superpictus in the northern province of Badakhshan shows a different pattern of susceptibility with suspected resistance observed only for deltamethrin and bendiocarb. Genotype analysis of knock down resistance (kdr) mutations at the voltage-gated channel gene from An. stephensi mosquitoes shows the presence of the known resistant alleles L1014S and L1014F. However, a significant fraction of deltamethrin-resistant mosquitoes were homozygous for the 1014L wild type allele indicating that other mechanisms must be considered to account for the observed pyrethroid resistance. This study confirms the importance of monitoring insecticide resistance for the development of an integrated vector management in Afghanistan. The
Effects of emotional dissonance and job burnout on the psychological heath of the nursery teachers
Energy Technology Data Exchange (ETDEWEB)
Choi, Kwang Il; Lee, Won Jae [Gachon University, Sungnam (Korea, Republic of)
2016-12-15
This study collected data from 467 nursery teachers and it aimed to investigate the association between mental health and emotional dissonance and job burnout of the day care nursery teachers. Measurement tool was developed, most of the questions having 5-point scale. The data were analyzed structural equation model with the statistical package IBM SPSS 23 and AMOS 21 with 5% percent of significance level. Main results are as follows. First, it was found that emotional dissonance of nursery teachers working in day care centers showed significant effect on the mental health such factors as job-stress (relationships with children and parents and work overload). Second, emotional dissonance were found to have a significant effect on job burnout, too. Third, job burnout had a significant effect on the mental health, job stress and psychological wellbeing. Fourth, job burnout was found to mediate partially on mental health and emotional dissonance. These findings suggest the importance of mental health promotion programs for child care teachers working in the day care centers.
Effects of emotional dissonance and job burnout on the psychological heath of the nursery teachers
International Nuclear Information System (INIS)
Choi, Kwang Il; Lee, Won Jae
2016-01-01
This study collected data from 467 nursery teachers and it aimed to investigate the association between mental health and emotional dissonance and job burnout of the day care nursery teachers. Measurement tool was developed, most of the questions having 5-point scale. The data were analyzed structural equation model with the statistical package IBM SPSS 23 and AMOS 21 with 5% percent of significance level. Main results are as follows. First, it was found that emotional dissonance of nursery teachers working in day care centers showed significant effect on the mental health such factors as job-stress (relationships with children and parents and work overload). Second, emotional dissonance were found to have a significant effect on job burnout, too. Third, job burnout had a significant effect on the mental health, job stress and psychological wellbeing. Fourth, job burnout was found to mediate partially on mental health and emotional dissonance. These findings suggest the importance of mental health promotion programs for child care teachers working in the day care centers
Halden, Amanda; Clark, Christina; Lewis, Fiona
2011-01-01
In May 2011 "Nursery World" and the National Literacy Trust launched its language development survey to celebrate Hello; the national year of communication. The National Literacy Trust teamed up with "Nursery World" to carry out research into the sector's support for children's language and literacy development. Two hundred…
Cytochrome P450s--Their expression, regulation, and role in insecticide resistance.
Liu, Nannan; Li, Ming; Gong, Youhui; Liu, Feng; Li, Ting
2015-05-01
P450s are known to be critical for the detoxification and/or activation of xenobiotics such as drugs and pesticides and overexpression of P450 genes can significantly affect the disposition of xenobiotics in the tissues of organisms, altering their pharmacological/toxicological effects. In insects, P450s play an important role in detoxifying exogenous compounds such as insecticides and plant toxins and their overexpression can result in increased levels of P450 proteins and P450 activities. This has been associated with enhanced metabolic detoxification of insecticides and has been implicated in the development of insecticide resistance in insects. Multiple P450 genes have been found to be co-overexpressed in individual insect species via several constitutive overexpression and induction mechanisms, which in turn are co-responsible for high levels of insecticide resistance. Many studies have also demonstrated that the transcriptional overexpression of P450 genes in resistant insects is regulated by trans and/or cis regulatory genes/factors. Taken together, these earlier findings suggest not only that insecticide resistance is conferred via multi-resistance P450 genes, but also that it is mediated through the interaction of regulatory genes/factors and resistance genes. This chapter reviews our current understanding of how the molecular mechanisms of P450 interaction/gene regulation govern the development of insecticide resistance in insects and our progress along the road to a comprehensive characterization of P450 detoxification-mediated insecticide resistance. Copyright © 2015 Elsevier Inc. All rights reserved.
[Hearing screening at nursery schools: results of an evaluation study].
Weichbold, Viktor; Rohrer, Monika; Winkler, Cornelia; Welzl-Müller, Kunigunde
2004-07-31
This study aimed to evaluate the hearing screening of pre-school children at nursery schools in Tyrol, Austria. 47 nursery schools with a total of 2199 enrolled children participated in the study. At the screening, the children were presented a series of tones at frequencies 0.5 kHz (25dB), 1 kHz, 2 kHz, 3 kHz, and 4 kHz (20 dB each) from portable audiometers. The tones were presented over headphones for each ear separately and at irregular intervals. Failure to respond to any of the frequencies was considered failure of the screening. Parents were then advised in written form to have the child examined by an ENT-specialist. 1832 individuals were screened (coverage: 83% of nursery school children; corresponding to at least 63% of all Tyrolean children aged 3 to 5 years). Of these, 390 failed the test (referral rate: 21% of all screened). Examination through an ENT-specialist occurred with 217 children, and this confirmed the positive test in 139 children (hit rate: 64%). In most cases, a temporary conductive hearing loss due to external or middle ear problems (glue ear, tube dysfunction, cerumen, otitis media) was diagnosed. A sensorineural hearing loss was found in 4 children (in 3 of them bilateral). The need for therapy was recognized in 81 children (4% of all screened). Pre-school hearing screening identifies children with ear and hearing problems that need therapeutical intervention. Although the hearing problems are mostly of a temporary nature, some may require monitoring over some period. Also some children with permanent sensorineural hearing loss may be detected through this measure. Hearing screening is an efficient means of assessing ear and hearing problems in pre-school children. However, the follow-up rate needs to be improved for optimizing the efficacy.
Effects of insecticide spray application on insect pest infestation and ...
African Journals Online (AJOL)
USER
2010-03-15
Mar 15, 2010 ... This study provides information on the incidence of major insect pests of cowpea as well as the minimum insecticide control intervention necessary for effectively reducing cowpea yield losses on the field. Two insecticide spray regimes (once at flowering and podding) significantly reduced insect population ...
Substances inertes et plantes à effet insecticide utilisées dans la ...
African Journals Online (AJOL)
Les insecticides naturels tels que les plantes à effet insecticide et les substances inertes (sable, cendre, terres à diatomées,…) méritent d'être valorisées afin de réduire l'utilisation des insecticides chimiques et protéger l'environnement. Ce travail basé sur une revue documentaire fouillée et actualisée vise à faire la genèse ...
Novel flow-through bioremediation system for removing nitrate from nursery discharge water.
Chris Wilson, P; Albano, Joseph P
2013-11-30
Nitrate losses in surface runoff water from nursery production areas can be significant. This study evaluated the potential use of microbial-based (denitrification), flow-through bioreactors for their nitrate-remediation ability. Duplicate bioreactor systems were constructed at a local foliage plant nursery. Each bioreactor system consisted of four 242 L tanks with connections alternating between bottom and top. Each tank was filled with approximately 113 L of Kaldness media to provide surface area for attachment of native microflora. Molasses was supplied as a carbon source for denitrification and water flow rates through the systems ranged from 5 to 18 L min(-1) during tests. Automatic water samplers were used to collect composite samples every 15 min from both the inflow and the exit flow water. Results indicate consistent removal of 80-100% of the nitrate flowing into the systems. Accumulation of ammoniacal and nitrite nitrogen did not occur, indicating that the nitrate-nitrogen was removed from the water, and not simply transformed into another water-soluble species. Occasions where removal rates were less than 80% were usually traced to faulty delivery of the carbon source. Results indicate that modular microbial-based bioremediation systems may be a useful tool for helping water managers meet stringent nitrogen water quality regulations, especially at nurseries with limited space for expansion of water retention facilities. Copyright © 2013 Elsevier Ltd. All rights reserved.
A systems approach for detecting sources of Phytophthora contamination in nurseries
Jennifer L. Parke; Niklaus Grünwald; Carrie Lewis; Val Fieland
2010-01-01
Nursery plants are also important long-distance vectors of non-indigenous pathogens such as P. ramorum and P. kernoviae. Pre-shipment inspections have not been adequate to ensure that shipped plants are free from Phytophthora, nor has this method informed growers about sources of contamination in their...
PID temperature controller in pig nursery: spatial characterization of thermal environment
de Souza Granja Barros, Juliana; Rossi, Luiz Antonio; Menezes de Souza, Zigomar
2018-05-01
The use of enhanced technologies of temperature control can improve the thermal conditions in environments of livestock facilities. The objective of this study was to evaluate the spatial distribution of the thermal environment variables in a pig nursery with a heating system with two temperature control technologies based on the geostatistical analysis. The following systems were evaluated: overhead electrical resistance with Proportional, Integral, and Derivative (PID) controller and overhead electrical resistance with a thermostat. We evaluated the climatic variables: dry bulb temperature (Tbs), air relative humidity (RH), temperature and humidity index (THI), and enthalpy in the winter, at 7:00, 12:00, and 18:00 h. The spatial distribution of these variables was mapped by kriging. The results showed that the resistance heating system with PID controllers improved the thermal comfort conditions in the pig nursery in the coldest hours, maintaining the spatial distribution of the air temperature more homogeneous in the pen. During the hottest weather, neither system provided comfort.
PID temperature controller in pig nursery: spatial characterization of thermal environment
de Souza Granja Barros, Juliana; Rossi, Luiz Antonio; Menezes de Souza, Zigomar
2017-11-01
The use of enhanced technologies of temperature control can improve the thermal conditions in environments of livestock facilities. The objective of this study was to evaluate the spatial distribution of the thermal environment variables in a pig nursery with a heating system with two temperature control technologies based on the geostatistical analysis. The following systems were evaluated: overhead electrical resistance with Proportional, Integral, and Derivative (PID) controller and overhead electrical resistance with a thermostat. We evaluated the climatic variables: dry bulb temperature (Tbs), air relative humidity (RH), temperature and humidity index (THI), and enthalpy in the winter, at 7:00, 12:00, and 18:00 h. The spatial distribution of these variables was mapped by kriging. The results showed that the resistance heating system with PID controllers improved the thermal comfort conditions in the pig nursery in the coldest hours, maintaining the spatial distribution of the air temperature more homogeneous in the pen. During the hottest weather, neither system provided comfort.
Intergenerational transmission of attachment for infants raised in a prison nursery.
Byrne, M W; Goshin, L S; Joestl, S S
2010-07-01
Within a larger intervention study, attachment was assessed with the Strange Situation Procedure for 30 infants who co-resided with their mothers in a prison nursery. Sixty percent of infants were classified secure, 75% who co-resided a year or more and 43% who co-resided less than a year, all within the range of normative community samples. The year-long co-residing group had significantly more secure and fewer disorganized infants than predicted by their mothers' attachment status, measured by the Adult Attachment Interview, and a significantly greater proportion of secure infants than meta-analyzed community samples of mothers with low income, depression, or drug/alcohol abuse. Using intergenerational data collected with rigorous methods, this study provides the first evidence that mothers in a prison nursery setting can raise infants who are securely attached to them at rates comparable to healthy community children, even when the mother's own internal attachment representation has been categorized as insecure.
PID temperature controller in pig nursery: spatial characterization of thermal environment.
de Souza Granja Barros, Juliana; Rossi, Luiz Antonio; Menezes de Souza, Zigomar
2017-11-28
The use of enhanced technologies of temperature control can improve the thermal conditions in environments of livestock facilities. The objective of this study was to evaluate the spatial distribution of the thermal environment variables in a pig nursery with a heating system with two temperature control technologies based on the geostatistical analysis. The following systems were evaluated: overhead electrical resistance with Proportional, Integral, and Derivative (PID) controller and overhead electrical resistance with a thermostat. We evaluated the climatic variables: dry bulb temperature (Tbs), air relative humidity (RH), temperature and humidity index (THI), and enthalpy in the winter, at 7:00, 12:00, and 18:00 h. The spatial distribution of these variables was mapped by kriging. The results showed that the resistance heating system with PID controllers improved the thermal comfort conditions in the pig nursery in the coldest hours, maintaining the spatial distribution of the air temperature more homogeneous in the pen. During the hottest weather, neither system provided comfort.
Effects of insecticide spray application on insect pest infestation and ...
African Journals Online (AJOL)
Field studies were conducted during the 2008 - 2009 cropping season to determine the minimal insecticide application which can reduce cowpea yield losses on the field due to insect pest infestations in the Transkei region of South Africa. Treatments consisted of five cowpea varieties and four regimes of insecticide spray ...
Insecticide resistance status of Aedes aegypti (L.) from Colombia.
Fonseca-González, Idalyd; Quiñones, Martha L; Lenhart, Audrey; Brogdon, William G
2011-04-01
To evaluate the insecticide susceptibility status of Aedes aegypti (L.) in Colombia, and as part of the National Network of Insecticide Resistance Surveillance, 12 mosquito populations were assessed for resistance to pyrethroids, organophosphates and DDT. Bioassays were performed using WHO and CDC methodologies. The underlying resistance mechanisms were investigated through biochemical assays and RT-PCR. All mosquito populations were susceptible to malathion, deltamethrin and cyfluthrin, and highly resistant to DDT and etofenprox. Resistance to lambda-cyhalothrin, permethrin and fenitrothion ranged from moderate to high in some populations from Chocó and Putumayo states. In Antioquia state, the Santa Fe population was resistant to fenitrothion. Biochemical assays showed high levels of both cytochrome P450 monooxygenases (CYP) and non-specific esterases (NSE) in some of the fenitrothion- and pyrethroid-resistant populations. All populations showed high levels of glutathione-S-transferase (GST) activity. GSTe2 gene was found overexpressed in DDT-resistant populations compared with Rockefeller susceptible strain. Differences in insecticide resistance status were observed between insecticides and localities. Although the biochemical assay results suggest that CYP and NSE could play an important role in the pyrethroid and fenitrothion resistance detected, other mechanisms remain to be investigated, including knockdown resistance. Resistance to DDT was high in all populations, and GST activity is probably the main enzymatic mechanism associated with this resistance. The results of this study provide baseline data on insecticide resistance in Colombian A. aegypti populations, and will allow comparison of changes in susceptibility status in this vector over time. Copyright © 2011 Society of Chemical Industry.
Underpinning sustainable vector control through informed insecticide resistance management.
Directory of Open Access Journals (Sweden)
Edward K Thomsen
Full Text Available There has been rapid scale-up of malaria vector control in the last ten years. Both of the primary control strategies, long-lasting pyrethroid treated nets and indoor residual spraying, rely on the use of a limited number of insecticides. Insecticide resistance, as measured by bioassay, has rapidly increased in prevalence and has come to the forefront as an issue that needs to be addressed to maintain the sustainability of malaria control and the drive to elimination. Zambia's programme reported high levels of resistance to the insecticides it used in 2010, and, as a result, increased its investment in resistance monitoring to support informed resistance management decisions.A country-wide survey on insecticide resistance in Zambian malaria vectors was performed using WHO bioassays to detect resistant phenotypes. Molecular techniques were used to detect target-site mutations and microarray to detect metabolic resistance mechanisms. Anopheles gambiae s.s. was resistant to pyrethroids, DDT and carbamates, with potential organophosphate resistance in one population. The resistant phenotypes were conferred by both target-site and metabolic mechanisms. Anopheles funestus s.s. was largely resistant to pyrethroids and carbamates, with potential resistance to DDT in two locations. The resistant phenotypes were conferred by elevated levels of cytochrome p450s.Currently, the Zambia National Malaria Control Centre is using these results to inform their vector control strategy. The methods employed here can serve as a template to all malaria-endemic countries striving to create a sustainable insecticide resistance management plan.
Expression, Delivery and Function of Insecticidal Proteins Expressed by Recombinant Baculoviruses
Kroemer, Jeremy A.; Bonning, Bryony C.; Harrison, Robert L.
2015-01-01
Since the development of methods for inserting and expressing genes in baculoviruses, a line of research has focused on developing recombinant baculoviruses that express insecticidal peptides and proteins. These recombinant viruses have been engineered with the goal of improving their pesticidal potential by shortening the time required for infection to kill or incapacitate insect pests and reducing the quantity of crop damage as a consequence. A wide variety of neurotoxic peptides, proteins that regulate insect physiology, degradative enzymes, and other potentially insecticidal proteins have been evaluated for their capacity to reduce the survival time of baculovirus-infected lepidopteran host larvae. Researchers have investigated the factors involved in the efficient expression and delivery of baculovirus-encoded insecticidal peptides and proteins, with much effort dedicated to identifying ideal promoters for driving transcription and signal peptides that mediate secretion of the expressed target protein. Other factors, particularly translational efficiency of transcripts derived from recombinant insecticidal genes and post-translational folding and processing of insecticidal proteins, remain relatively unexplored. The discovery of RNA interference as a gene-specific regulation mechanism offers a new approach for improvement of baculovirus biopesticidal efficacy through genetic modification. PMID:25609310
Insecticide resistance and resistance mechanisms in bed bugs, Cimex spp. (Hemiptera: Cimicidae).
Dang, Kai; Doggett, Stephen L; Veera Singham, G; Lee, Chow-Yang
2017-06-29
The worldwide resurgence of bed bugs [both Cimex lectularius L. and Cimex hemipterus (F.)] over the past two decades is believed in large part to be due to the development of insecticide resistance. The transcriptomic and genomic studies since 2010, as well as morphological, biochemical and behavioral studies, have helped insecticide resistance research on bed bugs. Multiple resistance mechanisms, including penetration resistance through thickening or remodelling of the cuticle, metabolic resistance by increased activities of detoxification enzymes (e.g. cytochrome P450 monooxygenases and esterases), and knockdown resistance by kdr mutations, have been experimentally identified as conferring insecticide resistance in bed bugs. Other candidate resistance mechanisms, including behavioral resistance, some types of physiological resistance (e.g. increasing activities of esterases by point mutations, glutathione S-transferase, target site insensitivity including altered AChEs, GABA receptor insensitivity and altered nAChRs), symbiont-mediated resistance and other potential, yet undiscovered mechanisms may exist. This article reviews recent studies of resistance mechanisms and the genes governing insecticide resistance, potential candidate resistance mechanisms, and methods of monitoring insecticide resistance in bed bugs. This article provides an insight into the knowledge essential for the development of both insecticide resistance management (IRM) and integrated pest management (IPM) strategies for successful bed bug management.
Genetics, Synergists, and Age Affect Insecticide Sensitivity of the Honey Bee, Apis mellifera
Rinkevich, Frank D.; Margotta, Joseph W.; Pittman, Jean M.; Danka, Robert G.; Tarver, Matthew R.; Ottea, James A.; Healy, Kristen B.
2015-01-01
The number of honey bee colonies in the United States has declined to half of its peak level in the 1940s, and colonies lost over the winter have reached levels that are becoming economically unstable. While the causes of these losses are numerous and the interaction between them is very complex, the role of insecticides has garnered much attention. As a result, there is a need to better understand the risk of insecticides to bees, leading to more studies on both toxicity and exposure. While much research has been conducted on insecticides and bees, there have been very limited studies to elucidate the role that bee genotype and age has on the toxicity of these insecticides. The goal of this study was to determine if there are differences in insecticide sensitivity between honey bees of different genetic backgrounds (Carniolan, Italian, and Russian stocks) and assess if insecticide sensitivity varies with age. We found that Italian bees were the most sensitive of these stocks to insecticides, but variation was largely dependent on the class of insecticide tested. There were almost no differences in organophosphate bioassays between honey bee stocks (bees aged, the sensitivity to phenothrin significantly decreased, but the sensitivity to naled significantly increased. These results demonstrate the variation arising from the genetic background and physiological transitions in honey bees as they age. This information can be used to determine risk assessment, as well as establishing baseline data for future comparisons to explain the variation in toxicity differences for honey bees reported in the literature. PMID:26431171
Directory of Open Access Journals (Sweden)
Liu Yangyang
2011-12-01
Full Text Available Abstract Background In China, large amounts of chemical insecticides are applied in fields or indoors every year, directly or indirectly bringing selection pressure on vector mosquitoes. Culex pipiens complex has evolved to be resistant to all types of chemical insecticides, especially organophosphates, through carboxylesterases. Six resistant carboxylesterase alleles (Ester were recorded previously and sometimes co-existed in one field population, representing a complex situation for the evolution of Ester genes. Results In order to explore the evolutionary scenario, we analyzed the data from an historical record in 2003 and a recent investigation on five Culex pipiens pallens populations sampled from north China in 2010. Insecticide bioassays showed that these five populations had high resistance to pyrethroids, medium resistance to organophosphates, and low resistance to carbamates. Six types of Ester alleles, EsterB1, Ester2, Ester8, Ester9, EsterB10, and Ester11 were identified, and the overall pattern of their frequencies in geographic distribution was consistent with the report seven years prior to this study. Statistical correlation analysis indicated that Ester8 and Ester9 positively correlated with resistance to four insecticides, and EsterB10 to one insecticide. The occurrences of these three alleles were positively correlated, while the occurrence of EsterB1 was negatively correlated with Ester8, indicating an allelic competition. Conclusion Our analysis suggests that one insecticide can select multiple Ester alleles and one Ester allele can work on multiple insecticides. The evolutionary scenario of carboxylesterases under insecticide selection is possibly "one to many".
Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei
Directory of Open Access Journals (Sweden)
D.C. Pathak
2011-07-01
Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.
Plant compounds insecticide activity against Coleoptera pests of stored products
Energy Technology Data Exchange (ETDEWEB)
Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br
2007-07-15
The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)
Household use of insecticide consumer products in a dengue-endemic area in México.
Loroño-Pino, María Alba; Chan-Dzul, Yamili N; Zapata-Gil, Rocio; Carrillo-Solís, Claudia; Uitz-Mena, Ana; García-Rejón, Julián E; Keefe, Thomas J; Beaty, Barry J; Eisen, Lars
2014-10-01
To evaluate the household use of insecticide consumer products to kill mosquitoes and other insect pests, as well as the expenditures for using these products, in a dengue-endemic area of México. A questionnaire was administered to 441 households in Mérida City and other communities in Yucatán to assess household use of insecticide consumer products. A total of 86.6% of surveyed households took action to kill insect pests with consumer products. The most commonly used product types were insecticide aerosol spray cans (73.6%), electric plug-in insecticide emitters (37.4%) and mosquito coils (28.3%). Mosquitoes were targeted by 89.7% of households using insecticide aerosol spray cans and >99% of households using electric plug-in insecticide emitters or mosquito coils. Products were used daily or every 2 days in most of the households for insecticide aerosol spray cans (61.4%), electric plug-in insecticide emitters (76.2%) and mosquito coils (82.1%). For all products used to kill insect pests, the median annual estimated expenditure per household that took action was 408 Mexican pesos ($MXN), which corresponded to approximately 31 $US. These numbers are suggestive of an annual market in excess of 75 million $MXN (>5.7 million $US) for Mérida City alone. Mosquitoes threaten human health and are major nuisances in homes in the study area in México. Households were found to have taken vigorous action to kill mosquitoes and other insect pests and spent substantial amounts of money on insecticide consumer products. © 2014 John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Glyndon E. Hatchell, Research Forester, Retired Institute for Mycorrhizal Research and Development Athens, Georgia and H. David Muse, Professor Department of Mathematics University of North Alabama Florence, Alabama
1990-01-01
A large study of morphological attributes of longleaf pine nursery stock at the Savannah River site of the various attributes measured, only number of lateral roots and seedling diameters were related to performance. Lateral root pruning in the nursery also improved performance. Both survival and growth during the first two years were strongly correlated with larger stem diameter and larger root system development
Leach, Heather; Wise, John C; Isaacs, Rufus
2017-12-01
High tunnels are large protective structures used for season extension of many crops, including raspberries. These structures are often covered in plastic films to reduce and diffuse ultraviolet light transmission for pest and disease control, but this may also affect the photodegradation and efficacy of pesticides applied under these tunnels. We compared the residue levels of ten insecticides under three tunnel plastics with varying levels of UV transmission and open field conditions. Raspberry plants placed in research-scale tunnels were treated with insecticides and residues on fruit and foliage were monitored for one or two weeks in early 2015 and early and late 2016. Plastics that reduce UV transmission resulted in 50% greater residues of some insecticides compared to transparent plastics, and 60% compared to uncovered tunnels. This increased persistence of residues was evident within 1 day and remained consistently higher for up to 14 days. This pattern was demonstrated for multiple insecticides, including bifenthrin, esfenvalerate, imidacloprid, thiamethoxam, and spinosad. In contrast, the insecticide malathion degraded rapidly regardless of the plastic treatment, indicating less sensitivity to photodegradation. Bioassays using insecticide-treated leaves that were under UV-blocking plastic revealed higher mortality of the invasive fruit pest, Drosophila suzukii, compared to leaves that were uncovered. This indicates that the activity of pesticides under high tunnels covered in UV-reducing plastics may be prolonged, allowing for fewer insecticide applications and longer intervals between sprays. This information can be used to help optimize pest control in protected culture berry production. Copyright © 2017 Elsevier Ltd. All rights reserved.
Evolution of insecticide resistance in non-target black flies (Diptera: Simuliidae from Argentina
Directory of Open Access Journals (Sweden)
Cristina Mónica Montagna
2012-06-01
Full Text Available Black flies, a non-target species of the insecticides used in fruit production, represent a severe medical and veterinary problem. Large increases in the level of resistance to the pyrethroids fenvalerate (more than 355-fold and deltamethrin (162-fold and a small increase in resistance to the organophosphate azinphos methyl (2-fold were observed between 1996-2008 in black fly larvae under insecticide pressure. Eventually, no change or a slight variation in insecticide resistance was followed by a subsequent increase in resistance. The evolution of pesticide resistance in a field population is a complex and stepwise process that is influenced by several factors, the most significant of which is the insecticide selection pressure, such as the dose and frequency of application. The variation in insecticide susceptibility within a black fly population in the productive area may be related to changes in fruit-pest control. The frequency of individuals with esterase activities higher than the maximum value determined in the susceptible population increased consistently over the sampling period. However, the insecticide resistance was not attributed to glutathione S-transferase activity. In conclusion, esterase activity in black flies from the productive area is one mechanism underlying the high levels of resistance to pyrethroids, which have been recently used infrequently. These enzymes may be reselected by currently used pesticides and enhance the resistance to these insecticides.
Evolution of insecticide resistance in non-target black flies (Diptera: Simuliidae) from Argentina.
Montagna, Cristina Mónica; Gauna, Lidia Ester; D'Angelo, Ana Pechen de; Anguiano, Olga Liliana
2012-06-01
Black flies, a non-target species of the insecticides used in fruit production, represent a severe medical and veterinary problem. Large increases in the level of resistance to the pyrethroids fenvalerate (more than 355-fold) and deltamethrin (162-fold) and a small increase in resistance to the organophosphate azinphos methyl (2-fold) were observed between 1996-2008 in black fly larvae under insecticide pressure. Eventually, no change or a slight variation in insecticide resistance was followed by a subsequent increase in resistance. The evolution of pesticide resistance in a field population is a complex and stepwise process that is influenced by several factors, the most significant of which is the insecticide selection pressure, such as the dose and frequency of application. The variation in insecticide susceptibility within a black fly population in the productive area may be related to changes in fruit-pest control. The frequency of individuals with esterase activities higher than the maximum value determined in the susceptible population increased consistently over the sampling period. However, the insecticide resistance was not attributed to glutathione S-transferase activity. In conclusion, esterase activity in black flies from the productive area is one mechanism underlying the high levels of resistance to pyrethroids, which have been recently used infrequently. These enzymes may be reselected by currently used pesticides and enhance the resistance to these insecticides.
Advance innovations of an intelligent sprayer for nursery and fruit tree crops
Conventional spray application technology requires excessive amounts of pesticide use to achieve effective pest control in floral, nursery, and other specialty crop productions. This onerous challenge is now overcome by our newly developed automated variable-rate, air-assisted precision sprayer. Thi...
Archambault, B.; Rivot, E.; Savina, M.; Le Pape, O.
2018-02-01
Exploited coastal-nursery-dependent fish species are subject to various stressors occurring at specific stages of the life cycle: climate-driven variability in hydrography determines the success of the first eggs/larvae stages; coastal nursery habitat suitability controls juvenile growth and survival; and fisheries target mostly adults. A life cycle approach was used to quantify the relative influence of these stressors on the Eastern English Channel (EEC) population of the common sole (Solea solea), a coastal-nursery-dependent flatfish population which sustains important fisheries. The common sole has a complex life cycle: after eggs hatch, larvae spend several weeks drifting in open water. Survivors go on to metamorphose into benthic fish. Juveniles spend the first two years of their life in coastal and estuarine nurseries. Close to maturation, they migrate to deeper areas, where different subpopulations supplied by different nurseries reproduce and are exploited by fisheries. A spatially structured age-and stage-based hierarchical Bayesian model integrating various aspects of ecological knowledge, data sources and expert knowledge was built to quantitatively describe this complex life cycle. The model included the low connectivity among three subpopulations in the EEC, the influence of hydrographic variability, the availability of suitable juvenile habitat and fisheries. Scenarios were designed to quantify the effects of interacting stressors on population renewal. Results emphasized the importance of coastal nursery habitat availability and quality for the population renewal. Realistic restoration scenarios of the highly degraded Seine estuary produced a two-third increase in catch potential for the adjacent subpopulation. Fisheries, however, remained the main source of population depletion. Setting fishing mortality to the maximum sustainable yield led to substantial increases in biomass (+100%) and catch (+33%) at the EEC scale. The approach also showed how
Insecticide resistance in vector Chagas disease: evolution, mechanisms and management.
Mougabure-Cueto, Gastón; Picollo, María Inés
2015-09-01
Chagas disease is a chronic parasitic infection restricted to America. The disease is caused by the protozoa Trypanosoma cruzi, which is transmitted to human through the feces of infected triatomine insects. Because no treatment is available for the chronic forms of the disease, vector chemical control represents the best way to reduce the incidence of the disease. Chemical control has been based principally on spraying dwellings with insecticide formulations and led to the reduction of triatomine distribution and consequent interruption of disease transmission in several areas from endemic region. However, in the last decade it has been repeatedly reported the presence triatomnes, mainly Triatoma infestans, after spraying with pyrethroid insecticides, which was associated to evolution to insecticide resistance. In this paper the evolution of insecticide resistance in triatomines is reviewed. The insecticide resistance was detected in 1970s in Rhodnius prolixus and 1990s in R. prolixus and T. infestans, but not until the 2000s resistance to pyrthroids in T. infestans associated to control failures was described in Argentina and Bolivia. The main resistance mechanisms (i.e. enhanced metabolism, altered site of action and reduced penetration) were described in the T. infestans resistant to pyrethrods. Different resistant profiles were demonstrated suggesting independent origin of the different resistant foci of Argentina and Bolivia. The deltamethrin resistance in T. infestans was showed to be controlled by semi-dominant, autosomally inherited factors. Reproductive and developmental costs were also demonstrated for the resistant T. infestans. A discussion about resistance and tolerance concepts and the persistence of T. infestans in Gran Chaco region are presented. In addition, theoretical concepts related to toxicological, evolutionary and ecological aspects of insecticide resistance are discussed in order to understand the particular scenario of pyrethroid
Influence on sensitivity to insecticides: a case study of a settled area ...
African Journals Online (AJOL)
monitoring for successful alternative insecticides. There are currently two ... behaviour or modification avoid landing on insecticide .... aquarium fish food18. When they .... National Statistical Office (NSO) Malawi Government 1998 Census. 16.
Habitat quality of a subarctic nursery ground for 0-group plaice ( Pleuronectes platessa L.)
Freitas, Vânia; Campos, Joana; Skreslet, Stig; van der Veer, Henk W.
2010-07-01
Habitat quality of a subarctic nursery ground in northern Norway for 0-group plaice Pleuronectes platessa was investigated by following settlement, mortality and growth during 2005 and 2006. Newly settled individuals were first observed in the end of May to early June and settlement lasted until mid-July. Densities peaked in early July and were comparable to those reported in temperate nursery grounds. Mortality estimates after settlement differed between 0.062 d -1 in 2005 and 0.025 d -1 in 2006. Potential predators appeared to be rather similar as those reported in other areas: the brown shrimp Crangoncrangon, the shore crab Carcinus maenas and demersal fish species (gadoids). Population mean growth indicated linear growth until August leveling-off afterwards. 0-group plaice reached a lower mean size (5-6 cm) at the end of the growing season than in temperate areas probably due to later settlement timing in combination with lower summer-autumn water temperatures. The comparison of observed growth rates with predictions of maximum growth models indicated a similar pattern as observed in temperate nursery grounds: Growth appeared to be maximal except for the period after summer. Whether or not this was related to changes in food quality throughout the season, to interspecies competition or to emigration remains to be elucidated.
Moyes, Catherine L; Vontas, John; Martins, Ademir J; Ng, Lee Ching; Koou, Sin Ying; Dusfour, Isabelle; Raghavendra, Kamaraju; Pinto, João; Corbel, Vincent; David, Jean-Philippe; Weetman, David
2017-07-01
Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus), making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids). Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance.
Vontas, John; Martins, Ademir J.; Ng, Lee Ching; Koou, Sin Ying; Dusfour, Isabelle; Raghavendra, Kamaraju; Pinto, João; Corbel, Vincent; David, Jean-Philippe; Weetman, David
2017-01-01
Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus), making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids). Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance. PMID:28727779
Directory of Open Access Journals (Sweden)
Catherine L Moyes
2017-07-01
Full Text Available Both Aedes aegytpi and Ae. albopictus are major vectors of 5 important arboviruses (namely chikungunya virus, dengue virus, Rift Valley fever virus, yellow fever virus, and Zika virus, making these mosquitoes an important factor in the worldwide burden of infectious disease. Vector control using insecticides coupled with larval source reduction is critical to control the transmission of these viruses to humans but is threatened by the emergence of insecticide resistance. Here, we review the available evidence for the geographical distribution of insecticide resistance in these 2 major vectors worldwide and map the data collated for the 4 main classes of neurotoxic insecticide (carbamates, organochlorines, organophosphates, and pyrethroids. Emerging resistance to all 4 of these insecticide classes has been detected in the Americas, Africa, and Asia. Target-site mutations and increased insecticide detoxification have both been linked to resistance in Ae. aegypti and Ae. albopictus but more work is required to further elucidate metabolic mechanisms and develop robust diagnostic assays. Geographical distributions are provided for the mechanisms that have been shown to be important to date. Estimating insecticide resistance in unsampled locations is hampered by a lack of standardisation in the diagnostic tools used and by a lack of data in a number of regions for both resistance phenotypes and genotypes. The need for increased sampling using standard methods is critical to tackle the issue of emerging insecticide resistance threatening human health. Specifically, diagnostic doses and well-characterised susceptible strains are needed for the full range of insecticides used to control Ae. aegypti and Ae. albopictus to standardise measurement of the resistant phenotype, and calibrated diagnostic assays are needed for the major mechanisms of resistance.
Household use of insecticide consumer products in a dengue endemic area in México
Loroño-Pino, María Alba; Chan-Dzul, Yamili N.; Zapata-Gil, Rocio; Carrillo-Solís, Claudia; Uitz-Mena, Ana; García-Rejón, Julián E.; Keefe, Thomas J.; Beaty, Barry J.; Eisen, Lars
2014-01-01
Objectives To evaluate household use of insecticide consumer products to kill mosquitoes and other insect pests, as well as the expenditures for using these products, in a dengue endemic area in México. Methods A questionnaire was administered to 441 households in Mérida City or other communities in Yucatán State to assess household use of insecticide consumer products. Results Most (86.6%) households took action to kill insect pests with consumer products. Among those households, the most commonly used product types were insecticide aerosol spray cans (73.6%), electric plug-in insecticide emitters (37.4%), and mosquito coils (28.3%). Mosquitoes were targeted by 89.7% of households using insecticide aerosol spray cans and >99% of households using electric plug-in insecticide emitters or mosquito coils. During the part of the year when a given product type was used, the frequency of use was daily or every 2 days in most of the households for insecticide aerosol spray cans (61.4%), electric plug-in insecticide emitters (76.2%), and mosquito coils (82.1%). For all products used to kill insect pests, the median annual estimated expenditure per household that took action was 408 Mexican pesos ($MXN), which corresponded to ∼31 $U.S. These numbers are suggestive of an annual market in excess of 75 million $MXN (>5.7 million $U.S.) for Mérida City alone. Conclusion Mosquitoes threaten human health and are major nuisances in homes in the study area in México. Households were found to have taken vigorous action to kill mosquitoes and other insect pests and spent substantial amounts of money on insecticide consumer products. PMID:25040259
The evolution of insecticide resistance in the peach potato aphid, Myzus persicae.
Bass, Chris; Puinean, Alin M; Zimmer, Christoph T; Denholm, Ian; Field, Linda M; Foster, Stephen P; Gutbrod, Oliver; Nauen, Ralf; Slater, Russell; Williamson, Martin S
2014-08-01
The peach potato aphid, Myzus persicae is a globally distributed crop pest with a host range of over 400 species including many economically important crop plants. The intensive use of insecticides to control this species over many years has led to populations that are now resistant to several classes of insecticide. Work spanning over 40 years has shown that M. persicae has a remarkable ability to evolve mechanisms that avoid or overcome the toxic effect of insecticides with at least seven independent mechanisms of resistance described in this species to date. The array of novel resistance mechanisms, including several 'first examples', that have evolved in this species represents an important case study for the evolution of insecticide resistance and also rapid adaptive change in insects more generally. In this review we summarise the biochemical and molecular mechanisms underlying resistance in M. persicae and the insights study of this topic has provided on how resistance evolves, the selectivity of insecticides, and the link between resistance and host plant adaptation. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.
North Carolina State Dept. of Human Resources, Raleigh. Div. of Mental Health, Mental Retardation and Substance Abuse Services.
This document consists of a combination of two separately published fact sheets, one on crisis nursery care for children at risk of abuse or neglect and one on respite care for families of children with disabilities or chronic illness. The fact sheet on crisis nursery care presents background information on the federal role in developing crisis…
Alves, Fabiana Bt; Wambier, Denise S; Alvarez, Jenny Ha; da Rocha, José Cf; Kummer, Thais R; de Castro, Vanessa C; Cabral, Howard; Kozlowski, Vitoldo A
2016-09-01
This study evaluated the expression of nonnutritive sucking habits and the presence of malocclusion in children using day nurseries' facilities. The 195 children (7-40 months) attending 18 public day nurseries were evaluated clinically in Ponta Grossa, Brazil. Statistical package software was used for descriptive, univariate, bivariate, and multiple logistic regressions of the data about the socioeconomic condition, educational family status, malocclusions, and prevalence of nonnutritive sucking habits among the children. The pacifier users had a statistically significant, explanatory association with open bite [odds ratio (OR) = 10.97; 95% confidence interval (CI): 4.95, 24.31; p < 0.0001]. The children older than 25 months had more open bite than younger children (OR = 6.07; 95% CI: 2.81, 13.11; p < 0.0001). Of the children examined, 35.4% had an anterior open bite, 0.51% had posterior cross-bite, and 1.03% showed finger-sucking habits. A high frequency of pacifier-sucking habits was found (52%), with a significant association between this habit and anterior open bite (p < 0.0001, OR = 7.49; 95% CI: 3.71, 15.15). The 126 children without open bite (36.5%) were pacifier users. There was suggestive, though nonsignificant, evidence of a difference in pacifier use by gender (males, 34%; females, 46%; p = 0.07). The 69 children with open bite (81.16%) were pacifier users and (18.84%) nonusers. The boys showed a slightly greater association with open bite (OR = 21.33; 95% CI: 6.12, 74.40; p < 0.0001) than girls (OR = 5.03; 95% CI: 1.26, 20.00; p = 0.02) in the age group of 25 to 40 months; however, it was not observed in younger children. Pacifier use is a predictor for open bite in children from the lower socioeconomic classes using day nurseries' facilities. The parents, guardians, and caregivers working in public day nurseries should be advised to monitor nonnutritive sucking habits in order to avoid or minimize the occurrence of malocclusion. It demonstrates that
Root Rot Disease of Five Fruit Tree Seedlings in the Nursery ...
African Journals Online (AJOL)
The incidence of root rot disease in the nursery of Chrysophyllum albidun Dacryodes edulis, persea Americana, Irvingia gabonensis and Annona muricala was assessed. Ten fungal pathogen were isolated using serial dilution and pathogenicity tests were carried out on the 5 fruit trees with the 10 isolated fungi. The 5 fruit ...
Playful and Creative ICT Pedagogical Framing: A Nursery School Case Study
Roberts-Holmes, Guy
2014-01-01
This article reports on the findings of a one-year qualitative study in which a nursery school used information and communication technology (ICT) and a digital media consultant as a catalyst for cultural change leading to teachers' improved pedagogical framing and children's enhanced learning dispositions. The pedagogic framing included the…
Establishment of northern red oak genetic tests with nursery-graded seedlings
S. A. Lay; M. A. Remaley; S. E. Schlarbaum; P. P. Kormanik; T. Tibbs; R. A. Cox; T. LaFarge; A. M. Saxton
1997-01-01
Artificial regeneration of northern red oak (Quercus rubra L.) has had variable success over time. Current nursery practices generally involve the growth of seedlings to a standardized height and form with little regard to seed source, seedling quality, or subsequent field performance. Additionally, there is not an accepted culling criteria for...
Combining the essential oil of Piper aduncum L. with commercial insecticides
Directory of Open Access Journals (Sweden)
Murilo Fazolin
2016-12-01
Full Text Available The use of synergists is important to minimize the amount of chemical insecticide required for insect control. Their use may contribute to reducing environmental contamination and preserving beneficial insects. The aim of this study was to evaluate the synergy and uniformity of the response of Spodoptera frugiperda (Noctuidae larvae to doses of an essential oil of an Amazon chemotype, Piper aduncum (Piperaceae, when combinationed with the following commercial insecticides: cypermethrin, zeta-cypermethrin, permethrin and esfenvarelate, compared to piperonyl butoxide (PBO. Through the relationship between CL50 and DL50 of insecticides taken separately and their synergistic combinations with the essential oil and PBO, synergism factors (SF were obtained for comparison with each other. With residual contact, there was a significant enhancement of commercial insecticides formulated with cypermethrin (SF = 73.03, zeta-cypermethrin (SF = 16.51 and permethrin (SF = 8.46-17.22, when combined with the P. aduncum essential oil; in turn, with topical application, there was only an observed significant enhancement for zeta-cypermethrin (SF = 0.40-4.26, permethrin (SF = 2.10-4.79 and esfenvarelate (SF = 3.80 insecticides when combined with the essential oil. With the exception of esfenvarelate, the other synergistic combinations showed homogeneous responses for topical application and residual contact for at least one synergistic combination with P. aduncum essential oil. The significance of the SF values from combining P. aduncum essential oil with cypermethrin, zeta-cypermethrin, permethrin and esfenvarelate insecticides may indicate that this essential oil is an alternative option to PBO.
Antifeedant and insecticidal activity of Polygonum persicaria extracts on Nomophila indistinctalis
Directory of Open Access Journals (Sweden)
Luisa Quesada-Romero
2017-05-01
Full Text Available Context: Vegetal extracts represent an alternative to control against agricultural pests that have become resistant to pesticides. Using natural products is considered to be more friendly to the environment and safe. Aims: To determine the insecticidal and antifeedant activity of Polygonum persicaria extracts of two differents populations in Chile (Valparaiso and Curico against Nomophila indistinctalis larvae. Methods: Insecticide Resistance Action Committee (IRAC susceptibility test was used to evaluate the insecticidal activity of the extracts at concentrations of 100, 250, 500 and 1000 mg/L; against first instar larvae of Nomophila indistinctalis. The antifeedant activity was evaluated to determine the percentage of consumption in third instar larvae on treatment. Results: When comparing the control and the treatment groups in the antifeedant activity assay, significant differences (p<0.05 were observed after 90 minutes of exposure. With respect to the insecticidal activity, all extracts showed significant effects at the applied concentrations compared to the negative control. Moreover, the dichloromethane extracts of Curico and Valparaiso at concentrations greater than 500 mg/L showed a similar insecticidal activity as compared to the commercial formulation Neem. Conclusions: This work presents for the first time the results of the anti-feeding and insecticide activity of ethanol, methanol, and dichloromethane extracts from Polygonum persicaria on Nomophila indistinctalis. The results show that the extracts of this species can be used as an alternative for biological control. In addition, the results obtained allow a bioguided fractionation for the identification of secondary metabolites present in these extracts.
Challenges and opportunities in South Africa’s indigenous plants industry: De Fynne Nursery
Directory of Open Access Journals (Sweden)
Edward Mabaya
2016-04-01
Full Text Available De Fynne Nursery, a black-owned agribusiness, has cemented a unique position in South Africa’s indigenous plants industry against all odds. With an undying passion for the horticulture industry, Jacky Goliath and Elton Jefthas, De Fynne’s cofounders, continue to live the dream that began in their backyard. Today, they sit in their new 22-hectare farm and muse over strategic decisions as they navigate the challenges of doing business in an emerging economy. This case study focuses on opportunities and challenges for De Fynne as it pushes into its next growth phase by looking at the changing competitive landscape, the balance between marketing existing products and innovating new products, and ways to become operationally efficient and profitable in both its nursery and the farm.
Effect of arbuscular mycorrhizal fungi and pesticides on Cynara cardunculus growth
Directory of Open Access Journals (Sweden)
M. MARIN
2008-12-01
Full Text Available Wild cardoon (Cynara cardunculus L. is a promising crop for biomass production. A nursery trial was conducted to investigate the effectiveness of mycorrhizal inoculation on the biomass yield of wild cardoon seedlings and the effect of the pesticides fosetyl-Al, folpet and propamocarb, as fungicides, and isofenphos, phoxim and oxamyl, as insecticides, on cardoon plant growth and the mycorrhization. The arbuscular mycorrhizal (AM fungi inocula were: commercial inoculum with Glomus mosseae spores, and an inoculum of a Glomus sp. strain (AMF-i isolated locally. Mycorrhizal inoculation with either inoculum increased cardoon shoot biomass compared to non-inoculated control plants. The pesticide applications had a neutral or positive effect on cardoon seedling growth. However, the AM fungi colonisation did not decrease except for plants colonised by G. mosseae and treated with the insecticides isofenphos and oxamyl. Thus, the mycorrhiza can survive to pesticide concentrations employed in commercial nursery, and enhance cardoon plant productivity.
Design, Synthesis and Insecticidal Activities of Novel Phenyl Substituted Isoxazolecarboxamides
Institute of Scientific and Technical Information of China (English)
LIU Peng-fei; ZHANG Ji-feng; YAN Tao; XIONG Li-xia; LI Zheng-ming
2012-01-01
Thirteen novel phenyl substituted isoxazolecarboxamides were synthesized,and their structures were characterized by 1H NMR,elementary analysis and high-resolution mass spectrometry(HRMS) techniques.Their evaluated insecticidal activities against oriental armyworm(Mythimna separata) indicate that the phcnyl substituted isoxazolecarboxamides exhibited moderate insecticidal activities,among which compounds 9c and 9k showed comparatively higher activities.
Metabolic control of the insecticides safety use
Directory of Open Access Journals (Sweden)
L.I. Solomenko
2016-06-01
Full Text Available The results of the conducted research affirm that the phosphororganic insecticides utilization can lead to the break in the nitrogen metabolism, breaking the protein formation, reducing the protein molecules renewal, causing the amino acid and amides accumulation in the active state. It has been revealed that the translocation and transformation of the insecticides under consideration are more closely connected with the changes of insoluble protein fraction. The stagnation point of the Phosphamide and Kaunter impact on the plant has been determined. And only the use of the preparation in optimal norms can influence stimulatingly the course of the process under consideration.
Agricultural insecticides threaten surface waters at the global scale.
Stehle, Sebastian; Schulz, Ralf
2015-05-05
Compared with nutrient levels and habitat degradation, the importance of agricultural pesticides in surface water may have been underestimated due to a lack of comprehensive quantitative analysis. Increasing pesticide contamination results in decreasing regional aquatic biodiversity, i.e., macroinvertebrate family richness is reduced by ∼30% at pesticide concentrations equaling the legally accepted regulatory threshold levels (RTLs). This study provides a comprehensive metaanalysis of 838 peer-reviewed studies (>2,500 sites in 73 countries) that evaluates, for the first time to our knowledge on a global scale, the exposure of surface waters to particularly toxic agricultural insecticides. We tested whether measured insecticide concentrations (MICs; i.e., quantified insecticide concentrations) exceed their RTLs and how risks depend on insecticide development over time and stringency of environmental regulation. Our analysis reveals that MICs occur rarely (i.e., an estimated 97.4% of analyses conducted found no MICs) and there is a complete lack of scientific monitoring data for ∼90% of global cropland. Most importantly, of the 11,300 MICs, 52.4% (5,915 cases; 68.5% of the sites) exceeded the RTL for either surface water (RTLSW) or sediments. Thus, the biological integrity of global water resources is at a substantial risk. RTLSW exceedances depend on the catchment size, sampling regime, and sampling date; are significantly higher for newer-generation insecticides (i.e., pyrethroids); and are high even in countries with stringent environmental regulations. These results suggest the need for worldwide improvements to current pesticide regulations and agricultural pesticide application practices and for intensified research efforts on the presence and effects of pesticides under real-world conditions.
Protocols for sagebrush seed processing and seedling production at the Lucky Peak Nursery
Clark D. Fleege
2010-01-01
This paper presents the production protocols currently practiced at the USDA Forest Service Lucky Peak Nursery (Boise, ID) for seed processing and bareroot and container seedling production for three subspecies of big sagebrush (Artemisia tridentata).
Insecticide resistance in the western flower thrips, Frankliniella occidentalis
DEFF Research Database (Denmark)
Jensen, Sten Erik
of acetylcholinesterase, the target site enzyme for methiocarb. The results from bioassays with synergists included indicated involvement of cytochrome P450- monooxygenases and esterases in methiocarb resistance in the most resistant populations. Selection with methiocarb on one of the populations to increase the level......The western flower thrips, Frankliniella occidentalis (Pergande) is a serious pest on a wide range of crops throughout the world. In Denmark F. occidentalis is a pest in greenhouses. F. occidentalis is difficult to control with insecticides because of its thigmokinetic behaviour and resistance...... to insecticides. Since F. occidentulis spread to become a worldwide pest in 1980’es, resistance to a number of different insecticides has been shown in many populations of F. occidentalis. This flower thrips has the potential of fast development of resistance owing to the short generation time, high fecundity...
Sternberg, Eleanore D; Waite, Jessica L; Thomas, Matthew B
2014-12-16
Control of mosquitoes requires the ability to evaluate new insecticides and to monitor resistance to existing insecticides. Monitoring tools should be flexible and low cost so that they can be deployed in remote, resource poor areas. Ideally, a bioassay should be able to simulate transient contact between mosquitoes and insecticides, and it should allow for excito-repellency and avoidance behaviour in mosquitoes. Presented here is a new bioassay, which has been designed to meet these criteria. This bioassay was developed as part of the Mosquito Contamination Device (MCD) project and, therefore, is referred to as the MCD bottle bioassay. Presented here are two experiments that serve as a proof-of-concept for the MCD bottle bioassay. The experiments used four insecticide products, ranging from fast-acting, permethrin-treated, long-lasting insecticide nets (LLINs) that are already widely used for malaria vector control, to the slower acting entomopathogenic fungus, Beauveria bassiana, that is currently being evaluated as a prospective biological insecticide. The first experiment used the MCD bottle to test the effect of four different insecticides on Anopheles stephensi with a range of exposure times (1 minute, 3 minutes, 1 hour). The second experiment is a direct comparison of the MCD bottle and World Health Organization (WHO) cone bioassay that tests a subset of the insecticides (a piece of LLIN and a piece of netting coated with B. bassiana spores) and a further reduced exposure time (5 seconds) against both An. stephensi and Anopheles gambiae. Immediate knockdown and mortality after 24 hours were assessed using logistic regression and daily survival was assessed using Cox proportional hazards models. Across both experiments, fungus performed much more consistently than the chemical insecticides but measuring the effect of fungus required monitoring of mosquito mortality over several days to a week. Qualitatively, the MCD bottle and WHO cone performed comparably
Anbarashan, Padmavathy; Gopalswamy, Poyyamoli
2013-07-15
The usage of synthetic fertilizers/insecticides in conventional farming has dramatically increased over the past decades. The aim of the study was to compare the effects of bio-pesticides and insecticides/pesticides on selected beneficial non targeted arthropods. Orders Collembola, Arachinida/Opiliones, Oribatida and Coleoptera were the main groups of arthropods found in the organic fields and Coleoptera, Oribatida, Gamasida and Collembola in conventional fields. Pesticides/insecticides had a significant effect on non-targeted arthropods order- Collembola, Arachinida/Opiliones, Hymenoptera and Thysonoptera were suppressed after pesticides/insecticides spraying. Bio-insecticides in organic fields had a non-significant effect on non targeted species and they started to increase in abundance after 7 days of spraying, whereas insecticide treatment in conventional fields had a significant long-term effect on non targeted arthropods and short term effect on pests/insects, it started to increase after 21 days of the spraying. These results indicate that insecticide treatment kept non targeted arthropods at low abundance. In conclusion, organic farming does not significantly affected the beneficial-non targeted arthropods biodiversity, whereas preventive insecticide application in conventional fields had significant negative effects on beneficial non targeted arthropods. Therefore, conventional farmers should restrict insecticide applications, unless pest densities reach the thresholds and more desirably can switch to organic farming practices.
Nagelkerken, I.; van der Velde, G.; Gorissen, M. W.; Meijer, G. J.; Van't Hof, T.; den Hartog, C.
2000-07-01
The nursery function of various biotopes for coral reef fishes was investigated on Bonaire, Netherlands Antilles. Length and abundance of 16 commercially important reef fish species were determined by means of visual censuses during the day in six different biotopes: mangrove prop-roots ( Rhizophora mangle) and seagrass beds ( Thalassia testudinum) in Lac Bay, and four depth zones on the coral reef (0 to 3 m, 3 to 5 m, 10 to 15 m and 15 to 20 m). The mangroves, seagrass beds and shallow coral reef (0 to 3 m) appeared to be the main nursery biotopes for the juveniles of the selected species. Mutual comparison between biotopes showed that the seagrass beds were the most important nursery biotope for juvenile Haemulon flavolineatum, H. sciurus, Ocyurus chrysurus, Acanthurus chirurgus and Sparisoma viride, the mangroves for juvenile Lutjanus apodus, L. griseus, Sphyraena barracuda and Chaetodon capistratus, and the shallow coral reef for juvenile H. chrysargyreum, L. mahogoni , A. bahianus and Abudefduf saxatilis. Juvenile Acanthurus coeruleus utilized all six biotopes, while juvenile H. carbonarium and Anisotremus surinamensis were not observed in any of the six biotopes. Although fishes showed a clear preference for a specific nursery biotope, most fish species utilized multiple nursery biotopes simultaneously. The almost complete absence of juveniles on the deeper reef zones indicates the high dependence of juveniles on the shallow water biotopes as a nursery. For most fish species an (partial) ontogenetic shift was observed at a particular life stage from their (shallow) nursery biotopes to the (deeper) coral reef. Cluster analyses showed that closely related species within the families Haemulidae, Lutjanidae and Acanthuridae, and the different size classes within species in most cases had a spatial separation in biotope utilization.
Directory of Open Access Journals (Sweden)
Nighat Perveen
2017-07-01
Full Text Available Quantitative studies concerning total and differential haemocyte counts and abnormalities were performed under laboratory conditions for larvae, pupae and adults collected from a wild Apis dorsata colony. Haemolymph samples were observed immediately, thirty and sixty minutes after field recommended concentration exposure of five different insecticides. Total haemocyte counts were significantly higher for larvae and pupae but less for adult bees, however, differential haemocyte counts insignificantly different. Exposure of insecticides showed variable response for tested insecticides with immediate increased change with ethofenprox, diafenthiuron and imidacloprid but decreased for all tested insecticides after sixty minutes. For differential haemocyte counts, plasmatocytes and granulocytes increased with exposure of insecticides. Immune response of haemocytes against insecticides showed different degrees of abnormalities like agglutination, denucleation and cell shape distortion. Such studies may help in possible identification of insect defense mechanisms against their exposure to external hazards for instance insecticide exposure.
Bacci, Leandro; Crespo, André L B; Galvan, Tederson L; Pereira, Eliseu J G; Picanço, Marcelo C; Silva, Gerson A; Chediak, Mateus
2007-07-01
Efficient chemical control is achieved when insecticides are active against insect pests and safe to natural enemies. In this study, the toxicity of 17 insecticides to the sweetpotato whitefly, Bemisia tabaci (Gennadius), and the selectivity of seven insecticides to natural enemies of this insect pest were evaluated. To determine the insecticide toxicity, B. tabaci adults were exposed to abamectin, acephate, acetamiprid, cartap, imidacloprid, malathion, methamidophos, bifenthrin, cypermethrin, deltamethrin, esfenvalerate, fenitrothion, fenpropathrin, fenthion, phenthoate, permethrin and trichlorphon at 50 and 100% of the field rate (FR), and to water (untreated control). To determine the insecticide selectivity, adults of Encarsia sp., Acanthinus sp., Discodon sp. and Lasiochilus sp. were exposed to abamectin, acephate, acetamiprid, cartap, imidacloprid, malathion and methamidophos at 50 and 100% FR, and to water. Groups of each insect species were exposed to kale leaves preimmersed in each treatment under laboratory conditions. Mortality of exposed individuals was recorded 24 h after treatment. Cartap and imidacloprid at 50 and 100% FR and abamectin and acetamiprid at 100% FR showed insecticidal activity to B. tabaci adults. Abamectin at 50 and 100% FR was the least insecticidal compound to the natural enemies Acanthinus sp., Discodon sp. and Lasiochilus sp. The present results suggest that abamectin at 100% FR may decrease B. tabaci field populations but can still be harmless to predators. Implications of these results within an integrated pest management context are discussed. Copyright (c) 2007 Society of Chemical Industry.
Nitrate leaching beneath a containerized nursery crop receiving trickle or overhead irrigation.
Colangelo, D J; Brand, M H
2001-01-01
Container production of nursery crops is intensive and a potential source of nitrogen release to the environment. This study was conducted to determine if trickle irrigation could be used by container nursery producers as an alternative to standard overhead irrigation to reduce nitrogen release into the environment. The effect of overhead irrigation and trickle irrigation on leachate nitrate N concentration, flow-weighted nitrate N concentration, leachate volume, and plant growth was investigated using containerized rhododendron (Rhododendron catawbiense Michx. 'Album') supplied with a controlled-release fertilizer and grown outdoors on top of soil-monolith lysimeters. Leachate was collected over two growing seasons and overwinter periods, and natural precipitation was allowed as a component of the system. Precipitation accounted for 69% of the water entering the overhead-irrigated system and 80% of the water entering the trickle-irrigated system. Leachate from fertilized plants exceeded the USEPA limit of 10 mg L(-1) at several times and reached a maximum of 26 mg L(-1) with trickle irrigation. Average annual loss of nitrate N in leachate for fertilized treatments was 51.8 and 60.5 kg ha(-1) for the overhead and trickle treatments, respectively. Average annual flow-weighted concentration of nitrate N in leachate of fertilized plants was 7.2 mg L(-1) for overhead irrigation and 12.7 mg L(-1) for trickle irrigation. Trickle irrigation did not reduce the amount of nitrate N leached from nursery containers when compared with overhead irrigation because precipitation nullified the potential benefits of reduced leaching fractions and irrigation inputs provided under trickle irrigation.
Directory of Open Access Journals (Sweden)
Nonić Marina
2016-01-01
Full Text Available European beech (Fagus sylvatica L. is, along with its significance as a forest species, renowned as an ornamental species, due to its numerous cultivars. Ornamental beech cultivars are planted in various green spaces, but a small number of such trees have ascertained in Serbia. For the time being, production of beech cultivars is represented in a very small number of nurseries, with a negligible share of those seedlings in their total assortment. The aim of this research is to study the attitudes of ornamental trees and shrubs producers towards the nursery production of ornamental beech cultivars, and possibilities of its improvements in Serbia. “Door to door” survey and in-depth interviews were used as research techniques. Surveys with the representatives of 65 nurseries in Serbia (in the selected statistical region Šumadija and Western Serbia were conducted in the first stage of data collection. In the second stage of data collection were interviewed the representatives of the 10 nurseries who, during the survey, pointed out that they produce ornamental beech cultivars. Nurserymen’s attitudes suggest that there is a possibility to improve the production of ornamental beech cultivars in Serbia, with the appropriate support measures and increased interest of customers on the market, i.e. with the provision of subsidies for the production of seedlings and greater use of cultivars by utility companies in the cities of Serbia. [Projekat Ministarstva nauke Republike Srbije, br. ТP 31041: Establishment of forest plantations to increase the afforested areas in Serbia
A secondary nursery area for the copper shark Carcharhinus brachyurus from the late Miocene of Peru
Landini, Walter; Collareta, Alberto; Pesci, Fabio; Di Celma, Claudio; Urbina, Mario; Bianucci, Giovanni
2017-10-01
The life history strategies of sharks often include the use of protected nursery areas by young-of-the-year and juveniles. Nursery areas can be primary (i.e., grounds where the sharks are born and spend the very first part of their lives) or secondary (i.e., grounds inhabited by slightly older but not yet mature individuals). Criteria utilized to recognize these strategic habitats include: high concentration of young sharks, high food availability, and low predation risk. Since the fossil record of sharks consists mainly of isolated teeth, identification of paleonurseries involves a series of problems due to difficult application of actualistic criteria. A rich shark tooth-bearing level (ST-low1) has recently been discovered in the upper Miocene deposits of the Pisco Formation exposed at Cerro Colorado (southern coast of Peru). Most of the teeth collected from this level belong to the extant copper shark Carcharhinus brachyurus. These teeth are small and compatible with those of extant juveniles. This observation, coupled with other paleoenvironmental considerations, indicates that the ST-low1 horizon could have represented a nursery ground for juvenile individuals of C. brachyurus. The absence of very small-sized teeth (i.e., referable to young-of-the-year) suggests a secondary nursery ground inhabited by immature copper sharks. Observations on the tooth size of other Lamniformes, Carcharhiniformes, and Myliobatiformes occurring along with C. brachyurus point to a significantly juvenile structure of this elasmobranch assemblage, thus supporting the hypothesis of a communal use of the Cerro Colorado paleonursery.
root rot disease of five fruit tree seedlings in the nursery
African Journals Online (AJOL)
KAMALDEEN
on them. Our experience in the nursery in Port Harcourt had been that many tree species of the tropical region are susceptible to root rot diseases of fungal origin. The fungal invasion of the succulent root tissues causes the young tree seedlings to dieback; their leaves becomes discoloured, wilted and eventually dead.
Technology Use in Nursery and Primary Education in Two Different Settings
Bueno Alastuey, Mª Camino; García Laborda, Jesús
2016-01-01
This article studies which and how Information and Communications Technologies (ICTs) are used by nursery and primary education in-service teachers as reported by their pre-service teacher trainees after observations in their practicum in two provinces in Spain, Alcalá de Henares-Guadalajara and Navarre. Results indicate that in-service teachers…
Effectiveness of Special Nursery Provision for Children with Autism Spectrum Disorders
Reed, Phil; Osborne, Lisa A.; Corness, Mark
2010-01-01
The effectiveness of three local authority early teaching interventions for children with autism spectrum disorders (ASDs) was studied. Thirty-three children (2:6 to 4:0 years old) received one of three early teaching interventions: a 1:1 home-based programme, and two different forms of special nursery placement. Measures from the…
Directory of Open Access Journals (Sweden)
Esmaeily Saeideh
2014-07-01
Full Text Available In addition to direct mortality caused by insecticides, some biological traits of insects may also be affected by sublethal insecticide doses. In this study, we used the age-stage, two-sex life table method to evaluate the sublethal effects of the four synthetic insecticides: abamectin, imidacloprid, diazinon, and pymetrozin as well as the botanical insecticide taken from Calotropis procera (Asclepiadaceae extract, on eggs of the cotton whitefly, Bemisia tabaci (Hem.: Aleyrodidae. The lowest and highest survival rates and oviposition periods were observed in whiteflies treated by diazinon and imidacloprid, respectively. We found significant differences in the net reproductive rate (R0, the intrinsic rate of increase (r, the finite rate of increase (?, and the gross reproductive rate (GRR among different insecticides. Altogether, our results showed that pymetrozin and C. procera induced the most sublethal effects, thus they may be suitable candidates for use in integrated pest management programs of B. tabaci.
Lofty, Hayam M.; Abd El-Aleem, Abd El-Aziz A.; Monir, Hany H.
2013-01-01
A sensitive gas chromatographic method has been developed for the determination of malathion and lambda-cyhalothrin (λ-cyhalothrin) insecticide residues in zucchini. The developed method consists of extraction with acetone, purification and partitioning with methylene chloride, column chromatographic clean-up, and finally capillary gas chromatographic determination of the insecticides. The recoveries of method were greater than 90% and limit of determination was 0.001 ppm for both insecticide...
Efficacy of insecticides in fruit borer control and residues on sugar apple fruit
Directory of Open Access Journals (Sweden)
Alessandro da Silva Oliveira
Full Text Available ABSTRACT Bahia is the Brazilian state with the largest production of sugar apple fruits (Annona squamosa L., and fruit borer (Cerconota anonella, Sepp. 1830 is a key crop pest. Insecticides are the main strategy for pest control even though there are no pesticides registered for this crop. This study aimed to assess the efficacy of insecticides to control fruit borer and determine the levels of insecticide residues in sugar apple fruits aiming at requesting the extension of authorization to use insecticide products in this crop. The experiment was conducted in an eight-year-old irrigated orchard (2 × 4 m located in Anagé, Bahia, Brazil. The experimental design was a randomized block design with 10 treatments (three insecticides with three doses and a control with water and 5 replications. Each plot was composed of four plants but only the two central ones were assessed. Insecticides and doses (g a.i. 100 L−1 water were Bacillus thuringiensis: 0.8, 1.7, and 2.5; triflumuron: 2.4, 3.6, and 4.8; and imidacloprid: 4.0, 10.0, and 16.0. Nine sprayings were carried out at fortnightly intervals with a costal sprayer with constant pressure, JA-2 nozzle, and with jet directed to the fruits. Ten assessments were performed in order to observe fruit borer presence in 30 previously marked fruits per plot. Imidacloprid, at the highest studied dose, was the only effective treatment. Analyses of imidacloprid residues, at 21 and 30 days after the highest dose application, indicated levels higher than the maximum limit allowed. Insecticides under the conditions tested do not meet the norms for requesting the extension of authorization to use insecticides for citrus in sugar apple fruits.
Coastal Nurseries and Their Importance for Conservation of Sea Kraits
Bonnet, Xavier; Brischoux, François; Bonnet, Christophe; Plichon, Patrice; Fauvel, Thomas
2014-01-01
Destruction and pollution of coral reefs threaten these marine biodiversity hot stops which shelter more than two thirds of sea snake species. Notably, in many coral reef ecosystems of the Western Pacific Ocean, large populations of sea kraits (amphibious sea snakes) have drastically declined during the past three decades. Protecting remaining healthy populations is thus essential. In New Caledonia, coral reefs shelter numerous sea krait colonies spread throughout an immense lagoon (24,000 km2). Sea kraits feed on coral fish but lay their eggs on land. However, ecological information on reproduction and juveniles is extremely fragmentary, precluding protection of key habitats for reproduction. Our 10 years mark recapture study on Yellow sea kraits (L. saintgironsi >8,700 individuals marked) revealed that most neonates aggregate in highly localized coastal sites, where they feed and grow during several months before dispersal. Hundreds of females emigrate seasonally from remote populations (>50 km away) to lay their eggs in these coastal nurseries, and then return home. Protecting these nurseries is a priority to maintain recruitment rate, and to retain sea krait populations in the future. PMID:24670985
Coastal nurseries and their importance for conservation of sea kraits.
Directory of Open Access Journals (Sweden)
Xavier Bonnet
Full Text Available Destruction and pollution of coral reefs threaten these marine biodiversity hot stops which shelter more than two thirds of sea snake species. Notably, in many coral reef ecosystems of the Western Pacific Ocean, large populations of sea kraits (amphibious sea snakes have drastically declined during the past three decades. Protecting remaining healthy populations is thus essential. In New Caledonia, coral reefs shelter numerous sea krait colonies spread throughout an immense lagoon (24,000 km2. Sea kraits feed on coral fish but lay their eggs on land. However, ecological information on reproduction and juveniles is extremely fragmentary, precluding protection of key habitats for reproduction. Our 10 years mark recapture study on Yellow sea kraits (L. saintgironsi >8,700 individuals marked revealed that most neonates aggregate in highly localized coastal sites, where they feed and grow during several months before dispersal. Hundreds of females emigrate seasonally from remote populations (>50 km away to lay their eggs in these coastal nurseries, and then return home. Protecting these nurseries is a priority to maintain recruitment rate, and to retain sea krait populations in the future.
Choe, Dong-Hwan; Tsai, Kasumi; Lopez, Carlos M; Campbell, Kathleen
2014-02-01
Outdoor residual sprays are among the most common methods for targeting pestiferous ants in urban pest management programs. If impervious surfaces such as concrete are treated with these insecticides, the active ingredients can be washed from the surface by rain or irrigation. As a result, residual sprays with fipronil and pyrethroids are found in urban waterways and aquatic sediments. Given the amount of insecticides applied to urban settings for ant control and their possible impact on urban waterways, the development of alternative strategies is critical to decrease the overall amounts of insecticides applied, while still achieving effective control of target ant species. Herein we report a "pheromone-assisted technique" as an economically viable approach to maximize the efficacy of conventional sprays targeting the Argentine ant. By applying insecticide sprays supplemented with an attractive pheromone compound, (Z)-9-hexadecenal, Argentine ants were diverted from nearby trails and nest entrances and subsequently exposed to insecticide residues. Laboratory experiments with fipronil and bifenthrin sprays indicated that the overall kill of the insecticides on Argentine ant colonies was significantly improved (57-142% increase) by incorporating (Z)-9-hexadecenal in the insecticide sprays. This technique, once it is successfully implemented in practical pest management programs, has the potential of providing maximum control efficacy with reduced amount of insecticides applied in the environment.
Burtet, Leonardo M; Bernardi, Oderlei; Melo, Adriano A; Pes, Maiquel P; Strahl, Thiago T; Guedes, Jerson Vc
2017-12-01
Maize plants expressing insecticidal proteins of Bacillus thuringiensis are valuable options for managing fall armyworm (FAW), Spodoptera frugiperda, in Brazil. However, control failures were reported, and therefore insecticides have been used to control this species. Based on these, we evaluated the use of Bt maize and its integration with insecticides against FAW in southern Brazil. Early-planted Agrisure TL, Herculex, Optimum Intrasect and non-Bt maize plants were severely damaged by FAW and required up to three insecticidal sprays. In contrast, YieldGard VT Pro, YieldGard VT Pro 3, PowerCore, Agrisure Viptera and Agrisure Viptera 3 showed little damage and did not require insecticides. Late-planted Bt maize plants showed significant damage by FAW and required up to four sprays, with the exceptions of Agrisure Viptera and Agrisure Viptera 3. Exalt (first and second sprays); Lannate + Premio (first spray) and Avatar (second spray); and Karate + Match (first spray) and Ampligo (second spray) were the most effective insecticides against FAW larvae in Bt and non-Bt maize. Maize plants expressing Cry proteins exhibited FAW control failures in southern Brazil, necessitating insecticidal sprays. In contrast, Bt maize containing the Vip3Aa20 protein remained effective against FAW. However, regardless of the insecticide used against FAW surviving on Bt maize, grain yields were similar. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Rafael Tavares
2016-01-01
Full Text Available The protection of the habitats used by juvenile sharks is a management strategy that has recently caught the attention of fishery biologists. In the present study, we evaluated the population of the lemon shark (Negaprion brevirostris from Los Roques Archipelago in order to identify the nursery area, describe the size composition, and examine the variation in nocturnal activity of the juvenile individuals. The data analysed came from three different sources: commercial shark fishery, tag-recapture sampling, and visual records. A total of 375 lemon sharks with total lengths between 55 and 281 cm were recorded during the study period. Overall data showed that the area occupied by juvenile lemon sharks was clearly partitioned into primary and secondary nurseries. Additionally, nighttime activity seemed to change according to the size of sharks in the primary nursery, suggesting a reduction of time activity overlapping among juveniles of distinct size/age. Results suggest that the strategy of utilization of the primary nurseries by the lemon shark may lead to important ecological benefits by reducing the competition, predation and natural mortality.
Neonicotinoid insecticides can serve as inadvertent insect contraceptives
Villamar-Bouza, Laura; Bruckner, Selina; Chantawannakul, Panuwan; Gauthier, Laurent; Khongphinitbunjong, Kitiphong; Retschnig, Gina; Troxler, Aline; Vidondo, Beatriz; Neumann, Peter; Williams, Geoffrey R.
2016-01-01
There is clear evidence for sublethal effects of neonicotinoid insecticides on non-target ecosystem service-providing insects. However, their possible impact on male insect reproduction is currently unknown, despite the key role of sex. Here, we show that two neonicotinoids (4.5 ppb thiamethoxam and 1.5 ppb clothianidin) significantly reduce the reproductive capacity of male honeybees (drones), Apis mellifera. Drones were obtained from colonies exposed to the neonicotinoid insecticides or controls, and subsequently maintained in laboratory cages until they reached sexual maturity. While no significant effects were observed for male teneral (newly emerged adult) body mass and sperm quantity, the data clearly showed reduced drone lifespan, as well as reduced sperm viability (percentage living versus dead) and living sperm quantity by 39%. Our results demonstrate for the first time that neonicotinoid insecticides can negatively affect male insect reproductive capacity, and provide a possible mechanistic explanation for managed honeybee queen failure and wild insect pollinator decline. The widespread prophylactic use of neonicotinoids may have previously overlooked inadvertent contraceptive effects on non-target insects, thereby limiting conservation efforts. PMID:27466446
Dermal insecticide residues from birds inhabiting an orchard
Vyas, N.B.; Spann, J.W.; Hulse, C.S.; Gentry, S.; Borges, S.L.
2007-01-01
The US Environmental Protection Agency conducts risk assessments of insecticide applications to wild birds using a model that is limited to the dietary route of exposure. However, free-flying birds are also exposed to insecticides via the inhalation and dermal routes. We measured azinphos-methyl residues on the skin plus feathers and the feet of brown-headed cowbirds (Molothrus ater) in order to quantify dermal exposure to songbirds that entered and inhabited an apple (Malus x domestica) orchard following an insecticide application. Exposure to azinphos-methyl was measured by sampling birds from an aviary that was built around an apple tree. Birds sampled at 36 h and 7-day post-application were placed in the aviary within 1 h after the application whereas birds exposed for 3 days were released into the aviary 4-day post-application. Residues on vegetation and soil were also measured. Azinphos-methyl residues were detected from the skin plus feathers and the feet from all exposure periods. Our results underscore the importance of incorporating dermal exposure into avian pesticide risk assessments.
[Work-related stress in nursery school educators in the Venice and Marghera districts].
Camerino, Donatella; Fichera, G P; Punzi, Silvia; Campanini, P; Conway, P M; Prevedello, Laura; Costa, G
2011-01-01
Based on an investigation on organizational well-being in the Municipality of Venice (2009), we examined 110 public nursery school and preschool teachers working in the Venice and Marghera districts. The aim of this study was to develop and implement a procedure for work-related stress assessment and management in Municipality of Venice, in the light of Law 81/2008. Occupational stress and its impact on teachers' well-being and health were assessed by means of self-administered questionnaires and semi-structured interviews. Descriptive analyses were conducted to compare teachers' data with those concerning employees operating in other services in the Venice and Marghera districts. According to the results, while nursery school and preschool teachers work with considerable commitment, vigor, dedication and involvement, problems were observed related to: assignment of administrative tasks without appropriate support from the district offices; difficult access to support services; shortage of temporary teachers and auxiliary personnel and, limited to some facilities, lack of adequate physical space devoted to teaching activities. Such adverse conditions result in an increase in vigilance levels required to ensure children's safety. Personnel also suffer from a lack of career prospects, with scarce opportunities for contact with other facilities in the area and inadequate involvement in the decisional processes at Municipality level. Improving such adverse conditions could solve the current marginalization of public nursery school and preschool teachers and encourage mutual exchange of information, which would in turn favour more appropriate methods of managing each single facility.
Eddleston, Michael; Eyer, Peter; Worek, Franz; Mohamed, Fahim; Senarathna, Lalith; von Meyer, Ludwig; Juszczak, Edmund; Hittarage, Ariyasena; Azhar, Shifa; Dissanayake, Wasantha; Sheriff, M H Rezvi; Szinicz, Ladislaus; Dawson, Andrew H; Buckley, Nick A
Although more than 100 organophosphorus insecticides exist, organophosphorus poisoning is usually regarded as a single entity, distinguished only by the compound's lethal dose in animals. We aimed to determine whether the three most common organophosphorus insecticides used for self-poisoning in Sri Lanka differ in the clinical features and severity of poisoning they cause. We prospectively studied 802 patients with chlorpyrifos, dimethoate, or fenthion self-poisoning admitted to three hospitals. Blood cholinesterase activity and insecticide concentration were measured to determine the compound and the patients' response to insecticide and therapy. We recorded clinical outcomes for each patient. Compared with chlorpyrifos (35 of 439, 8.0%), the proportion dying was significantly higher with dimethoate (61 of 264, 23.1%, odds ratio [OR] 3.5, 95% CI 2.2-5.4) or fenthion (16 of 99, 16.2%, OR 2.2, 1.2-4.2), as was the proportion requiring endotracheal intubation (66 of 439 for chlorpyrifos, 15.0%; 93 of 264 for dimethoate, 35.2%, OR 3.1, 2.1-4.4; 31 of 99 for fenthion, 31.3%, 2.6, 1.6-4.2). Dimethoate-poisoned patients died sooner than those ingesting other pesticides and often from hypotensive shock. Fenthion poisoning initially caused few symptoms but many patients subsequently required intubation. Acetylcholinesterase inhibited by fenthion or dimethoate responded poorly to pralidoxime treatment compared with chlorpyrifos-inhibited acetylcholinesterase. Organophosphorus insecticide poisoning is not a single entity, with substantial variability in clinical course, response to oximes, and outcome. Animal toxicity does not predict human toxicity since, although chlorpyrifos is generally the most toxic in rats, it is least toxic in people. Each organophosphorus insecticide should be considered as an individual poison and, consequently, patients might benefit from management protocols developed for particular organophosphorus insecticides.
Concentration-mortality responses of Myzus persicae and natural enemies to selected insecticides.
Bacci, Leandro; Rosado, Jander F; Picanço, Marcelo C; Pereira, Eliseu J G; Silva, Gerson A; Martins, Júlio C
2012-01-01
The toxicity of six insecticides was determined for the peach-potato aphid, Myzus persicae (Hemiptera: Aphididae), and some of its natural enemies - the predatory beetles Cycloneda sanguinea (Coccinellidae) and Acanthinus sp. (Anthicidae), and the wasp parasitoid Diaeretiella rapae (Aphidiidae). Natural enemies from these groups are important natural biological control agents in a number of agroecosystems, and insecticides potentially safe to these non-target organisms should be identified using standardized tests. Thus, concentration-mortality bioassays were carried out with both the aphid and its natural enemies to assess the toxicity and selectivity of acephate, deltamethrin, dimethoate, methamidophos, methyl parathion, and pirimicarb. The latter insecticide was highly selective to all natural enemies tested, and its LC(90) for M. persicae was 14-fold lower than the field rate recommended for control of the aphid in brassica crops. Methyl parathion also showed selectivity to C. sanguinea and Acanthinus sp., but not to D. rapae. Acephate was the least potent insecticide against M. persicae and was equally or more toxic to the natural enemies relative to the aphid. Pirimicarb and methyl parathion were efficient against M. persicae and selective in favor of two of the natural enemies tested. Acanthinus sp. and C. sanguinea were more tolerant to the insecticides than was the parasitoid D. rapae. This study shows that there are selective insecticides that may be compatible with conservation of natural enemies in brassica crops, which is important practical information to improve integrated pest management systems in these crops.
Children's exposure to indoor air in urban nurseries-part I: CO{sub 2} and comfort assessment
Energy Technology Data Exchange (ETDEWEB)
Branco, P.T.B.S.; Alvim-Ferraz, M.C.M.; Martins, F.G.; Sousa, S.I.V., E-mail: sofia.sousa@fe.up.pt
2015-07-15
Indoor air quality (IAQ) in nurseries is an emerging case-study. Thus, this study, as the Part I of the larger study “Children's exposure to indoor air in urban nurseries”, aimed to: i) evaluate nurseries’ indoor concentrations of carbon dioxide (CO{sub 2}), a global IAQ indicator, in class and lunch rooms; ii) assess indoor comfort parameters–temperature (T) and relative humidity (RH); and iii) analyse them according to guidelines and references for IAQ, comfort and children's health. Indoor continuous measurements were performed. Non-compliances with guidelines were found in comfort parameters, which could cause discomfort situations and also microbial proliferation. Exceedances in CO{sub 2} concentrations were also found and they were caused by poor ventilation and high classroom occupation. More efficient ventilation and control of comfort parameters, as well as to reduce occupation by reviewing Portuguese legislation on that matter, would certainly improve IAQ and comfort in nurseries and consequently safeguard children's health. - Highlights: • High occupation and poor ventilation were main determinants of IAQ in nurseries. • T and RH indoor values found in nurseries are likely to cause thermal discomfort. • Building characteristics and an inadequate ventilation determined T and RH values. • High CO{sub 2} concentrations found could indicate accumulation of other air pollutants.
Influence of Pyrethroid Insecticides on Sodium and Calcium Influx in Neocortical Neurons
Pyrethroid insecticides bind to voltage-gated sodium channels and modify their gating kinetics, thereby disrupting neuronal function. Using murine neocortical neurons in primary culture, we have compared the ability of 11 structurally diverse pyrethroid insecticides to evoke Na+ ...
Nault, Brian A; Hsu, Cynthia L; Hoepting, Christine A
2013-07-01
Insecticides and fungicides are commonly co-applied in a tank mix to protect onions from onion thrips, Thrips tabaci Lindeman, and foliar pathogens. Co-applications reduce production costs, but past research shows that an insecticide's performance can be reduced when co-applied with a fungicide. An evaluation was made of the effects of co-applying spinetoram, abamectin and spirotetramat with commonly used fungicides, with and without the addition of a penetrating surfactant, on onion thrips control in onion fields. Co-applications of insecticides with chlorothalonil fungicides reduced thrips control by 25-48% compared with control levels provided by the insecticides alone in three of five trials. Inclusion of a penetrating surfactant at recommended rates with the insecticide and chlorothalonil fungicide did not consistently overcome this problem. Co-applications of insecticides with other fungicides did not interfere with thrips control. Co-applications of pesticides targeting multiple organisms should be examined closely to ensure that control of each organism is not compromised. To manage onion thrips in onion most effectively, insecticides should be applied with a penetrating surfactant, and should be applied separately from chlorothalonil fungicides. © 2012 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Jialong Sun
2015-03-01
Full Text Available In this study a series of diacylhydrazine and acylhydrazone derivatives were designed and synthesized according to the method of active group combination and the principles of aromatic group bioisosterism. The structures of the novel derivatives were determined on the basis on 1H-NMR, IR and ESI-MS spectral data. All of the compounds were evaluated for their in vivo insecticidal activity against the third instar larvae of Spodoptera exigua Hiibner, Helicoverpa armigera Hubner, Plutella xyllostella Linnaeus and Pieris rapae Linne, respectively, at a concentration of 10 mg/L. The results showed that all of the derivatives displayed high insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, metaflumizone and tolfenpyrad, and approximately identical insecticidal activity against H. armigera, P. xyllostella and P. rapae as the references metaflumizone and tolfenpyrad.
Production of camu camu plants with different organic substrates in conventional nursery bed
Directory of Open Access Journals (Sweden)
Carlos Abanto Rodriguez
2013-12-01
Full Text Available The aim was to verify the initial development of camu camu plants with different organic substrates in conventional nursery bedding microsprinkler irrigation and shade management Chromatine® mesh with 50% red light. We used genetic material from mother plants Germplasm Bank of INIA-camu camu Iquitos, seeds were germinated in decomposed sawdust and kept for a period of 40 days after subculturing was performed with 10 cm in height in different substrates according treatments in nursery beds with dimensions of 1.20 m wide x 10 m long with a depth of 30 cm. After conducting assessments of height (cm and basal diameter (mm for a period of 120 days, it was found that the substrate manure has become the substrate for greater efficiency in plant development camu camu substrate followed by humus worm.
Resistance: a threat to the insecticidal crystal proteins of Bacillus thuringiensis
Leah S. Bauer
1995-01-01
Insecticidal crystal proteins (also known as d-endotoxins) synthesized by the bacterium Bacillus thuringiensis Berliner (Bt) are the active ingredient of various environmentally friendly insecticides that are 1) highly compatible with natural enemies and other nontarget organisms due to narrow host specificity, 2) harmless to vertebrates, 3) biodegradable in the...
Mechanistic modeling of insecticide risks to breeding birds in North American agroecosystems
Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of ...
Reflections on a Time-Limited Mother-Baby Yoga Program at the Wee Ones Nursery
Pickholtz, Naomi
2012-01-01
This brief article discusses a yoga program offered to mothers and babies who were participating in a prison nursery. The author describes the goals and the sometimes unexpected effects of the program.
Samant, S. A.; Beighley, R. E.
2007-12-01
In agriculture, improper, excessive or poorly timed irrigation and fertilizer applications can result in increased pollutants in runoff and degraded water quality. Specifically, the cultivation of salt sensitive plants and nurseries require significant irrigation and fertilizer that leads to high nutrient leaching. In southern California, a large producer of Avocados and nursery plant, waterways are often subjected to elevated nutrient concentrations, which stress the aquatic ecosystem. In this research, the specific objectives are to determine optimal irrigation and fertilizer application rates for minimizing nutrient and sediment export from avocado groves and nurseries. Altered irrigation and fertilizer application experiments will be implemented and monitored at the San Diego State University's Santa Margarita Ecological Reserve, which contains a 12 ha avocado grove and newly constructed 0.4 ha nursery. The study will last for twelve months, with runoff from natural rainfall or irrigation sampled and analyzed for nutrient concentrations on a monthly basis. The growth rate, leaf nutrient content and plant yield will also be monitored monthly. The nursery site is divided into eight plots (13.5-m x 13.5-m), with each plot containing 1200 plants consisting of four commonly used landscaping varieties in southern California. The avocado grove of the Hass variety is divided into four 1-ha plots. The experimental plots represent combinations of irrigation and fertilization practices with different methods and rates. In all cases, irrigation is fully automated based on soil moisture. To assess the effectiveness of the altered irrigation and fertilizer strategies, runoff water quality and plant yield will be compared to controlled treatments. This research is intended to provide a better understanding of how irrigation and fertilizer management can be used for the long-term reduction of nutrients in the Santa Margarita Watershed, which in turn will lead to improved
Owusu Adjah, Ebenezer S; Panayiotou, Andrie G
2014-01-01
Background: Media messages have been used in Ghana to promote insecticide-treated net (ITN)/bed net usage in an effort to impact on malaria prevention. The aim of this study was to assess the effect of such malaria-related messages delivered through electronic/print media and by volunteers/health workers on the use of ITNs by children living in a household. Methods: Data was collected from September to November of 2008 using a structured, interviewer-administered questionnaire by the Ghana St...
[Susceptibility of natural populations of dengue vector to insecticides in Colombia].
Santacoloma, Liliana; Chaves, Bernardo; Brochero, Helena Luisa
2012-09-01
Physiological resistance of natural population of Aedes aegypti to insecticides contribute to the decreased efficacy of chemical control as a main control strategy during dengue outbreaks. The susceptibility status of Ae. aegypti was assessed for the carbamate propoxur, the adulticide malathion and the larvicide temephos on 13 natural populations of Ae. aegypti immature forms were taken from 8 Colombian localities. These included the following: Bucaramanga (1), Sabana de Torres (2), Girardot (2), La Mesa (2), Villavicencio (2), Puerto López (2), San José del Guaviare (1) and Florencia (1). Susceptibility tests mainly consisted of the standardized bioassay outlined by WHO (1981) and CDC bottles (1998). Colorimetric tests were undertaken to determine enzyme levels possibly responsible for the reduction of susceptibility to organophosphate and carbamate insecticides. All specimens demonstrated susceptibility to malathion and propoxur insecticides. Four of the 13 populations revealed susceptibility to the temephos larvicide. Seven of 11 populations showed a limited increase in values for nonspecific esterase enzymes. The Bucaramanga population was the only one which showed an increase in the cytochrome P450 monooxygenases enzymes. Neither population was found with modified acetilcolinesterase. The widespread susceptibility to organophosphates used as adulticides indicated that malathion, the most used insecticide in Colombia, remains effective in interrupting the transmission of dengue. Physiological resistance to insecticides occurring in communities of a single township proved to be a localized phenomenon.
Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei
D.C. Pathak
2011-01-01
Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei) in Chakrashila Wildlife Sanctuary (CWS) in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pu...
Aleme, Adisu; Girma, Eshetu; Fentahun, Netsanet
2014-01-01
Understanding the feasibility of achieving widespread coverage with Insecticide-Treated Nets has to be preceded by learning how people value the Insecticide-Treated Nets and estimating the potential demand and willingness to pay so that sustainability of the intervention can be assured. The objective of this study was to determine willingness to pay for Insecticide-Treated Nets among households in Berehet District, Northern Ethiopia. A community-based cross-sectional study was conducted using both quantitative and qualitative methods in five randomly selected Kebeles from January-February 2012. Open ended contingent valuation technique with follow-up method was used. Qualitative data were collected through focus group discussions and observation methods. Binary logistic regression was used to determine the association between dependent and independent variables. The average number of individuals per Insecticide-Treated Nets was 3.83. Nearly 68.5% persons had willingness to buy Insecticide-Treated Nets if they have access to these Nets. The median maximum price a person is willingness to pay for blue rectangular Insecticide-Treated Net was 20 ETB. People had willingness to pay 30 ETB for blue and white conical insecticide-treated nets. Working on knowledge of malaria (OR=0.68, CI (0.47, 0.98; ppay Insecticide-Treated Nets. Respondents who prefer Kebele/place/ to buy Insecticide-Treated Net for rectangular shape had a significant association with a willingness to pay for Insecticide-Treated Nets (OR=1.92, CI= 1.07-3.92). Promotions, products, price and place had significant association with willingness to pay for Insecticide-Treated Nets. Designing a social marketing strategy helps ensure sustainable supply of Insecticide-Treated Nets and proper use of Insecticide-Treated Nets.
Study on radon concentration in nursery school in the mining region
International Nuclear Information System (INIS)
Skowronek, J.; Wysocka, M.; Mielnikow, A.
1999-01-01
Study on children exposure from natural radon background has been performed on the example of nursery schools being localized in Piekary Slaskie in the coal mining region of Silesia. Indoor air contamination has been measured as well as soil air and air outside the houses. In none of examined places the exposure do not exceeded the IAEA acceptable level
An Early Start: WPA Emergency Nursery Schools in Texas, 1934-1943
Burlbaw, Lynn Matthew
2009-01-01
This paper begins with an overview of the location and types of nursery schools reported to be operating in Texas between 1934 and 1943. The author reports on the results of the analysis of the photographs used in this study. The analysis is supported and contextualized by the use of references from federal documents and other publications…
Takada, Y; Kawamura, S; Tanaka, T
2001-12-01
The toxicity of six insecticides, acephate, methomyl, ethofenprox, cartap, chlorfluazuron, and Bacillus thuringiensis (Bt) was tested on different developmental stages of the egg parasitoid, Trichogramma dendrolimi (Matsumura). Each of the insecticides tested showed different degrees of toxicity to the parasitoid, Ethofenprox showed the highest toxicity and cartap showed relatively higher toxicity compared with the other insecticides. The development of the parasitoids treated with these two insecticides was normal, similar to that of the control group. Only the emergence of adult wasps from host eggs was disturbed. Emergence of the host, Mamestra brassicae larva was reduced following treatment with ethofenprox, cartap and methomyl. However, adult female wasps, which emerged from host eggs treated with the insecticides had the ability to oviposit normally.
Main, Bradley J; Everitt, Amanda; Cornel, Anthony J; Hormozdiari, Fereydoun; Lanzaro, Gregory C
2018-04-04
Malaria mortality rates in sub-Saharan Africa have declined significantly in recent years as a result of increased insecticide-treated bed net (ITN) usage. A major challenge to further progress is the emergence and spread of insecticide resistance alleles in the Anopheles mosquito vectors, like An. coluzzii. A non-synonymous mutation in the para voltage-gated sodium channel gene reduces pyrethroid-binding affinity, resulting in knockdown resistance (kdr). Metabolic mechanisms of insecticide resistance involving detoxification genes like cytochrome P450 genes, carboxylesterases, and glutathione S-transferases are also important. As some gene activity is tissue-specific and/or environmentally induced, gene regulatory variation may be overlooked when comparing expression from whole mosquito bodies under standard rearing conditions. We detected complex insecticide resistance in a 2014 An. coluzzii colony from southern Mali using bottle bioassays. Additional bioassays involving recombinant genotypes from a cross with a relatively susceptible 1995 An. coluzzii colony from Mali confirmed the importance of kdr and associated increased permethrin resistance to the CYP9K1 locus on the X chromosome. Significant differential expression of CYP9K1 was not observed among these colonies in Malpighian tubules. However, the P450 gene CYP6Z1 was overexpressed in resistant individuals following sublethal permethrin exposure and the carboxylesterase gene COEAE5G was constitutively overexpressed. The significant P450-related insecticide resistance observed in the 2014 An. coluzzii colony indicates that ITNs treated with the P450 inhibitor piperonyl butoxide (PBO) would be more effective in this region. The known insecticide resistance gene CYP6Z1 was differentially expressed exclusively in the context of sublethal permethrin exposure, highlighting the importance of tissue-specificity and environmental conditions in gene expression studies. The increased activity of the carboxylesterase
Factor Analysis of Temperament Category Scores in a Sample of Nursery School Children.
Simonds, John F.; Simonds, M. Patricia
1982-01-01
Mothers of children attending nursery schools completed the Behavior Style Questionnaire (BSQ) from which scores for nine temperament categories were derived. Found membership in groups based on factor scores independent of sex, socioeconomic class, age but not ordinal birth position. (Author)
Davó, Mari Carmen; Gil-González, Diana; Vives-Cases, Carmen; Alvarez-Dardet, Carlos; La Parra, Daniel
2008-01-01
To identify the characteristics of health education and promotion interventions in Spanish nursery and primary schools, through the studies published in scientific journals. We performed a review of studies on health education and promotion interventions in Spanish nursery and primary schools, published from 1995 to 2005. The information sources were Medline (through Pubmed), Cinhal, Eric, Sociological Abstracts, Science Citation Index, and Isooc (CSIC). Studies performed in Spanish nursery and primary schools that incorporated health education and promotion interventions were selected. The studies' general features, main subject and aims, methodology, the kind of intervention described, and compliance with the criteria for Healthy Schools were analyzed. Only 26 of the 346 articles identified met the inclusion criteria. Health education programs focussed more on disease prevention than on health promotion and only a few studies were performed in nursery and primary schools. The criteria for health promotion in schools were included in 5 articles (19.2%). The importance of health institutions (n = 7; 26.9%) and universities (n = 8; 30.8%) as promoters of programs was notable. The most frequent subject was smoking (n = 11; 42.3%). Teachers play a lesser role in health promotion in schools than health institutions in the implementation and dissemination of health programs. Research into health promotion in nursery and primary schools is scarce.
Wu, Shaohui; Kostromytska, Olga S; Koppenhöfer, Albrecht M
2017-08-01
The annual bluegrass weevil, Listronotus maculicollis (Kirby), is a major pest of golf course turf in eastern North America and has become particularly problematic owing to widespread development of insecticide resistance. As an alternative option to manage resistant adult L. maculicollis, we explored combinations of the pyrethroid insecticide bifenthrin with an emulsifiable oil formulation of the entomopathogenic fungus Beauveria bassiana strain GHA (Bb ES). Combinations synergistically enhanced mortality in both insecticide-susceptible and insecticide-resistant L. maculicollis adults in the laboratory when bifenthrin was used at LC50s for each population. To determine the component behind the synergism, technical spores of B. bassiana GHA and the emulsifiable oil carrier in the fungal formulation were tested separately or in combination with bifenthrin. In both separate and combined applications, the emulsifiable oil carrier was responsible for high mortality within 3 d after treatment and interacted synergistically with bifenthrin, whereas fungus-induced mortality started later. Strong synergism was also observed in three field experiments with a relatively resistant L. maculicollis population. Combinations of Bb ES and bifenthrin hold promise as an effective L. maculicollis management tool, particularly of pyrethroid-resistant populations. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
International Nuclear Information System (INIS)
Chairul, S.M.
2012-01-01
Simulation methods to determination of chlorphyriphos insecticides residue in grapes cause effect gamma rays, was done. Fruits of grapes soaked with chlorpyriphos insecticide solution high level concentrated (100 ppm; 200 ppm; and 300 ppm) for 3 (three minutes). The treatment of the sample was direct of extraction after soaks; extract after storage for one week after soak, and extract after soak after storage for one week after irradiation at 0.5 kGy; 1.0 kGy; and 1.5 kGy dose. Extraction methods using ethyl acetate solvent, and using sodium sulphate as to dryed water level in grapes, and then extractan was injected to chromatography gas use electron capture detector. The result indicated that occur of descent of chlorpyrifos residues from eachs soaked consequence at storage for one week was amount 7,55; 8,42; and 18,88% respectively, while of consequence irradiation of gamma ray at 0,5 kGy doses, will be descent of chlorpyrifos residues in amount 13,90; 19,16; and 52,79% respectively, and at 1,0 kGy doses irradiation will be descent in amount 34,45; 36,15 and 49,79%, respectively. (author)
Management of genetic resources in the nursery system of wild cherry (Prunus avium L.
Directory of Open Access Journals (Sweden)
Proietti R
2006-01-01
Full Text Available Knowledge of genetic and adaptive traits of reproductive materials used in the nursery system of wild cherry, could be an useful instrument to improve ecological and economic sustainability of plantation ecosystems. This work reports results from a research which the objectives were: 1 to study the genetic variation of a Prunus avium L. Population, used for seed harvesting, through its multi-locus genotypes detected by starch gel electrophoresis; 2 to analyze the level of genetic variation within and among different steps in a commercial nursery system (basic population and sub-populations, seedlings aged S1T1 and S1T2, plantation. Results showed low genetic variation levels of the basic population, similar to a reference system of other 12 wild cherry Italian populations and to other French and Caucasian materials. The genetic distances among Monte Baldo and some closer Lombardy provenances (Area Garda, Bosco Fontana, Valtellina were smaller than the Venice Region populations (Monti Lessini and Asiago. Number of alleles and percentage of polymorphic loci within the complex of Monte Baldo provenance and multiplication materials were similar, whilst a variable value of Fis was noted. Indeed, along with the nursery system until the plantation, heterozygosis initially (S1T1 increased, then decreased proceeding to the plantation. This fluctuation of FIS values could be determined by seed lots characterized initially by higher levels of variation, due to self-incompatibility. In the following steps, a possible selection pressure can affect randomly the genotypic structure of wild cherry by increasing the homozygosity. There is not among population a well defined geographic characterization, as suggested by genetic distances, therefore homogeneous seed harvest could be established an area larger than geographic and administrative borders. On this way we could have reproductive material with a wide genetic base and environmental adaptability. To
Navarro García, Alejandra; Del Pilar Bañón Árias, Sebastián; Morte, Asunción; Sánchez-Blanco, María Jesús
2011-01-01
The influence of a water deficit treatment and mycorrhizal inoculation with Pisolithus tinctorius (Pers.) Coker and Couch on the water relations, gas exchange, and plant growth in Arbutus unedo L. plants was studied in order to evaluate the hardening process during the nursery period. The ability to withstand the adverse conditions after transplantation was also studied. Mycorrhizal and non-mycorrhizal seedlings of A. unedo were pot-grown for 4 months in a greenhouse (nursery period), during which time two irrigation treatments, well watered (100% water holding capacity, leaching 20% of the applied water) and deficit irrigation (50% of the well watered), were applied. Subsequently, the plants were transplanted to the field and well irrigated (transplanting period), after which and until the end of the experiment they received no water (establishment period). At the end of the nursery period, both water deficit and mycorrhizae were seen to have altered the plant morphology. Mycorrhizal plants had lower leaf area and improved leaf color parameters, while the water deficit increased root dry weight and the root/shoot ratio. Mycorrhizal plants had higher leaf water potential values than non-inoculated plants. Mycorrhizae increased stomatal conductance and photosynthesis values, especially in stressed plants. Drought led to an osmotic adjustment and a decrease in the leaf water potential values at turgor loss point in the mycorrhizal plants. Cell wall rigidity, measured as increased bulk modulus of elasticity, was decreased by the mycorrhizae effect. After transplanting, no differences were found in the water relations or gas exchange values between treatments. During the establishment period, the plants that had been exposed to both drought and mycorrhizae showed a better water status (higher leaf water and turgor potential values) and higher gas exchange values. In conclusion, water deficit and mycorrhizal inoculation of A. unedo plants in nursery produced changes in
Tricoire-Leignel, Hélène; Thany, Steeve Hervé; Gadenne, Christophe; Anton, Sylvia
2012-01-01
Most animals, including pest insects, live in an "odor world" and depend strongly on chemical stimuli to get information on their biotic and abiotic environment. Although integrated pest management strategies including the use of insect growth regulators (IGRs) are increasingly developed, most insect pest treatments rely on neurotoxic chemicals. These molecules are known to disrupt synaptic transmission, affecting therefore sensory systems. The wide-spread use of neurotoxic insecticides and the growing use of IGRs result in residual accumulation of low concentrations in the environment. These insecticide residues could act as an "info-disruptor" by modifying the chemical communication system, and therefore decrease chances of reproduction in target insects. However, residues can also induce a non-expected hormesis effect by enhancing reproduction abilities. Low insecticide doses might thus induce adaptive processes in the olfactory pathway of target insects, favoring the development of resistance. The effect of sublethal doses of insecticides has mainly been studied in beneficial insects such as honeybees. We review here what is known on the effects of sublethal doses of insecticides on the olfactory system of insect pests.
Directory of Open Access Journals (Sweden)
Hélène eTricoire-Leignel
2012-03-01
Full Text Available Most animals, including pest insects, live in an odour world and depend strongly on chemical stimuli to get information on their biotic and abiotic environment. Although integrated pest management strategies including the use of insect growth regulators (IGRs are increasingly developed, most insect pest treatments rely on neurotoxic chemicals. These molecules are known to disrupt synaptic transmission, affecting therefore sensory systems. The wide-spread use of neurotoxic insecticides and the growing use of IGRs result in residual accumulation of low concentrations in the environment. These insecticide residues could act as an info-disruptor by modifying the chemical communication system, and therefore decrease chances of reproduction in target insects. However, residues can also induce a non-expected hormesis effect by enhancing reproduction abilities. Low insecticide doses might thus induce adaptive processes in the olfactory pathway of target insects, favouring the development of resistance. The effect of sublethal doses of insecticides has mainly been studied in beneficial insects such as honeybees. We review here what is known on the effects of sublethal doses of insecticides on the olfactory system of insect pests.
Blended Refuge and Insect Resistance Management for Insecticidal Corn
Crespo, Andre L B; Pan, Zaiqi; Crain, Philip R; Thompson, Stephen D; Pilcher, Clinton D; Sethi, Amit
2018-01-01
Abstract In this review, we evaluate the intentional mixing or blending of insecticidal seed with refuge seed for managing resistance by insects to insecticidal corn (Zea mays). We first describe the pest biology and farming practices that will contribute to weighing trade-offs between using block refuges and blended refuges. Case studies are presented to demonstrate how the trade-offs will differ in different systems. We compare biological aspects of several abstract models to guide the reader through the history of modeling, which has played a key role in the promotion or denigration of blending in various scientific debates about insect resistance management for insecticidal crops. We conclude that the use of blended refuge should be considered on a case-by-case basis after evaluation of insect biology, environment, and farmer behavior. For Diabrotica virgifera virgifera, Ostrinia nubilalis, and Helicoverpa zea in the United States, blended refuge provides similar, if not longer, delays in the evolution of resistance compared to separate block refuges. PMID:29220481
Screening Test for Detection of Leptinotarsa decemlineata (Say Sensitivity to Insecticides
Directory of Open Access Journals (Sweden)
Dušanka Inđić
2012-01-01
Full Text Available In 2009, the sensitivity of 15 field populations of Colorado potato beetle (Leptinotarsadecemlineata Say. - CPB was assessed to chlorpyrifos, cypermethrin, thiamethoxam and fipronil,four insecticides which are mostly used for its control in Serbia. Screening test that allows rapidassessment of sensitivity of overwintered adults to insecticides was performed. Insecticideswere applied at label rates, and two, five and 10 fold higher rates by soaking method (5 sec.Mortality was assessed after 72h. From 15 monitored populations of CPB, two were sensitiveto label rate of chlorpyrifos, one was slightly resistant, 11 were resistant and one populationwas highly resistant. Concerning cypermethrin, two populations were sensitive, two slightlyresistant, five were resistant and six highly resistant. Highly sensitive to thiamethoxam labelrate were 12 populations, while three were sensitive. In the case of fipronil applied at label rate,two populations were highly sensitive, six sensitive, one slightly resistant and six were resistant.The application of insecticides at higher rates (2, 5 and 10 fold, that is justified only in bioassays,provided a rapid insight into sensitivity of field populations of CPB to insecticides.
Directory of Open Access Journals (Sweden)
Ann Sluder
Full Text Available The efficacy of all major insecticide classes continues to be eroded by the development of resistance mediated, in part, by selection of alleles encoding insecticide insensitive target proteins. The discovery of new insecticide classes acting at novel protein binding sites is therefore important for the continued protection of the food supply from insect predators, and of human and animal health from insect borne disease. Here we describe a novel class of insecticides (Spiroindolines encompassing molecules that combine excellent activity against major agricultural pest species with low mammalian toxicity. We confidently assign the vesicular acetylcholine transporter as the molecular target of Spiroindolines through the combination of molecular genetics in model organisms with a pharmacological approach in insect tissues. The vesicular acetylcholine transporter can now be added to the list of validated insecticide targets in the acetylcholine signalling pathway and we anticipate that this will lead to the discovery of novel molecules useful in sustaining agriculture. In addition to their potential as insecticides and nematocides, Spiroindolines represent the only other class of chemical ligands for the vesicular acetylcholine transporter since those based on the discovery of vesamicol over 40 years ago, and as such, have potential to provide more selective tools for PET imaging in the diagnosis of neurodegenerative disease. They also provide novel biochemical tools for studies of the function of this protein family.
ASGDB: a specialised genomic resource for interpreting Anopheles sinensis insecticide resistance.
Zhou, Dan; Xu, Yang; Zhang, Cheng; Hu, Meng-Xue; Huang, Yun; Sun, Yan; Ma, Lei; Shen, Bo; Zhu, Chang-Liang
2018-01-10
Anopheles sinensis is an important malaria vector in Southeast Asia. The widespread emergence of insecticide resistance in this mosquito species poses a serious threat to the efficacy of malaria control measures, particularly in China. Recently, the whole-genome sequencing and de novo assembly of An. sinensis (China strain) has been finished. A series of insecticide-resistant studies in An. sinensis have also been reported. There is a growing need to integrate these valuable data to provide a comprehensive database for further studies on insecticide-resistant management of An. sinensis. A bioinformatics database named An. sinensis genome database (ASGDB) was built. In addition to being a searchable database of published An. sinensis genome sequences and annotation, ASGDB provides in-depth analytical platforms for further understanding of the genomic and genetic data, including visualization of genomic data, orthologous relationship analysis, GO analysis, pathway analysis, expression analysis and resistance-related gene analysis. Moreover, ASGDB provides a panoramic view of insecticide resistance studies in An. sinensis in China. In total, 551 insecticide-resistant phenotypic and genotypic reports on An. sinensis distributed in Chinese malaria-endemic areas since the mid-1980s have been collected, manually edited in the same format and integrated into OpenLayers map-based interface, which allows the international community to assess and exploit the high volume of scattered data much easier. The database has been given the URL: http://www.asgdb.org /. ASGDB was built to help users mine data from the genome sequence of An. sinensis easily and effectively, especially with its advantages in insecticide resistance surveillance and control.
Cloyd, Raymond A; Bethke, James A
2011-01-01
The neonicotinoid insecticides imidacloprid, acetamiprid, dinotefuran, thiamethoxam and clothianidin are commonly used in greenhouses and/or interiorscapes (plant interiorscapes and conservatories) to manage a wide range of plant-feeding insects such as aphids, mealybugs and whiteflies. However, these systemic insecticides may also be harmful to natural enemies, including predators and parasitoids. Predatory insects and mites may be adversely affected by neonicotinoid systemic insecticides when they: (1) feed on pollen, nectar or plant tissue contaminated with the active ingredient; (2) consume the active ingredient of neonicotinoid insecticides while ingesting plant fluids; (3) feed on hosts (prey) that have consumed leaves contaminated with the active ingredient. Parasitoids may be affected negatively by neonicotinoid insecticides because foliar, drench or granular applications may decrease host population levels so that there are not enough hosts to attack and thus sustain parasitoid populations. Furthermore, host quality may be unacceptable for egg laying by parasitoid females. In addition, female parasitoids that host feed may inadvertently ingest a lethal concentration of the active ingredient or a sublethal dose that inhibits foraging or egg laying. There are, however, issues that require further consideration, such as: the types of plant and flower that accumulate active ingredients, and the concentrations in which they are accumulated; the influence of flower age on the level of exposure of natural enemies to the active ingredient; the effect of neonicotinoid metabolites produced within the plant. As such, the application of neonicotinoid insecticides in conjunction with natural enemies in protected culture and interiorscape environments needs further investigation. Copyright © 2010 Society of Chemical Industry.
Plant compounds insecticide activity against Coleoptera pests of stored products
MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.
2008-01-01
The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...
Villanueva, Raul T; Walgenbach, James F
2005-12-01
Eight reduced-risk insecticides (acetamiprid, thiamethoxam, imidacloprid, thiacloprid, methoxyfenozide, pyriproxyfen, indoxacarb, and spinosad) and three conventional insecticides (azinphosmethyl, fenpropathrin, and esfenvalerate) were tested against Neoseiulus fallacis (Garman) (Acari: Phytoseiidae), the most abundant predacious mite in North Carolina apple (Malus spp.) orchards. To assess the effect of insecticides on development and mortality of N. fallacis immatures, 12-h-old eggs were individually placed on bean leaf disks previously dipped in insecticide solutions. Tetranychus urticae Koch (Acari: Tetranychidae) females were added as a food source. None of the reduced-risk insecticides significantly affected immature N. fallacis compared with the control; however, the pyrethroids esfenvalerate and fenpropathrin were highly toxic to immatures. To evaluate the effect of insecticides on mortality and oviposition of adult N. fallacis, 7- to 8-d-old females were confined on insecticide-treated bean leaves with Malephora crocea (Aizoaceae) pollen added as a food source. Spinosad resulted in the highest mortality, whereas azinphosmethyl, acetamiprid, fenpropathrin, and imidacloprid were moderately toxic, and mortality from esfenvalerate, indoxacarb, thiacloprid, methoxyfenozide, pyriproxyfen, and thiamethoxam did not differ significantly from the control. Oviposition was affected in a similar manner, with the exception of acetamiprid that did not affect oviposition, and thiamethoxam that reduced oviposition.
The effect of insecticide applications to melon crop on melon aphid and its natural enemies
International Nuclear Information System (INIS)
Guerra, J.; Gonzalez, J.E.; Ceballos, J.; Checa, B.
1999-01-01
Melons are an important export crop for Panama and are cultivated on more than 1000 ha of land. Long growing season, extending well into January, allows several generations and build up of heavy populations of an important insect pest, Aphis gossypii, the melon aphid. Growers find it difficult to cultivate melons without several applications of insecticides. Although the insecticide applications control the aphids, they may also have adverse effects on the natural enemies of the aphid, in particular the two predatory insects Cycloneda sanguinea and Chrysoperla carnea. The purpose of this research was to evaluate the impact of insecticide applications on these insects and on the yield of melons, and to estimate residues of the applied insecticides in soil. The insecticides were applied as four different type of treatments to melon crop. The treatments were (i) three periodic applications of endosulfan (Thiodan 35EC), each at 0.52 kg a.i./ha, (ii) three applications of fenitrothion (Sumithion 50WP), each at 0.35 kg a.i./ha, (iii) two applications of fenitrothion and one of endosulfan, and (iv) grower's treatment, which included applications of six different insecticides. The effect of the insecticide applications was evaluated by estimating numbers of each of the three type of insects before and within 72 hours after the applications and estimating yield of melons. All insecticide treatments reduced the populations of Aphis gossypii, but they also reduced the numbers of the benificial insects. Endosulfan was somewhat less toxic to C. carnea than the other insecticides were, since greater number of C. carnea were recorded from the plots treated with endosulfan than the other treated plots. The best yield of melons was recorded in the plots which were sprayed with fenitrothion, followed by the plots sprayed with endosulfan. and then those with grower's insecticides. Soon after the application of endosulfan the residue in the soil was 0.2 mg/kg, but it declined to less
Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...
African Journals Online (AJOL)
HP
Original Research Article. Gas Chromatography-Mass Spectrometric Analysis and ... into a natural fumigant/insecticide for the control of stored product insects. Keywords: Mallotus ..... stability as well as reduce cost. ACKNOWLEDGEMENT.
Directory of Open Access Journals (Sweden)
S. Moinoddini
2016-05-01
Full Text Available In the last decades, pesticides have been used extensively, in order to control pests and plant diseases, but negative impacts of pesticides caused several environmental problems and put human health in danger. In order to decrease environmental hazards of pesticide, risk of pesticide application should be measured briefly and precisely. In this study environmental impacts of registered insecticides in Iran which applied in 2001-2002, 2003-2004, 2004-2005, are considered using environmental impact quotient (EIQ index. Results showed that among considered insecticides, Imidacloprid, Fipronil and Tiodicarb, potentially (EIQ were the most hazardous insecticides, respectively. Taking rate of application and active ingredient of insecticide in to account, environmental impact (practical toxicity per cultivated hectare (EIQ Field of each provinces were investigated. In this regard, among different province of Iran, Kerman, Mazandaran and Golestan were in danger more than the others, respectively. Besides, considering the amount of agricultural production in provinces, environmental impact per ton of production were calculated for each provinces which three northern provinces of Mazandaran, Golestan and Guilan, respectively endure the most environmental impact per ton of production. Eventually based on environmental impact quotient, results demonstrated that majority of environmental impacts of insecticide in Iran were due to inadequate knowledge and also overuse of a few number of insecticides. Therefore, by improving knowledge about environmental impact of pesticides and also developing environmental friendly and ecological based methods, negative environmental impacts of insecticides will be reduced significantly.
Container production of nursery plants using biodegradable containers has been studied in recent years as a sustainable alternative to traditional plastic containers. Plant growth and photosynthetic performance of Hydrangea macrophylla ‘Merritt’s Supreme’ were investigated in this study when they we...
Performance evaluation of a newly developed variable rate sprayer for nursery liner applications
An experimental variable-rate sprayer designed for liner applications was tested by comparing its spray deposit, coverage, and droplet density inside canopies of six nursery liner varieties with constant-rate applications. Spray samplers, including water sensitive papers (WSP) and nylon screens, wer...
The Case Against Using Organic Fertilizers in Channel Catfish Ictalurus punctatus Nursery Ponds
This paper reviews the assumed advantages and disadvantages of organic fertilizers and presents the case that the risks outweigh the benefits for channel catfish, Ictalurus punctatus, nursery pond fertilization. Under certain conditions, organic fertilizers may be beneficial to provide forage for z...
Suresh, Geetha; Haridasan, K; Krishnamurthy, Kulithala Viswanathan
2013-07-01
Plant propagation is critical to augment the resource and has been the main concern for farmers and planters through history. India has evolved the science of Vṛkṣāyurveda to address the above issue. An effort is made here to review Vṛkṣāyurveda literature related to nursery techniques. Different libraries were visited and relevant review material obtained by hand search and from databases. Interaction with Sanskrit scholars and eminent scientists working in the field of Vṛkṣāyurveda, as well as the efforts of the authors of this paper, helped in the selection of pertinent literature. In the absence of original texts, authentic translations of the publications were referred. A conscious decision was made to limit the search to the fields of seed storage, pretreatment and nutrition of seedlings. To have a comparative account recent trends and literature on nursery technology were also examined. This was supplemented by interviews with traditional organic farmers. Our survey revealed that the time period of the literature pertaining to Vṛkṣāyurveda ranges from BCE 1200 to the present times. The subject has evolved from morphological descriptions and uses of plants, in texts such as Ṛgveda and Atharvaveda, to treatises dedicated solely to the art of growing plants like Kṛṣi-Parāśara and Vṛkṣāyurveda. It is also evident that there were important periods when more works appeared across subjects such as water divining, soil types, seed collection and storage, propagation, germination and sprouting, watering regimen, pest, and disease control. The review revealed that valuable information pertaining to nursery techniques is available in Vṛkṣāyurveda, which can be used in the development of nursery protocol. This will not only help in effective organic nursery management, but also ensure the health and livelihood security of the communities involved and effective waste management.
Szpyrka, Ewa; Matyaszek, Aneta; Słowik-Borowiec, Magdalena
2017-05-01
Dissipations of three insecticides: chlorantraniliprole, chlorpyrifos-methyl and indoxacarb in apples were studied following their foliar application on apples intended for production of baby food. The apples were sprayed with formulations for control of codling moth (Cydia Pomonella L.) and leafrollers (Tortricidae). Six experiments were conducted; each insecticide was applied individually on dessert apples. A validated gas chromatography-based method with simultaneous electron capture and nitrogen-phosphorus detection (GC-ECD/NPD) was used for the residue analysis. The analytical performance of the method was satisfactory, with expanded uncertainties ≤36% (a coverage factor, k = 2, and a confidence level of 95%). The dissipations of insecticides were studied in pseudo-first-order kinetic models (for which the coefficient of determination, R 2 , ranged between 0.9188 and 0.9897). Residues of studied insecticides were below their maximum residue limits of 0.5 mg/kg at an early stage of growth of the fruit. The half-lives of chlorantraniliprole, chlorpyrifos-methyl and indoxacarb were 16-17, 4-6 and 20-24 days, respectively. The initial residue levels declined gradually and reached the level of 0.01 mg/kg in 1 month for chlorpyrifos-methyl, 2 months for chlorantraniliprole and 2.5 months for indoxacarb. To obtain the insecticide residue levels below 0.01 mg/kg, which is the default MRL for food intended for infants and young children, the application of the studied insecticides should be carried out at recommended doses not later then: 1 month before harvest for chlorpyrifos-methyl, 2 months for chlorantraniliprole and 2.5 months for indoxacarb.
International Nuclear Information System (INIS)
Blasiak, J.
1995-01-01
Using an isotope labelling technique it has been shown that an organophosphorus insecticide methyl parathion (0,0-diethyl 0-4-nitrophenyl phosphorothionate) depressed calcium uptake by sarcoplasmic reticulum isolated from rabbit hind leg muscle. The effect was significant for insecticide concentrations of 50 and 100 μM and was dose-dependent. The insecticide exerted a more pronounced effect on calcium uptake in the presence of ATP in the reticulum environment than in the absence of ATP. The inhibitory action of methyl parathion on Ca 2+ accumulation by sarcoplasmic reticulum can cause a rise in myoplasmic free Ca 2+ , the essential prerequisite for contracture activation. Because methyl parathion, as well as other organophosphorus insecticides, is primarily neurotoxic, evidence of non-specific effect could be important for assessing its environmental safety. (author). 20 refs, 2 figs
Aedes aegypti resistance development to commonly used insecticides in Jakarta, Indonesia.
Directory of Open Access Journals (Sweden)
Penny Humaidah Hamid
Full Text Available Aedes aegypti is the primary vector of various relevant arthropod-borne viral infectious diseases worldwide. The mosquito control is still mainly performed by using insecticides but their effectiveness is increasingly questioned nowadays. We here conducted a study on Ae. aegypti resistance development towards several commonly used insecticides in the capital city of Jakarta, Indonesia. In order to achieve this goal, Ae. aegypti eggs from Jakarta were collected with ovitraps and hatched in the insectary of the Gadjah Mada University, Indonesia. The F0 generations were used for WHO resistance tests and knockdown resistance (kdr assays. Presented results clearly showed that there was resistance development of Ae. aegypti populations to the here tested pyrethroid insecticides (i. e. permethrin. Observed mortalities were less than 90% with highest resistance against 0.75% permethrin concentrations. Furthermore, a significant association of V1016G gene mutations with resistance phenotypes to 0.75% permethrin was observed. Nevertheless, the F1534C mutation did not show a significant correlation to resistance development. In conclusion, our results show that populations of Ae. aegypti mosquitoes within the city of Jakarta have developed resistance against several routinely used pyrethroid insecticides in local performed control programs. Thus, the regular verification/assessment of resistance development status will hopefully help in the future to assist local public health authorities in their mosquito control programs by recommending and managing the rotation of different routinely used insecticides with diverse effector mechanisms in order to delay Ae. aegypti resistance development.
Asiimwe, Peter; Naranjo, Steven E; Ellsworth, Peter C
2014-04-01
Variation in plant quality and natural enemy abundance plays an important role in insect population dynamics. In manipulative field studies, we evaluated the impact of varying irrigation levels and insecticide type on densities of Lygus hesperus Knight and the arthropod predator community in cotton. Three watering levels were established via irrigations timed according to three levels of percent soil water depletion (SWD): 20, 40, or 60, where 40% SWD is considered standard grower practice, 60% represents a deficit condition likely to impose plant productivity losses, and 20% represents surplus conditions with likely consequences on excessive vegetative plant production. The two key L. hesperus insecticides used were the broad-spectrum insecticide acephate and the selective insecticide flonicamid, along with an untreated check. We hypothesized that densities of L. hesperus and its associated predators would be elevated at higher irrigation levels and that insecticides would differentially impact L. hesperus and predator dynamics depending on their selectivity. L. hesperus were more abundant at the higher irrigation level (20% SWD) but the predator densities were unaffected by irrigation levels. Both L. hesperus and its predators were affected by the selectivity of the insecticide with highest L. hesperus densities and lowest predator abundance where the broad spectrum insecticide (acephate) was used. There were no direct interactions between irrigation level and insecticides, indicating that insecticide effects on L. hesperus and its predators were not influenced by the irrigation levels used here. The implications of these findings on the overall ecology of insect-plant dynamics and yield in cotton are discussed.
Roubos, Craig R; Rodriguez-Saona, Cesar; Holdcraft, Robert; Mason, Keith S; Isaacs, Rufus
2014-02-01
A series of bioassays were conducted to determine the relative toxicities and residual activities of insecticides labeled for use in blueberry (Vaccinium corymbosum L.) on natural enemies, to identify products with low toxicity or short duration effects on biological control agents. In total, 14 insecticides were evaluated using treated petri dishes and four commercially available natural enemies (Aphidius colemani Viereck, Orius insidiosus [Say], Chrysoperla rufilabris [Burmeister], and Hippodamia convergens [Guérin-Menéville]). Dishes were aged under greenhouse conditions for 0, 3, 7, or 14 d before introducing insects to test residual activity. Acute effects (combined mortality and knockdown) varied by insecticide, residue age, and natural enemy species. Broad-spectrum insecticides caused high mortality to all biocontrol agents, whereas products approved for use in organic agriculture had little effect. The reduced-risk insecticide acetamiprid consistently caused significant acute effects, even after aging for 14 d. Methoxyfenozide, novaluron, and chlorantraniliprole, which also are classified as reduced-risk insecticides, had low toxicity, and along with the organic products could be compatible with biological control. This study provides information to guide blueberry growers in their selection of insecticides. Further research will be needed to determine whether adoption of a pest management program based on the use of more selective insecticides will result in higher levels of biological control in blueberry.
Flupyradifurone: a brief profile of a new butenolide insecticide
Nauen, Ralf; Jeschke, Peter; Velten, Robert; Beck, Michael E; Ebbinghaus-Kintscher, Ulrich; Thielert, Wolfgang; Wölfel, Katharina; Haas, Matthias; Kunz, Klaus; Raupach, Georg
2015-01-01
BACKGROUND The development and commercialisation of new chemical classes of insecticides for efficient crop protection measures against destructive invertebrate pests is of utmost importance to overcome resistance issues and to secure sustainable crop yields. Flupyradifurone introduced here is the first representative of the novel butenolide class of insecticides active against various sucking pests and showing an excellent safety profile. RESULTS The discovery of flupyradifurone was inspired by the butenolide scaffold in naturally occurring stemofoline. Flupyradifurone acts reversibly as an agonist on insect nicotinic acetylcholine receptors but is structurally different from known agonists, as shown by chemical similarity analysis. It shows a fast action on a broad range of sucking pests, as demonstrated in laboratory bioassays, and exhibits excellent field efficacy on a number of crops with different application methods, including foliar, soil, seed treatment and drip irrigation. It is readily taken up by plants and translocated in the xylem, as demonstrated by phosphor imaging analysis. Flupyradifurone is active on resistant pests, including cotton whiteflies, and is not metabolised by recombinantly expressed CYP6CM1, a cytochrome P450 conferring metabolic resistance to neonicotinoids and pymetrozine. CONCLUSION The novel butenolide insecticide flupyradifurone shows unique properties and will become a new tool for integrated pest management around the globe, as demonstrated by its insecticidal, ecotoxicological and safety profile. © 2014 The Authors. Pest Management Science published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry. PMID:25351824
Denlinger, David S; Lozano-Fuentes, Saul; Lawyer, Phillip G; Black, William C; Bernhardt, Scott A
2015-09-01
Chemical insecticides are effective for controlling Lutzomyia and Phlebotomus sand fly (Diptera: Psychodidae) vectors of Leishmania parasites. However, repeated use of certain insecticides has led to tolerance and resistance. The objective of this study was to determine lethal concentrations (LCs) and lethal exposure times (LTs) to assess levels of susceptibility of laboratory Lutzomyia longipalpis (Lutz and Nieva) and Phlebotomus papatasi (Scopoli) to 10 insecticides using a modified version of the World Health Organization (WHO) exposure kit assay and Centers for Disease Control and Prevention (CDC) bottle bioassay. Sand flies were exposed to insecticides coated on the interior of 0.5-gallon and 1,000-ml glass bottles. Following exposure, the flies were allowed to recover for 24 h, after which mortality was recorded. From dose-response survival curves for L. longipalpis and P. papatasi generated with the QCal software, LCs causing 50, 90, and 95% mortality were determined for each insecticide. The LCs and LTs from this study will be useful as baseline reference points for future studies using the CDC bottle bioassays to assess insecticide susceptibility of sand fly populations in the field. There is a need for a larger repository of sand fly insecticide susceptibility data from the CDC bottle bioassays, including a range of LCs and LTs for more sand fly species with more insecticides. Such a repository would be a valuable tool for vector management. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Pyrethrum flowers and pyrethroid insecticides.
Casida, J E
1980-01-01
The natural pyrethrins from the daisy-like flower, Tanacetum or Chrysanthemum cinerariifolium, are nonpersistent insecticides of low toxicity to mammals. Synthetic analogs or pyrethroids, evolved from the natural compounds by successive isosteric modifications, are more potent and stable and are the newest important class of crop protection chemicals. They retain many of the favorable properties of the pyrethrins.
Log bioassay of residual effectiveness of insecticides against bark beetles
Richard H. Smith
1982-01-01
Residual effectiveness of nine insecticides applied to bark was tested against western, mountain, and Jeffrey pine beetles. Ponderosa and Jeffrey pine trees were treated and logs cut from them 2 to 13 months later, and bioassayed with the three beetles. The insecticides were sprayed at the rate of 1 gal (3.8 l) per 40- or 80-ft² (3.6 or 7.2 m²) bark surface at varying...
Insecticidal activity of Trichilia claussenii (Meliaceae) fruits against Spodoptera frugiperda
International Nuclear Information System (INIS)
Nebo, Liliane; Matos, Andrea Pereira; Vieira, Paulo Cezar; Fernandes, Joao Batista; Silva, Maria Fatima das Gracas Fernandes da; Rodrigues, Ricardo Ribeiro
2010-01-01
An evaluation of the insecticidal activity of the fruits extracts of Trichilia claussenii was carried out and the methanol extract revealed to have strong insecticidal activity. The fractionation of methanol extract of T. claussenii seeds bioassay-guided against Spodoptera frugiperda has led to the identification of the ω-phenylalkyl and alkenyl fatty acids as active compounds in this extract. The structures of the compounds were proposed by spectroscopic analysis and comparison with literature data. (author)
Weed and Pathogen Control with Reduced Methyl Bromide Rates in Open Field Nurseries
Producers of nursery stock in California rely on preplant soil fumigation to meet requirements for nematode free planting stock. Certified clean stock is essential for successful establishment and future productivity of new orchards and vineyards and is a requirement for intra- and interstate as ...
Report of the 2016 Uniform Regional Scab Nursery for spring wheat parents
The Uniform Regional Scab Nursery for Spring Wheat Parents (URSN) was grown for the 21st year in 2016. Five locations (Brookings, SD, St. Paul and Crookston, MN, Prosper, ND, and Morden, Canada) reported results. A total of 33 entries was included in the 2016 URSN, in addition to the resistant chec...
Using polymer-coated controlled-release fertilizers in the nursery and after outplanting
Thomas D. Landis; R. Kasten Dumroese
2009-01-01
Controlled-release fertilizers (CRF) are the newest and most technically advanced way of supplying mineral nutrients to nursery crops. Compared to conventional fertilizers, their gradual pattern of nutrient release better meets plant needs, minimizes leaching, and therefore improves fertilizer use efficiency. In our review of the literature, we found many terms used...
Degradation analysis of some synthetic and bio-insecticides sprayed on okra crop using HPLC
International Nuclear Information System (INIS)
Abar, M.F.; Haq, M.A.; Yasmin, N.; Khan, M.F.U.
2012-01-01
This study aimed to find out the degradation of three conventional and two bio-insecticides sprayed on okra crop. Imidacloprid, Endosulfan and Profenofos were selected as convectional and biosal and spinosad as bioinsecticide. The insecticides were sprayed at the rates of 49.4, 642.2, 988, 35.5 and 158 g. a. i. ha/sup -1/ respectively. The insecticide residues were analyzed in the leaf and fruit after 0, 1, 3 and 7 days using high performance liquid chromatography. First order degradation kinetics was fitted on this data and degradation rate constants and half life were calculated. Conventional insecticides were found to be more persistent in the crop (Average half life: 1.95, 2.42 and 1.57 days for imidacloprid, endosulfan and profenofos respectively) than bioinsecticides (Average half life 1.25 and 0.27 days for spinosad and biosal respectively). Residues of all tested insecticides were compared with codex and EU MRLs and found both the bio-insecticides treated crops safe for human consumption even after few hours of spray. Endosulfan and profenofos treated crops were not found to be fit for consumption even after 7 days of application. Imidacloprid being biorational (low risk) was also safe for consumption on the next day of application. (author)
Knodel, Janet J; Olson, Denise L; Hanson, Bryan K; Henson, Robert A
2008-06-01
Integration of cultural practices, such as planting date with insecticide-based strategies, was investigated to determine best management strategy for flea beetles (Phyllotreta spp.) (Coleoptera: Chrysomelidae) in canola (Brassica napus L.). We studied the effect of two spring planting dates of B. napus and different insecticide-based management strategies on the feeding injury caused by fleabeetles in North Dakota during 2002-2003. Adult beetle peak emergence usually coincided with the emergence of the early planted canola, and this resulted in greater feeding injury in the early planted canola than later planted canola. Use of late-planted canola may have limited potential for cultural control of flea beetle, because late-planted canola is at risk for yield loss due to heat stress during flowering. Flea beetle injury ratings declined when 1) the high rate of insecticide seed treatment plus a foliar insecticide applied 21 d after planting was used, 2) the high rate of insecticide seed treatment only was used, or 3) two foliar insecticide sprays were applied. These insecticide strategies provided better protection than the low rates of insecticide seed treatments or a single foliar spray, especially in areas with moderate-to-high flea beetle populations. The foliar spray on top of the seed treatment controlled later-emerging flea beetles as the seed treatment residual was diminishing and the crop became vulnerable to feeding injury. The best insecticide strategy for management of flea beetle was the high rate of insecticide seed treatment plus a foliar insecticide applied at 21 d after planting, regardless of planting date.
Hueter, Robert E.; Manire, Charles A.
1994-01-01
The bays and estuaries of the southeast United States coast generally are thought to serve as nursery areas for various species of coastal sharks, where juvenile sharks find abundant food and are less exposed to predation by larger sharks. Because these areas typically support substantial commercial and recreational fisheries, fishing mortality of sharks in the nurseries particularly by bycatch, may be significant. This two-year project assessed the relative importance of two estuaries of the...
Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research ... apelta aerial parts was analyzed by gas chromatography/mass spectrometric (GC/MS) to determine its composition. ... into a natural fumigant/insecticide for the control of stored product insects.
Plavšin, Ivana; Stašková, Tereza; Šerý, Michal; Smýkal, Vlastimil; Hackenberger, Branimir K; Kodrík, Dalibor
2015-04-01
Insect anti-stress responses, including those induced by insecticides, are controlled by adipokinetic hormones (AKHs). We examined the physiological consequences of Pyrap-AKH application on Tribolium castaneum adults (AKH-normal and AKH-deficient prepared by the RNAi technique) treated by two insecticides, pirimiphos-methyl and deltamethrin. Co-application of pirimiphos-methyl and/or deltamethrin with AKH significantly increased beetle mortality compared with application of the insecticides alone. This co-treatment was accompanied by substantial stimulation of general metabolism, as monitored by carbon dioxide production. Further, the insecticide treatment alone affected some basic markers of oxidative stress: it lowered total antioxidative capacity as well as the activity of superoxide dismutase in the beetle body; in addition, it enhanced the activity of catalase and glutathione-S-transferase. However, these discrepancies in oxidative stress markers were eliminated/reduced by co-application with Pyrap-AKH. We suggest that the elevation of metabolism, which is probably accompanied with faster turnover of toxins, might be responsible for the higher mortality that results after AKH and insecticide co-application. Changes in oxidative stress markers are probably not included in the mechanisms responsible for increased mortality. Copyright © 2015 Elsevier Inc. All rights reserved.
Budda, Madeline L; Ely, John J; Doan, Sandra; Chavez-Suarez, Maria; White, Gary L; Wolf, Roman F
2013-08-01
Baboons (Papio hamadryas anubis) of a conventional breeding colony were nursery-reared to create a specific pathogen-free (SPF) baboon-breeding program. Because the founding generations were nursery-reared until 2 years of age, it was suspected that the SPF baboons would exhibit increased reproductive challenges as adults. Mothering behavior was of interest, because SPF females were not exposed to parental role models during the nursery-rearing process. We compared reproductive data from the SPF baboon breeding program during its first 10 years with data from age-matched baboons during the same period from an established, genetically-similar conventional breeding colony. We also evaluated records documenting mother-infant behaviors within the SPF colony. The average age of menarche in SPF females was 3.3 years. The overall live birth rate of both SPF and conventional females was approximately 90%, with no difference in pregnancy outcome between the two colonies. The average age at first conception for SPF females was earlier (4.2 years) than that of the conventional females (4.7 years). In both colonies, primiparous females were more likely to abort than multiparous females. Similarly, primiparous females were more likely to lose their infants to death or human intervention. A mothering score system was developed in the SPF colony to facilitate intervention of poor mother-infant relationships. Records revealed 70% of SPF mothers were able to raise one or more of their infants successfully to at least 180 days of age, which did not differ from conventional mothers. SPF females returned to post-partum amenorrhea 27 days sooner on average than the conventional females, independent of dam age. The nursery-rearing process used for recruitment into the SPF colony therefore did not have an adverse effect on reproduction or rearing offspring. © 2013 Wiley Periodicals, Inc.
Investigation of air pollutants in rural nursery school - a case study
Mainka, Anna; Zajusz-Zubek, Elwira; Kozielska, Barbara; Brągoszewska, Ewa
2018-01-01
Children's exposure to air pollutants is an important public health challenge. Indoor air quality (IAQ) in nursery school is believed to be different from elementary school. Moreover, younger children are more vulnerable to air pollution than higher grade children because they spend more time indoors, and their immune systems and bodies are less mature. The purpose of this study was to evaluate the indoor air quality (IAQ) at naturally ventilated rural nursery schools located in Upper Silesia, Poland. We investigated the concentrations of volatile organic compounds (VOCs), particulate matter (PM), bacterial and fungal bioaerosols, as well as carbon dioxide (CO2) concentrations in younger and older children's classrooms during the winter and spring seasons. The concentration of the investigated pollutants in indoor environments was higher than those in outdoor air. The results indicate the problem of elevated concentrations of PM2.5 and PM10 inside the examined classrooms, as well as that of high levels of CO2 exceeding 1,000 ppm in relation to outdoor air. The characteristics of PM and CO2 levels were significantly different, both in terms of classroom occupation (younger or older children) and of season (winter or spring).
The role of the neonatal nurse practitioner in the community hospital level I nursery.
Hatch, Julie
2012-01-01
Neonatal nurse practitioners (NNPs) have played a significant role in providing medical coverage to many of the country's Level III neonatal intensive care units (NICUs). Extensive education and experience are required for a nurse practitioner (NP) to become competent in caring for these critically ill newborns. The NNP can take this competence and experience and expand her role out into the community Level I nurseries. Clinical care of the infants and close communication with parents, pediatricians, and the area tertiary center provide a community service with the goal of keeping parents and babies together in the community hospital without compromising the health of the baby. The NNP service, with 24-hour nursery and delivery coverage, supports an ongoing obstetric service to the community hospital. The NNP's experience enables her to provide a neonatal service that encompasses a multitude of advanced practice nursing roles.
Directory of Open Access Journals (Sweden)
Endang Sulistyowati
2014-05-01
Full Text Available Control of cocoa mirid, Helopeltis antoniiso far uses chemicalinsecticides as the main alternative. Therefore, it is necessary to find out the environment friendly control techniques. Lemongrass, garlic, and tree marigold have been known as an efectiveness botanical insecticides for horticulture. A research with aim to study the effectiveness of lemongrass (Cymbopogon nardus, garlic (Allium sativum and tree marigold (Tithonia diversifoliafor controlling H. antoniihave been carried out in cocoa plantation at Kaliwining experimental garden of Indonesian Coffee and Cocoa Research Institute. The research was arranged in split plot design in three replication, with the main plot infestation time of H. antoniiand sub-plot kind of botanical insecticides. Concentration of botanical insecticides used in this study was 5% and applied on 12 cm cocoa pod in length by using knapsack sprayer. Infestation of H. antonii nymphes were conducted before and after insecticide applications. Observation was conducted on the mortality and the lesion of H. antonii. The results of orthogonal contrast test on feeding activity based on the number of lesion and percentage of mortality of H. antoniishowed that there were significantly different between insecticide treatment and control, between chemical insecticide and botanical insecticides, but there was no significant different on kind of botanical insecticides. The lowest number of lesion due to H. antonii was shown by chemical insecticide with an average 34.0, followed by garlic and lemongrass botanical insecticide with number of lesion were 51.2 and 64.7 respectively, whereas the number of lesion in the control reached 84.2. The highest percentage mortality of H. antoniiwas shown by chemical insecticide with active ingredient teta-cypermethrin at 84.3%, followed by garlic, lemon grass and tree marigold botanical insecticide were 65.8%; 65.0%; and 63.8% respectively and significantly different with control by 8
Gas Chromaotography-Mass Spectrometry Analysis of Insecticidal ...
African Journals Online (AJOL)
Insecticidal Essential Oil Derived from Chinese Ainsliaea fragrans Champ ex Benth ... Methods: The essential oil of A. fragrans aerial parts was obtained by hydrodistillation and analyzed by ..... toxicity than the crude oil. Caryophyllene showed.
Influence on sensitivity to insecticides: a case study of a settled area ...
African Journals Online (AJOL)
The close proximity of Liwonde National Park to Liwonde town creates a unique situation of a large human population adjacent to a natural undisturbed animal reserve. The closeness of the two ecosystems has an impact on biology of mosquitoes of the area, such as susceptibility to insecticides. Susceptibility to insecticide ...
Szczepaniec, Adrianna; Raupp, Michael J.; Parker, Roy D.; Kerns, David; Eubanks, Micky D.
2013-01-01
Background Chemical suppression of arthropod herbivores is the most common approach to plant protection. Insecticides, however, can cause unintended, adverse consequences for non-target organisms. Previous studies focused on the effects of pesticides on target and non-target pests, predatory arthropods, and concomitant ecological disruptions. Little research, however, has focused on the direct effects of insecticides on plants. Here we demonstrate that applications of neonicotinoid insecticides, one of the most important insecticide classes worldwide, suppress expression of important plant defense genes, alter levels of phytohormones involved in plant defense, and decrease plant resistance to unsusceptible herbivores, spider mites Tetranychus urticae (Acari: Tetranychidae), in multiple, distantly related crop plants. Methodology/Principal Findings Using cotton (Gossypium hirsutum), corn (Zea mays) and tomato (Solanum lycopersicum) plants, we show that transcription of phenylalanine amonia lyase, coenzyme A ligase, trypsin protease inhibitor and chitinase are suppressed and concentrations of the phytohormone OPDA and salicylic acid were altered by neonicotinoid insecticides. Consequently, the population growth of spider mites increased from 30% to over 100% on neonicotinoid-treated plants in the greenhouse and by nearly 200% in the field experiment. Conclusions/Significance Our findings are important because applications of neonicotinoid insecticides have been associated with outbreaks of spider mites in several unrelated plant species. More importantly, this is the first study to document insecticide-mediated disruption of plant defenses and link it to increased population growth of a non-target herbivore. This study adds to growing evidence that bioactive agrochemicals can have unanticipated ecological effects and suggests that the direct effects of insecticides on plant defenses should be considered when the ecological costs of insecticides are evaluated. PMID
Mosaic Stunting in jack pine seedlings in a northern Michigan bareroot nursery
Lynette Potvin; R. Kasten Dumroese; Martin F. Jurgensen; Dana Richter
2010-01-01
Mosaic, or patchy, stunting of bareroot conifer seedlings is thought to be caused by deficiencies of mycorrhizal fungi following fumigation, resulting in reduced nutrient uptake, particularly phosphorus. Mosaic stunting of jack pine (Pinus banksiana) seedlings was observed in 2005 at the USDA Forest Service JW Toumey Nursery in Watersmeet, MI. We initiated a study to...
Alexander, B; Barros, V C; de Souza, S F; Barros, S S; Teodoro, L P; Soares, Z R; Gontijo, N F; Reithinger, R
2009-10-01
To investigate the insecticide susceptibility of two geographically separated Lutzomyia longipalpis populations (Lapinha and Montes Claros) with different histories of insecticide exposure (i.e. no exposure and repeated exposure, respectively). (i) Bioassay monitoring of sand fly survival over time when exposed to a range of insecticides; and (ii) analysis of the level of insecticide detoxification enzymes in individual sand flies caught at both study sites. Insecticides tested were the organophosphates malathion and fenitrothion and the pyrethroids lambda-cyhalothrin, permethrin and deltamethrin. Survival analyses showed that whilst there was no overall significant difference in susceptibility of both populations to organophosphates, Lapinha sand flies were significantly more susceptible to pyrethroids than those from Montes Claros. Multiple regression analyses also showed that insecticide susceptibility in both locations varied with sand fly sex. The relative susceptibilities of the two sand fly populations to tested insecticides were also compared. Thus, Montes Claros sand flies were most susceptible to malathion, followed by fenitrothion, deltamethrin and permethrin. Those from Lapinha were most susceptible to lambda-cyhalothrin, followed by malathion, permethrin, deltamethrin and fenitrothion. Biochemical analyses demonstrated that Montes Claros sand flies had significantly lower insecticide detoxification enzyme activity than Lapinha sand flies. Our results are the first record of significantly reduced susceptibility to the insecticides used in control of wild populations of Lu. longipalpis. They demonstrate the importance of evaluating chemicals against this species by conventional bioassay and microplate assays before and during spraying programmes.
Directory of Open Access Journals (Sweden)
Francesco Colloca
Full Text Available The identification of nursery grounds and other essential fish habitats of exploited stocks is a key requirement for the development of spatial conservation planning aimed at reducing the adverse impact of fishing on the exploited populations and ecosystems. The reduction in juvenile mortality is particularly relevant in the Mediterranean and is considered as one of the main prerequisites for the future sustainability of trawl fisheries. The distribution of nursery areas of 11 important commercial species of demersal fish and shellfish was analysed in the European Union Mediterranean waters using time series of bottom trawl survey data with the aim of identifying the most persistent recruitment areas. A high interspecific spatial overlap between nursery areas was mainly found along the shelf break of many different sectors of the Northern Mediterranean indicating a high potential for the implementation of conservation measures. Overlap of the nursery grounds with existing spatial fisheries management measures and trawl fisheries restricted areas was also investigated. Spatial analyses revealed considerable variation depending on species and associated habitat/depth preferences with increased protection seen in coastal nurseries and minimal protection seen for deeper nurseries (e.g. Parapenaeus longirostris 6%. This is partly attributed to existing environmental policy instruments (e.g. Habitats Directive and Mediterranean Regulation EC 1967/2006 aiming at minimising impacts on coastal priority habitats such as seagrass, coralligenous and maerl beds. The new knowledge on the distribution and persistence of demersal nurseries provided in this study can support the application of spatial conservation measures, such as the designation of no-take Marine Protected Areas in EU Mediterranean waters and their inclusion in a conservation network. The establishment of no-take zones will be consistent with the objectives of the Common Fisheries Policy
Colloca, Francesco; Garofalo, Germana; Bitetto, Isabella; Facchini, Maria Teresa; Grati, Fabio; Martiradonna, Angela; Mastrantonio, Gianluca; Nikolioudakis, Nikolaos; Ordinas, Francesc; Scarcella, Giuseppe; Tserpes, George; Tugores, M Pilar; Valavanis, Vasilis; Carlucci, Roberto; Fiorentino, Fabio; Follesa, Maria C; Iglesias, Magdalena; Knittweis, Leyla; Lefkaditou, Eugenia; Lembo, Giuseppe; Manfredi, Chiara; Massutí, Enric; Pace, Marie Louise; Papadopoulou, Nadia; Sartor, Paolo; Smith, Christopher J; Spedicato, Maria Teresa
2015-01-01
The identification of nursery grounds and other essential fish habitats of exploited stocks is a key requirement for the development of spatial conservation planning aimed at reducing the adverse impact of fishing on the exploited populations and ecosystems. The reduction in juvenile mortality is particularly relevant in the Mediterranean and is considered as one of the main prerequisites for the future sustainability of trawl fisheries. The distribution of nursery areas of 11 important commercial species of demersal fish and shellfish was analysed in the European Union Mediterranean waters using time series of bottom trawl survey data with the aim of identifying the most persistent recruitment areas. A high interspecific spatial overlap between nursery areas was mainly found along the shelf break of many different sectors of the Northern Mediterranean indicating a high potential for the implementation of conservation measures. Overlap of the nursery grounds with existing spatial fisheries management measures and trawl fisheries restricted areas was also investigated. Spatial analyses revealed considerable variation depending on species and associated habitat/depth preferences with increased protection seen in coastal nurseries and minimal protection seen for deeper nurseries (e.g. Parapenaeus longirostris 6%). This is partly attributed to existing environmental policy instruments (e.g. Habitats Directive and Mediterranean Regulation EC 1967/2006) aiming at minimising impacts on coastal priority habitats such as seagrass, coralligenous and maerl beds. The new knowledge on the distribution and persistence of demersal nurseries provided in this study can support the application of spatial conservation measures, such as the designation of no-take Marine Protected Areas in EU Mediterranean waters and their inclusion in a conservation network. The establishment of no-take zones will be consistent with the objectives of the Common Fisheries Policy applying the ecosystem
Irrigation runoff insecticide pollution of rivers in the Imperial Valley, California (USA)
Energy Technology Data Exchange (ETDEWEB)
Vlaming, V. de [Aquatic Toxicology Laboratory, VM: APC, 1321 Haring Hall, University of California, Davis, CA 95616 (United States)]. E-mail: vldevlaming@ucdavis.edu; DiGiorgio, C. [Department of Water Resources, P.O. Box 942836, Sacramento, CA 94236 (United States); Fong, S. [Aquatic Toxicology Laboratory, VM: APC, 1321 Haring Hall, University of California, Davis, CA 95616 (United States); Deanovic, L.A. [Aquatic Toxicology Laboratory, VM: APC, 1321 Haring Hall, University of California, Davis, CA 95616 (United States); Paz Carpio-Obeso, M. de la [Colorado River Basin Region Water Quality Control Board, 73-720 Fred Waring Drive, Suite 100, Palm Desert, CA 92260 (United States); Miller, J.L. [AQUA-Science, 17 Arboretum Drive, Davis, CA 95616 (United States); Miller, M.J. [AQUA-Science, 17 Arboretum Drive, Davis, CA 95616 (United States); Richard, N.J. [Division of Water Quality, State Water Resources Control Board, 1001 I Street, Sacramento, CA 95814 (United States)
2004-11-01
The Alamo and New Rivers located in the Imperial Valley, California receive large volumes of irrigation runoff and discharge into the ecologically sensitive Salton Sea. Between 1993 and 2002 we conducted a series of studies to assess water quality using three aquatic species: a cladoceran (Ceriodaphnia dubia), a mysid (Neomysis mercedis), and a larval fish (Pimephales promelas). Although no mortality was observed with the P. promelas, high-level toxicity to the invertebrate species was documented in samples from both rivers during many months of each year. Toxicity identifications and chemical analyses identified the organophosphorus insecticides (OP), chlorpyrifos and diazinon, as the cause of C. dubia toxicity. The extent of the C. dubia mortality was highly correlated with quantities of these OPs applied in the river watersheds. C. dubia mortality occurred during more months of our 2001/2002 study than in the 1990s investigations. During 2001/2002, the extensive C. dubia mortality observed in New River samples was caused by OP insecticide pollution that originated from Mexico. Mortality to N. mercedis in New River samples was likely caused by contaminants other than OP insecticides. Our studies document OP insecticide-caused pollution of the Alamo River over a 10-year period and provide the necessary information for remediation efforts. - Capsule: Organophosphorous insecticides in runoff water from the USA and Mexico have impacted rivers in the Imperial Valley, California.
Irrigation runoff insecticide pollution of rivers in the Imperial Valley, California (USA)
International Nuclear Information System (INIS)
Vlaming, V. de; DiGiorgio, C.; Fong, S.; Deanovic, L.A.; Paz Carpio-Obeso, M. de la; Miller, J.L.; Miller, M.J.; Richard, N.J.
2004-01-01
The Alamo and New Rivers located in the Imperial Valley, California receive large volumes of irrigation runoff and discharge into the ecologically sensitive Salton Sea. Between 1993 and 2002 we conducted a series of studies to assess water quality using three aquatic species: a cladoceran (Ceriodaphnia dubia), a mysid (Neomysis mercedis), and a larval fish (Pimephales promelas). Although no mortality was observed with the P. promelas, high-level toxicity to the invertebrate species was documented in samples from both rivers during many months of each year. Toxicity identifications and chemical analyses identified the organophosphorus insecticides (OP), chlorpyrifos and diazinon, as the cause of C. dubia toxicity. The extent of the C. dubia mortality was highly correlated with quantities of these OPs applied in the river watersheds. C. dubia mortality occurred during more months of our 2001/2002 study than in the 1990s investigations. During 2001/2002, the extensive C. dubia mortality observed in New River samples was caused by OP insecticide pollution that originated from Mexico. Mortality to N. mercedis in New River samples was likely caused by contaminants other than OP insecticides. Our studies document OP insecticide-caused pollution of the Alamo River over a 10-year period and provide the necessary information for remediation efforts. - Capsule: Organophosphorous insecticides in runoff water from the USA and Mexico have impacted rivers in the Imperial Valley, California
Mode of Action of the Natural Insecticide, Decaleside Involves Sodium Pump Inhibition.
Rajashekar, Yallappa; Shivanandappa, Thimmappa
2017-01-01
Decalesides are a new class of natural insecticides which are toxic to insects by contact via the tarsal gustatory chemosensilla. The symptoms of their toxicity to insects and the rapid knockdown effect suggest neurotoxic action, but the precise mode of action and the molecular targets for decaleside action are not known. We have presented experimental evidence for the involvement of sodium pump inhibition in the insecticidal action of decaleside in the cockroach and housefly. The knockdown effect of decaleside is concomitant with the in vivo inhibition of Na+, K+ -ATPase in the head and thorax. The lack of insecticidal action by experimental ablation of tarsi or blocking the tarsal sites with paraffin correlated with lack of inhibition of Na+- K+ ATPase in vivo. Maltotriose, a trisaccharide, partially rescued the toxic action of decaleside as well as inhibition of the enzyme, suggesting the possible involvement of gustatory sugar receptors. In vitro studies with crude insect enzyme preparation and purified porcine Na+, K+ -ATPase showed that decaleside competitively inhibited the enzyme involving the ATP binding site. Our study shows that the insecticidal action of decaleside via the tarsal gustatory sites is causally linked to the inhibition of sodium pump which represents a unique mode of action. The precise target(s) for decaleside in the tarsal chemosensilla and the pathway linked to inhibition of sodium pump and the insecticidal action remain to be understood.
Skin care practices in newborn nurseries and mother-baby units in Maryland.
Khalifian, S; Golden, W C; Cohen, B A
2017-06-01
Skin provides several important homeostatic functions to the developing neonate. However, no consensus guidelines exist in the United States for skin care in the healthy term newborn. We performed a study of skin and umbilical cord care (including bathing practices, vernix removal and antiseptic cord application) in newborn nurseries and mother-baby units throughout the state of Maryland to determine practices in a variety of clinical settings and assess if uniformity in skin care exists. These data were then assessed in the context of a review of the current literature. We received responses from over 90% of nurseries across the state. In our cohort, practices varied widely between institutions and specific populations, and often were not evidence-based or were contrary to best practices discussed in the scientific literature. The frequent departures from evidence that occur regarding the aforementioned practices are likely due to a lack of consensus on these issues as well as limited data on such practices, further highlighting the need for data-driven guidelines on newborn skin care.
Nursery use of shallow habitats by epibenthic fishes in Maine nearshore waters
Lazzari, M. A.; Sherman, S.; Kanwit, J. K.
2003-01-01
Species richness and abundance of epibenthic fishes were quantified with daytime beam trawl tows in shallow water habitats during April-November 2000 of three mid-coast Maine estuaries: Casco Bay, Muscongus Bay and the Weskeag River. Five shallow (Gasterosteus aculeatus, Apeltes quadracus, Pungitius pungitius, Myoxocephalus aenaeus, and Cylcopterus lumpus. The fish community of mid-coast estuaries was dominated by young-of-the-year (YOY) and juvenile fishes and all of the habitat types function as nursery areas. Twelve species (38%) of commercial and recreational importance were collected in the three estuaries, but the percentage was higher in Casco Bay (44%) and the Weskeag River (46%). These species included Anguilla rostrata, Clupea harengus, Gadus morhua, Microgadus tomcod, Pollachius virens, Urophycis chuss, Urophycis regia, Urophycis tenuis, Osmerus mordax, Macrozoarces americanus, Tautogolabrus adspersus, and Pleuronectes americanus. Four species, G. morhua, M. tomcod, P. virens, and U. tenuis were more common in spring than summer or autumn. P. americanus was most abundant in summer followed by spring and autumn. This study documents the importance of shallow estuarine areas in Maine as nurseries for these species.
Radiation fixation of vinyl chloride in an insecticide aerosol container
International Nuclear Information System (INIS)
Kagiya, V.T.; Takemoto, K.
1975-01-01
Recently, a large quantity of vinyl chloride has been used as spraying additive for insecticide aerosols. Since January 1974 when the Food and Drug Administration of the United States of America announced that vinyl chloride causes liver cancer, it has been forbidden in Japan and the United States of America to market insecticide aerosol containers containing vinyl chloride. In Japan, following a government order, about 20 million insecticide aerosol containers have been collected and put into storage. A report is given on the radiation fixation of vinyl chloride as polyvinylchloride powder by gamma-ray-induced polymerization in the aerosol container. Insecticide aerosol containers containing vinyl chloride were irradiated by gamma rays from 60 Co at room temperature. Vinyl chloride polymerized to form powdered polymer in the container. Polymerization conversion increased with the irradiation dose, and after 10 Mrad irradiation, vinyl chloride was not found in the sprayed gas. This establishes that vinyl chloride can be fixed by gamma-ray irradiation in the aerosol container. To accelerate the reaction rate, the effect of various additives on the reaction was investigated. It was found that halogenated hydrocarbons, such as chloroform and carbon tetrachloride, accelerated the initiation of the polymerization, and that a vinyl monomer such as vinyl acetate accelerated the reaction rate due to the promotion of the initiation and the high reactivity of the polyvinylacetate radical to vinyl chloride. Consequently, the required irradiation dose for the fixation of vinyl chloride was decreased to less than 5 Mrad by the addition of various kinds of additives. Following the request of the Ministry of Public Welfare, various technical problems for large-scale treatment are being studied with the co-operation of the Federation of Insecticide Aerosols. (author)
Tri-trophic insecticidal effects of African plants against cabbage pests.
Directory of Open Access Journals (Sweden)
Blankson W Amoabeng
Full Text Available Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae, Siam weed, Chromolaena odorata (Asteraceae, Cinderella weed, Synedrella nodiflora (Asteraceae, chili pepper, Capsicum frutescens (Solanaceae, tobacco, Nicotiana tabacum (Solanaceae cassia, Cassia sophera (Leguminosae, physic nut, Jatropha curcas (Euphorbiaceae, castor oil plant, Ricinus communis (Euphorbiaceae and basil, Ocimum gratissimum (Lamiaceae. In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis, all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from
Tri-trophic insecticidal effects of African plants against cabbage pests.
Amoabeng, Blankson W; Gurr, Geoff M; Gitau, Catherine W; Nicol, Helen I; Munyakazi, Louis; Stevenson, Phil C
2013-01-01
Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily
Tri-Trophic Insecticidal Effects of African Plants against Cabbage Pests
Amoabeng, Blankson W.; Gurr, Geoff M.; Gitau, Catherine W.; Nicol, Helen I.; Stevenson, Phil C.
2013-01-01
Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily
Energy Technology Data Exchange (ETDEWEB)
Stenstroem, Elna [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Mycology and Pathology; Arvidsson, Bernt [Svenska Skogsplantor AB, Joenkoeping (Sweden)
2001-07-01
During the 1990s, there were serious outbreaks of the pathogen Lophodermium seditiosum on pine seedlings in Swedish forest nurseries, even though the seedlings had been treated with the fungicide propiconazole. The present experiment was carried out to evaluate two other fungicides, fluazinam and azoxystrobin, as possible alternatives to propiconazole. In the tests, which were all carried out in the same forest nursery, seedlings were treated with either propiconazole, fluazinam. or azoxystrobin, and the proportion of needles with ascocarps of L. seditiosum and the number of ascocarps per needle were recorded over the following 2 yrs. Seedlings treated with azoxystrobin already appeared healthier than control seedlings in September of the first year, and by November all azoxystrobin-treated seedlings had fewer ascocarps per needle compared with control seedlings. In autumn of the second year, there were no ascocarps on seedlings treated with fluazinam or azoxystrobin, whereas seedlings treated with propiconazole had similar numbers of ascocarps to non-treated control seedlings.
Directory of Open Access Journals (Sweden)
Haoliang Chen
2017-11-01
Full Text Available Bradysia odoriphaga (Diptera: Sciaridae is the most important pest of Chinese chive. Insecticides are used widely and frequently to control B. odoriphaga in China. However, the performance of the insecticides chlorpyrifos and clothianidin in controlling the Chinese chive maggot is quite different. Using next generation sequencing technology, different expression unigenes (DEUs in B. odoriphaga were detected after treatment with chlorpyrifos and clothianidin for 6 and 48 h in comparison with control. The number of DEUs ranged between 703 and 1161 after insecticide treatment. In these DEUs, 370–863 unigenes can be classified into 41–46 categories of gene ontology (GO, and 354–658 DEUs can be mapped into 987–1623 Kyoto Encyclopedia of Genes and Genomes (KEGG pathways. The expressions of DEUs related to insecticide-metabolism-related genes were analyzed. The cytochrome P450-like unigene group was the largest group in DEUs. Most glutathione S-transferase-like unigenes were down-regulated and most sodium channel-like unigenes were up-regulated after insecticide treatment. Finally, 14 insecticide-metabolism-related unigenes were chosen to confirm the relative expression in each treatment by quantitative Real Time Polymerase Chain Reaction (qRT-PCR. The results of qRT-PCR and RNA Sequencing (RNA-Seq are fairly well-established. Our results demonstrate that a next-generation sequencing tool facilitates the identification of insecticide-metabolism-related genes and the illustration of the insecticide mechanisms of chlorpyrifos and clothianidin.
Zhang, Wenming
2017-09-19
One of the greatest global challenges is to feed the ever-increasing world population. The agrochemical tools growers currently utilize are also under continuous pressure, due to a number of factors that contribute to the loss of existing products. Mesoionic pyrido[1,2-a]pyrimidinones are an unusual yet very intriguing class of compounds. Known for several decades, this class of compounds had not been systemically studied until we started our insecticide discovery program. This Account provides an overview of the efforts on mesoionic pyrido[1,2-a]pyridinone insecticide discovery, beginning from the initial high throughput screen (HTS) discovery to ultimate identification of triflumezopyrim (4, DuPont Pyraxalt) and dicloromezotiaz (5) for commercialization as novel insecticides. Mesoionic pyrido[1,2-a]pyrimidinones with a n-propyl group at the 1-position, such as compound 1, were initially isolated as undesired byproducts from reactions for a fungicide discovery program at DuPont Crop Protection. Such compounds showed interesting insecticidal activity in a follow-up screen and against an expanded insect species list. The area became an insecticide hit for exploration and then a lead area for optimization. At the lead optimization stage, variations at three regions of compound 1, i.e., side-chain (n-propyl group), substituents on the 3-phenyl group, and substitutions on the pyrido- moiety, were explored with many analogues prepared and evaluated. Breakthrough discoveries included replacing the n-propyl group with a 2,2,2-trifluoroethyl group to generate compound 2, and then with a 2-chlorothiazol-5-ylmethyl group to form compound 3. 3 possesses potent insecticidal activity not only against a group of hopper species, including corn planthopper (Peregrinus maidis (Ashmead), CPH) and potato leafhopper (Empoasca fabae (Harris), PLH), as well as two key rice hopper species, namely, brown planthopper (Nilaparvata lugens (Stål), BPH) and rice green leafhopper (Nephotettix
PM2.5 in Urban and Rural Nursery Schools in Upper Silesia, Poland: Trace Elements Analysis
Directory of Open Access Journals (Sweden)
Anna Mainka
2015-07-01
Full Text Available Indoor air quality (IAQ in nursery schools is an emerging public health challenge. Particular attention should be paid to younger children, because they are more vulnerable to air pollution than older children. Among air pollutants, fine particulate matter (PM2.5 is of the greatest interest mainly due to its strong association with acute and chronic effects on children’s health. In this paper, we present concentrations of PM2.5 and the composition of its trace elements at naturally ventilated nursery schools located in the area of Gliwice, Poland. The nursery schools were selected to characterize areas with different degrees of urbanization and traffic densities during the winter and spring seasons. The results indicate there is a problem with elevated concentrations of PM2.5 inside the examined classrooms. The children’s exposure to trace elements was different based on localization and season. PM2.5 concentration and its trace element composition have been studied using correlation coefficients between the different trace elements, the enrichment factor (EF and principal component analysis (PCA. PCA allowed the identification of the three components: anthropogenic and geogenic sources (37.2%, soil dust contaminated by sewage sludge dumping (18.6% and vehicular emissions (19.5%.