Evaluation of two progestogen-based estrous synchronization protocols in yearling heifers of Bos indicus × Bos taurus breeding.

Science.gov (United States)

McKinniss, E N; Esterman, R D; Woodall, S A; Austin, B R; Hersom, M J; Thatcher, W W; Yelich, J V

2011-06-01

Yearling Bos indicus × Bos taurus heifers (n = 410) from three locations, were synchronized with either the Select Synch/CIDR+timed-AI (SSC+TAI) or 7-11+timed-AI (7-11+TAI) treatments. On Day 0 of the experiment, within each location, heifers were equally distributed to treatments by reproductive tract score (RTS; Scale 1-5: 1 = immature, 5 = estrous cycling) and body condition score. The 7-11+TAI treatment consisted of melengestrol acetate (0.5 mg/head/d) from Days 0 to 7, with PGF(2α) (25 mg im) on Day 7, GnRH (100 μg im) on Day 11, and PGF(2α) (25 mg im) on Day 18. The SSC+TAI heifers received the same carrier supplement (without MGA) from Days 0 to 7, and on Day 11 they were given 100 μg GnRH and an intravaginal CIDR (containing 1.38 g progesterone). The CIDR were removed on Day 18, concurrent with 25 mg PGF(2α) im For both treatments, estrus was visually detected for 1 h twice daily (0700 and 1600 h) for 72 h after PGF(2α), with AI done 6 to 12 h after a detected estrus. Non-responders were timed-AI and received GnRH (100 μg im) 72 to 76 h post PGF(2α). The 7-11+TAI heifers had a greater (P conception rate (47.0 vs 31.3%), and synchronized pregnancy rate (33.5 vs 24.8%) compared to SSC+TAI heifers, respectively. Heifers exhibiting estrus at 60 h (61.7%) had a greater (P conception rate compared to heifers that exhibited estrus at ≤ 36 (35.3%), 48 (31.6%), and 72 h (36.2%), which were similar (P > 0.05) to each other. As RTS increased from ≤ 2 to ≥ 3, estrous response, conception rate, synchronized pregnancy rate, and 30 d pregnancy rate all increased (P rates compared to SSC+TAI treatment in yearling Bos indicus × Bos taurus heifers. Copyright © 2011 Elsevier Inc. All rights reserved.

BoS: a large and diverse family of short interspersed elements (SINEs) in Brassica oleracea.

Science.gov (United States)

Zhang, Xiaoyu; Wessler, Susan R

2005-05-01

Short interspersed elements (SINEs) are nonautonomous non-LTR retrotransposons that populate eukaryotic genomes. Numerous SINE families have been identified in animals, whereas only a few have been described in plants. Here we describe a new family of SINEs, named BoS, that is widespread in Brassicaceae and present at approximately 2000 copies in Brassica oleracea. In addition to sharing a modular structure and target site preference with previously described SINEs, BoS elements have several unusual features. First, the head regions of BoS RNAs can adopt a distinct hairpin-like secondary structure. Second, with 15 distinct subfamilies, BoS represents one of the most diverse SINE families described to date. Third, several of the subfamilies have a mosaic structure that has arisen through the exchange of sequences between existing subfamilies, possibly during retrotransposition. Analysis of BoS subfamilies indicate that they were active during various time periods through the evolution of Brassicaceae and that active elements may still reside in some Brassica species. As such, BoS elements may be a valuable tool as phylogenetic makers for resolving outstanding issues in the evolution of species in the Brassicaceae family.

Is the American Zebu really Bos indicus?

Directory of Open Access Journals (Sweden)

Meirelles Flávio V.

1999-01-01

Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

Observación de la conducta homosexual en un rebaño de vacas mestizas de doble propósito

OpenAIRE

Lozada Melero, Rafael Enrique

2011-01-01

La identificación de la conducta homosexual de las hembras bovinos de la ganadería mestiza de doble propósito en la República Bolivariana de Venezuela, particularmente en el estado Trujillo; ha sido poco estudiada a pesar de ser una importante herramienta en la unidad de producción bajo programas de inseminación artificial. Para determinar la frecuencia de los principales síntomas y signo del celo, así como su relación con el diagnostico de la gestación por vía transrectal, en una finca (...

Polymorphism and Mobilization of Rransposons in Bos taurus

DEFF Research Database (Denmark)

Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

The bovine genome assembly was explored to detect putative retrotransposon sequences. In total 87,310 such sites were detected. Four breeds of dairy cattle (Bos taurus) were examined with respect to the presence, segregation or complete absence of the putative retrotransposon. A total of 10...

De prijsvorming van hout uit het Nederlandse bos

NARCIS (Netherlands)

Slangen, L.H.G.

1984-01-01

De prijsvorming van hout op stam en hout geveld uit het Nederlandse bos op het niveau van het bosbedrijf staat centraal in deze publikatie. Na een schets van een aantal facetten die invloed hebben op de prijsvorming wordt nader ingegaan op de prijsvorming zelf. Onderzocht wordt of er verschil in

Anticorpos em bovinos (Bos indicus e Bos taurus e bubalinos (Bubalus bubalis inoculados com oocistos de Toxoplasma gondii. Estudo comparativo

Directory of Open Access Journals (Sweden)

Oliveira F.C.R.

2000-01-01

Full Text Available Três animais de cada espécie (Bos indicus, Bos taurus e Bubalus bubalis foram inoculados, via oral, com 2×10(5 oocistos de Toxoplasma gondii. Seis outros animais, dois de cada espécie, foram mantidos como testemunhas. A resposta de anticorpos avaliada por meio da reação de imunofluorescência indireta iniciou-se a partir do quinto dia pós-inoculação (DPI nos zebuínos e bubalinos, e no sétimo DPI nos taurinos. Os títulos sorológicos nos taurinos permaneceram elevados até o final do experimento (70º DPI, alcançando níveis máximos (1:16.384 entre o 42º e 49º DPI. Nos zebuínos e bubalinos o maior título de anticorpos anti-Toxoplasma foi de 1:256. A resposta de anticorpos mais ou menos acentuada não está necessariamente relacionada à sensibilidade ao T. gondii.

Evidence of Bos javanicus x Bos indicus hybridization and major QTLs for birth weight in Indonesian Peranakan Ongole cattle.

Science.gov (United States)

Hartati, Hartati; Utsunomiya, Yuri Tani; Sonstegard, Tad Stewart; Garcia, José Fernando; Jakaria, Jakaria; Muladno, Muladno

2015-07-04

Peranakan Ongole (PO) is a major Indonesian Bos indicus breed that derives from animals imported from India in the late 19(th) century. Early imports were followed by hybridization with the Bos javanicus subspecies of cattle. Here, we used genomic data to partition the ancestry components of PO cattle and map loci implicated in birth weight. We found that B. javanicus contributes about 6-7% to the average breed composition of PO cattle. Only two nearly fixed B. javanicus haplotypes were identified, suggesting that most of the B. javanicus variants are segregating under drift or by the action of balancing selection. The zebu component of the PO genome was estimated to derive from at least two distinct ancestral pools. Additionally, well-known loci underlying body size in other beef cattle breeds, such as the PLAG1 region on chromosome 14, were found to also affect birth weight in PO cattle. This study is the first attempt to characterize PO at the genome level, and contributes evidence of successful, stabilized B. indicus x B. javanicus hybridization. Additionally, previously described loci implicated in body size in worldwide beef cattle breeds also affect birth weight in PO cattle.

Phylogenetic relationships of Malayan gaur with other species of the genus Bos based on cytochrome b gene DNA sequences.

Science.gov (United States)

Rosli, M K A; Zakaria, S S; Syed-Shabthar, S M F; Zainal, Z Z; Shukor, M N; Mahani, M C; Abas-Mazni, O; Md-Zain, B M

2011-03-22

The Malayan gaur (Bos gaurus hubbacki) is one of the three subspecies of gaurs that can be found in Malaysia. We examined the phylogenetic relationships of this subspecies with other species of the genus Bos (B. javanicus, B. indicus, B. taurus, and B. grunniens). The sequence of a key gene, cytochrome b, was compared among 20 Bos species and the bongo antelope, used as an outgroup. Phylogenetic reconstruction was employed using neighbor joining and maximum parsimony in PAUP and Bayesian inference in MrBayes 3.1. All tree topologies indicated that the Malayan gaur is in its own monophyletic clade, distinct from other species of the genus Bos. We also found significant branching differences in the tree topologies between wild and domestic cattle.

Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

International Nuclear Information System (INIS)

Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki

2016-01-01

BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when not used in accordance with the use of the in-house Bos

Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

Energy Technology Data Exchange (ETDEWEB)

Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki [Dept. of Radiation Oncology, Samsung Seoul Hospital, Seoul (Korea, Republic of)

2016-06-15

BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

Heterosis for meat quality and fatty acid profiles in crosses among Bos indicus and Bos taurus finished on pasture or grain.

Science.gov (United States)

Gama, L T; Bressan, M C; Rodrigues, E C; Rossato, L V; Moreira, O C; Alves, S P; Bessa, R J B

2013-01-01

Physicochemical properties and fatty acid profiles of meat from Bos indicus, Bos taurus and crossbred B. taurus×B. indicus bullocks (n=216), finished on pasture or grain, were used to estimate the effects of heterosis. Meat quality and fatty acid profiles generally benefited with crossbreeding, but the advantages from heterosis differed among finishing systems. The Warner-Bratzler shear-force in fresh and aged meat was reduced due to heterosis in pasture-finishing, but the effect was minor under grain-finishing. With pasture-finishing, heterosis caused an increase of 5% in CLA concentration, but few other changes in fatty acid profiles. In grain-finishing, heterosis caused a reduction in intramuscular fat and cholesterol, increased amounts of PUFA, n-6 fatty acids and PUFA/SFA ratio, and a decline in atherogenic index. The Δ(9) desaturase estimated activity in crossbreds showed a behavior close to B. indicus, suggesting the existence of few loci and a dominance genetic effect on enzymes involved in fatty acid synthesis and metabolism. Copyright © 2012 Elsevier Ltd. All rights reserved.

Tasas de logro educativo en las poblaciones afrodescendiente, indígena y mestiza: Revisión de algunos factores de exclusión

Directory of Open Access Journals (Sweden)

Marcelo Gaete-Astica

2016-01-01

Full Text Available Este artículo es resultado de la investigación Tasas de logro educativo entre la población afrodescendiente, indígena y mestiza y la revisión de algunos factores de exclusión e inclusión (Gaete, 2014. Mediante la exploración de los datos del X Censo Nacional de Población y el establecimiento de algunas medidas cuantitativas, en este artículo se busca establecer el logro educativo de la población de personas de origen indígena y afrodescendiente, en contraposición con la población mestiza (que denominamos acríticamente blanca y algunos elementos como los de la localización provincial y el de inserción temprana en el mundo del trabajo como factores de exclusión educativa. Siendo este estudio de corte exploratorio, se pretende que dé insumos prácticos y conceptuales para profundizar en la temática de la exclusión social y educativa. El análisis estadístico realizado ha permitido visualizar el hecho de que la identidad étnica y cultural, así como la localización geográfica (a escala provincial no son factores de exclusión educativa y social, sino que las explicaciones hay que buscarlas en la circularidad de la pobreza, que determina logros educativos bajos que influyen, a su vez, el acceso a puestos de trabajo de baja calificación. Este estudio sugiere que la inserción temprana en el mercado de trabajo es un factor clave de exclusión.

Gloria Anzaldúa, a consciência mestiça e o "feminismo da diferença" Gloria Anzaldúa, mestiza consciousness, and "feminism of difference"

Directory of Open Access Journals (Sweden)

Claudia de Lima Costa

2005-12-01

Full Text Available Este artigo situa a contribuição fundamental de Gloria Anzaldúa sobre a consciência mestiça na história do feminismo, enfocando sua perspectiva epistemológica da diferença interseccional na articulação de uma política de coalizão contra a exclusão da alteridade dos lugares privilegiados da construção da modernidade. Ancorando-se nas reflexões acad��micas sobre os escritos de Anzaldúa, as autoras destacam as maneiras pelas quais a teoria da identidade mestiça de Anzaldúa está antecipando não apenas críticas aos conceitos de sujeito, diferença e modernidade, mas também aquelas que enfatizam as distinções entre versões capitalistas e versões críticas do hibridismo cultural.This article situates Gloria Anzaldúa's influential "La Conciencia de la mestiza / Towards a New Consciousness" within the history of feminism, focusing on her epistemological perspective of intersectional difference to articulate a politics of coalition against the exclusion of alterity from privileged sites of modernity construction, in both space and time. Drawing on various academic sources of Anzaldúa criticism, we highlight some important ways her theory of mestiza identity actually anticipates not only critiques of the concepts of the subject, difference and modernity but also distinctions between capitalist and critical versions of cultural hybridity, all of which require sensitivity to discourses of dehistoricization, cooptation and assimilation.

Feed intake and weight changes in Bos indicus-Bos taurus crossbred steers following Bovine Viral Diarrhea Virus Type 1b challenge under production conditions

Science.gov (United States)

Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366) that were challenge...

Polidactilia en los cuatro miembros, en una potranca mestiza en Chile

Directory of Open Access Journals (Sweden)

Onésimo Sepúlveda S.

2011-05-01

Full Text Available La polidactilia es una anomalía congénita de muy baja incidencia en caballos. A una potranca mestiza de 6 semanas de edad con polidactilia en sus cuatro miembros se le realizó un examen clínico y radiológico. Los exámenes mostraron la presencia de un dígito supernumerario en ambos miembros anteriores, correspondiente a la primera y segunda falange del dígito II, con su respectivo hueso metacarpiano. En ambos miembros posteriores, se observó que un segundo dígito se originaba a nivel de la articulación metatarso-falángica; ambos dígitos eran del mismo tamaño y estaban formados por tres falanges, los que articulaban con el metatarsiano III. En ambos miembros posteriores, las primeras falanges estaban parcialmente fusionadas a nivel proximal. En el miembro posterior izquierdo había osteomielitis y fractura en el dígito lateral. Debido al compromiso del hueso y al dolor, se realizó eutanasia. No se realizó análisis citogenético. De acuerdo con la clasificación existente, la polidactilia encontrada en los miembros anteriores corresponde a la forma atavística y la encontrada en los posteriores a la forma teratogénica. Hasta lo que nosotros sabemos, este es el primer caso de polidactilia en los cuatro miembros registrado en América del Sur y en los últimos 55 años a nivel mundial.

In vivo comparison of susceptibility between Bos indicus and Bos taurus cattle types to Theileria parva infection

Directory of Open Access Journals (Sweden)

S.G. Ndungu

2005-09-01

Full Text Available The objective of this study was to determine whether Bos taurus cattle differ form Bos indicus in their susceptibility to infection with the Muguga stabilate of Theileria parva and in their resistance to the resultant disease. Ten Friesians (B. taurus, ten improved Borans (B. indicus, ten unimproved Borans (B. indicus and ten Zebus (B. indicus born to dams from an East Coast fever (ECF endemic area were inoculated with an infective dose50 dilution of T. parva Muguga stabilate 147. All the animals except one Friesian and one Zebu developed schizont parasitosis. All the improved Borans, nine of the Friesians, eight of the unimproved Borans and six of the Zebus developed a febrile response. Four of the improved Borans, four of the Friesians and three of the unimproved Borans died of theileriosis. No significant difference (P > 0.05 in the prepatent period occurred between the groups, but the Zebus had a significantly shorter duration of schizont parasitosis (P > 0.05 and took a significantly shorter time to recover (P > 0.05 than the other three groups. There was no significant difference in the two parameters between the other three groups. The study showed that three B. indicus breds and a B. taurus breed are equally susceptible to T. parva infection. However, Zebus born to dams from an ECF endemic area showed a better ability to control the course of disease than cattle from ECF free areas.

Efecto de la proporción de genes Bos indicus x Bos taurus sobre peso al destete y edad a primer parto en una población multirracial

Directory of Open Access Journals (Sweden)

Hugo O. Toledo Alvarado

2015-01-01

Full Text Available Se analizaron 1,289 registros de hembras de primer parto con diversas proporciones de genes Bos indicus y Bos taurus (Charolais, Suizo, Simmental, Holstein Friesian y Salers. Tanto animales puros y cruzados de un hato comercial, ubicado en el municipio de Hueytamalco, Puebla, nacidas entre 1966 a 2006, con el objetivo de estimar la combinación óptima de genes Cebú y la retención de heterosis (RVH sobre las características de peso al destete ajustado a 270 días (PD y edad a primer parto (EPP. A partir de modelos de regresión múltiple se identificó la proporción de Cebú con el mejor comportamiento para las dos características de acuerdo al coeficiente de determinación (R 2 y al estadístico de Mallow (CP. La mejor respuesta para PD se encontró en el rango de 42 a 70 % de genes Bos indicus ; mientras que las menores EPP se establecieron entre 27 al 40 % de proporción Cebú. La retención de heterosis que mostró mayor potencial para PD fue de 76 a 78 % y para EPP de 79 a 92 %. Estos resultados manifiestan la importancia de los efectos no aditivos en ambas características, así como la necesidad de realizar cruzamientos dirigidos.

MADURACIÓN DEL SOLOMO (Biceps femoris EN VACAS DE DESCARTE Bos indicus Y Bos taurus

Directory of Open Access Journals (Sweden)

Roger Alonso Cubero-Rojas

2013-01-01

Full Text Available El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de Investigaciones en Tecnología de Alimentos de la Universidad de Costa Rica, ubicado en San Pedro de Montes de Oca, San José, en julio del año 2011. De acuerdo con la evaluación instrumental, la especie y la cronometría dental no fueron factores significativos en la determinación de la terneza de la carne, mientras que el tiempo de maduración sí mostró cambios altamente significativos (p>0,001 sobre el mismo parámetro. Los mejores resultados se obtuvieron a los 28 días, donde B. indicus mostró 3,78 kg de fuerza al corte, mientras que para B. taurus se obtuvo 3,88 kg. En la evaluación sensorial, los animales B. indicus se calificaron como más jugosos (p=0,016 y con mejor sabor (p<0,001. Se determinó una relación inversa entre sabor y tiempo de maduración, lo cual indicó que a mayor tiempo de maduración el sabor de la carne se volvió menos agradable al paladar.

Urinary excretion of purine derivatives as an index of microbial protein supply in cross-bred (Bos indicus x Bos taurus) cattle in tropical environment

International Nuclear Information System (INIS)

Ojeda, A.; Parra, O.

1999-01-01

Four experiments were carried out to establish a response model between urinary excretion of purine derivatives (PD) and microbial production in Bos indicus x Bos taurus cross-bred cattle: LZ, MZ and HZ (3/8, 1/2 and 5/8 Bos indicus, respectively). The fasting PD excretion was considered as endogenous excretion and amounted to 268 (± 85.1), 294 (± 128.1) and 269 (± 68.4) μmol/kg W 0.75 for LZ, MZ and HZ, respectively. Urinary recovery of absorbed purine bases (PB) was calculated as the urinary recovery of a single dose of intrajugular infused uric acid (1,3- 15 N). In HZ crossbred cattle 83% (± 20.3) of infused uric acid was recovered in the urinary PD. The relationship between duodenal purine absorption (X, mmol/d) and urinary PD excretion (Y, mmol/d) was defined in HZ crossbred cattle as Y = 0.83 X + 0.269W 0.75 (± 85.1), assuming that the endogenous contribution was constant and independent of the exogenous PB supply. The activity of xanthine oxidase (EC 1.2.3.2.) was determined in HZ and MZ and was found to be higher in the liver (0.62 and 0.66 units/g, respectively) than in intestinal mucosa (0.09 and 0.03 units/g, respectively), whereas xanthine oxidase activity was practically absent in plasma of both cross breeds. The ratio PB:total N was determined in microbial extracts taken from rumen fluid of cows fed Bermuda grass (Cynodon dactylon) as the sole diet or supplemented (ratio of 80:20, grass: supplement) with gluten feed, soybean hulls or Gliricidia species and were found to range from 1.52-1.62 μmol PB/mg N. (author)

Fixed-time artificial insemination with estradiol and progesterone for Bos indicus cows II: strategies and factors affecting fertility.

Science.gov (United States)

Sá Filho, O G; Meneghetti, M; Peres, R F G; Lamb, G C; Vasconcelos, J L M

2009-07-15

In Experiments 1, 2, and 3, we evaluated the effects of temporary weaning (TW), equine chorionic gonadotropin (eCG), and follicle-stimulating hormone (FSH) treatments on results of a fixed-time artificial insemination (TAI) protocol in postpartum Bos indicus cows. In Experiment 1, treatment with 400 IU eCG or with TW for 48 h consistently improved pregnancy rates (PRs) at TAI, but, in Experiment 2, FSH treatment was less effective than eCG or TW. In Experiment 3, the inclusion of eCG treatment in cows subjected to TW did not improve PRs. We concluded that TW or 400 IU eCG should be included in the TAI protocol in postpartum Bos indicus cows to enhance fertility. In Experiment 4, we used records from heifers and cows treated with the proposed protocol during the 2006-2007 (n=27,195) and 2007-2008 (n=36,838) breeding seasons from multiple locations in Brazil to evaluate factors potentially affecting PRs. Overall PR at TAI was 49.6% (31,786 of 64,033). Pregnancy rate differed (Pcow group within farm, by breed (Bos indicus, 48.3% [26,123 of 54,145]; Bos taurus, 61.7% [3652 of 5922]; and crossbred Bos indicus x Bos taurus, 50.7% [2011 of 3966]), category (nulliparous, 39.6% [2095 of 5290]; suckled primiparous, 45.2% [3924 of 8677]; suckled multiparous, 51.8% [24,245 of 46,767]; and nonsuckled multiparous, 46.1% [1522 of 3299]), body condition score at TAI ( or =3.5, 52.7% [9419 of 17,881]). Days postpartum at beginning of protocol did not affect PR (30 to 60 d, 47.6% [4228 of 8881]; 61 to 90 d, 51.7% [16,325 to 31,572]; and 91 to 150 d, 50.8% [7616 to 14,991]; P>0.1). Pregnancy rate was also consistently affected (P<0.01) by sire (results ranging from 7.2% to 77.3%) and artificial insemination technician (results ranging from 15.1% to 81.8%).

Implementasi Kebijakan Pembiayaan Pendidikan pada Era Otonomi Daerah (Studi Kasus Implementasi Dana BOS dan BKM Pada Sekolah yang Terpilih di Kabupaten Kebumen

Directory of Open Access Journals (Sweden)

Panuntun Nur Karomah

2017-08-01

Full Text Available Tujuan Penelitian ini untuk mengetahui implementasi kebijakan pembiayaan pendidikan pada era otonomi daerah studi di Kabupaten Kebumen dilihat dari aspek pelaksanaan, sumber-sumber dan alokasi anggaran pendidikan. Teknik pengumpulan data yaitu observasi, wawancara, dan dokumentasi. Uji keabsahan data adalah triangulasi. Hasil penelitian ini adalah pelaksanaan BOS diimplementasikan berdasarkan RAKS dan RAPBS, dan BKM berdasarkan penjaringan dari pihak sekolah. Dana BOS bersumber dari APBN (pemerintah pusat, BKM bersumber dari APBD Kabupaten (pemerintah daerah dan sumbangan sukarela bersumber dari masyarakat. Alokasi dana BOS setiap sekolah berbeda-beda, yang mempengaruhi hal itu adalah perbedaan jenjang sekolah, banyaknya jumlah siswa yang ada di sekolah, perbedaan letak sekolah. Hal ini, karena setiap sekolah mempunyai perbedaan kebutuhan operasional sekolah dan kegiatan-kegiatan yang dilakukan sekolah. Sumbangan sukarela untuk memenuhi kekurangan biaya yang diperlukan sekolah. Alokasi dana BKM tepat sasaran, namun waktu alokasi pencairannya kurang efektif .  This research aims to determine the education funding policy implementation at the regional autonomy in Kebumen, seen from the aspect implementation, resources and the education budget allocation for education. Data collection techniques are observation, interviews, and documentation. Test the validity of the data is triangulation. The results of this study are the implementation of BOS based RAKS and RAPBS, and BKM based networking from the school. BOS funds from the state budget (central government, BKM sourced from district budget (local government and voluntary contributions provided by the community. BOS funding is in each school different, the casue of difference in levels of schooling, the amount of students in the school, the school location. This is because each school has different operational needs and the activities. Voluntary donations for meet defiency from BOS. Allocation of

Seroprevalence of antibodies to Neospora caninum in Bos javanicus ('Bali cattle') from Indonesia.

Science.gov (United States)

Damriyasa, I Made; Schares, Gereon; Bauer, Christian

2010-01-01

A cross-sectional survey was performed to obtain first information on the presence of Neospora caninum infection in Bos javanicus ('Bali cattle'), the predominant beef cattle in the Eastern Islands of Indonesia. Serum samples were collected from 438 Bali cattle of two age classes (2 years) and both genders at three slaughterhouses in the Bali island, and examined for N. caninum-specific antibodies using native NcSRS2 (p38 antigen) as an ELISA antigen. The estimated overall seroprevalence of antibodies was 5.5% (95% CI: 3.5-8.0%). The seroprevalence was not significantly associated with age class or gender of the animals. The results give first serological evidence for the presence of natural N. caninum infection in Bos javanicus and indicate its occurrence in Indonesia.

The BOS-X approach: achieving drastic cost reduction in CPV through holistic power plant level innovation

Science.gov (United States)

Plesniak, A.; Garboushian, V.

2012-10-01

In 2011, the Amonix Advanced Technology Group was awarded DOE SunShot funding in the amount of 4.5M to design a new Balance of System (BOS) architecture utilizing Amonix MegaModules™ focused on reaching the SunShot goal of 0.06-$0.08/kWhr LCOE. The project proposal presented a comprehensive re-evaluation of the cost components of a utility scale CPV plant and identified critical areas of focus where innovation is needed to achieve cost reduction. As the world's premier manufacturer and most experienced installer of CPV power plants, Amonix is uniquely qualified to lead a rethinking of BOS architecture for CPV. The presentation will focus on the structure of the BOS-X approach, which looks for the next wave of cost reduction in CPV through evaluation of non-module subsystems and the interaction between subsystems during the lifecycle of a solar power plant. Innovation around nonmodule components is minimal to date because CPV companies are just now getting enough practice through completion of large projects to create ideas and tests on how to improve baseline designs and processes. As CPV companies increase their installed capacity, they can utilize an approach similar to the methodology of BOS-X to increase the competitiveness of their product. Through partnership with DOE, this holistic approach is expected to define a path for CPV well aligned with the goals of the SunShot Initiative.

Genetic variation in the β-lactoglobulin of Chinese yak ( Bos ...

Indian Academy of Sciences (India)

Yak (Bos grunniens) is distributed in the area of Central. Asian highlands, it thrives in conditions of extreme harsh- ness with severely cold winters, short growing seasons for herbage and no absolutely frost-free periods (Wiener et al. 2003). The total population of yak is estimated to be 14 mil- lion, about 90% of the domestic ...

Distribución de la garrapata Amblyomma cajennense (Acari: Ixodidae sobre Bos taurus y Bos indicus en Costa Rica

Directory of Open Access Journals (Sweden)

Víctor Alvarez C.

2000-03-01

Full Text Available Se informa sobre la casuística de A. cajennense encontrada sobre B. taurus y B. indicus en Costa Rica en 532 fincas muestreadas a nivel nacional en los diferentes sistemas de producción (leche, carne y doble propósito. Existe desigual distribución Amblyomma spp. (incluidas A. cajennense, A. maculatum, A. inornatum y A. oblongoguttatum en las diferentes regiones administrativas y en las zonas ecológicas. La presencia de Amblyomma spp. fue 12 veces (X², PResistance to acaricides in the cattle tick population was surveyed in 532 farms throughout Costa Rica. Samples were collected from bovines (Bos taurus and Bos indicus, in three production systems: dairy, meat and double-purpose. There is an uneven distribution of Amblyomma spp. (including A. cajennense, A. maculatum and A. oblongoguttatum in the administrative regions in which the country is divided, as well as in ecological zones. Administratively, Amblyomma spp., was 12 times more frecuent (X², p<0.001 in the Central Pacific and Chorotega regions (Pacific coast, than elsewhere. Ecologically, ticks of this genus were more common in the Tropical Humid Forest (33 % and the Very Humid Montain Forest (18 %. There was at least one sample of Amblyomma in 41% of counties. The most frecuent Amblyomma was A. cajennense. The wide distribution of Amblyomma spp. in very warm places with a marked six months rainy season suggests a potential danger of the substitution capacity of Amblyomma spp., which can also affect public health. The paper also reviews Amblyomma literature in detail.

Genotype x environment interactions for fatty acid profiles in Bos indicus and Bos taurus finished on pasture or grain.

Science.gov (United States)

Bressan, M C; Rossato, L V; Rodrigues, E C; Alves, S P; Bessa, R J B; Ramos, E M; Gama, L T

2011-01-01

A study was conducted to characterize lipid profiles in the M. longissimus thoracis of commercial Brazilian beef and to assess how those profiles are influenced by finishing system, genetic group, and their interaction. Intramuscular fat (IMF) and fatty acid (FA) profiles were determined in 160 bulls of the Bos taurus (n = 75) and Bos indicus (n = 85) genetic groups, finished on pasture (n = 46) or with grain supplementation (n = 114) and slaughtered in a commercial abattoir. Finishing system had a major impact on the deposition of IMF, as well as on the concentration of SFA, PUFA, and their ratio, but genetic groups showed important differences in the ability to convert SFA into cis-9 MUFA and to convert 16:0 into 18:0. When compared with pasture-finished animals, those finished with grain had greater content of IMF and SFA (P 0.05), and about one-half the amount of PUFA (P 0.05). With pasture-finishing, no differences were observed among the 2 genetic groups in SFA and MUFA (P > 0.05), but PUFA were decreased in B. taurus (P genetic groups were compared in grain-finishing, B. taurus had a decreased ability for elongation and B. indicus had a decreased aptitude for desaturation of FA. On the other hand, with pasture-finishing a greater deposition of intermediate FA from ruminal biohydrogenation was observed in B. indicus than in B. taurus. Overall, FA profiles were affected more by finishing system in B. indicus than in B. taurus.

Development of Uncertainty Quantification Method for MIR-PIV Measurement using BOS Technique

International Nuclear Information System (INIS)

Seong, Jee Hyun; Song, Min Seop; Kim, Eung Soo

2014-01-01

Matching Index of Refraction (MIR) is frequently used for obtaining high quality PIV measurement data. ven small distortion by unmatched refraction index of test section can result in uncertainty problems. In this context, it is desirable to construct new concept for checking errors of MIR and following uncertainty of PIV measurement. This paper proposes a couple of experimental concept and relative results. This study developed an MIR uncertainty quantification method for PIV measurement using SBOS technique. From the reference data of the BOS, the reliable SBOS experiment procedure was constructed. Then with the combination of SBOS technique with MIR-PIV technique, velocity vector and refraction displacement vector field was measured simultaneously. MIR errors are calculated through mathematical equation, in which PIV and SBOS data are put. These errors are also verified by another BOS experiment. Finally, with the applying of calculated MIR-PIV uncertainty, correct velocity vector field can be obtained regardless of MIR errors

Differences in Beef Quality between Angus (Bos taurus taurus) and Nellore (Bos taurus indicus) Cattle through a Proteomic and Phosphoproteomic Approach.

Science.gov (United States)

Rodrigues, Rafael Torres de Souza; Chizzotti, Mario Luiz; Vital, Camilo Elber; Baracat-Pereira, Maria Cristina; Barros, Edvaldo; Busato, Karina Costa; Gomes, Rafael Aparecido; Ladeira, Márcio Machado; Martins, Taiane da Silva

2017-01-01

Proteins are the major constituents of muscle and are key molecules regulating the metabolic changes during conversion of muscle to meat. Brazil is one of the largest exporters of beef and most Brazilian cattle are composed by zebu (Nellore) genotype. Bos indicus beef is generally leaner and tougher than Bos taurus such as Angus. The aim of this study was to compare the muscle proteomic and phosphoproteomic profile of Angus and Nellore. Seven animals of each breed previously subjected the same growth management were confined for 84 days. Proteins were extracted from Longissimus lumborum samples collected immediately after slaughter and separated by two-dimensional electrophoresis. Pro-Q Diamond stain was used in phosphoproteomics. Proteins identification was performed using matrix assisted laser desorption/ionization time-of-flight mass spectrometry. Tropomyosin alpha-1 chain, troponin-T, myosin light chain-1 fragment, cytoplasmic malate dehydrogenase, alpha-enolase and 78 kDa glucose-regulated protein were more abundant in Nellore, while myosin light chain 3, prohibitin, mitochondrial stress-70 protein and heat shock 70 kDa protein 6 were more abundant in Angus (PAngus had greater phosphorylation of phosphoglucomutase-1 and troponin-T (PAngus and Nellore. Furthermore, prohibitin appears to be a potential biomarker of intramuscular fat in cattle. Additionally, differences in phosphorylation of myofilaments and glycolytic enzymes could be involved with differences in muscle contraction force, susceptibility to calpain, apoptosis and postmortem glycolysis, which might also be related to differences in beef quality among Angus and Nellore.

Clotting of cow (Bos taurus) and goat milk ( Capra hircus ) using ...

African Journals Online (AJOL)

The ease to locally produce kid rennet contrary to that of calve has led us to compare the proteolytic and clotting activities of these two rennets depending on their action on goat (Capra hircus) milk and cow (Bos taurus) milk. The proteolysis was measured by determining the increase of non-protein nitrogen according to the ...

Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

NARCIS (Netherlands)

Kotterman, M.

1998-01-01

Outline of this thesis
In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations,

Bill E. Kunkle Interdisciplinary Beef Symposium: Temperament and acclimation to human handling influence growth, health, and reproductive responses in Bos taurus and Bos indicus cattle.

Science.gov (United States)

Cooke, R F

2014-12-01

Temperament in cattle is defined as the fear-related behavioral responses when exposed to human handling. Our group evaluates cattle temperament using 1) chute score on a 1 to 5 scale that increases according to excitable behavior during restraint in a squeeze chute, 2) exit velocity (speed of an animal exiting the squeeze chute), 3) exit score (dividing cattle according to exit velocity into quintiles using a 1 to 5 scale where 1=cattle in the slowest quintile and 5=cattle in the fastest quintile), and 4) temperament score (average of chute and exit scores). Subsequently, cattle are assigned a temperament type of adequate temperament (ADQ; temperament score≤3) or excitable temperament (EXC; temperament score>3). To assess the impacts of temperament on various beef production systems, our group associated these evaluation criteria with productive, reproductive, and health characteristics of Bos taurus and Bos indicus-influenced cattle. As expected, EXC cattle had greater plasma cortisol vs. ADQ cattle during handling, independent of breed type (B. indicus×B. taurus, Preproduction, EXC females had reduced annual pregnancy rates vs. ADQ cohorts across breed types (B. taurus, P=0.03; B. indicus, P=0.05). Moreover, B. taurus EXC cows also had decreased calving rate (P=0.04), weaning rate (P=0.09), and kilograms of calf weaned/cow exposed to breeding (P=0.08) vs. ADQ cohorts. In regards to feedlot cattle, B. indicus EXC steers had reduced ADG (P=0.02) and G:F (P=0.03) during a 109-d finishing period compared with ADQ cohorts. Bos taurus EXC cattle had reduced weaning BW (P=0.04), greater acute-phase protein response on feedlot entry (P≤0.05), impaired feedlot receiving ADG (P=0.05), and reduced carcass weight (P=0.07) vs. ADQ cohorts. Acclimating B. indicus×B. taurus or B. taurus heifers to human handling improved temperament (P≤0.02), reduced plasma cortisol (Preproductive, and health characteristics of beef cattle independent of breed type. Hence, strategies

Genetic origin, admixture and population history of aurochs (Bos primigenius) and primitive European cattle

NARCIS (Netherlands)

Upadhyay, M R; Chen, W; Lenstra, J A; Goderie, C R J; MacHugh, D E; Park, S D E; Magee, D A; Matassino, D; Ciani, F; Megens, H-J; van Arendonk, J A M; Groenen, M A M; Marsan, P A; Balteanu, V; Dunner, S; Garcia, J F; Ginja, C; Kantanen, J

2017-01-01

The domestication of taurine cattle initiated ~10 000 years ago in the Near East from a wild aurochs (Bos primigenius) population followed by their dispersal through migration of agriculturalists to Europe. Although gene flow from wild aurochs still present at the time of this early dispersion is

Genetic origin, admixture and population history of aurochs (Bos primigenius) and primitive European cattle

NARCIS (Netherlands)

Upadhyay, M.R.; Chen, W.; Lenstra, J.A.; Goderie, C.R.J.; MacHugh, D.E.; Park, S.D.E.; Magee, D.A.; Matassino, D.; Ciani, F.; Megens, H.J.; Arendonk, van J.A.M.; Groenen, M.A.M.

2017-01-01

The domestication of taurine cattle initiated ~10 000 years ago in the Near East from a wild aurochs (Bos primigenius) population followed by their dispersal through migration of agriculturalists to Europe. Although gene flow from wild aurochs still present at the time of this early dispersion is

Las salamancas mestizas: de las religiones indígenas a la hechicería colonial. Santiago del Estero, siglo XVIII

Directory of Open Access Journals (Sweden)

Judith Farberman

2005-12-01

Full Text Available La mayoría de los folcloristas ha coincidido en el origen hispano del estereotipo de escuela de magia conocida como salamanca, de amplia difusión en el noroeste argentino. Este trabajo postula la configuración mestiza del mismo y su desarrollo a partir de la hibridación de elementos religiosos y culturales entre los siglos XVI y XVIII. Como fuentes principales me he valido de dos procesos civiles contra hechiceras sustanciados en Santiago del Estero y, secundariamente, de materiales como Cartas Anuas jesuíticas, catecismos y confesionarios de indios.In general folklore studies agreed upon the Spanish origins of the magic school known as Salamanca, widely spread in the northwest of Argentina. Based on the existence of hybrid elements, found in culture and religion, this article poses the existence of a mestizo influence in its development in Santiago del Estero during the XVI and XVII centuries. The main sources analyzed were judicial processes held against witches in the area under study, and secondarily some material such us the Jesuits' Cartas Anuas, and Indian catechisms and confessionaries.

When and how did Bos indicus introgress into Mongolian cattle?

Science.gov (United States)

Yue, Xiangpeng; Li, Ran; Liu, Li; Zhang, Yunsheng; Huang, Jieping; Chang, Zhenhua; Dang, Ruihua; Lan, Xianyong; Chen, Hong; Lei, Chuzhao

2014-03-10

The Mongolian cattle are one of the most widespread breeds with strictly Bos taurus morphological features in northern China. In our current study, we presented a diversity of mitochondrial DNA (mtDNA) D-loop region and Y chromosome SNP markers in 25 male and 8 female samples of Mongolian cattle from the Xinjiang Uygur autonomous region in Western China, and detected 21 B. taurus and four Bos indicus (zebu) mtDNA haplotypes. Among four B. indicus mtDNA haplotypes, two haplotypes belonged to I1 haplogroup and the remaining two haplotypes belonged to I2 haplogroup. In contrast, all 25 male Mongolian cattle samples revealed B. taurus Y chromosome haplotype and no B. indicus haplotypes were found. Historical and archeological records indicate that B. taurus was introduced to Xinjiang during the second millennium BC and B. indicus appeared in this region by the second century AD. The two types of cattle coexisted for many centuries in Xinjiang, as depicted in clay and wooden figurines unearthed in the Astana cemetery in Turfan (3rd-8th century AD). Multiple lines of evidence suggest that the earliest B. indicus introgression in the Mongolian cattle may have occurred during the 2nd-7th centuries AD through the Silk Road around the Xinjiang region. This conclusion differs from the previous hypothesis that zebu introgression to Mongolian cattle happened during the Mongol Empire era in the 13th century. Copyright © 2014 Elsevier B.V. All rights reserved.

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Science.gov (United States)

Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

2016-01-01

The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Directory of Open Access Journals (Sweden)

Cristina Ballarin

Full Text Available The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ, and Cerebellar Quotient (CQ. Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

Electrocardiogram of Clinically Healthy Mithun (Bos frontalis): Variation among Strains

Science.gov (United States)

Sanyal, Sagar; Das, Pradip Kumar; Ghosh, Probal Ranjan; Das, Kinsuk; Vupru, Kezha V.; Rajkhowa, Chandan; Mondal, Mohan

2010-01-01

A study was conducted to establish the normal electrocardiogram in four different genetic strains of mithun (Bos frontalis). Electrocardiography, cardiac electrical axis, heart rate, rectal temperature and respiration rate were recorded in a total of 32 adult male mithun of four strains (n = 8 each). It was found that the respiration and heart rates were higher (P electrocardiogram of mithun revealed that the amplitude and duration of P wave, QRS complex and T wave were different among four different genetic strains of mithun and the electrical axis of QRS complex for Nagamese and Mizoram mithuns are dissimilar to bovine species. PMID:20886013

Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

Science.gov (United States)

Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

Recent Status of Banteng (Bos javanicus Conservation in East Java and Its Perspectives on Ecotourism Planning

Directory of Open Access Journals (Sweden)

Luchman Hakim

2015-09-01

Full Text Available The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threats may be categorized into two factors, socio-economic and ecological factors. Socio-economic problems lead to the increase of habitat disturbance, poaching, and illegal hunting. Ecological aspect was ranging from invasion of exotic plant species, competitors, predators, drought, forest fire and vegetation changes. Lack of habitat management also recognized as an important factor to drive Bos javanicus decline and extinction. Ecotourism in the national park may become one of the significant and effective stimuli to support Banteng conservation.

A Novel Bromophenol Derivative BOS-102 Induces Cell Cycle Arrest and Apoptosis in Human A549 Lung Cancer Cells via ROS-Mediated PI3K/Akt and the MAPK Signaling Pathway

Directory of Open Access Journals (Sweden)

Chuan-Long Guo

2018-01-01

Full Text Available Bromophenol is a type of natural marine product. It has excellent biological activities, especially anticancer activities. In our study of searching for potent anticancer drugs, a novel bromophenol derivative containing indolin-2-one moiety, 3-(4-(3-([1,4′-bipiperidin]-1′-ylpropoxy-3-bromo-5-methoxybenzylidene-N-(4-bromophenyl-2-oxoindoline-5-sulfonamide (BOS-102 was synthesized, which showed excellent anticancer activities on human lung cancer cell lines. A study of the mechanisms indicated that BOS-102 could significantly block cell proliferation in human A549 lung cancer cells and effectively induce G0/G1 cell cycle arrest via targeting cyclin D1 and cyclin-dependent kinase 4 (CDK4. BOS-102 could also induce apoptosis, including activating caspase-3 and poly (ADP-ribose polymerase (PARP, increasing the Bax/Bcl-2 ratio, enhancing reactive oxygen species (ROS generation, decreasing mitochondrial membrane potential (MMP, ΔΨm, and leading cytochrome c release from mitochondria. Further research revealed that BOS-102 deactivated the PI3K/Akt pathway and activated the mitogen-activated protein kinase (MAPK signaling pathway resulting in apoptosis and cell cycle arrest, which indicated that BOS-102 has the potential to develop into an anticancer drug.

Temperature Studies for ATLAS MDT BOS Chambers

CERN Document Server

Engl, A.; Biebel, O.; Mameghani, R.; Merkl, D.; Rauscher, F.; Schaile, D.; Ströhmer, R.

Data sets with high statistics taken at the cosmic ray facility, equipped with 3 ATLAS BOS MDT chambers, in Garching (Munich) have been used to study temperature and pressure effects on gas gain and drifttime. The deformation of a thermally expanded chamber was reconstructed using the internal RasNik alignment monitoring system and the tracks from cosmic data. For these studies a heating system was designed to increase the temperature of the middle chamber by up to 20 Kelvins over room temperature. For comparison the temperature effects on gas properties have been simulated with Garfield. The maximum drifttime decreased under temperature raise by -2.21 +- 0.08 ns/K, in agreement with the results of pressure variations and the Garfield simulation. The increased temperatures led to a linear increase of the gas gain of about 2.1% 1/K. The chamber deformation has been analyzed with the help of reconstructed tracks. By the comparison of the tracks through the reference chambers with these through the test chamber ...

Determinación serológica de leucosis bovina enzoótica en novillas de levante y vacas adultas de la vereda Morichal, Yopal, Casanare

Directory of Open Access Journals (Sweden)

Nelly Andrea Bautista-R.

2013-01-01

Full Text Available La investigación se llevó a cabo con el objetivo de realizar una determinación serológica de leucosis bovina enzoótica en novillas de levante y vacas adultas. Se recolectaron 100 muestras de sangre de hembras escogidas al azar, pertenecientes a tres fincas del sector La Guafilla, de la vereda Morichal, en Yopal, Casanare, las cuales fueron analizadas para anticuerpos contra el LVB (virus de la Leucosis Viral Bovina; adicionalmente, se obtuvieron 100 muestras de los mismos animales para realización de hemograma, con el fin de observar cambios a nivel sanguíneo de aquellos que resultaran positivos. La técnica serológica empleada fue la prueba de ELISA indirecta. Se realizó un análisis descriptivo tabulando la información con datos de seropositividad y seronegatividad obtenidos de cada animal; los resultados se interpretaron de acuerdo con las variables raza, edad y variaciones del cuadro hemático. Para determinar la relación entre seropositividad y cada una de las variables se utilizó la prueba de Probabilidad de Fisher. Las pruebas arrojaron una seroprevalencia del 15% para LVB. No se encontraron diferencias significativas de prevalencia asociadas a las variables raza, edad o resultados del hemograma (p>=0.05. Se demuestra la presencia del virus LBE en La Guafilla. Se confirma la importancia de implementar un programa de control y prevención de la diseminación de la infección, con el fin de evitar las pérdidas económicas asociadas, y, dentro de lo posible, la eliminación de los animales seropositivos para lograr la erradicación de la infección en esta zona del país.

Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

DEFF Research Database (Denmark)

Andersen, Hans Skifter

Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikk...

Origen geno-geográfico de haplotipos STR del cromosoma Y en una muestra caucásico-mestiza y afrodescendiente de Colombia

Directory of Open Access Journals (Sweden)

Juan J. Yunis

2013-09-01

Full Text Available Introducción. Los haplotipos STR de cromosoma Y han sido ampliamente utilizados en estudios de poblaciones para establecer el origen de diversas poblaciones. Objetivo. Se analizaron haplotipos STR del cromosoma Y (8 loci en 134 afrodescendientes y caucásico-mestizos no relacionados de Colombia, para correlacionar el origen geográfico con los datos históricos, así como las relaciones genéticas y posibles patrones de mezcla. Materiales y métodos. Se analizaron los haplotipos STR del cromosoma Y mediante PCR seguidas de electroforesis en acrilamida, de 134 muestras de afrodescendientes y 137 muestras de caucásicos mestizos. Resultados. No se encontró evidencia de subestructuración de la población afrodescendiente. El 2,59 % de los haplotipos eran compartidos en los dos grupos analizados, con la posible existencia deflujo génico de caucásico-mestizos hacia los afrodescendientes. Conclusión. La población caucásico-mestiza colombiana se agrupa con otras poblaciones de la península Ibérica y Europa, mientras que la población afrodescendiente colombiana se agrupa conotras poblaciones africanas reportadas.   doi: http://dx.doi.org/10.7705/biomedica.v33i3.807

Comportamiento productivo de vacas mestizas Siboney, en condiciones de estabulación en el trópico

Directory of Open Access Journals (Sweden)

Julio J. Reyes

2015-01-01

Full Text Available Con el objetivo de conocer el comportamiento productivo de vacas lecheras en condiciones de estabulación con forrajes tropicales, se estudiaron 20 vacas mestizas Siboney durante tres años, utilizando una superficie de cultivo de los forrajes de 4.25 hectáreas. Para el análisis estadístico se empleó un modelo multiplicativo (producción y calidad de leche, el resto de las medidas se analizó por un análisis de varianza, según diseño completamente aleatorizado. Se mostraron interacciones entre los bimestres de parto y producción, por años (P<0.001, mostraron una mayor producción en los animales que parieron en la época lluviosa (8.63 vs. 8.09 kg vaca-1 día-1. Con respecto a la calidad de la leche, solamente los sólidos totales mostraron, en los dos primeros años, un mayor (P<0.05 porcentaje en la época lluviosa. Los animales del grupo seco revelaron una mejor (P<0.05 condición corporal que los de ordeño en ambas épocas (2.96; 3.35 vs. 2.87; 3.30 ordeño y secos en lluvia y poco lluviosa, respectivamente. El análisis del punto de equilibrio, mostró una ganancia neta sobre las ventas del 23.68, 31.44 y 36.46% para los años del primero al tercero, respectivamente. Los resultados del trabajo demuestran la posibilidad de obtener producción láctea bioeconómicamente factible, en el orden de los 9,183.09 a 12,035.40 kg leche ha-1 año-1, sin afectaciones en la calidad de la misma.

La dinámica placer/afecto en la constitución de feminidades en mujeres negras y mestizas-blancas de diferentes sectores sociales en el suroccidente colombiano

Directory of Open Access Journals (Sweden)

Fernando Urrea Giraldo

Full Text Available Este articulo analiza la producción de determinadas feminidades en el suroeste colombiano actual, a través de las tensiones entre placer y afecto reveladas por las biografías sexuales de 18 mujeres negras y blancas-mestizas, de diferentes clases sociales, color de piel, orientación sexual, generación, edad, estado civil y prole. A través de la construcción de cuatro tipologías, se aborda el papel creciente del placer en la conformación social de las subjetividades contemporáneas. Parte de los resultados son debatidos a partir de la perspectiva foucaultiana, el feminismo radical, la teoría queer, y el psicoanálisis lacaniano, con aportes de la sociología y el feminismo afroamericano. El presente texto se inscribe en la teoría feminista de la interseccionalidad, y plantea especialmente el papel de la racialización en la vivencia de la sexualidad de las mujeres negras entrevistadas, mediante la articulación de las dimensiones sexual y racial.

A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore ( Bos indicus) beef cattle

NARCIS (Netherlands)

Rosa, A.J.M.; Bijma, P.; Oliveira, H.N.; Lobo, R.B.; Arendonk, van J.A.M.

2007-01-01

We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET) closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS) of Nellore (Bos indicus) beef cattle embryos prior to transplantation to reduce the age at first calving

Efecto de la suplementación con residuos de destilería del maíz en el comportamiento de novillas en una asociación de gramínea y leucaena Effect of supplementation with corn distillery residues on the performance of heifers in an association of grass and leucaena

Directory of Open Access Journals (Sweden)

Tania Sánchez

2010-09-01

Full Text Available El objetivo del presente trabajo fue evaluar el efecto de la suplementación con residuos de destilería del maíz en el comportamiento de novillas, en una asociación de gramínea y leucaena. El estudio se realizó en un área de la Estación Experimental "Indio Hatuey", en el municipio de Perico, provincia de Matanzas, Cuba. La especie de pasto predominante fue Panicum maximum cv. Likoni y como leguminosa Leucaena leucocephala. Se estudiaron 18 novillas, distribuidas en un diseño completamente aleatorizado en tres grupos de seis animales; el grupo control no recibió suplementación (A y los otros dos grupos se suplementaron con residuos de destilería del maíz en un 10% (B y 20% (C de los requerimientos de proteína con relación al peso vivo. Se determinó la composición química, la disponibilidad de materia seca, la ganancia de peso vivo, la infestaci��n parasitaria y el hematocrito. Al analizar las ganancias diarias por tratamiento se encontraron diferencias significativas (PThe objective of this work was to evaluate the effect of supplementation with corn distillery residues on the performance of heifers in an association of grass and leucaena. The study was conducted in an area of the Experimental Station "Indio Hatuey" , Perico municipality, Matanzas province, Cuba. The prevailing pasture species was Panicum maximum cv. Likoni and as legume, Leucaena leucocephala. Eighteen heifers, distributed in a completely randomized design in three groups of six animals, were used; the control group did not receive supplementation (A, and the other two groups were supplemented with corn distillery residues in 10% (B and 20% (C of the protein requirements with regards to live weight. The chemical composition, dry matter availability, live weight gain, parasite infestation and hematocrit were determined. When analyzing the daily gain per treatments, significant differences (P<0,05 were found and the highest values were obtained in treatment C

Consumo de forrajes tropicales por vacas lecheras, mestizas Siboney, manejadas en condiciones de estabulación

Directory of Open Access Journals (Sweden)

Julio J. Reyes

2015-01-01

Full Text Available Con el objetivo de estudiar el comportamiento de tres forrajes tropicales y su consumo por animales lecheros, durante tres años, se utilizó un área total de cultivos de 4.25 hectáreas, distribuidas en 1.50 hectáreas para caña de azúcar (Sacharum officinarun, 2 hectáreas del king grass clon CT-169 (Pennisetum purpureum vc Cuba CT-169 y 0.75 hectáreas de leucaena (Leucaena leucocephala; para estimar el consumo, se utilizaron 20 vacas lecheras mestizas de Siboney, mantenidas en régimen de estabulación, con dieta semi-integral. Se realizó un análisis de varianza, según diseño completamente aleatorizado, en arreglo factorial. Los resultados arrojan que las disponibilidades promedio del forraje caña de azúcar fueron mayores (P<0.05 en la época poco lluviosa: 1,916.64 vs. 1,474.73 kg MS ha-1 mes-1; mientras que los forrajes de CT-169 y leucaena fueron superiores sus disponibilidades (P<0.01 en la época lluviosa: 924.76 y 519.01 vs. 649.10 y 314.20 kg MS ha-1 mes-1, respectivamente. La calidad de los forrajes fue menor (P<0.001 en la época poco lluviosa. Los consumos totales de materia seca que realizaron los animales, fue superior (P<0.001 en la época lluviosa (10.56 vs. 9.33 kg MS animal-1 día-1; mientras que los animales de ordeño realizaron un mayor (P<0.001 consumo que los secos (10.82 vs. 9.06 kg MS animal-1 día-1. Los resultados expresan la posibilidad del sistema en estabulación de mantener una carga promedio de 4.70 a 4.9 UGM ha-1, con vacas lecheras de mediano potencial y obtener un consumo adecuado de estos forrajes.

Bekalking en toevoegen van nutriënten; evaluatie van de effecten op de vitaliteit van het bos; een veldonderzoek naar boomgroei

NARCIS (Netherlands)

Wolf, R.J.A.M.; Engels, M.E.; Knotters, M.; Schraven, R.; Boertjes, M.

2006-01-01

Dit rapport doet verslag van een deelonderzoek uit de Evaluatie van effectgerichte maatregelen in multifunctionele bossen 2004-2005 en is gericht op de effecten van de maatregelen bemes-ting en bekalking in bossen als overbruggingsmaatregel in het kader van het Overlevingsplan Bos en Natuur (OBN).

Tractus génital des vaches zébus (Bos indicus) au Niger.

OpenAIRE

Moussa Garba, Mahamadou; Marichatou, H; Issa, M; Abdoul Aziz, ML; Hanzen, Christian

2013-01-01

Les caractéristiques anatomiques et les structures ovariennes et pathologiques du tractus génital de 500 femelles zébus (Bos indicus), appartenant à quatre races bovines (Azawak, Bororo, Djelli, Goudali), ont été étudiées à l’abattoir de Niamey au Niger du 15 août au 15 décembre 2011. Chaque animal a été examiné avant abattage. Ces vaches et génisses, âgées en moyenne de 8 ± 2,5 ans, ont eu une note d’état corporel moyenne de 1,6 ± 0,6 et un poids moyen de carcasse de 113 ± ...

Evaluación de indicadores productivos en conejas mestizas con una dieta basada en forraje y pienso criollo Evaluation of productive indicators in crossbred does with a diet based on forage and homemade concentrate

Directory of Open Access Journals (Sweden)

O López

2011-03-01

Full Text Available Con el objetivo de evaluar el comportamiento productivo de conejas mestizas se utilizaron un total de 24 reproductoras, entre 10 y 18 meses de edad, con un peso promedio superior a los 3,0 kg durante cuatro meses. Las reproductoras consumieron una dieta constituida por: forraje de morera (Morus alba: 0,30 kg; caña (Saccharum officinarum molida: 0,25 kg, glycine (Neonotonia wightii: 0,40 kg y pienso criollo: 0,06 kg. Las crías se pesaron al nacimiento, a los 20 y a los 45 días de edad. En las reproductoras se controló las crías nacidas vivas y destetadas por parto. Se obtuvo como promedio 6,4 gazapos vivos por parto con 0,054 kg de PV al nacimiento y se destetaron 5,4 crías a los 45 días de edad con un peso de 0,694 kg. Además, se encontró un 84,4% de supervivencia durante la etapa de lactación. La ganancia media diaria durante la lactancia fue de 0,014 kg/animal/día. Los resultados evidenciaron que con la dieta propuesta se obtuvieron indicadores productivos alentadores en reproductoras mestizas.With the objective of evaluating the productive performance of crossbred does, a total of 24 animals were used, between 10 and 18 months old, with average weight higher than 3,0 kg, during four months. The does ate a diet constituted by mulberry (Morus alba forage: 0,30 kg; ground sugarcane (Saccharum officinarum: 0,25 kg; glycine (Neonotonia wightii: 0,40 kg and homemade concentrate: 0,06 kg. The young rabbits were weighed at birth, 20 and 45 days after birth. In the does the offspring born alive and weaned per parturition, were controlled. As average, 6,4 live rabbits were obtained per parturition, with 0,054 kg LW at birth and 5,4 rabbits were weaned being 45 days old and weighing 0,694 kg. In addition, 84,4% survival was found during the lactation stage. The mean daily gain during lactation was 0,014 kg/animal/day. The results proved that with the proposed diet encouraging productive indicators were obtained in crossbred does.

Absence of heat intolerance (panting) syndrome in foot-and-mouth disease-affected Indian cattle (Bos indicus) is associated with intact thyroid gland function.

Science.gov (United States)

Maddur, M S; Rao, S; Chockalingam, A K; Kishore, S; Gopalakrishna, S; Singh, N; Suryanarayana, V V S; Gajendragad, M R

2011-06-01

Foot-and-mouth disease (FMD) is a highly contagious and economically important viral disease with high morbidity and reduced productivity of affected animals. We studied the heat intolerance (HI) (panting) syndrome and the effect of FMD virus (FMDV) infection on thyroid gland function in Indian cattle (Bos indicus). Experimental infection with FMDV Asia 1 resulted in a mild form of disease with superficial lesions. Heat intolerance syndrome and its signs were not observed among the recovered animals. Subtle changes in the serum level of thyroid hormones, triiodothyronine (T₃) and thyroxine (T₄) were observed. However, there were no distinct histological changes in the thyroid gland, and FMDV antigens were not detected in the thyroid tissues. Our results thus suggest that the absence of panting syndrome in FMD-affected Bos indicus cattle may be associated with intact thyroid gland function.

Resposta superovulatória na primeira onda de crescimento folicular em doadoras Nelore (Bos indicus)

OpenAIRE

Luiz Fernando Tonissi Nasser

2006-01-01

Três experimentos foram realizados para testar a hipótese de que a resposta superestimulatória de doadoras Nelore (Bos indicus) com tratamentos iniciados próximo à ovulação durante a primeira onda de crescimento folicular seria maior ou comparável àquela decorrente de tratamentos convencionais. Os animais foram aleatoriamente alocados em três grupos. As doadoras dos Grupos 1 - Onda 1 s/P4 e 2 - Onda 1 c/P4 foram superestimuladas na primeira onda de crescimento folicular, e as do Grupo 3 - Sin...

The relevance, biases, and importance of digitising opportunistic non-standardised collections: A case study in Iberian harvestmen fauna with BOS Arthropod Collection datasets (Arachnida, Opiliones).

Science.gov (United States)

Merino-Sáinz, Izaskun; Torralba-Burrial, Antonio; Anadón, Araceli

2014-01-01

In this study, we analyse the relevance of harvestmen distribution data derived from opportunistic, unplanned, and non-standardised collection events in an area in the north of the Iberian Peninsula. Using specimens deposited in the BOS Arthropod Collection at the University of Oviedo, we compared these data with data from planned, standardised, and periodic collections with pitfall traps in several locations in the same area. The Arthropod Collection, begun in 1977, includes specimens derived from both sampling types, and its recent digitisation allows for this type of comparative analysis. Therefore, this is the first data-paper employing a hybrid approach, wherein subset metadata are described alongside a comparative analysis. The full dataset can be accessed through Spanish GBIF IPT at http://www.gbif.es:8080/ipt/archive.do?r=Bos-Opi, and the metadata of the unplanned collection events at http://www.gbif.es:8080/ipt/resource.do?r=bos-opi_unplanned_collection_events. We have mapped the data on the 18 harvestmen species included in the unplanned collections and provided records for some species in six provinces for the first time. We have also provided the locations of Phalangium opilio in eight provinces without published records. These results highlight the importance of digitising data from unplanned biodiversity collections, as well as those derived from planned collections, especially in scarcely studied groups and areas.

Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

DEFF Research Database (Denmark)

Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede

2013-01-01

Several quantitative trait loci (QTL) affecting mastitis incidence and mastitis-related traits such as somatic cell score exist in dairy cows. Previously, QTL haplotypes associated with susceptibility to Escherichia coli mastitis in Nordic Holstein-Friesian (HF) cows were identified on Bos taurus...... autosome 9. In the present study, we induced experimental E. coli mastitis in Danish HF cows to investigate the effect of 2 E. coli mastitis-associated QTL haplotypes on the cows' disease phenotypes and recovery in early lactation. Thirty-two cows were divided in 2 groups bearing haplotypes with either low...... the HH group did. However, we also found interactions between the effects of haplotype and biopsy for body temperature, heart rate, and PMNL. In conclusion, when challenged with E. coli mastitis, HF cows with the specific Bos taurus autosome 9-located QTL haplotypes were associated with differences...

A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

Directory of Open Access Journals (Sweden)

Ceiridwen J Edwards

Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

LENUS (Irish Health Repository)

Edwards, Ceiridwen J

2010-01-01

BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

Dinâmica folicular e taxa de prenhez em novilhas receptoras de embrião (Bos taurus indicus x Bos taurus taurus tratadas com o protocolo "Ovsynch" para inovulação em tempo fixo

Directory of Open Access Journals (Sweden)

Pietro Sampaio Baruselli

2003-01-01

Full Text Available Objetivou-se avaliar a eficiência da sincronização da ovulação para inovulação em tempo fixo em novilhas Bos taurus indicus x Bos taurus taurus receptoras de embrião. No Experimento 1, a dinâmica folicular foi acompanhada durante o protocolo "Ovsynch" (G1; n=35 e após a aplicação de PGF2alfa (G2; n=34. No Experimento 2, os mesmos tratamentos foram realizados a campo em 168 (G1 e 177 (G2 novilhas. No D6, colheu-se sangue para dosagem de P4 e se realizaram exames ultra-sonográficos. No D7, realizou-se a inovulação. No Experimento 1, 45,7% dos animais ovularam após o 1º GnRH (P;0,05. Ao final, a taxa de prenhez no Gl foi de 35,7% e no G2 de 25,4% (P<0,05. Foram detectadas em estro 53,7% das novilhas do G2 e 33,3% do Gl (P<0,05. Os corpos lúteos com maior área determinaram maiores concentrações de P4 e taxa de concepção (P<0,05. A sincronização da ovulação para inovulação em tempo fixo aumentou as taxas de ovulação, de aproveitamento e de prenhez em novilhas receptoras de embrião.

Assessment of exposure to PCDD/F, PCB, and PAH at a basic oxygen Steelmaking (BOS) and an iron ore sintering plant in the UK.

Science.gov (United States)

Jackson, Kevin; Aries, Eric; Fisher, Raymond; Anderson, David R; Parris, Adrian

2012-01-01

An assessment was carried out at a UK integrated steelworks to investigate the exposure of workers via inhalation to dioxins [polychlorinated dibenzo-p-dioxins (PCDD/F)], polychlorinated biphenyls (PCBs), and polycyclic aromatic hydrocarbons (PAH) including benzo[a]pyrene (B[a]P). Investigations focused on a basic oxygen steelmaking (BOS) plant and an iron ore sintering plant. The highest concentrations of PCDD/F and dioxin-like PCB were found at the BOS vessels and sinter strand area at the BOS and sinter plant, respectively. A risk assessment was carried out by comparing the daily intake of PCDD/F and PCB via inhalation with the recommended tolerable daily intake (TDI) proposed by the World Health Organisation (WHO). For the most exposed category of worker in this study (i.e. sinter plant workers inside the strand area), the estimated daily intake via inhalation was estimated to be 0.25 pg WHO-toxic equivalent concentrations (TEQ) kg(-1) body weight (bw). Considering that the average UK adult exposure to PCDD/F from the diet is 1.8 pg WHO-TEQ kg(-1) bw day(-1), the results indicated that the estimated daily intake of PCDD/F and PCB via inhalation for sinter plant workers would not result in the recommended range of the TDI (1-4 pg WHO-TEQ kg(-1) bw day(-1)) being exceeded. Cancer risks for a 40-year occupational exposure period were determined by multiplying the estimated intake by the inhalation cancer potency factor for 2,3,7,8-tetrachlorodibenzo-p-dioxin. For the most exposed category of worker, cancer risks from exposure to PCDD/F and PCB ranged from 2.5 × 10(-6) to 5.2 × 10(-5). Under most regulatory programmes, excess cancer risks between 1.0 × 10(-6) and 1.0 × 10(-4) indicate an acceptable range of cancer risk, suggesting a limited risk from PCDD/F and PCB exposure for workers in the sinter plant. With regard to PAH, B[a]P concentrations were typically plant and the BOS plant. In several cases, particularly at the sinter plant, B[a]P concentrations

Cloning of an endangered species (Bos gaurus) using interspecies nuclear transfer.

Science.gov (United States)

Lanza, R P; Cibelli, J B; Diaz, F; Moraes, C T; Farin, P W; Farin, C E; Hammer, C J; West, M D; Damiani, P

2000-01-01

Approximately 100 species become extinct a day. Despite increasing interest in using cloning to rescue endangered species, successful interspecies nuclear transfer has not been previously described, and only a few reports of in vitro embryo formation exist. Here we show that interspecies nuclear transfer can be used to clone an endangered species with normal karyotypic and phenotypic development through implantation and the late stages of fetal growth. Somatic cells from a gaur bull (Bos gaurus), a large wild ox on the verge of extinction, (Species Survival Plan cloned animals was gaurus in origin. The gaur nuclei were shown to direct normal fetal development, with differentiation into complex tissue and organs, even though the mitochondrial DNA (mtDNA) within all the tissue types evaluated was derived exclusively from the recipient bovine oocytes. These results suggest that somatic cell cloning methods could be used to restore endangered, or even extinct, species and populations.

Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

Science.gov (United States)

There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

Cow allergen (Bos d2) and endotoxin concentrations are higher in the settled dust of homes proximate to industrial-scale dairy operations.

Science.gov (United States)

Williams, D' Ann L; McCormack, Meredith C; Matsui, Elizabeth C; Diette, Gregory B; McKenzie, Shawn E; Geyh, Alison S; Breysse, Patrick N

2016-01-01

Airborne contaminants produced by industrial agricultural facilities contain chemical and biological compounds that can impact the health of residents living in close proximity. Settled dust can be a reservoir for these contaminants and can influence long-term exposures. In this study, we sampled the indoor- and outdoor-settled dust from 40 homes that varied in proximity to industrial-scale dairies (ISD; industrial-scale dairy, a term used in this paper to describe a large dairy farm and adjacent waste sprayfields, concentrated animal feeding operation or animal feeding operation, that uses industrial processes) in the Yakima Valley, Washington. We analyzed settled dust samples for cow allergen (Bos d2, a cow allergen associated with dander, hair, sweat and urine, it is a member of the lipocalin family of allergens associated with mammals), mouse allergen (Mus m1; major mouse allergen, a mouse urinary allergen, in the lipocalin family), dust mite allergens (Der p1 (Dermatophagoides pteronissinus 1) and Der f1 (Dermatophagoides farinae 1)), and endotoxin (a component of the cell walls of gram negative bacteria, lipopolysaccharide, which can be found in air and dust and can produce a strong inflammatory response). A concentration gradient was observed for Bos d2 and endotoxin measured in outdoor-settled dust samples based on proximity to ISD. Indoor-settled dust concentrations of Bos d2 and endotoxin were also highest in proximal homes. While the associated health effects of exposure to cow allergen in settled dust is unknown, endotoxin at concentrations observed in these proximal homes (100 EU/mg) has been associated with increased negative respiratory health effects. These findings document that biological contaminants emitted from ISDs are elevated in indoor- and outdoor-settled dust samples at homes close to these facilities and extend to as much as three miles (4.8 km) away.

Draft genome of the gayal, Bos frontalis

Science.gov (United States)

Wang, Ming-Shan; Zeng, Yan; Wang, Xiao; Nie, Wen-Hui; Wang, Jin-Huan; Su, Wei-Ting; Xiong, Zi-Jun; Wang, Sheng; Qu, Kai-Xing; Yan, Shou-Qing; Yang, Min-Min; Wang, Wen; Dong, Yang; Zhang, Ya-Ping

2017-01-01

Abstract Gayal (Bos frontalis), also known as mithan or mithun, is a large endangered semi-domesticated bovine that has a limited geographical distribution in the hill-forests of China, Northeast India, Bangladesh, Myanmar, and Bhutan. Many questions about the gayal such as its origin, population history, and genetic basis of local adaptation remain largely unresolved. De novo sequencing and assembly of the whole gayal genome provides an opportunity to address these issues. We report a high-depth sequencing, de novo assembly, and annotation of a female Chinese gayal genome. Based on the Illumina genomic sequencing platform, we have generated 350.38 Gb of raw data from 16 different insert-size libraries. A total of 276.86 Gb of clean data is retained after quality control. The assembled genome is about 2.85 Gb with scaffold and contig N50 sizes of 2.74 Mb and 14.41 kb, respectively. Repetitive elements account for 48.13% of the genome. Gene annotation has yielded 26 667 protein-coding genes, of which 97.18% have been functionally annotated. BUSCO assessment shows that our assembly captures 93% (3183 of 4104) of the core eukaryotic genes and 83.1% of vertebrate universal single-copy orthologs. We provide the first comprehensive de novo genome of the gayal. This genetic resource is integral for investigating the origin of the gayal and performing comparative genomic studies to improve understanding of the speciation and divergence of bovine species. The assembled genome could be used as reference in future population genetic studies of gayal. PMID:29048483

Aktivitas Manusia dan Distribusi Banteng (Bos Javanicus D’alton 1832 di Taman Nasional Alas Purwo

Directory of Open Access Journals (Sweden)

Muhammad Ali Imron

2013-01-01

Full Text Available Human Activities and Distribution of Banteng (Bos Javanicus D’alton 1832 in Alas Purwo National Park This study aims to comprehend whether human activities contribute to the presence of banteng (Bos sundaicus d’Alton 1836 in the Alas Purwo National Park (APNP. We laid continuous strip line transects from centre of human activities to the direction of core area of APNP. Three locations were selected: Sadengan grazing area, Giri Salaka Hinduism praying area, and Kutorejo village; representing low to high human disturbance respectively. We collected both direct and indirect presence of banteng as well as human activities within 20 metre strip lines with 10 metre width. Data were compiled each 100 metres and analyzed with means comparison to observe difference among locations. Correlation analyses were used to assess the relation between distance from centre of human activities, human activities and banteng presence. Regression analysis was used when  significant correlations found. Our non parametric test showed that human disturbances are significantly different among sites (Kruskal Wallis Test; df 2 = 6.220, p< 0.05. In similar tendency but different manner, it is showed that the different levels of human disturbance conveyed significant difference in number of banteng’s tracks (Kruskal Wallis Test; df 2 = 18.888, p< 0.05. The distance from centre of human activities is negatively related to number of human tracks (Spearman rho; r2= -0.307 N= 64, p<0.05* and also to number of banteng’s tracks (Spearman rho, r2= -0.728 N= 30, p<0.05**. The regression analysis showed that number of human tracks explained 18.6% of total variation on number of Banteng’s tracks, while distance from centre of human activities explained 59%.

Research and development of evaluation system for photovoltaic power generation system. Research and survey on test and evaluation method for BOS component devices; Taiyoko hatsuden system hyoka gijutsu no kenkyu kaihatsu. Shuhen gijutsu hyoka system no kenkyu kaihatsu

Energy Technology Data Exchange (ETDEWEB)

Tatsuta, M [New Energy and Industrial Technology Development Organization, Tokyo (Japan)

1994-12-01

This paper reports the study results on R and D of the evaluation method for BOS component devices in fiscal 1994. (1) On the study on requirements of BOS component devices for practical use, the study results on storage battery, inverter, protective device for system interconnection, and effective use means for storage battery were summarized. On the future device technology, it was clarified that the following value added technologies are promising: simple design of inverter circuit, cost reduction by common specification and mass production, and stabilization of voltage and compensation of momentary peak load by combining inverter with small-capacity storage batteries. (2) On the study on the performance test method for BOS component devices, basic characteristic (capacity, efficiency) test, PSOC charge/discharge cycle test, and accelerated life cycle test were performed for 4 kinds of new storage batteries developed by NEDO. The whole characteristic test results satisfied specifications, and long-term cycle test is in promotion for all new storage batteries. 3 figs., 4 tabs.

MODELO MATEMÁTICO APLICADO A LA CURVA DE LACTANCIA EN GANADO VACUNO DOBLE PROPÓSITO

Directory of Open Access Journals (Sweden)

Luz Botero

2006-05-01

Full Text Available hembras vacunas. Materiales y métodos. Durante 11 meses, se estudió la producción de leche en 500novillas doble propósito Bos taurus x Bos indicus, de las sabanas del trópico bajo colombiano. Laproducción se cuantificó en kilogramos. Se incluyeron los datos de la producción de leche en época(seca-lluviosa y número de lactancias (primera; segunda y tercera y, más de tres. Los datos hacen partedel archivo de la Ganadería XB, ubicada en las sabanas de Bolívar, Colombia, recopilados desde el año1990 hasta el 2000. A estos datos se le aplicó los modelos lineal simple, cuadrático, lineal logarítmico,cuadrático logarítmico, gamma incompleto, lineal hiperbólico y polinomial inverso. Los parámetros paralos modelos gamma incompleto y polinomial inverso fueron estimados, a partir del método de “Gauss-Newton”, para la regresión no lineal; los demás modelos fueron ajustados por regresión lineal de lasproducciones, en función de los meses en lactancia, por el método de los cuadrados mínimos. Resultados.En los modelos propuestos, se observó que el modelo polinomial inverso es el que mejor caracteriza lacurva de lactancia por presentar los mayores valores para el estadístico Durbin-Watson y coeficiente dedeterminación (R2 y sobre dicho modelo existe información necesaria para obtener parámetros prácticoscalculados a partir de la ecuación de la curva de lactancia. Conclusión. El modelo matemático polinomialinverso se constituye en una excelente herramienta para aplicar en la administración y toma de decisionesen el manejo de hatos del sistema de doble propósito

Objective Measures for the Assessment of Post-Operative Pain in Bos indicus Bull Calves Following Castration

Science.gov (United States)

Musk, Gabrielle C.; Hyndman, Timothy H.; Lehmann, Heidi S.; Tuke, S. Jonathon; Collins, Teresa; Johnson, Craig B.

2017-01-01

Simple Summary Surgical castration of cattle is a common husbandry procedure, and although this procedure is known to cause pain in cattle and other species, in some countries it is often performed without anaesthesia or analgesia. Society is increasingly aware of this animal welfare issue and it is creating pressure to drive research into animal welfare science with the aim of identifying practical and economical approaches to pain management in livestock. To effectively manage pain, a pain assessment must be performed. Pain assessment methods are often subjective and therefore influenced by the observer. Ideally, objective assessments that generate consistent and repeatable results between observers should be identified. Bos indicus bull calves were divided into four groups: no castration (NC, n = 6); castration with pre-operative local anaesthetic (CL n = 12); castration with pre-operative anti-inflammatory medication (CM, n = 12); and, castration without pain relief (C, n = 12). A range of objective assessments was performed: bodyweight measurements, activity, and rest levels, and four different compounds in the blood. The results of this study suggest that animals rest for longer periods after the pre-operative administration of anti-inflammatory medication. The other objective assessments measured in this study were not able to consistently differentiate between treatment groups. These findings emphasise the need for alternative quantifiable and objective indicators of pain in Bos indicus bull calves. Abstract The aim of the study was to assess pain in Bos indicus bull calves following surgical castration. Forty-two animals were randomised to four groups: no castration (NC, n = 6); castration with pre-operative lidocaine (CL, n = 12); castration with pre-operative meloxicam (CM, n = 12); and, castration alone (C, n = 12). Bodyweight was measured regularly and pedometers provided data on activity and rest from day −7 (7 days prior to surgery) to 13. Blood

Mitochondrial DNA single nucleotide polymorphism associated with weight estimated breeding values in Nelore cattle (Bos indicus

Directory of Open Access Journals (Sweden)

Fernando Henrique Biase

2007-01-01

Full Text Available We sampled 119 Nelore cattle (Bos indicus, 69 harboring B. indicus mtDNA plus 50 carrying Bos taurus mtDNA, to estimate the frequencies of putative mtDNA single nucleotide polymorphisms (SNPs and investigate their association with Nelore weight and scrotal circumference estimated breeding values (EBVs. The PCR restriction fragment length polymorphism (PCR-RFLP method was used to detect polymorphisms in the mitochondrial asparagine, cysteine, glycine, leucine and proline transporter RNA (tRNA genes (tRNAasn, tRNAcys, tRNAgly, tRNAleu and tRNApro. The 50 cattle carrying B. taurus mtDNA were monomorphic for all the tRNA gene SNPs analyzed, suggesting that they are specific to mtDNA from B. indicus cattle. No tRNAcys or tRNAgly polymorphisms were detected in any of the cattle but we did detect polymorphic SNPs in the tRNAasn, tRNAleu and tRNApro genes in the cattle harboring B. indicus mtDNA, with the same allele observed in the B. taurus sequence being present in the following percentage of cattle harboring B. indicus mtDNA: 72.46% for tRNAasn, 95.23% for tRNAleu and 90.62% for tRNApro. Analyses of variance using the tRNAasn SNP as the independent variable and EBVs as the dependent variable showed that the G -> T SNP was significantly associated (p < 0.05 with maternal EBVs for weight at 120 and 210 days (p < 0.05 and animal's EBVs for weight at 210, 365 and 455 days. There was no association of the tRNAasn SNP with the scrotal circumference EBVs. These results confirm that mtDNA can affect weight and that mtDNA polymorphisms can be a source of genetic variation for quantitative traits.

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

OpenAIRE

Norberto Villa-Duque; Claudia Marcela Amaya-Torres; Darwin García-Rojas; Natalia Nieto-Omeara; Natalia Terán-Acuña

2016-01-01

En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander). El estudio consis...

Efeitos da injeção de cloreto de cálcio pós-morte e tempo de maturação no amaciamento e nas perdas por cozimento do músculo Longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso Effects of postmortem calcium chloride injection and aging time on tenderness and cooking losses of Longissimus dorsi muscle from Bos indicus and Bos taurus animals selected for weight gain

Directory of Open Access Journals (Sweden)

Aparecida Carla de Moura

1999-01-01

Full Text Available O objetivo deste estudo foi avaliar o efeito da injeção pós-morte de cloreto de cálcio (CaCl2 e o tempo de maturação no amaciamento e nas perdas por cozimento do músculo longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso. Foram usados 64 machos inteiros (16 Caracu, 16 Guzerá, 16 Nelore Controle e 16 Nelore Seleção. Vinte quatro horas após o abate, foi retirada uma amostra do músculo Longissiumus dorsi (contra-filé entre a 6ª e 9ª vértebras lombares e dividida em nove subamostras. Em cada grupo de três subamostras escolhidas ao acaso, foi injetada, na quantia correspondente a 10% do seu peso, uma das seguintes soluções: a água (controle, b 200 mM de CaCl2 e c 300 mM de CaCl2. Cada subamostra foi, então, embalada a vácuo, congelada (- 2ºC e maturada por 1,7 ou 14 dias até a realização de testes de força de cisalhamento e perdas por cozimento (evaporação, gotejamento e perdas totais. Foi usado delineamento experimental completamente casualizado com parcelas subdivididas, em que a parcela correspondia à raça e a sub-parcela, à combinação entre três níveis de CaCl2 e três tempos de maturação. A raça influenciou a força de cisalhamento, mas não influiu nas perdas por cozimento A maturação por um período de sete dias reduziu os valores de força de cisalhamento e as perdas por evaporação, gotejamento e totais. Maiores concentrações de CaCl2 resultaram em menor força de cisalhamento e maiores perdas por evaporação, embora não tenham influenciado as perdas por gotejamento e totais. A concentração de 200 mM CaCl2 apresentou a melhor redução para a força de cisalhamento. A injeção pós-morte de uma solução de CaCl2 aumentou o processo de amaciamento, sem influir nas perdas por cozimento.ABSTRACT - The objective of this study was to evaluate the effect of postmortem calcium chloride (CaCl2 injection and aging time on tenderness and cooking losses of Longissimus

Iberian Odonata distribution: data of the BOS Arthropod Collection (University of Oviedo, Spain)

Science.gov (United States)

Torralba-Burrial, Antonio; Ocharan, Francisco J.

2013-01-01

Abstract Odonata are represented from the Iberian Peninsula by 79 species. However, there exists a significant gap in accessible knowledge about these species,especially regarding their distribution. This data paper describes the specimen-based Odonata data of the Arthropod Collection of the Department of Biología de Organismos y Sistemas (BOS), University of Oviedo, Spain. The specimens were mainly collected from the Iberian Peninsula (98.63% of the data records), especially the northern region. The earliest specimen deposited in the collection dates back to 1950, while the 1980’s and 2000’s are the best-represented time periods. Between 1950 and 2009, 16, 604 Odonata specimens were deposited and are documented in the dataset. Approximately 20% of the specimens belong to the families Coenagrionidae and Calopterygidae. Specimens include the holotype and paratypes of the Iberian subspecies Calopteryx haemorrhoidalis asturica Ocharan, 1983 and Sympetrum vulgatum ibericum Ocharan, 1985. The complete dataset is also provided in Darwin Core Archive format. PMID:23794917

Cambios antropométricos en la nariz mestiza después de rinoplastia abierta Anthropometric changes in the mestizo nose after open rhinoplasty

Directory of Open Access Journals (Sweden)

Julio César Gálvez Chávez

2007-12-01

Full Text Available Se describen los cambios antropométricos nasales en una serie de 29 pacientes mestizos, a los cuales se practicó rinoplastia abierta. La nariz mestiza de la muestra estuvo caracterizada por dorso ancho, altura normal, punta nasal ancha e hipoproyectada, ángulo naso-labial agudo, columela retraída, relación dorso-punta desproporcionada y triángulo base-punta no equilátero. Los resultados estéticos fueron evaluados como regulares en todos los pacientes, según patrones estéticos aceptados como ideales. Con el plan quirúrgico empleado todas las regiones anatómicas experimentaron mejorías; siendo dichos cambios más significativos en parámetros como la proyección y ancho de la punta, así como en el ancho y altura del dorso. Las modificaciones fueron menos marcadas en cuanto a la proyección de la columela, el triángulo base-punta y el ángulo nasolabial.The nasal anthropometric changes in a series of 29 mestizo patients that underwent open rhinoplasty are described. The mestizo nose of the sample was characterized by broad dorsum, normal height, wide and hypoprojected nose tip, acute nasolabial angle, retrusive columella, disproportionate dorsum-tip relation and non-equilateral base-tip triangle. The aesthetic results were evaluated as fair in every patient, according to the aesthetic patterns accepted as ideal. With the surgical plan used, all the anatomical regions improved. The most significant changes were observed in parameters such as the projection and tip width, as well as in the width and height of the dorsum. The modifications were less marked as regards the projection of the columella, the base-tip triangle and the nasolabial angle.

Climacteric symptoms in Quechua and Mestizo women from the Andean region of Cusco, Peru: effects of altitude and ethnicity.

Science.gov (United States)

Ojeda, Eliana; Blümel, Juan E; Vallejo, María Soledad; Lavín, Pablo

2014-04-01

Latin-American women present a greater severity of climacteric symptoms than women from other parts of the world. Previous studies suggest that this could be due to either its Amerindian crossbreeding or the altitude in which a huge proportion of the Latin-American population lives. To answer this question, climacteric symptoms between Peruvian women ("Hispanic-Mestizas" and "Quechuas") living in similar altitude (around 3000 MASL) were compared. This is a cross sectional descriptive study of healthy women of 40-59 years of age living in Departamento de El Cusco, Peru. Using the MRS questionnaire climacteric symptoms were assessed in 395 "Hispanic-Mestizas" (Quechua-Spaniard breeding) and 376 pure "Quechuas". The "Quechuas" compared with "Hispanic-Mestizas" have comparable similar age, but less: obesity, schooling years, cigarette smoking, use of hormonal therapy, diabetes and hypertension; and a greater: proportion of postmenopausal women and number of children. "Quechuas" showed a greater prevalence in ten of the eleven symptoms evaluated by the MRS scale, except for insomnia. The total MRS score was 14.54±7.51 vs. 9.87±6.26 (pQuechuas" had a deteriorated quality of life due to severe climacteric symptomatology, compared to only 14.2% of "Hispanic-Mestizas" women (pQuechua being (OR: 2.38, 95% CI: 1.27-4.45). Peruvian "Quechuas" women have severer climacteric symptoms than the Peruvian "Hispanic-Mestizas" who live in a comparable altitude. This could suggest that the ethnicity could be one of the factors that could explain the augmented symptoms in Latin-American climacteric woman. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Vaccine-induced rabies case in a cow (Bos taurus): Molecular characterisation of vaccine strain in brain tissue.

Science.gov (United States)

Vuta, Vlad; Picard-Meyer, Evelyne; Robardet, Emmanuelle; Barboi, Gheorghe; Motiu, Razvan; Barbuceanu, Florica; Vlagioiu, Constantin; Cliquet, Florence

2016-09-22

Rabies is a fatal neuropathogenic zoonosis caused by the rabies virus of the Lyssavirus genus, Rhabdoviridae family. The oral vaccination of foxes - the main reservoir of rabies in Europe - using a live attenuated rabies virus vaccine was successfully conducted in many Western European countries. In July 2015, a rabies vaccine strain was isolated from the brain tissues of a clinically suspect cow (Bos taurus) in Romania. The nucleotide analysis of both N and G gene sequences showed 100% identity between the rabid animal, the GenBank reference SAD B19 strain and five rabies vaccine batches used for the national oral vaccination campaign targeting foxes. Copyright © 2016 Elsevier Ltd. All rights reserved.

AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus), INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893) DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

OpenAIRE

Maria Aparecida Schenki; Cláudio Roberto Madruga; Aguemi Kohayagawa; Carla Lopes Mendonça; Dirson Vieira; Raul Kessler

2006-01-01

Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus) inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, ...

Bosón de Higgs o la partícula de Dios: Entre el hito investigador y la quimera

OpenAIRE

Sanz Pascual, Julián

2013-01-01

Últimamente ha habido una eclosión informativa respecto a un descubrimiento científico que se supone va a ser histórico, la detección en el acelerador de partículas LHC de la partícula denominada el bosón de Higgs, bautizada como la partícula de Dios. Cabe considerar que la detección de esta partícula puede suponer una clave que va a revolucionar la física. Nosotros, que no somos físicos especializados, sino que pertenecemos a la filosofía, vamos a intentar una visión del tema desde ...

Genital tract of zebu (Bos indicus cows in Niger

Directory of Open Access Journals (Sweden)

M. Moussa Garba

2014-01-01

Full Text Available The anatomical characteristics, and the ovarian and pathological structures of the genital tract of 500 zebu (Bos indicus females belonging to four breeds (Azawak, Bororo, Djelli, Goudali were studied at Niamey’s slaughterhouse in Niger from August 15 to December 15, 2011. Each animal was examined before slaughter. The cows and heifers were on average 8 ± 2.5 years old. Their mean body condition score was 1.6 ± 0.6 and mean carcass weight 113 ± 21 kg. The anatomical characteristics of the genital tract did not show differences between breeds (p > 0.05. The following characteristics were observed: cervix diameter 3.4 ± 1.1 cm, cervix length 8.1 ± 2.5 cm, horn length 21.6 ± 5.2 cm, horn diameter 1.6 ± 0.5 cm, length and width of the right ovary 19.8 ± 4.4 and 11.2 ± 3.8 mm, of the left ovary 18.8 ± 4.5 and 10.2 ± 3.3 mm, and weight of the right and left ovaries 2.9 ± 1.8 and 2.5 ± 1.6 g, respectively. A corpus luteum was identified in only 14% cases and no visible follicles were found on the surface of the ovaries in 32% cases. These characteristics were significantly (p < 0.05 influenced by the age of the animal. Among the examined females, 7.4% were confirmed pregnant. Various genital tract diseases (cysts, uterine infection, free martinism, pyometra... were observed in 10.4% of the genital tracts.

Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions

Directory of Open Access Journals (Sweden)

Chase A. Runyan

2017-12-01

Full Text Available Bovine viral diarrhea virus (BVDV has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366 that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV, killed, (KV or no vaccine (NON. Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05, and interacted with day (p < 0.001 for ADFI. Although low incidence of clinical signs was observed, there were marked reductions in average daily gain (ADG and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104% and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI (p < 0.001, and a sire by time period interaction affected ADG (p = 0.03 and total feed intake (p = 0.03. This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

Shiga toxin-producing Escherichia coli in yaks (Bos grunniens from the Qinghai-Tibetan Plateau, China.

Directory of Open Access Journals (Sweden)

Xiangning Bai

Full Text Available Shiga toxin (Stx-producing Escherichia coli (STEC are recognized as important human pathogens of public health concern. Many animals are the sources of STEC. In this study we determined the occurrence and characteristics of the STEC in yaks (Bos grunniens from the Qinghai-Tibetan plateau, China. A total of 728 yak fecal samples was collected from June to August, 2012 and was screened for the presence of the stx 1 and stx 2 genes by TaqMan real-time PCR after the sample was enriched in modified Tryptone Soya Broth. Of the 138 (18.96% stx 1 and/or stx 2-positive samples, 85 (61.59% were confirmed to have at least 1 STEC isolate present by culture isolation, from which 128 STEC isolates were recovered. All STEC isolates were serotyped, genotyped by pulsed-field gel electrophoresis (PFGE and characterized for the presence of 16 known virulence factors. Fifteen different O serogroups and 36 different O:H serotypes were identified in the 128 STEC isolates with 21 and 4 untypable for the O and H antigens respectively. One stx 1 subtype (stx 1a and 5 stx 2 subtypes (stx 2a, stx 2b, stx 2c, stx 2d and stx 2g were present in these STEC isolates. Apart from lpfA O157/OI-141, lpfA O157/OI-154, lpfA O113, katP and toxB which were all absent, other virulence factors screened (eaeA, iha, efa1, saa, paa, cnf1, cnf2, astA, subA, exhA and espP were variably present in the 128 STEC isolates. PFGE were successful for all except 5 isolates and separated them into 67 different PFGE patterns. For the 18 serotypes with 2 or more isolates, isolates of the same serotypes had the same or closely related PFGE patterns, demonstrating clonality of these serotypes. This study was the first report on occurrence and characteristics of STEC isolated from yaks (Bos grunniens from the Qinghai-Tibetan plateau, China, and extended the genetic diversity and reservoir host range of STEC.

AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus, INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893 DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

Directory of Open Access Journals (Sweden)

Maria Aparecida Schenki

2006-10-01

Full Text Available Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, Babesia bigemina, parasitemia, bioquímica sérica.

Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

Directory of Open Access Journals (Sweden)

Daniela Bebbere

Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore Cattle Are Modulators of Growth.

Directory of Open Access Journals (Sweden)

Anirene G T Pereira

Full Text Available Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS, were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1 as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1, IGF2 (insulin like growth factor 2, GH1 (growth hormone 1, IGF1R (insulin like growth factor 1 receptor and GHR (growth hormone receptor, suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

Indicadores metabólicos en razas lecheras especializadas en condiciones tropicales en Colombia

Directory of Open Access Journals (Sweden)

Rómulo Campos G

2007-06-01

Full Text Available Se ha seleccionado un alto número de razas bovinas para producción de leche, sin embargo, las de origen Bos taurus no han logrado adaptarse a las condiciones tropicales. El objetivo del trabajo fue analizar el comportamiento metabólico de siete razas (Ayrshire, Girolando, Holstein Friesian, Jersey, Lucerna, Pardo Suizo y Simenthal a través de 15 metabolitos. Se emplearon 28 animales por raza, distribuidos en cuatro grupos fisiológicos: novillas, inicio y final de lactancia y vacas secas (final de gestación. Los valores medios de los indicadores metabólicos fueron: BOH 0.5 mmol/l; glucosa 2.8 mmol/l; colesterol 2.5 mmol/l; potasio 4.1 mmol/l; calcio 2.0 mmol/l; fósforo inorgánico 1.7 mmol/l; magnesio 1.1 mmol/l; proteínas totales 66.2 mg/dl; albúmina 25.8 mg/dl; globulinas 40.2 mg/dl; creatinina 109 µmol/l; BUN 3.8 mmol/l; ALT 32.2 UI/l; AST 56.6 UI/l; GGT 12.3 UI/l; bilirrubina total 0.2 µmol/l; bilirrubina conjugada 0.08 µmol/l. Los valores medios de la condición corporal y el hematocrito fueron 3.25% y 27.0% respectivamente. Se encontraron diferencias estadísticas significativas entre grupos raciales y entre grupos de producción. Los animales de menor peso metabólico (Jersey presentaron mejor homeostasis que los de pesos mayores (Simenthal, Holstein.

Posición anatómica y longitud del apéndice vermiforme en una población de raza mestiza de la ciudad de Bucaramanga - Colombia

Directory of Open Access Journals (Sweden)

Mónica Saavedra Martínez

2009-12-01

Full Text Available Antecedentes: La posición y longitud del apéndice vermiforme en el ser humano no son constantes y los datos sobre sus variaciones son limitados. Estudios previos soportan que algunas posiciones particulares o apéndices muy largas pueden confundir los signos clínicos de una apendicitis. Algunos autores afirman que el curso de una apendicitis puede estar influenciada por la posición del apéndice. Método: La posición y longitud del apéndice cecal fueron estudiados en 100 especímenes cadavéricos de población mestiza de Bucaramanga - Colombia. La posición del apéndice se dividió en 6 grupos: pélvica, retrocecal, preileal, postileal, subcecal y paracecal. La posición fue estudiada in situ. Resultados: La posición predominante fue la retrocecal 41%. Igualmente se encontró un porcentaje elevado de posición pélvica 28%. El promedio de la longitud del apéndice fue de 7.1 cm. Conclusión: El porcentaje de la posición retrocecal de nuestro estudio concuerda con otros estudios realizados en especímenes cadavéricos. Algunos autores han reportado porcentajes elevados de posición pélvica especialmente en poblaciones de raza negra. La posición pélvica del apéndice cecal puede producir dolor hipogástrico confundiendo los síntomas clínicos principalmente en mujeres. Los resultados de este tipo de investigaciones son importantes porque las relaciones de variables anatómicas son usadas en imágenes clínicas de apendicitis aguda; además éstas observaciones pueden alentar la mayor realización de apendicectomías por laparoscopia.

Influence of the age on hematological parameters of Sindi cattle (Bos indicus in Paraíba backwoods

Directory of Open Access Journals (Sweden)

Luciano José Bezerra Delfino

2014-09-01

Full Text Available ABSTRACT. Delfino L.J.B., de Souza B.B., Silva W.W., Ferreira A.F. & Soares C.E.A. Influence of the age on hematological parameters of Sindi cattle (Bos indicus in Paraíba backwoods. [Influência da idade nos parâmetros hematológicos do gado Sindi (Bos indicus no sertão paraibano.] Revista Brasileira de Medicina Veterinária, 36(3:266-270, 2014. Departamento de Medicina Veterinária, Universidade Federal de Campina Grande, Campus de Patos, Av. Universitária, s/n, Santa Cecília, Patos, PB 58708-110, Brasil. Email: zulu_vet@hotmail.com The aim this work was to establish reference values of the hemogram of Sindi cattle raised in Paraiba backwood and evaluate the influence of same age, on blood samples we collected from 60 clinically healthy animals, being 30 females and 30 males, with the following age groups: Group I: 6 - 24 months, Group II: 24 - 48 months and Group III: up to 48 months. The experiment was conducted at the Center for Research and Development for the Semiarid Tropics (NUPEÁRIDO and the Veterinary Clinical Pathology Laboratory of the Health Center and Rural Technology (CSTR, Universidade Federal de Campina Grande (UFCG, Campus de Patos-PB. Blood samples were placed in tubes containing EDTA (tetracético-ethylenediamine-di-sodium as an anticoagulant were performed the following tests: counting the number of red blood cells, packed cell volume (PCV, Hemoglobin (Hb content, calculations of absolute Erythrocyte count (RBC, Mean corpuscular volume (MCV and Mean corpuscular hemoglobin concentration (CHGH. Held global count and differential leukocyte such as segmented neutrophils, eosinophils, lymphocytes and monocytes. Reference values for erythrocyte count (RBC, hematocrit (PCV, hemoglobin (Hb, MCV and CHGH were, respectively, (6375 to 13,400 X106 / MM3 , (32 – 50 %, (9 - 15 G/DL (37 – 60 µ3, (23 to 33 µµG. And for the WBC were obtained the following results: WBC (5270 to 17,170 UL, segmented neutrophils (from 1360 to 5780

How to Implement Blue Ocean Strategy (BOS in B2B Sector Kaip įgyvendinti žydrųjų vandenynų strategiją (ŽVS sektoriuje „verslas – verslui“

Directory of Open Access Journals (Sweden)

Andrejs Čirjevskis

2011-11-01

Full Text Available The aim of research is to confirm the hypothesis that BOS is viable in the B2B sectors. The objects of research are two business entities: world’s lead­ing suppliers of construction chemicals and manufacturer of purification equip­ment. Authors posed first research question is BOS a suitable within construction chemicals and purification equipment manufacturers’ industries? Second research question was about how to evaluate acceptability of new strategic choice on BOS? Third research question was how to diagnosis organisational hurdles on BOS implementation? Research has confirmed the hypothesis and suggested application of innovation value chain to diagnosing company’s ability to implement value in­novation.

Tyrimo tikslas patvirtina hipotezę, kad ŽVS yra gyvybinga B2B sektoriuose. Tyrimo objektai yra du verslo subjektai: pasaulyje pirmaujantys statybos chemikalų tiekėjai ir valymo įrenginių gamintojai. Autorių keliamas pirmasis mokslinių tyrimų klausimas – ar ŽVS yra tinkama statybos chemikalų ir valymo įrenginių gamintojų pramonei? Antrasis mokslinių tyrimų klausimas – apie tai, kaip įvertinti naujo strateginio pasirinkimo

El bosón de Higgs no te va a hacer la cama la física como nunca te la han contado

CERN Document Server

Santaolalla, Javier

2016-01-01

Viajes en el tiempo, agujeros negros, motores de antimateria, aceleración del universo… La física moderna suena a película, pero es ciencia, de la de verdad verdadera, la que nos cuenta una historia fascinante de descubrimientos y sueños cumplidos, de luchas y disputas, de pasión por comprender la naturaleza. Este divertido libro te ayudará a entender de una vez por todas lo que nos rodea, desde lo más pequeño a lo más grande, y a saber que el bosón de Higgs no te va a hacer la cama, ¡ni aunque le insistas!

THE INFLUENCE OF AUTOLYSIS ON THE PROTEIN-PEPTIDE PROFILE OF Bos taurus AND Sus scrofa HEART AND AORTA TISSUES

Directory of Open Access Journals (Sweden)

I. M. Chernukha

2016-01-01

Full Text Available The article presents the results of autolytic processes impact on the protein-peptide profile of Bos taurus and Sus scrofa cardiac muscle and aorta. The results of tissue-specific protein identification are also presented as well as the effect of autolysis. Apolipoprotein A-1 involved in the formation of high-density lipoproteins, peroxiredoxin-1 involved in the suppression of oxidative stress, galectin-1 induced apoptosis of T-lymphocytes, as well as number of heat shock proteins with molecular weight less than 30 kDa were identified in Sus scrofa aorta tissue. It was discovered that functional proteins with molecular weight less than 30 kDa are retained during the freezing process, but destroyed under the action of autolytic enzymes. This work was supported by the Russian Science Foundation (project No. 16–16–10073.

Production of volatile fatty acid in the rumen and its relationship with their concentration, intake of dry matter and digestible organic matter in buffalo (Bos bubalis) calves

International Nuclear Information System (INIS)

Verma, D.N.; Singh, U.B.

1979-01-01

The production rates of total volatile fatty acid (TVFA) in the rumen of buffalo (Bos bubalis) calves were estimated using a single injection isotope dilution technique. A series of twelve experiments were done with animals given wheat straw and concentrate mixture. The production rate of TVFA ranged from 19.77 to 24.84 moles/d depending upon the amount of food consumed by the animals. Highly significant correlations were observed between TVFA production and their concentration, dry matter and digestible organic matter intake. (auth.)

Do cattle (Bos taurus) retain an association of a visual cue with a food reward for a year?

Science.gov (United States)

Hirata, Masahiko; Takeno, Nozomi

2014-06-01

Use of visual cues to locate specific food resources from a distance is a critical ability of animals foraging in a spatially heterogeneous environment. However, relatively little is known about how long animals can retain the learned cue-reward association without reinforcement. We compared feeding behavior of experienced and naive Japanese Black cows (Bos taurus) in discovering food locations in a pasture. Experienced animals had been trained to respond to a visual cue (plastic washtub) for a preferred food (grain-based concentrate) 1 year prior to the experiment, while naive animals had no exposure to the cue. Cows were tested individually in a test arena including tubs filled with the concentrate on three successive days (Days 1-3). Experienced cows located the first tub more quickly and visited more tubs than naive cows on Day 1 (usually P visual cue with a food reward within a day and retain the association for 1 year despite a slight decay. © 2014 Japanese Society of Animal Science.

DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

Directory of Open Access Journals (Sweden)

Mishra Bina

2006-11-01

Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

In vivo Efficacy of Vernonia amygdalina (Compositae Against Natural Helminth Infection in Bunaji (Bos indicus Calves

Directory of Open Access Journals (Sweden)

C. B. I. Alawa ab*, A. M. Adamu, J. O. Gefub, O. J. Ajanusic, P. A. Abdud and N. P. Chiezeyb

2010-10-01

Full Text Available Fifteen Bunaji calves (Bos indicus averaging 105±12.5 Kg liveweight and approximately nine months of age with natural helminth infection were distributed into three treatment groups of five animals each. Animals were either treated orally with aqueous extract of Vernonia amygdalina at a dose concentration of 1.1g/Kg body weight, a conventional anthelmintic or left untreated. V. amygdalina treatment produced 59.5% reduction in eggs per gram (EPG of faeces which was significantly different (P<0.001 from the untreated control (-17.24%, whereas levamisol hydrochloride treatment produced 100% reduction in EPG. A total of six genera of helminths were recovered from the gastrointestinal tracts and liver of experimental animals. These were Haemonchus contortus, Trichostrongylus spp, Bunostomum spp, Oesophagostomum spp, Fasciola spp and Dicrocoelium spp. There was significant difference (P<0.001 in worm load between the different treatment groups. Except for Haemonchus spp, animals in the untreated group had significantly (P<0.001 higher worm load for all the genera of helminth recovered than those of the V. amygdalina treated group, indicating that V. amygdalina had no effect on Haemonchus contortus.

Quantitative proteomic analysis of whey proteins in the colostrum and mature milk of yak (Bos grunniens).

Science.gov (United States)

Yang, Yongxin; Zhao, Xiaowei; Yu, Shumin; Cao, Suizhong

2015-02-01

Yak (Bos grunniens) is an important natural resource in mountainous regions. To date, few studies have addressed the differences in the protein profiles of yak colostrum and milk. We used quantitative proteomics to compare the protein profiles of whey from yak colostrum and milk. Milk samples were collected from 21 yaks after calving (1 and 28 d). Whey protein profiles were generated through isobaric tag for relative and absolute quantification (iTRAQ)-labelled proteomics. We identified 183 proteins in milk whey; of these, the expression levels of 86 proteins differed significantly between the whey from colostrum and milk. Haemoglobin expression showed the greatest change; its levels were significantly higher in the whey from colostrum than in mature milk whey. Functional analysis revealed that many of the differentially expressed proteins were associated with biological regulation and response to stimuli. Further, eight differentially expressed proteins involved in the complement and coagulation cascade pathway were enriched in milk whey. These findings add to the general understanding of the protein composition of yak milk, suggest potential functions of the differentially expressed proteins, and provide novel information on the role of colostral components in calf survival. © 2014 Society of Chemical Industry.

Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

Directory of Open Access Journals (Sweden)

Rodrigo Pinheiro Araldi

2015-01-01

Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

Harvestmen of the BOS Arthropod Collection of the University of Oviedo (Spain) (Arachnida, Opiliones)

Science.gov (United States)

Merino-Sáinz, Izaskun; Anadón, Araceli; Torralba-Burrial, Antonio

2013-01-01

Abstract There are significant gaps in accessible knowledge about the distribution and phenology of Iberian harvestmen (Arachnida: Opiliones). Harvestmen accessible datasets in Iberian Peninsula are unknown, an only two other datasets available in GBIF are composed exclusively of harvestmen records. Moreover, only a few harvestmen data from Iberian Peninsula are available in GBIF network (or in any network that allows public retrieval or use these data). This paper describes the data associated with the Opiliones kept in the BOS Arthropod Collection of the University of Oviedo, Spain (hosted in the Department of Biología de Organismos y Sistemas), filling some of those gaps. The specimens were mainly collected from the northern third of the Iberian Peninsula. The earliest specimen deposited in the collection, dating back to the early 20th century, belongs to the P. Franganillo Collection. The dataset documents the collection of 16,455 specimens, preserved in 3,772 vials. Approximately 38% of the specimens belong to the family Sclerosomatidae, and 26% to Phalangidae; six other families with fewer specimens are also included. Data quality control was incorporated at several steps of digitisation process to facilitate reuse and improve accuracy. The complete dataset is also provided in Darwin Core Archive format, allowing public retrieval, use and combination with other biological, biodiversity of geographical variables datasets. PMID:24146596

Effect of follicular diameter, time of first cleavage and H3K4 methylation on embryo production rates of Bos indicus cattle

Directory of Open Access Journals (Sweden)

Paula Alvares Lunardelli

2016-10-01

Full Text Available This study aimed investigate the relationship between epigenetics, follicular diameter and cleavage speed, by evaluating the developmental potential and occurence of H3K4 monomethylation of early-, intermediate- and late-cleaving Bos indicus embryos from in vitro fertilized oocytes originating from follicles up to 2 mm in diameter or between 4 and 8 mm in diameter. Oocytes (n = 699 from small follicles (? 2 mm and 639 oocytes from large follicles (4-8 mm were punched from 1,982 Bos indicus’ slaughterhouse ovaries. After maturation and in vitro fertilization (IVF, the cultured embryos were separated into early (? 28 h post-IVF, intermediate (> 28 h and ? 34 h post-IVF and late (> 34 h and ? 54 h post-IVF cleavage groups. Blastocysts were subjected to an immunofluorescence assessment for H3K4me investigation. The blastocyst rate for large follicles (36.3% was higher than that for small follicles (22.9%, P < 0.05. In addition, blastocyst rates for early and intermediate cleavage groups (45.3% and 33.8%, respectively were higher than that for late cleavage group (13.5%, P < 0.05. The blastocysts from all groups displayed H3K4me staining by immunofluorescence, particularly intense in what seemed to be trophectoderm cells and weak or absent in cells seemingly from the inner cell mass. For the first time for indicus embryos, data from this study demonstrate that higher blastocyst embryo rates are obtained from embryos that cleave within 34 h after fertilization and from those produced from follicles of 4-8 mm in diameter, indicating a greater ability of these embryos to develop to the stage of embryonic preimplantation. This is the first article demonstrating the occurrence of H3K4me in cattle embryos; its presence in all the evaluated blastocysts suggests that this histone modification plays a key role in maintaining embryo viability at preimplantation stage.

Prevalence of Circulating Antibodies to Bovine Herpesvirus 1 in Yaks (Bos grunniens) on the Qinghai-Tibetan Plateau, China.

Science.gov (United States)

Han, Zhaoqing; Gao, Jianfeng; Li, Kun; Shahzad, Muhammad; Nabi, Fazul; Zhang, Ding; Li, Jiakui; Liu, Zhengfei

2016-01-01

Bovine Herpesvirus 1 (BoHV-1) causes infections with many clinical signs, including rhinotracheitis, encephalitis, and genital lesions. The virus occurs worldwide in bovines, and in recent years, it has been reported in yaks (Bos grunniens) inhabiting the Tibetan Plateau in China. However, there is little epidemiologic data describing BoHV-1 infections in China's yak herds. We conducted a cross-sectional study on the Qinghai-Tibetan Plateau (QTP) in China July 2011-July 2012 to estimate the prevalence of BoHV-1 antibody in yak herds. We collected 1,840 serum samples from yaks on the QTP, in Tibet (988 yaks), Qinghai (475 yaks), and Sichuan (377 yaks) Provinces. Using an enzyme-linked immunosorbent assay, we found that 381 (38.6%) of the Tibetan samples, 212 (44.6%) of the Qinghai samples, and 105 (27.9%) of the Sichuan samples had detectable antibodies to BoHV-1. Given that this high prevalence of infection in yaks could result in heavy economic losses, we suggest that an effective management program, including vaccination and strategies for infection control, be developed.

Rumen microbial variation and nutrient utilisation in mithun (Bos frontalis) under different feeding regimes.

Science.gov (United States)

Prakash, B; Saha, S K; Khate, K; Agarwal, N; Katole, S; Haque, N; Rajkhowa, C

2013-04-01

The aim of the study was to investigate the effect of feeding different diets on fermentation, enzyme activities and microbial population in the rumen fluid of mithun (Bos frontalis). In a randomized block design, 20 male mithun (6-8 months of age, 152 ± 12.6 kg body weight) were randomly divided into four experimental groups (n = 5/group) and fed experimental diets ad libitum for 180 days. The diet R1 contained tree foliages (TF), R2 comprised of 50% concentrate mixture (CM) and 50% TF, R3 contained 50% CM and 50% rice straw, and R4 contained 50% CM, 25% TF and 25% rice straw. Rumen liquor was collected at 0 and 180 days of the experiment for estimation of different ruminal parameters and a digestion trial was conducted at the end of the experiment. Rumen fluid was analysed for pH, ammonia nitrogen (NH3 -N), total-N, ruminal enzymes, short chain fatty acid (SCFA) and microbial profile. The relative quantification of ruminal microbes was carried out with real-time PCR using bacteria as the house keeping gene. The dry matter intake, nutrients digestibility, body weight gain, NH3 -N, total-N, carboxymethyl cellulase, avicelase, xylanase, amylase, protease and molar proportion of butyrate were (p ecology, nutrient utilization and thus better performance under stall fed system. © 2012 Blackwell Verlag GmbH.

Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki: A preliminary study

Directory of Open Access Journals (Sweden)

M.S. Khairiah

2012-10-01

Full Text Available The Malayan gaur (Bos gaurus hubbacki or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN. The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM and electroejaculation (EEJ technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur.

REVIEW: The Characteristics of Genetic Resource of Bali Cattle (Bos-bibos banteng and the Alternative of It's Conservation Methods

Directory of Open Access Journals (Sweden)

ACHMAD NUR CHAMDI

2005-01-01

Full Text Available Bali cattle is an Indonesian native beef cattle, the result of domestication of Banteng (Bos-bibos banteng. The main problem faced in the development of Bali cattle is the low quality of breed, which is predicted as the effect of inbreeding or raising management. The affects of genetic and cross breeding which usually inflict a loss are the decreasing of cattle’s endurance, fertility and birth weight. Seeing the fact, the government effort to introduce a quality bull to the breed source areas, the determination of cattle release including the controll on the cutting of productive female cattle, and to exactly count the number of Bali cattle which can be released in order to do not disturb its population balance, so it is necessary to do conservation attempt by in-situ and ex-situ. The result of this study shows that the characteristics on genetic resource of Bali cattle which comprises documentation, evaluation on reproduction and production, and attempt in increasing Bali cattle’s genetic quality in Indonesia have been done, eventhough those are still limited.

Microbiota composition, gene pool and its expression in Gir cattle (Bos indicus) rumen under different forage diets using metagenomic and metatranscriptomic approaches.

Science.gov (United States)

Pandit, Ramesh J; Hinsu, Ankit T; Patel, Shriram H; Jakhesara, Subhash J; Koringa, Prakash G; Bruno, Fosso; Psifidi, Androniki; Shah, S V; Joshi, Chaitanya G

2018-03-09

Zebu (Bos indicus) is a domestic cattle species originating from the Indian subcontinent and now widely domesticated on several continents. In this study, we were particularly interested in understanding the functionally active rumen microbiota of an important Zebu breed, the Gir, under different dietary regimes. Metagenomic and metatranscriptomic data were compared at various taxonomic levels to elucidate the differential microbial population and its functional dynamics in Gir cattle rumen under different roughage dietary regimes. Different proportions of roughage rather than the type of roughage (dry or green) modulated microbiome composition and the expression of its gene pool. Fibre degrading bacteria (i.e. Clostridium, Ruminococcus, Eubacterium, Butyrivibrio, Bacillus and Roseburia) were higher in the solid fraction of rumen (Pcomparison of metagenomic shotgun and metatranscriptomic sequencing appeared to be a much richer source of information compared to conventional metagenomic analysis. Copyright © 2018 Elsevier GmbH. All rights reserved.

Effect of shadow availability at pasture on reproductive traits of Nelore bulls (Bos indicus raised in southeastern Brazil

Directory of Open Access Journals (Sweden)

Octavio Fabián Bao Tarragó

2013-12-01

Full Text Available Solar radiation is responsible for bull body temperature elevation. An alternative to minimize heat stress is to use artificial shade. Thus, this study aimed to evaluate the effect of thermal stress reduction, through shade availability, on reproductive characteristics of Nellore bulls (Bos indicus. For this, ten bulls were divided in: Available artificial shade (AS, n = 5 and Unavailable shade (US, n = 5. Each group was kept in two hectare paddocks, in which shade availability for group AS was artificially created. Animals were submitted to a clinical-reproductive evaluation and seminal analyses. No interaction was observed between treatments (AS and US and time (8 collections for all analyzed variables (P>0.05. No significant effect (P > 0.05 of treatment was observed for all parameters analyzed. So, it can be concluded that the absence of shaded areas during summer does not negatively affect reproductive characteristics such as: scrotal circumference, testicular consistency, progressive motility, percentage of rapidly moving cells (Computer Assisted Semen Analysis - CASA, morphology or sperm viability in Nellore bulls raised in southeastern Brazil, considering that results could be different in other regions of the country where average temperature is higher.

Magnetic Resonance Imaging of the Normal Stifle Joint in Buffaloes (Bos Bubalis: An Anatomic Study

Directory of Open Access Journals (Sweden)

Moustafa Samy Sherif

2014-12-01

Full Text Available The aim of the present study was to describe the normal anatomy of the stifle joint in buffaloes (Bos bubalis on magnetic resonance images and related anatomical sectional slices to facilitate the interpretation of all these images, as well as to understand the basis for diseases diagnosis. The hind limbs of ten healthy adult buffaloes (Twenty stifle joints were used. After slaughtering, MR images were made in sagittal, transverse, and dorsal planes. The limbs then were frozen at -20° then correspondingly sectioned using an electric band saw. Clinically relevant anatomic structures were identified and labeled at each level in the corresponding images (MR and anatomic slices. MRI images were used to identify the bony and soft tissue structures of the stifle joint. The articular cartilage appeared with hyperintense signal and separated from the subcondral bone by gray line (moderate signal intensity. It is difficult to differentiate between the synovia, infrapatellar fat body and the articular cartilage because they appeared with hyperintense signal. The meniscial, femoropatellar and cruciate ligaments recognized as moderate signal intensity. However, the collateral and intermediate patellar ligaments, the common tendon of the Mm. extensor digitorum longus and peroneus tertius as well as the menisci and the medial patellar fibrocartilage appeared with hypointense signal. The knowledge of normal anatomy of the buffalo stifle joint would serve as initial reference to the evaluation of MR images in this species.

Obtenção de oócitos e produção in vitro de embriões em doadoras lactantes da raça Gir (Bos taurus indicus)

OpenAIRE

Ferreira, Marcos Brandão Dias [UNESP

2011-01-01

Raças zebuínas (Bos taurus indicus) e seus cruzamentos têm papel fundamental na pecuária brasileira, e a raça Gir, em especial, acrescenta rusticidade e produtividade nas suas descendentes leiteiras. A produção in vitro de embriões bovinos é uma biotécnica de alto valor econômico, que, aliada à utilização de sêmen sexado para cromossoma X, possibilita a multiplicação com fêmeas de valor genético superior. Foram realizados dois experimentos com o objetivo de avaliar a produção in vitro (PIV) d...

Bronchiolitis obliterans syndrome after single-lung transplantation: impact of time to onset on functional pattern and survival.

Science.gov (United States)

Brugière, Olivier; Pessione, Fabienne; Thabut, Gabriel; Mal, Hervé; Jebrak, Gilles; Lesèche, Guy; Fournier, Michel

2002-06-01

Among risk factors for the progression of bronchiolitis obliterans syndrome (BOS) after lung transplantation (LT), the influence of time to BOS onset is not known. The aim of the study was to assess if BOS occurring earlier after LT is associated with worse functional prognosis and worse graft survival. We retrospectively compared functional outcome and survival of all single-LT (SLT) recipients who had BOS develop during follow-up in our center according to time to onset of BOS ( or = 3 years after transplantation). Among the 29 SLT recipients with BOS identified during the study period, 20 patients had early-onset BOS and 9 patients had late-onset BOS. The mean decline of FEV(1) over time during the first 9 months in patients with early-onset BOS was significantly greater than in patients with of late-onset BOS (p = 0.04). At last follow-up, patients with early-onset BOS had a lower mean FEV(1) value (25% vs 39% of predicted, p = 0.004), a lower mean PaO(2) value (54 mm Hg vs 73 mm Hg, p = 0.0005), a lower 6-min walk test distance (241 m vs 414 m, p = 0.001), a higher Medical Research Council index value (3.6 vs 1.6, p = 0.0001), and a higher percentage of oxygen dependency (90% vs 11%, p = 0.001) compared with patients with late-onset BOS. In addition, graft survival of patients with early-onset BOS was significantly lower than that of patients with late-onset BOS (log-rank test, p = 0.04). There were 18 of 20 graft failures (90%) in the early-onset BOS group, directly attributable to BOS in all cases (deaths [n = 10] or retransplantation [n = 8]). In the late-onset BOS group, graft failure occurred in four of nine patients due to death from extrapulmonary causes in three of four cases. The median duration of follow-up after occurrence of BOS was not statistically different between patients with early-onset BOS and patients with late-onset BOS (31 +/- 28 months and 37 +/- 26 months, respectively; p = not significant). The subgroup of patients who had BOS develop

Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

Directory of Open Access Journals (Sweden)

Sergio do Nascimento Kronka

2008-08-01

Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

Recombinant lactoferrin (Lf) of Vechur cow, the critical breed of Bos indicus and the Lf gene variants.

Science.gov (United States)

Anisha, Shashidharan; Bhasker, Salini; Mohankumar, Chinnamma

2012-03-01

Vechur cow, categorized as a critically maintained breed by the FAO, is a unique breed of Bos indicus due to its extremely small size, less fodder intake, adaptability, easy domestication and traditional medicinal property of the milk. Lactoferrin (Lf) is an iron-binding glycoprotein that is found predominantly in the milk of mammals. The full coding region of Lf gene of Vechur cow was cloned, sequenced and expressed in a prokaryotic system. Antibacterial activity of the recombinant Lf showed suppression of bacterial growth. To the best of our knowledge this is the first time that the full coding region of Lf gene of B. indicus Vechur breed is sequenced, successfully expressed in a prokaryotic system and characterized. Comparative analysis of Lf gene sequence of five Vechur cows with B. taurus revealed 15 SNPs in the exon region associated with 11 amino acid substitutions. The amino acid arginine was noticed as a pronounced substitution and the tertiary structure analysis of the BLfV protein confirmed the positions of arginine in the β sheet region, random coil and helix region 1. Based on the recent reports on the nutritional therapies of arginine supplementation for wound healing and for cardiovascular diseases, the higher level of arginine in the lactoferrin protein of Vechur cow milk provides enormous scope for further therapeutic studies. Copyright © 2011 Elsevier B.V. All rights reserved.

Seroprevalence and Risk Factors of Fascioliasis in Yaks, Bos grunniens, from Three Counties of Gansu Province, China.

Science.gov (United States)

Zhang, Xiao-Xuan; Feng, Sheng-Yong; Ma, Jian-Gang; Zheng, Wen-Bin; Yin, Ming-Yang; Qin, Si-Yuan; Zhou, Dong-Hui; Zhao, Quan; Zhu, Xing-Quan

2017-02-01

The aim of this study was to determine the seroprevalence and risk factors of fascioliasis in yaks, Bos grunniens , from 3 counties of Gansu Province in China. A total of 1,584 serum samples, including 974 samples from white yaks from Tianzhu, 464 from black yaks from Maqu, and 146 from black yaks from Luqu County, were collected and analyzed using ELISA to detect IgG antibodies against Fasciola hepatica . The overall F. hepatica seroprevalence was 28.7% (454/1,584), with 29.2% in white yaks (284/974) and 27.9% in black yaks (170/610). The seroprevalence of F. hepatica in yaks from Tianzhu, Luqu, and Maqu was 29.2%, 22.6%, and 29.5%, respectively. Female yaks (30.9%) had higher F. hepatica seroprevalence than male yaks (23.4%). Also, F. hepatica seroprevalence varied by different age group from 24.1% to 33.8%. Further, the seroprevalence ranged from 21.8% to 39.1% over different seasons. Interestingly, the season and age of yaks were associated with F. hepatica infection in yaks in the investigated areas. These findings provided a basis for further studies on this disease in yaks from 3 counties of Gansu Province in northwestern China, which may ultimately support the development of effective control strategies of fascioliasis in these areas.

Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

Directory of Open Access Journals (Sweden)

Rogério Abdallah Curi

2012-02-01

Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

Machine Learning Algorithms Utilizing Quantitative CT Features May Predict Eventual Onset of Bronchiolitis Obliterans Syndrome After Lung Transplantation.

Science.gov (United States)

Barbosa, Eduardo J Mortani; Lanclus, Maarten; Vos, Wim; Van Holsbeke, Cedric; De Backer, William; De Backer, Jan; Lee, James

2018-02-19

Long-term survival after lung transplantation (LTx) is limited by bronchiolitis obliterans syndrome (BOS), defined as a sustained decline in forced expiratory volume in the first second (FEV 1 ) not explained by other causes. We assessed whether machine learning (ML) utilizing quantitative computed tomography (qCT) metrics can predict eventual development of BOS. Paired inspiratory-expiratory CT scans of 71 patients who underwent LTx were analyzed retrospectively (BOS [n = 41] versus non-BOS [n = 30]), using at least two different time points. The BOS cohort experienced a reduction in FEV 1 of >10% compared to baseline FEV 1 post LTx. Multifactor analysis correlated declining FEV 1 with qCT features linked to acute inflammation or BOS onset. Student t test and ML were applied on baseline qCT features to identify lung transplant patients at baseline that eventually developed BOS. The FEV 1 decline in the BOS cohort correlated with an increase in the lung volume (P = .027) and in the central airway volume at functional residual capacity (P = .018), not observed in non-BOS patients, whereas the non-BOS cohort experienced a decrease in the central airway volume at total lung capacity with declining FEV 1 (P = .039). Twenty-three baseline qCT parameters could significantly distinguish between non-BOS patients and eventual BOS developers (P machine), we could identify BOS developers at baseline with an accuracy of 85%, using only three qCT parameters. ML utilizing qCT could discern distinct mechanisms driving FEV 1 decline in BOS and non-BOS LTx patients and predict eventual onset of BOS. This approach may become useful to optimize management of LTx patients. Copyright © 2018 The Association of University Radiologists. Published by Elsevier Inc. All rights reserved.

Withers height of pig - Sus scrofa domestica L. 1758, domestic cow - Bos taurus L. 1758 and sheep - Ovis aries L. 1758 at the “Gornja šuma” archaeological site (Novi Sad

Directory of Open Access Journals (Sweden)

Radmanović Darko P

2016-01-01

Full Text Available In spring 2012, osteological material was collected at the “Gornja Šuma” site (site no. 47, located in the territory of Novi Sad, and it was dated to the early 9th century. The withers heights of pig - Sus scrofa domestica, domestic cow - Bos taurus and sheep - Ovis aries, as the three most dominant species at this archaeological site, were analysed based on the length of bones and according to various authors [Boessneck 1956; Zalkin 1960; Matolcsi 1970; Teichert 1975]. It was determined that in these three species the withers heights mostly corresponded to the data from the Middle Ages.

Isolation, identification and retrospective study of foot-and-mouth disease virus from affected Mithun (Bos frontalis) in north-eastern India.

Science.gov (United States)

Borah, B; Deka, P; Sharma, K; Baro, S; Hazarika, A K; Das, C; Garam, G B; Boro, P; Ltu, K

2018-02-01

Foot-and-mouth disease (FMD) is a contagious disease of cloven-hoofed animals that causes substantial and perpetual economic loss. Apart from the contagious nature of the disease, the FMD virus can establish in a "carrier state" among all cloven-hoofed animals. The Mithun (Bos frontalis), popularly called the "Cattle of Mountain," is found in the geographically isolated, hilly region of north-east India: Arunachal Pradesh, Nagaland, Manipur and Mizoram. Despite the geographical inaccessibility, infection by FMD virus has emerged as the single most devastating disease among Mithun after the eradication of rinderpest from this region. Samples from outbreaks of FMD in Mithun were analysed by sandwich ELISA, multiplex RT-PCR (MRT-PCR) and liquid-phase blocking enzyme-linked immunosorbent assay and isolated in the BHK-21 cell line. The results indicate the presence of FMDV serotype "O." The sequencing and molecular phylogenies have revealed close relationships in the lineage of type "O" isolates from Bangladesh. The findings will provide useful information for further research and development of a sustainable programme for the progressive control of FMD in the Mithun population. © 2017 Blackwell Verlag GmbH.

Altas concentrações de FSH-p na maturação in vitro de oócitos Bos indicus High concentrations of FSH-p on the in vitro maturation of Bos indicus oocytes

Directory of Open Access Journals (Sweden)

Joana D'Arc Rocha Alves

2001-08-01

Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes concentrações de um FSH-p comercial sobre a maturação nuclear de oócitos Bos indicus, clivagem e desenvolvimento in vitro de embriões até estádios de blastocisto. Após seleção e transferência para o meio TCM 199/HEPES suplementado com diferentes concentrações de FSH-p (T1 = 10mg/m ; T2 = 20mg/m ; T3 = 40mg/m, os oócitos foram incubados, durante 24 horas, a 39ºC em atmosfera úmida contendo 5% de CO2. Parte dos oócitos foram retirados para análise da maturação nuclear e os demais foram transferidos para o meio de fecundação (mDM. Após 18 horas de incubação nas mesmas condições atmosféricas mencionadas para os oócitos, os presumíveis zigotos foram distribuídos no meio de desenvolvimento embrionário (KSOM contendo monocamada de células da granulosa. As porcentagens de metáfase II, de clivagem e de blastocisto foram, respectivamente, de 81,8/62,5/17,6% (T1; 55,6/64,0/19,5% (T2 e 50,0/65,0/16,3% (T3. A análise estatística revelou que uma menor porcentagem (P £ 0,05 de oócitos tratados com 20mg/m e 40mg/m de FSH-p alcançou o estádio de metáfase II e que as taxas de clivagem e blastocisto não diferiram (P ³ 0,05 entre os tratamentos. Os resultados permitem concluir que a adição de 20mg/m e 40mg/m de FSH-p ao meio de cultura interfere no processo de maturação nuclear, mas todas as concentrações testadas podem ser utilizadas sem prejuízo aparente para a clivagem e o posterior desenvolvimento embrionário.The aim of this work was to evaluate the efficiency of different concentrations of a commercial FSH-p on the nuclear maturation of Bos indicus oocytes, cleavage and in vitro development of embryos until blastocyst stages. The oocytes were selected and transferred to the maturation medium (TCM 199/25 mM HEPES supplemented with different concentrations of FSH-p (T1 = 10mg/m ; T2 - 20mg/m ; T3 - 40mg/m and after 24 hours of incubation, at 39º

A Critical Care Societies Collaborative Statement: Burnout Syndrome in Critical Care Health-care Professionals. A Call for Action.

Science.gov (United States)

Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

2016-07-01

Burnout syndrome (BOS) occurs in all types of health-care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health-care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health-care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health-care professionals and diminish the harmful consequences of BOS, both for critical care health-care professionals and for patients.

Influencia de la reproducción y calidad de la leche en la rentabilidad de las explotaciones lecheras

OpenAIRE

Rodrigues, A.M.

2013-01-01

Este trabajo pretende presentar algunas ideas que pueden ayudar a mejorar la rentabilidad de las explotaciones lecheras. Entre los factores que determinan la rentabilidad de las explotaciones lecheras se destacan parámetros reproductivos ideales como el intervalo entre partos (365 días), el número de inseminaciones por inseminación artificial fecundante (1,5 a 1,7), la edad de las novillas al primero parto (22 a 24 meses) y la calidad de la leche producida. La existencia de vacas con mastitis...

Development of ELISA-detected anti-HLA antibodies precedes the development of bronchiolitis obliterans syndrome and correlates with progressive decline in pulmonary function after lung transplantation.

Science.gov (United States)

Jaramillo, A; Smith, M A; Phelan, D; Sundaresan, S; Trulock, E P; Lynch, J P; Cooper, J D; Patterson, G A; Mohanakumar, T

1999-04-27

Development of anti-HLA antibodies after lung transplantation (LT) is thought to play an important role in the etiology of bronchiolitis obliterans syndrome (BOS). However, a cause-effect relationship between anti-HLA antibodies and BOS has not been established. This study was conducted to determine the temporal relationship between the development of anti-HLA antibodies and BOS after LT, and to determine the antigenic specificity of the antibodies developed in BOS patients. Sera from 15 BOS+ LT patients and 12 BOS- LT patients were obtained before LT and collected again at 6, 12, 24, 36, and 48 months after LT. Anti-HLA antibodies were detected by the PRA-STAT ELISA system and by complement-dependent cytotoxicity assays. Anti-HLA reactivity was further characterized by flow cytometry and absorption/elution with human platelets. When analyzed by ELISA, 10 of 15 BOS+ patients developed anti-HLA antibodies, whereas 0 of 12 BOS- patients developed anti-HLA antibodies (PELISA after LT can provide an early identification of an important subset of LT patients with an increased risk of developing BOS.

An Official Critical Care Societies Collaborative Statement-Burnout Syndrome in Critical Care Health-care Professionals: A Call for Action.

Science.gov (United States)

Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

2016-07-01

Burnout syndrome (BOS) occurs in all types of health-care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health-care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health-care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health-care professionals and diminish the harmful consequences of BOS, both for critical care health-care professionals and for patients. Copyright © 2016 American College of Chest Physicians. Published by Elsevier Inc. All rights reserved.

Effect of Vitamin E and Polyunsaturated Fatty Acids on Cryopreserved Sperm Quality in Bos taurus Bulls Under Testicular Heat Stress.

Science.gov (United States)

Losano, João D A; Angrimani, Daniel S R; Dalmazzo, Andressa; Rocha, Carolina C; Brito, Maíra M; Perez, Eduardo G A; Tsunoda, Roberta H; Góes, Paola A A; Mendes, Camilla M; Assumpção, Mayra E O A; Barnabe, Valquiria H; Nichi, Marcilio

2018-04-03

Taurine bulls are highly susceptible to heat stress, leading to increased oxidative stress (OS) and impaired sperm viability. Polyunsaturated fatty acids (PUFAs) supplementation can be an alternative to improve semen quality, which also results in more sperm susceptibility to lipid peroxidation. Moreover, this deleterious effect can be exacerbated in animals affected by heat stress. Vitamin E is a key antioxidant that counteracts lipid peroxidation of sperm membrane caused by OS. Thus, combining PUFAs with vitamin E may improve sperm quality. In this context, this study aimed to evaluate the effect of interaction between PUFAs and vitamin E on sperm quality in Bos taurus bulls under testicular heat stress. Sixteen taurine bulls under testicular heat stress were randomly assigned in four groups: Control, Vitamin E, PUFA, and PUFA + Vitamin E. All groups lasted for 60 days. Samples were cryopreserved/thawed and analyzed for motility variables (CASA), membrane and acrosome integrity, mitochondrial activity, susceptibility to oxidative stress, DNA integrity, and sperm-binding capacity. Results showed that vitamin E had a beneficial effect on some sperm characteristics, whereas PUFA supplementation had an adverse effect when the two treatments were evaluated separately. Finally, the association between PUFAs and vitamin E did not improve sperm quality.

Genome sequencing of the extinct Eurasian wild aurochs, Bos primigenius, illuminates the phylogeography and evolution of cattle.

Science.gov (United States)

Park, Stephen D E; Magee, David A; McGettigan, Paul A; Teasdale, Matthew D; Edwards, Ceiridwen J; Lohan, Amanda J; Murphy, Alison; Braud, Martin; Donoghue, Mark T; Liu, Yuan; Chamberlain, Andrew T; Rue-Albrecht, Kévin; Schroeder, Steven; Spillane, Charles; Tai, Shuaishuai; Bradley, Daniel G; Sonstegard, Tad S; Loftus, Brendan J; MacHugh, David E

2015-10-26

Domestication of the now-extinct wild aurochs, Bos primigenius, gave rise to the two major domestic extant cattle taxa, B. taurus and B. indicus. While previous genetic studies have shed some light on the evolutionary relationships between European aurochs and modern cattle, important questions remain unanswered, including the phylogenetic status of aurochs, whether gene flow from aurochs into early domestic populations occurred, and which genomic regions were subject to selection processes during and after domestication. Here, we address these questions using whole-genome sequencing data generated from an approximately 6,750-year-old British aurochs bone and genome sequence data from 81 additional cattle plus genome-wide single nucleotide polymorphism data from a diverse panel of 1,225 modern animals. Phylogenomic analyses place the aurochs as a distinct outgroup to the domestic B. taurus lineage, supporting the predominant Near Eastern origin of European cattle. Conversely, traditional British and Irish breeds share more genetic variants with this aurochs specimen than other European populations, supporting localized gene flow from aurochs into the ancestors of modern British and Irish cattle, perhaps through purposeful restocking by early herders in Britain. Finally, the functions of genes showing evidence for positive selection in B. taurus are enriched for neurobiology, growth, metabolism and immunobiology, suggesting that these biological processes have been important in the domestication of cattle. This work provides important new information regarding the origins and functional evolution of modern cattle, revealing that the interface between early European domestic populations and wild aurochs was significantly more complex than previously thought.

Cost of photovoltaic energy systems as determined by balance-of-system costs

Science.gov (United States)

Rosenblum, L.

1978-01-01

The effect of the balance-of-system (BOS), i.e., the total system less the modules, on photo-voltaic energy system costs is discussed for multikilowatt, flat-plate systems. Present BOS costs are in the range of 10 to 16 dollars per peak watt (1978 dollars). BOS costs represent approximately 50% of total system cost. The possibility of future BOS cost reduction is examined. It is concluded that, given the nature of BOS costs and the lack of comprehensive national effort focussed on cost reduction, it is unlikely that BOS costs will decline greatly in the next several years. This prognosis is contrasted with the expectations of the Department of Energy National Photovoltaic Program goals and pending legislation in the Congress which require a BOS cost reduction of an order of magnitude or more by the mid-1980s.

A Novel Protocol to Assess Acclimation Rate in Bos taurus Heifers during Yard Weaning

Directory of Open Access Journals (Sweden)

Jessica E. Monk

2018-04-01

Full Text Available The speed with which animals acclimate to a new environment could be an important measure of ability to cope with management induced stress. This study developed a measure of acclimation rate in a group of 50 Bos taurus heifers during yard weaning over nine days. We recorded the time and order in which heifers moved through a novel funnel structure into a feeding yard daily. We hypothesised that addition of an obstacle at the entrance would increase the time it took heifers to move through the funnel, but that they would acclimate to the obstacle over a three-day period. The change in latency to move through could then be used as a measure of acclimation rate. We hypothesised that individuals which acclimated to obstacles at a faster rate might display favourable temperament as assessed by flight time. All heifers took longer to move through the funnel after a novel object was introduced, then latency decreased over the following two days while the object was present. This indicates the protocol could be useful for measuring acclimation rate at a group level. Individual acclimation rate variables, measured as change in times and orders of heifers between test days, did not appear to have any consistent relationships with flight time or weight change during or post-weaning (p > 0.05. We concluded that the protocol was inappropriate for assessing acclimation rate at an individual level, due to social effects while testing heifers as a group. Heifers which were consistently one of the first 20 to move through the funnel had a significantly greater average weight 5 and 10 months post-weaning (345 ± 9 kg and 518 ± 10 kg respectively than heifers which were consistently one of the last 20 through the funnel (311 ± 8 kg and 484 ± 8 kg respectively; p < 0.001. This may indicate order of movement through the funnel was related to feeding motivation or another aspect of temperament not reflected by flight time.

Cattle phenotypes can disguise their maternal ancestry.

Science.gov (United States)

Srirattana, Kanokwan; McCosker, Kieren; Schatz, Tim; St John, Justin C

2017-06-26

Cattle are bred for, amongst other factors, specific traits, including parasite resistance and adaptation to climate. However, the influence and inheritance of mitochondrial DNA (mtDNA) are not usually considered in breeding programmes. In this study, we analysed the mtDNA profiles of cattle from Victoria (VIC), southern Australia, which is a temperate climate, and the Northern Territory (NT), the northern part of Australia, which has a tropical climate, to determine if the mtDNA profiles of these cattle are indicative of breed and phenotype, and whether these profiles are appropriate for their environments. A phylogenetic tree of the full mtDNA sequences of different breeds of cattle, which were obtained from the NCBI database, showed that the mtDNA profiles of cattle do not always reflect their phenotype as some cattle with Bos taurus phenotypes had Bos indicus mtDNA, whilst some cattle with Bos indicus phenotypes had Bos taurus mtDNA. Using D-loop sequencing, we were able to contrast the phenotypes and mtDNA profiles from different species of cattle from the 2 distinct cattle breeding regions of Australia. We found that 67 of the 121 cattle with Bos indicus phenotypes from NT (55.4%) had Bos taurus mtDNA. In VIC, 92 of the 225 cattle with Bos taurus phenotypes (40.9%) possessed Bos indicus mtDNA. When focusing on oocytes from cattle with the Bos taurus phenotype in VIC, their respective oocytes with Bos indicus mtDNA had significantly lower levels of mtDNA copy number compared with oocytes possessing Bos taurus mtDNA (P cattle with a Bos taurus phenotype. The phenotype of cattle is not always related to their mtDNA profiles. MtDNA profiles should be considered for breeding programmes as they also influence phenotypic traits and reproductive capacity in terms of oocyte quality.

Exposing Compassion Fatigue and Burnout Syndrome in a Trauma Team: A Qualitative Study.

Science.gov (United States)

Berg, Gina M; Harshbarger, Jenni L; Ahlers-Schmidt, Carolyn R; Lippoldt, Diana

2016-01-01

Compassion fatigue (CF) and burnout syndrome (BOS) are identified in trauma, emergency, and critical care nursing practices. The purpose of this qualitative study was to measure CF and BOS in a trauma team and allow them to share perceptions of related stress triggers and coping strategies. Surveys to measure CF and BOS and a focus group allowed a trauma team (12 practitioners) to share perceptions of related stress triggers and coping strategies. More than half scored at risk for CF and BOS. Stress triggers were described as situation (abuse, age of patient) versus injury-related. Personal coping mechanisms were most often reported. Both CF and BOS can be assessed with a simple survey tool. Strategies for developing a program culturally sensitive to CF and BOS are provided.

Dicty_cDB: Contig-U16181-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

Nonparticipation in Adult Education: From Self-Perceptions to Alternative Explanations

Science.gov (United States)

Porras-Hernandez, Laura Helena; Salinas-Amescua, Bertha

2012-01-01

In this article, the authors propose that dispositional factors do not sufficiently explain nonparticipation in adult education programs. Many nations report low participation rates, but empirical studies have usually been conducted with enrolled adults. This study, however, included 279 poorly educated mestizas and Native women in two regions of…

Chest health surveillance utility in the early detection of bronchiolitis obliterans syndrome in children after allo-SCT.

Science.gov (United States)

Gassas, A; Craig-Barnes, H; Dell, S; Doyle, J; Schechter, T; Sung, L; Egeler, M; Palaniyar, N

2013-06-01

To prospectively assess whether periodic chest health surveillance is beneficial for the early detection of bronchiolitis obliterans syndrome (BOS) in children after allo-SCT. Children up to 18 years of age receiving allo-SCT from September 2009 to September 2011 were included. Surveillance consisted of the following: a 7-item respiratory system questionnaire of cough, wheeze and shortness of breath; focused physical examination; and pulmonary function test (PFT) conducted before SCT and at 1, 3, 6, 9, 12, 18 and 24 months after SCT. Thirty-nine patients were enrolled. Five children developed BOS at a median time of 192 days (range 94-282). Positive response comparisons between the BOS group vs the non-BOS group were NS for history questionnaire (P=0.2), heart rate (P=0.3), respiratory rate (P=0.3) and oxygen saturation monitoring (P=0.8). Differences between the two groups for chest auscultation and PFT were statistically significant (P=0.03 and P=0.01, respectively). However, chest auscultation in the BOS group was only positive after BOS diagnosis. PFT reduction was evident in the asymptomatic phase (BOS group 33%; non-BOS group 4.5%, P=0.01). Changes in PFT, but not history/physical examination, allow the early detection of BOS in children after SCT. Our study is limited by the small sample size.

Effects of 12 hour calf withdrawal on conception rate and calf performance of Bos indicus cattle under extensive conditions.

Science.gov (United States)

Escrivão, R J A; Webb, E C; Garcês, A P J T

2009-01-01

Fifty-two multiparous Brahman type cows with reproductive tract scoring (RTS) >/=4 at 45 days post-partum were randomly assigned to two groups of 26 cows each separated into an ad libitum suckling group (C) and treatment group (T). Calves in the T group were separated for 12 h during the night from 45 days post-partum to the onset of the breeding season. Body condition score (BCS) and body weight (BW) were recorded 45 days post-partum, at the start of the breeding season, and at pregnancy diagnosis. Calves were weighed at calving and weaning. Weaning weights were corrected to 205 days. BW and BCS at the onset of the breeding season were similar (p > 0.05) between the experimental groups. Calving to breeding intervals were 93 +/- 18 d and 99 +/- 22 d for T and C groups, respectively. Calving to conception intervals differed significantly between the groups (111 +/- 10 d for T and 133 +/- 19 d for C) and a similar result was obtained for the breeding to conception intervals (18 +/- 15 d for T and 31 +/- 19 d for C). Conception rates were 80% for the T group and 59% for the C group, which correlated better with BW than BCS at the onset of the breeding season. Weaning weights differed (p conception rates and improves the calf weaning weights of Bos indicus beef cattle under extensive production systems in sub-tropical conditions.

Evidence of solitary chemosensory cells in a large mammal: the diffuse chemosensory system in Bos taurus airways

Science.gov (United States)

Tizzano, Marco; Merigo, Flavia; Sbarbati, Andrea

2006-01-01

The diffuse chemosensory system (DCS) of the respiratory apparatus is composed of solitary chemosensory cells (SCCs) that resemble taste cells but are not organized in end organs. The discovery of the DCS may open up new approaches to respiratory diseases. However, available data on mammalian SCCs have so far been collected from rodents, the airways of which display some differences from those of large mammals. Here we investigated the presence of the DCS and of SCCs in cows and bulls (Bos taurus), in which the airway cytology is similar to that in humans, focusing our attention on detection in the airways of molecules involved in the transduction cascade of taste [i.e. α-gustducin and phospholipase C of the β2 subtype (PLCβ2)]. The aim of the research was to extend our understanding of airway chemoreceptors and to compare the organization of the DCS in a large mammal with that in rodents. Using immunocytochemistry for α-gustducin, the taste buds of the tongue and arytenoid were visualized. In the trachea and bronchi, α-gustducin-immunoreactive SCCs were frequently found. Using immunocytochemistry for PLCβ2, the staining pattern was generally similar to those seen for α-gustducin. Immunoblotting confirmed the expression of α-gustducin in the tongue and in all the airway regions tested. The study demonstrated the presence of SCCs in cows and bulls, suggesting that DCSs are present in many mammalian species. The description of areas with a high density of SCCs in bovine bronchi seems to indicate that the view of the DCS as made up of isolated cells totally devoid of ancillary elements is probably an oversimplification. PMID:16928202

Magnetically frustrated double perovskites: synthesis, structural properties, and magnetic order of Sr{sub 2}BOsO{sub 6} (B = Y, In, Sc)

Energy Technology Data Exchange (ETDEWEB)

Paul, Avijit Kumar; Sarapulova, Angelina; Adler, Peter; Kanungo, Sudipta; Mikhailova, Daria; Schnelle, Walter; Hu, Zhiwei; Kuo, Changyang; Yan, Binghai; Felser, Claudia; Tjeng, Liu Hao [Max-Planck-Institut fuer Chemische Physik fester Stoffe,Dresden (Germany); Reehuis, Manfred [Helmholtz-Zentrum Berlin fuer Materialien und Energie, Berlin (Germany); Siruguri, Vasudeva; Rayaprol, Sudhindra [UGC-DAE Consortium for Scientific Research (CSR), Mumbai Centre, Mumbai (India); Soo, Yunlian [Department of Physics, National Tsing Hua University, Hsinchu (China); Jansen, Martin [Max-Planck-Institut fuer Chemische Physik fester Stoffe,Dresden (Germany); Max-Planck-Institut fuer Festkoerperforschung, Stuttgart (Germany)

2015-02-15

Double perovskites Sr{sub 2}BOsO{sub 6} (B = Y, In, and Sc) were prepared from the respective binary metal oxides, and their structural, magnetic, and electronic properties were investigated. At room temperature all these compounds crystallize in the monoclinic space group P2{sub 1}/n. They contain magnetic osmium (Os{sup 5+}, t{sub 2g}{sup 3}) ions and are antiferromagnetic insulators with Neel temperatures T{sub N} = 53 K, 26 K, and 92 K for B = Y, In, and Sc, respectively. Powder neutron diffraction studies on Sr{sub 2}YOsO{sub 6} and Sr{sub 2}InOsO{sub 6} showed that the crystal structures remain unchanged down to 3 K. The Y and In compounds feature a type I antiferromagnetic spin structure with ordered Os moments of 1.91 μ{sub B} and 1.77 μ{sub B}, respectively. The trend in T{sub N} does not simply follow the development of the lattice parameters, which suggests that d{sup 0} compared to d{sup 10} ions on the B site favor a somewhat different balance of exchange interactions in the frustrated Os{sup 5+} fcc-like lattice. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females.

Science.gov (United States)

Cooke, R F; Bohnert, D W; Cappellozza, B I; Mueller, C J; Delcurto, T

2012-10-01

Two experiments evaluated the effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females. In Exp. 1, 433 multiparous, lactating Angus × Hereford cows were sampled for blood and evaluated for temperament before the breeding season. Cow temperament was assessed by chute score and exit velocity. Chute score was assessed on a 5-point scale according to behavioral responses during chute restraining. Exit score was calculated by dividing exit velocity into quintiles and assigning cows with a score from 1 to 5 (1 = slowest, 5 = fastest cows). Temperament score was calculated by averaging chute and exit scores. Cows were classified for temperament type according to temperament score (≤ 3 = adequate, > 3 = aggressive). Plasma cortisol concentrations were greater (P score (d 10). On d 11, heifers were ranked by these variables and assigned to receive or not (control) an acclimation treatment. Acclimated heifers were processed through a handling facility 3 times weekly for 4 wk (d 11 to 39; Mondays, Wednesdays, and Fridays), whereas control heifers remained undisturbed on pasture. Heifer puberty status, evaluated via plasma progesterone concentrations, was assessed on d 0 and 10, d 40 and 50, 70 and 80, 100 and 110, 130 and 140, 160 and 170, and 190 and 200. Blood samples collected on d 10 and 40 were also analyzed for plasma concentrations of cortisol and haptoglobin. Temperament score was assessed again on d 40 and d 200. Acclimated heifers had reduced (P = 0.01) concentrations of cortisol and haptoglobin on d 40 and reduced (P = 0.02) exit velocity on d 200 compared with control heifers. Puberty was hastened in acclimated heifers compared with control (P = 0.01). Results from this study indicate that B. taurus beef cows with aggressive temperament have impaired reproductive performance compared with cohorts with adequate temperament, whereas acclimation to human handling after weaning hastens reproductive development of

Dampak Program Bantuan Operasional Sekolah (BOSTerhadap Tingkat Putus Sekolah Di Indonesia: Analisis DID

Directory of Open Access Journals (Sweden)

Bayu Kharisma

2013-02-01

Full Text Available This study aims to analyze the impact of school operational assistance (BOS program on the dropout rate of school during the post-rising fuel prices using difference in difference (DID approach. BOS program is a further development of the social safety net programs (JPS education of the government in the period of 1998-2003 and a reduction in fuel subsidy compensation program implemented over 2003-2005. The results showed that the impact of BOS on the dropout rate of students aged 7-15 years, during the period investigated in this study was lower than those who did not receive BOS fund, but it was not statistically significant. Meanwhile, if the account of the research is to be limited to the influence of students aged 16-20 years who had previously received the benefit of  BOS, it shows that BOS program had a positive influence to the dropout rates of school. However, children aged 16-20 years who had not previously received benefits BOS program have negatively affect to the dropout rates of school. Based on this fact, the benefit of the BOS proram following the fuel price hike in Indonesia during the research  period did not seem to be particularly effective in reducing the dropout rates of school.

Emotional Body Odors as Context: Effects on Cardiac and Subjective Responses.

Science.gov (United States)

Ferreira, Jacqueline; Parma, Valentina; Alho, Laura; Silva, Carlos F; Soares, Sandra C

2018-05-23

Many studies have indicated that the chemical cues from body odors (BOs) of donors experiencing negative emotions can influence the psychophysiological and behavioral response of the observers. However, these olfactory cues have been used mainly as contextual information for processing visual stimuli. Here, for the first time, we evaluate how emotional BO affects the emotional tone of a subsequent BO message. Axillary sweat samples were taken from 20 donors in 3 separate sessions while they watched fear, disgust, or neutral videos. In a double-blind experiment, we assessed the cardiac and subjective responses from 69 participants who were either exposed to negative emotional or neutral BOs. Our results showed a reduced cardiac parasympathetic activity (HF%)-indicating increased stress-when participants smelled the emotional BOs before the neutral BOs, compared to when they smelled neutral followed by emotional BOs. The intensity of the neutral odor also increased following the exposure to both negative BOs. These findings indicate that BOs contain an emotion-dependent chemical cue that affects the perceiver both at the physiological and subjective levels.

Acute cellular rejection is a risk factor for bronchiolitis obliterans syndrome independent of post-transplant baseline FEV1

DEFF Research Database (Denmark)

Burton, C.M.; Iversen, M.; Carlsen, J.

2009-01-01

BACKGROUND: Post-transplant baseline forced expiratory volume in 1 second (FEV(1)) constitutes a systematic bias in analyses of bronchiolitis obliterans syndrome (BOS). This retrospective study evaluates risk factors for BOS adjusting for the confounding of post-transplant baseline FEV(1). METHODS......-specific hazard of BOS (hazard ratio 1.4, confidence interval 1.1 to 1.8, p = 0.009). The absolute value of baseline FEV(1) was a significant confounder in all survival and competing risk analyses of BOS (p ... an independent risk factor for the development of BOS after adjusting for the confounding of post-transplant baseline FEV(1) Udgivelsesdato: 2009/9...

Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

NARCIS (Netherlands)

Utsunomiya, Yuri T.; Bomba, Lorenzo; Lucente, Giordana; Colli, Licia; Negrini, Riccardo; Lenstra, Johannes A.; Erhardt, Georg; Garcia, José F.; Ajmone-Marsan, Paolo; Moazami-Goudarzi, K.; Williams, J.; Wiener, P.; Olsaker, I.; Kantanen, J.; Dunner, S.; Cañón, J.; Rodellar, C.; Martín-Burriel, I.; Valentini, A.; Zanotti, M.; Holm, L. E.; Eythorsdottir, E.; Mommens, G.; Polygen, Van Haeringen; Nijman, I. J.; Dolf, G.; Bradley, D. G.

2014-01-01

Background: Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in

Genome-wide identification, classification, and functional analysis of the basic helix-loop-helix transcription factors in the cattle, Bos Taurus.

Science.gov (United States)

Li, Fengmei; Liu, Wuyi

2017-06-01

The basic helix-loop-helix (bHLH) transcription factors (TFs) form a huge superfamily and play crucial roles in many essential developmental, genetic, and physiological-biochemical processes of eukaryotes. In total, 109 putative bHLH TFs were identified and categorized successfully in the genomic databases of cattle, Bos Taurus, after removing redundant sequences and merging genetic isoforms. Through phylogenetic analyses, 105 proteins among these bHLH TFs were classified into 44 families with 46, 25, 14, 3, 13, and 4 members in the high-order groups A, B, C, D, E, and F, respectively. The remaining 4 bHLH proteins were sorted out as 'orphans.' Next, these 109 putative bHLH proteins identified were further characterized as significantly enriched in 524 significant Gene Ontology (GO) annotations (corrected P value ≤ 0.05) and 21 significantly enriched pathways (corrected P value ≤ 0.05) that had been mapped by the web server KOBAS 2.0. Furthermore, 95 bHLH proteins were further screened and analyzed together with two uncharacterized proteins in the STRING online database to reconstruct the protein-protein interaction network of cattle bHLH TFs. Ultimately, 89 bHLH proteins were fully mapped in a network with 67 biological process, 13 molecular functions, 5 KEGG pathways, 12 PFAM protein domains, and 25 INTERPRO classified protein domains and features. These results provide much useful information and a good reference for further functional investigations and updated researches on cattle bHLH TFs.

Structure analysis and laxative effects of oligosaccharides isolated from bananas.

Science.gov (United States)

Wang, Juan; Huang, Hui Hua; Cheng, Yan Feng; Yang, Gong Ming

2012-10-01

Banana oligosaccharides (BOS) were extracted with water, and then separated and purified using column chromatography. Gel penetration chromatography was used to determine the molecular weights. Thin layer chromatogram and capillary electrophoresis were employed to analyze the monosaccharide composition. The indican bond and structure of the BOS molecule were determined using Fourier transform infrared spectroscopy and nuclear magnetic resonance. Results showed that BOS were probably composed of eight β-D-pyran glucose units linked with 1→6 indican bonds. The laxative effects of BOS were investigated in mice using the method described in "Handbook of Technical Standards for Testing and Assessment of Health Food in China." The length of the small intestine over which a carbon suspension solution advanced in mice treated with low-, middle-, and high-dose BOS was significantly greater than that in the model group, suggesting that BOS are effective in accelerating the movement of the small intestine.

Early extracellular matrix changes are associated with later development of bronchiolitis obliterans syndrome after lung transplantation

DEFF Research Database (Denmark)

Müller, Catharina; Andersson-Sjöland, Annika; Schultz, Hans Henrik

2017-01-01

are largely unknown. The aim of this study was to identify potential early changes in the extracellular matrix (ECM) in different compartments of the transplanted lung prior to the development of BOS. Methods: Transbronchial biopsies from a cohort of 58 lung transplantation patients at the Copenhagen...... and immunohistochemistry. Results: A time-specific and compartment-specific pattern of ECM changes was detected. Alveolar total collagen (p=0.0190) and small airway biglycan (p=0.0199) increased between 3 and 12 months after transplantation in patients developing BOS, while collagen type IV (p=0.0124) increased...... in patients without BOS. Patients with early-onset BOS mirrored this increase. Patients developing grade 3 BOS showed distinct ECM changes already at 3 months. Patients with BOS with treated acute rejections displayed reduced alveolar total collagen (p=0.0501) and small airway biglycan (p=0.0485) at 3 months...

Blood Gene Expression Predicts Bronchiolitis Obliterans Syndrome

Directory of Open Access Journals (Sweden)

Richard Danger

2018-01-01

Full Text Available Bronchiolitis obliterans syndrome (BOS, the main manifestation of chronic lung allograft dysfunction, leads to poor long-term survival after lung transplantation. Identifying predictors of BOS is essential to prevent the progression of dysfunction before irreversible damage occurs. By using a large set of 107 samples from lung recipients, we performed microarray gene expression profiling of whole blood to identify early biomarkers of BOS, including samples from 49 patients with stable function for at least 3 years, 32 samples collected at least 6 months before BOS diagnosis (prediction group, and 26 samples at or after BOS diagnosis (diagnosis group. An independent set from 25 lung recipients was used for validation by quantitative PCR (13 stables, 11 in the prediction group, and 8 in the diagnosis group. We identified 50 transcripts differentially expressed between stable and BOS recipients. Three genes, namely POU class 2 associating factor 1 (POU2AF1, T-cell leukemia/lymphoma protein 1A (TCL1A, and B cell lymphocyte kinase, were validated as predictive biomarkers of BOS more than 6 months before diagnosis, with areas under the curve of 0.83, 0.77, and 0.78 respectively. These genes allow stratification based on BOS risk (log-rank test p < 0.01 and are not associated with time posttransplantation. This is the first published large-scale gene expression analysis of blood after lung transplantation. The three-gene blood signature could provide clinicians with new tools to improve follow-up and adapt treatment of patients likely to develop BOS.

INFLUÊNCIA DO GENÓTIPO BOS INDICUS NA ATIVIDADE DE CALPASTATINA E NA TEXTURA DA CARNE DE NOVILHOS ABATIDOS NO SUL DO BRASIL EFFECTS OF THE BOS INDICUS GENOTYPE ON CALPASTATIN ACTIVITIY AND TEXTURE OF BEEF FROM STEERS SLAUGHTERED IN THE SOUTH OF BRAZIL

Directory of Open Access Journals (Sweden)

Jane M. RUBENSAM

1998-10-01

Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non

Biomarkers for the prediction of the bronchiolitis obliterans syndrome after lung transplantation

NARCIS (Netherlands)

Paantjens, A.W.M.

2011-01-01

The main limitation for overall survival after lung transplantation (LTx) is the development of chronic rejection, which is represented by the bronchiolitis obliterans syndrome (BOS). The diagnosis BOS is based on lung function testing, however, it is a surrogate marker. And because BOS is an

Democratizing Academic Writing: A Revision of an Experience of Writing an Autoethnographic Dissertation in Color

Science.gov (United States)

Polanco, Marcela

2013-01-01

In this paper, I revise my experience of writing an autoethnographic (Ellis, 2004) dissertation in the field of family therapy as a Colombian mestiza. I discuss how I grappled with my writing, and, in the process, stumbled into matters of democratizing texts. I problematize male-dominant academic standards, telling of the tensions when maneuvering…

Plenoptic background oriented schlieren imaging

International Nuclear Information System (INIS)

Klemkowsky, Jenna N; Fahringer, Timothy W; Clifford, Christopher J; Thurow, Brian S; Bathel, Brett F

2017-01-01

The combination of the background oriented schlieren (BOS) technique with the unique imaging capabilities of a plenoptic camera, termed plenoptic BOS, is introduced as a new addition to the family of schlieren techniques. Compared to conventional single camera BOS, plenoptic BOS is capable of sampling multiple lines-of-sight simultaneously. Displacements from each line-of-sight are collectively used to build a four-dimensional displacement field, which is a vector function structured similarly to the original light field captured in a raw plenoptic image. The displacement field is used to render focused BOS images, which qualitatively are narrow depth of field slices of the density gradient field. Unlike focused schlieren methods that require manually changing the focal plane during data collection, plenoptic BOS synthetically changes the focal plane position during post-processing, such that all focal planes are captured in a single snapshot. Through two different experiments, this work demonstrates that plenoptic BOS is capable of isolating narrow depth of field features, qualitatively inferring depth, and quantitatively estimating the location of disturbances in 3D space. Such results motivate future work to transition this single-camera technique towards quantitative reconstructions of 3D density fields. (paper)

Evaluation of indirect TaSP enzyme-linked immunosorbent assay for diagnosis of tropical theileriosis in cattle (Bos indicus) and water buffaloes (Bubalus bubalis) in Egypt.

Science.gov (United States)

Mohamed, Amr M; Abdel-Rady, Ahmed; Ahmed, Laila S; El-Hosary, Amira

2012-05-25

The aim of the present study was to evaluate the validity of Theileria annulata surface protein (TaSP)-ELISA, in comparison with traditional microscopic test, for the diagnosis of T. annulata infection among Egyptian baladi cattle (Bos taurus) and water buffaloes (Bubalus bubalis). Molecular confirmation of infection using T. annulata merozoite surface (Tams-1) target amplification by PCR was used as a gold standard. A total of 76 clinically suspected animals including 64 baladi cattle and 12 water buffaloes were investigated in the current study by the three methods. Based on the PCR-confirmed results, the evaluation study revealed higher sensitivity of TaSP-ELISA (72.9% and 75%) as compared to microscopic examination (58.3% and 50%) among cattle and buffaloes, respectively. On the other hand, the specificity of TaSP-ELISA in diagnosis of T. annulata infection was higher (87.5%) in baladi cattle as compared to water buffaloes (37.5%). In conclusion, TaSP-ELISA was shown to be suitable for the diagnosis of T. annulata infection in cattle under field conditions. Copyright © 2011 Elsevier B.V. All rights reserved.

Development of a Multivariate Prediction Model for Early-Onset Bronchiolitis Obliterans Syndrome and Restrictive Allograft Syndrome in Lung Transplantation

Directory of Open Access Journals (Sweden)

Angela Koutsokera

2017-07-01

Full Text Available BackgroundChronic lung allograft dysfunction and its main phenotypes, bronchiolitis obliterans syndrome (BOS and restrictive allograft syndrome (RAS, are major causes of mortality after lung transplantation (LT. RAS and early-onset BOS, developing within 3 years after LT, are associated with particularly inferior clinical outcomes. Prediction models for early-onset BOS and RAS have not been previously described.MethodsLT recipients of the French and Swiss transplant cohorts were eligible for inclusion in the SysCLAD cohort if they were alive with at least 2 years of follow-up but less than 3 years, or if they died or were retransplanted at any time less than 3 years. These patients were assessed for early-onset BOS, RAS, or stable allograft function by an adjudication committee. Baseline characteristics, data on surgery, immunosuppression, and year-1 follow-up were collected. Prediction models for BOS and RAS were developed using multivariate logistic regression and multivariate multinomial analysis.ResultsAmong patients fulfilling the eligibility criteria, we identified 149 stable, 51 BOS, and 30 RAS subjects. The best prediction model for early-onset BOS and RAS included the underlying diagnosis, induction treatment, immunosuppression, and year-1 class II donor-specific antibodies (DSAs. Within this model, class II DSAs were associated with BOS and RAS, whereas pre-LT diagnoses of interstitial lung disease and chronic obstructive pulmonary disease were associated with RAS.ConclusionAlthough these findings need further validation, results indicate that specific baseline and year-1 parameters may serve as predictors of BOS or RAS by 3 years post-LT. Their identification may allow intervention or guide risk stratification, aiming for an individualized patient management approach.

Situación de la violencia de género en comunidades indígenas y mestizas de los municipios de Siuna y Rosita, RAAN

Directory of Open Access Journals (Sweden)

Jacoba Dávila Molina

2012-10-01

Full Text Available Esta investigación se realizó en cuatro comunidades mestizas y una indígena, en los municipios de Siuna y Rosita de la Región Autónoma del Atlántico Norte de Nicaragua en el 2010, la cual aborda la violencia basada en género. La metodología que se utilizó fue cualitativa y recoge las vivencias, percepciones y sentimientos de las mujeres víctimas de violencia y de las instancias encargadas de la atención a estos casos. Para el levantamiento de la información se utilizaron las técnicas de entrevista guiada y observación, las que se aplicaron a los grupos formados por representantes de las instituciones encargadas de hacer justicia, líderes comunitarios y mujeres víctimas de la violencia.Los resultados muestran que  existen mujeres en el área rural afectadas en sus derechos y deberes, que merecen una atención  especial por parte de las instancias competentes, y que en su estado de vulnerabilidad no afrontan la situación de manera adecuada dado que este tipo de acontecimiento, que pone en riesgo su integridad física y moral, donde prevalece la violencia psicológica,  seguida de la violencia física, económica  y sexual, es aceptada hasta el punto de convertirse en su propia manera de vivir. En la investigación se identificaron dos rutas críticas  a donde la minoría de mujeres entrevistadas ha acudido. Se cuenta con instituciones que brindan atención especializada a las mujeres; sin embargo, no se dispone del apoyo de la sociedad, hay carencia de recursos económicos y humanos para dar respuesta  de manera beligerantes a esta problemática.SummaryThis research is related to violence based on gender, and it was conducted in four mestizo communities and one indigenous community, from the municipalities of Siuna and Rosita in the North Autonomous Atlantic Region of Nicaragua in the year 2010. The methodology used was qualitative and it reflects the experiences, perceptions and feelings of women victims of violence and the

Indicadores metabólicos en razas lecheras especializadas en condiciones tropicales en Colombia Metabolic profile in dairy cows under tropical conditions in Colombia

Directory of Open Access Journals (Sweden)

Rómulo Campos G

2007-06-01

Full Text Available Se ha seleccionado un alto número de razas bovinas para producción de leche, sin embargo, las de origen Bos taurus no han logrado adaptarse a las condiciones tropicales. El objetivo del trabajo fue analizar el comportamiento metabólico de siete razas (Ayrshire, Girolando, Holstein Friesian, Jersey, Lucerna, Pardo Suizo y Simenthal a través de 15 metabolitos. Se emplearon 28 animales por raza, distribuidos en cuatro grupos fisiológicos: novillas, inicio y final de lactancia y vacas secas (final de gestación. Los valores medios de los indicadores metabólicos fueron: BOH 0.5 mmol/l; glucosa 2.8 mmol/l; colesterol 2.5 mmol/l; potasio 4.1 mmol/l; calcio 2.0 mmol/l; fósforo inorgánico 1.7 mmol/l; magnesio 1.1 mmol/l; proteínas totales 66.2 mg/dl; albúmina 25.8 mg/dl; globulinas 40.2 mg/dl; creatinina 109 µmol/l; BUN 3.8 mmol/l; ALT 32.2 UI/l; AST 56.6 UI/l; GGT 12.3 UI/l; bilirrubina total 0.2 µmol/l; bilirrubina conjugada 0.08 µmol/l. Los valores medios de la condición corporal y el hematocrito fueron 3.25% y 27.0% respectivamente. Se encontraron diferencias estadísticas significativas entre grupos raciales y entre grupos de producción. Los animales de menor peso metabólico (Jersey presentaron mejor homeostasis que los de pesos mayores (Simenthal, Holstein.High numbers of bovine breeds have been selected as milk producers, but those derived from the Bos taurus breeds have been unable to adapt to tropical conditions. The aim of this work was to analyze the metabolic profile of the seven breeds (Ayrshire, Girolando, Holstein Friesian, Jersey , Lucerna, Brown Swiss and Simmental through the use of 15 metabolites. For each breed, 28 animals were used, divided into four physiological different groups: heifers, cows from the first stages and last stages of the lactation process and dry cows. The mean values of metabolites indicators were as follow: BOH 0.5 mmol/l; glucose 2.8 mmol/l; cholesterol 2.5 mmol/l; potassium 4.1 mmol/l; calcium 2

Metabolic profile in dairy cows under tropical Indicadores metabólicos en razas lecheras especializadas en condiciones tropicales en Colombia

Directory of Open Access Journals (Sweden)

Campos G. Rómulo

2007-06-01

Full Text Available High numbers of bovine breeds have been selected as milk producers, but those derived from the Bos taurus breeds have been unable to adapt to tropical conditions. The aim of this work was to analyze the metabolic profile of the seven breeds (Ayrshire, Girolando, Holstein Friesian, Jersey, Lucerna, Brown Swiss and Simmental through the use of 15 metabolites. For each breed, 28 animals were used, divided into four physiological different groups: heifers, cows from the first stages and last stages of the lactation process and dry cows. The mean values of metabolites indicators were as follow: BOH 0.5 mmol/l; glucose 2.8 mmol/l; cholesterol 2.5 mmol/l; potassium 4.1 mmol/l; calcium 2.0 mmol/l; inorganic phosphorus 1.7 mmol/l; magnesium 1.1 mmol/l; total protein 66.2 mg/dl; albumin 25.8 mg/dl; globulin 40.2 mg/dl; creatinine 109 µmol/l; BUN 3.8 mmol/l; ALT 32.2 UI/l; AST 56.6 UI/l; GGT 12.3 UI/l; total bilirubin 0.2 µmol/L; conjugate bilirubin Additionally, body condition and PCV were determined with average values of 3.25 and 27% respectively. A significant statistical difference was found among breeding groups and physiological groups for production. It was observed that those animals with a low metabolic weight (Jersey demonstrate better homeostasis than those of high metabolic weight (Simmental, Holstein.Se ha seleccionado un alto número de razas bovinas para producción de leche, sin embargo, las de origen Bos taurus no han logrado adaptarse a las condiciones tropicales. El objetivo del trabajo fue analizar el comportamiento metabólico de siete razas (Ayrshire, Girolando, Holstein Friesian, Jersey, Lucerna, Pardo Suizo y Simenthal a través de 15 metabolitos. Se emplearon 28 animales por raza, distribuidos en cuatro grupos fisiológicos: novillas, inicio y final de lactancia y vacas secas (final de gestación. Los valores medios de los indicadores metabólicos fueron: BOH 0.5 mmol/l; glucosa 2.8 mmol/l; colesterol 2.5 mmol/l; potasio 4

A clone-free, single molecule map of the domestic cow (Bos taurus) genome.

Science.gov (United States)

Zhou, Shiguo; Goldstein, Steve; Place, Michael; Bechner, Michael; Patino, Diego; Potamousis, Konstantinos; Ravindran, Prabu; Pape, Louise; Rincon, Gonzalo; Hernandez-Ortiz, Juan; Medrano, Juan F; Schwartz, David C

2015-08-28

The cattle (Bos taurus) genome was originally selected for sequencing due to its economic importance and unique biology as a model organism for understanding other ruminants, or mammals. Currently, there are two cattle genome sequence assemblies (UMD3.1 and Btau4.6) from groups using dissimilar assembly algorithms, which were complemented by genetic and physical map resources. However, past comparisons between these assemblies revealed substantial differences. Consequently, such discordances have engendered ambiguities when using reference sequence data, impacting genomic studies in cattle and motivating construction of a new optical map resource--BtOM1.0--to guide comparisons and improvements to the current sequence builds. Accordingly, our comprehensive comparisons of BtOM1.0 against the UMD3.1 and Btau4.6 sequence builds tabulate large-to-immediate scale discordances requiring mediation. The optical map, BtOM1.0, spanning the B. taurus genome (Hereford breed, L1 Dominette 01449) was assembled from an optical map dataset consisting of 2,973,315 (439 X; raw dataset size before assembly) single molecule optical maps (Rmaps; 1 Rmap = 1 restriction mapped DNA molecule) generated by the Optical Mapping System. The BamHI map spans 2,575.30 Mb and comprises 78 optical contigs assembled by a combination of iterative (using the reference sequence: UMD3.1) and de novo assembly techniques. BtOM1.0 is a high-resolution physical map featuring an average restriction fragment size of 8.91 Kb. Comparisons of BtOM1.0 vs. UMD3.1, or Btau4.6, revealed that Btau4.6 presented far more discordances (7,463) vs. UMD3.1 (4,754). Overall, we found that Btau4.6 presented almost double the number of discordances than UMD3.1 across most of the 6 categories of sequence vs. map discrepancies, which are: COMPLEX (misassembly), DELs (extraneous sequences), INSs (missing sequences), ITs (Inverted/Translocated sequences), ECs (extra restriction cuts) and MCs (missing restriction cuts

[Burnout syndrome in pre-hospital and hospital emergency. Cognitive study in two cohorts of nurses].

Science.gov (United States)

Cicchitti, Chiara; Cannizzaro, Giorgia; Rosi, Fabrizio; Maccaroni, Roberto; Menditto, Vincenzo G

2014-01-01

Burnout syndrome (BOS) associated with stress has been documented in health care professionals in many specialties. The emergency department and the pre-hospital healthcare services are highly stressful environments. Little is known about the BOS in critical care nursing staff. The objective of the study is to compare the incidence of BOS and its three domains, namely, emotional exhaustion, depersonalization and reduced professional accomplishment, in two cohorts of critical care nurses: a pre-hospital and a hospital emergency service. A survey using a questionnaire (the Maslach Burnout Inventory-General Survey, MBI-GS), among nurses of two Italian emergency services has been performed: a hospital emergency service (HES, Emergency Department or "Pronto Soccorso") and a pre-hospital emergency service (PHES, territorial healthcare service or "Centrale Operativa 118"). All 60 nurses surveyed (82% female) filled the questionnaires. BOS-related symptoms have been identified in at least 50% of the nurses in the HES: 50% suffered a medium-high emotional exhaustion, 75% had a medium-high depersonalization and 92.5% had a medium-high reduced professional accomplishment. Among the PEHS nurses, BOS-related symptoms have been identified in at least 60% of the respondents: 60% had a medium-high emotional exhaustion, 70% had a medium-high depersonalization and 95% had a medium-high reduced professional accomplishment. Moreover, the likelihood that a nurse has a severe BOS, that is at least one degree of high burnout or ≥2 degrees of medium burnout, is significantly higher in the group of the PHES than in the HES (90% vs 60%, p nursing staff had a severe BOS. The incidence of BOS appeared to be similar among PHES and HES nurses with a higher trend for the former. Further interventional studies are needed to investigate the determinants of BOS among critical care nurses and the potentially preventive strategies.

Experimental Evaluation of Processing Time for the Synchronization of XML-Based Business Objects

Science.gov (United States)

Ameling, Michael; Wolf, Bernhard; Springer, Thomas; Schill, Alexander

Business objects (BOs) are data containers for complex data structures used in business applications such as Supply Chain Management and Customer Relationship Management. Due to the replication of application logic, multiple copies of BOs are created which have to be synchronized and updated. This is a complex and time consuming task because BOs rigorously vary in their structure according to the distribution, number and size of elements. Since BOs are internally represented as XML documents, the parsing of XML is one major cost factor which has to be considered for minimizing the processing time during synchronization. The prediction of the parsing time for BOs is an significant property for the selection of an efficient synchronization mechanism. In this paper, we present a method to evaluate the influence of the structure of BOs on their parsing time. The results of our experimental evaluation incorporating four different XML parsers examine the dependencies between the distribution of elements and the parsing time. Finally, a general cost model will be validated and simplified according to the results of the experimental setup.

Influencia de la condición corporal de novillas Mambí al parto en el comportamiento reproductivo posparto Influence of the body condition of Mambí heifers at parturition on the postpartum reproductive performance

Directory of Open Access Journals (Sweden)

O López

2007-06-01

Full Text Available Se estudiaron 105 hembras Mambí en un sistema silvopastoril multiasociado, en la vaquería 066 de la Empresa Pecuaria Genética de Matanzas, con el objetivo de evaluar la influencia de la condición corporal de las novillas al parto en el comportamiento reproductivo posparto. El área de la unidad es de 47 ha, de las cuales 42 ha se dedicaron al pastoreo, divididas en 37 cuartones, y las 5 ha restantes se utilizaron para la producción de forraje de caña de azúcar. La carga fue de 1,7 vacas/ha. Se monitoreó la condición corporal (CC de las hembras al parto, se estimó el peso vivo de los animales, se calculó el balance alimentario para las vacas con nueve meses de gestación y se determinaron los indicadores reproductivos. Se encontró una ligera deficiencia de energía de un 5% solo en la época poco lluviosa, mientras que hubo exceso de proteína bruta, calcio y fósforo en ambas épocas del año. La CC de las vacas al parto estuvo por encima de 3 en todos los bimestres del año, con el mayor valor en julio-agosto (3,5 y el menor en mayo-junio (3,1; además, en las dos épocas la CC promedio de los animales fue similar (3,3. El peso de los terneros al nacer no presentó diferencias para los distintos rangos de CC y estuvo entre 36,5 y 38,7 kg/animal. Las vacas que parieron con 2,5 de CC presentaron un intervalo parto-primer servicio (PA total of 105 Mambí heifers were studied in a multi-associated silvopastoral system, in the dairy 066 of the Livestock Genetic Firm of Matanzas, with the objective of evaluating the influence of the body condition of the heifers at parturition on the postpartum reproductive performance. The area of the unit is 47 ha, of which 42 ha were dedicated to grazing, divided into 37 paddocks, and the other 5 were used for forage production from sugarcane. The stocking rate was 1,7 cows/ha. The body condition (BC of the heifers at parturition was monitored, the live weight of the animals was estimated, the feeding

UCP Mainport : kontseptuaalne uurimus Utrechti raudteejaama maa-ala arendamiseks = UCP Mainport : concept study redevelopment station area Utrecht

Index Scriptorium Estoniae

2000-01-01

Mainporti projekti arhitekt Ben van Berkel, projekteerijad: Van Berkel & Bos, Holland Railconsult. Projekti II etapis uuriti Hoog Catherijne ostukeskuse laiendamist. Projekteerijad: Van Berkel & Bos, Neutelings & Riedijk, Alsop & Störmer.Van Berkel & Bos (arhitektibüroo, Holland). Holland Railconsult (projekteerimisbüroo, Utrecht). Alsop & Störmer (arhitektibüroo, London). Neutelings & Riedijk (arhitektibüroo, Rotterdam)

Valle de México, 2000

Directory of Open Access Journals (Sweden)

Héctor Hiram Hernández Bringas

2006-01-01

y, por supuesto, presentan peores niveles de vida que la población mestiza o no indígena. Se plantea aquí hacer visibles sus montos, particularidades y características, mismas que se comparan a cada paso con las de los no indígenas para presentar una visión de su situación en la actualidad

Protection against bronchiolitis obliterans syndrome is associated with allograft CCR7+ CD45RA- T regulatory cells.

Directory of Open Access Journals (Sweden)

Aric L Gregson

2010-06-01

Full Text Available Bronchiolitis obliterans syndrome (BOS is the major obstacle to long-term survival after lung transplantation, yet markers for early detection and intervention are currently lacking. Given the role of regulatory T cells (Treg in modulation of immunity, we hypothesized that frequencies of Treg in bronchoalveolar lavage fluid (BALF after lung transplantation would predict subsequent development of BOS. Seventy BALF specimens obtained from 47 lung transplant recipients were analyzed for Treg lymphocyte subsets by flow cytometry, in parallel with ELISA measurements of chemokines. Allograft biopsy tissue was stained for chemokines of interest. Treg were essentially all CD45RA(-, and total Treg frequency did not correlate to BOS outcome. The majority of Treg were CCR4(+ and CD103(- and neither of these subsets correlated to risk for BOS. In contrast, higher percentages of CCR7(+ Treg correlated to reduced risk of BOS. Additionally, the CCR7 ligand CCL21 correlated with CCR7(+ Treg frequency and inversely with BOS. Higher frequencies of CCR7(+ CD3(+CD4(+CD25(hiFoxp3(+CD45RA(- lymphocytes in lung allografts is associated with protection against subsequent development of BOS, suggesting that this subset of putative Treg may down-modulate alloimmunity. CCL21 may be pivotal for the recruitment of this distinct subset to the lung allograft and thereby decrease the risk for chronic rejection.

in silico identification of cross affinity towards Cry1Ac pesticidal protein with receptor enzyme in Bos taurus and sequence, structure analysis of crystal proteins for stability.

Science.gov (United States)

Ebenezer, King Solomon; Nachimuthu, Ramesh; Thiagarajan, Prabha; Velu, Rajesh Kannan

2013-01-01

Any novel protein introduced into the GM crops need to be evaluated for cross affinity on living organisms. Many researchers are currently focusing on the impact of Bacillus thuringiensis cotton on soil and microbial diversity by field experiments. In spite of this, in silico approach might be helpful to elucidate the impact of cry genes. The crystal a protein which was produced by Bt at the time of sporulation has been used as a biological pesticide to target the insectivorous pests like Cry1Ac for Helicoverpa armigera and Cry2Ab for Spodoptera sp. and Heliothis sp. Here, we present the comprehensive in silico analysis of Cry1Ac and Cry2Ab proteins with available in silico tools, databases and docking servers. Molecular docking of Cry1Ac with procarboxypeptidase from Helicoverpa armigera and Cry1Ac with Leucine aminopeptidase from Bos taurus has showed the 125(th) amino acid position to be the preference site of Cry1Ac protein. The structures were compared with each other and it showed 5% of similarity. The cross affinity of this toxin that have confirmed the earlier reports of ill effects of Bt cotton consumed by cattle.

Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

Directory of Open Access Journals (Sweden)

Norberto Villa-Duque

2016-01-01

Full Text Available En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander. El estudio consistió en someter pajillas comerciales de 0.5 ml de toros Holstein y Pardo Suizo a la técnica convencional y a tres modificaciones de esta (injurias mediante un diseño randomizado. Ninguna de las fincas evaluadas aplicó correctamente la práctica de la inseminación artificial; errores notorios fueron: exceso de tiempo durante la extracción de la pajilla, descongelación en la región axilar y no combinación correcta entre tiempo y temperatura. Los resultados evidenciaron diferencia significativa (P<0.05 por efecto de la raza para la integridad y resistencia de las membranas espermáticas, para la integridad de las membranas por efecto de los tratamientos cuando la pajilla se descongelo a temperatura corporal en la región axilar y para la integridad de la membrana acrosomal cuando la extracción de la pajilla se realizó en forma incorrecta. El semen de la raza Holstein evidencia una ligera tendencia a ser más resistente que el de la raza Pardo Suizo.

Burnout syndrome in critical care team members: A monocentric cross sectional survey.

Science.gov (United States)

Malaquin, Stéphanie; Mahjoub, Yazine; Musi, Arianna; Zogheib, Elie; Salomon, Alexis; Guilbart, Mathieu; Dupont, Hervé

2017-08-01

There has been a growing interest in evaluating the occurrence of burnout syndrome (BOS) among intensive care units (ICU) team over recent years. The aims of this study were to determine the prevalence of BOS among staff working in the Amiens University Hospital and to assess associated factors. Prospective observational study based on self-administered questionnaires filled in by physicians and non-physicians working in 3 ICUs. Demographic data, well-being assessment, work relationships, level of BOS and depressive symptoms were investigated. Logistic regression analysis was performed to identify variables independently associated with BOS. One hundred and sixty-one questionnaires were analysed. Participation rate was 90%. Thirty-two respondents were physicians and 129 were non-physicians. The prevalence of BOS was 51% and was not significantly different between physicians and non-physicians (56% versus 50%; P=0.501). Respondents who reported BOS less frequently had regular leisure activities (54 [66%] versus 70 [87%], P=0.001). In the BOS group, well-being was significantly lower (4.8±2.5/10 versus 6±2/10, P=0.001), a desire to leave the job was more frequently expressed (50 [61%] versus 32 [40%], P=0.009) and depressive symptoms were significantly more frequent (41 [50%] versus 21 [27%], P=0.002). Factors independently associated with BOS were regular leisure activities (OR 0.24 [0.1-0.59]; P=0.002), the presence of depressive symptoms (OR 2.71 [1.26-5.84]; P=0.011) and a well-being visual analogue scale≥5 (OR 0.40 [0.18-0.89]; P=0.024). BOS affects all ICU workers and is determined by multiple factors. Leisure activities and measures designed to improve well-being should be promoted. Copyright © 2016 Société française d'anesthésie et de réanimation (Sfar). Published by Elsevier Masson SAS. All rights reserved.

DIVERSIDAD GENÉTICA ENTRE SUBPOBLACIONES RACIALES BOVINAS DE COSTA RICA

Directory of Open Access Journals (Sweden)

Marco Martínez

2015-01-01

Full Text Available El objetivo del estudio fue cuantificar la diversidad genética entre 16 subpoblaciones raciales bovinas de Costa Rica, con base en 1412 muestras de ADN bovino de todo el país, evaluadas mediante 18 marcadores microsatélites. El número promedio de alelos (Na por locus dentro de raza fue de 10,3, que varían entre 8 (Holstein×Jersey y 13 (Criolla para doble propósito. El número promedio de alelos efectivo (Ne fue de 5,04, con cambios entre 4,18 (Jersey y 5,64 (Bos taurus×Bos indicus. La heterocigosidad observada promedio fue de 0,77, variando entre 0,73 (Jersey y 0,81 (Bos taurus×Bos indicus. La heterocigosidad esperada (He promedio fue de 0,78, que oscilan entre 0,74 (Jersey y Holstein×Jersey y 0,81 (Bos taurus×Bos indicus, Criolla para doble propósito y Cruces para doble propósito. El contenido de información polimórfica (PIC fue de 0,76, con variaciones entre 0,71 (Jersey y Holstein×Jersey y 0,79 (Criollas para doble propósito y Cruces para doble propósito. El FIS promedio fue de 0,02, con oscilaciones entre -0,03 (Holstein×Jersey a 0,04 (Brahman, Criolla para carne y Cruces para leche. La desviación del equilibrio Hardy Weinberg no fue significativa (p>0,05 en la mayoría de los loci para las subpoblaciones raciales. El subgrupo con mayor número de loci en desequilibrio fue Jersey (8 loci, mientras que los subgrupos Bos taurus×Bos indicus, Criolla para leche y Holstein×Jersey presentaron solo 1 locus en desequilibrio. Los índices de fijación FIS (0,02, FIT (0,05 y FST (0,03 indicaron cierta tendencia hacia la homocigosidad. Los dendrogramas mostraron 3 agrupaciones raciales claramente diferenciadas que coinciden con las razas de origen Bos taurus, Bos indicus y sus respectivos cruces. Los resultados del análisis indicaron que el número de microsatélites empleados sí permitió establecer una discriminación clara a nivel de las frecuencias alélicas y en la distribución del tamaño de los alelos entre las

Biochemical polymorphism in Egyptian Baladi cattle and their relationship with other breeds.

Science.gov (United States)

Graml, R; Ohmayer, G; Pirchner, F; Erhard, L; Buchberger, J; Mostageer, A

1986-01-01

Gene frequencies were estimated in a sample of Baladi cattle for milk proteins, blood proteins and blood groups. Gene frequency estimates of Bos taurus, Bos indicus and Sanga breeds were assembled from the literature. The gene frequencies were utilized for estimating the genetic distance between the breeds and breed groups. The Egyptian Baladi cattle appeared to be closer to Bos taurus breeds than to the Sanga. They are far removed from Zebus.

Comparison of 37 months global net radiation flux derived from PICARD-BOS over the same period observations of CERES and ARGO

Science.gov (United States)

Zhu, Ping; Wild, Martin

2016-04-01

The absolute level of the global net radiation flux (NRF) is fixed at the level of [0.5-1.0] Wm-2 based on the ocean heat content measurements [1]. The space derived global NRF is at the same order of magnitude than the ocean [2]. Considering the atmosphere has a negligible effects on the global NRF determination, the surface global NRF is consistent with the values determined from space [3]. Instead of studying the absolute level of the global NRF, we focus on the interannual variation of global net radiation flux, which were derived from the PICARD-BOS experiment and its comparison with values over the same period but obtained from the NASA-CERES system and inferred from the ocean heat content survey by ARGO network. [1] Allan, Richard P., Chunlei Liu, Norman G. Loeb, Matthew D. Palmer, Malcolm Roberts, Doug Smith, and Pier-Luigi Vidale (2014), Changes in global net radiative imbalance 1985-2012, Geophysical Research Letters, 41 (no.15), 5588-5597. [2] Loeb, Norman G., John M. Lyman, Gregory C. Johnson, Richard P. Allan, David R. Doelling, Takmeng Wong, Brian J. Soden, and Graeme L. Stephens (2012), Observed changes in top-of-the-atmosphere radiation and upper-ocean heating consistent within uncertainty, Nature Geoscience, 5 (no.2), 110-113. [3] Wild, Martin, Doris Folini, Maria Z. Hakuba, Christoph Schar, Sonia I. Seneviratne, Seiji Kato, David Rutan, Christof Ammann, Eric F. Wood, and Gert Konig-Langlo (2015), the energy balance over land and oceans: an assessment based on direct observations and CMIP5 climate models, Climate Dynamics, 44 (no.11-12), 3393-3429.

ORF Alignment: NT_033779 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available rEMBL::g2674107:GUANINE NUCLEOTIDE-EXCHANGE ... PROTEIN. organism:BOS TAURUS (BOVINE). dbxref:GenBank...; ... AF023451; g2674107; -.'', species:''BOS TAURUS ... Length = 185 ... Query: 586 METGIELFNRKP

An international ISHLT/ATS/ERS clinical practice guideline:

DEFF Research Database (Denmark)

Meyer, Keith C; Raghu, Ganesh; Verleden, Geert M

2014-01-01

Bronchiolitis obliterans syndrome (BOS) is a major complication of lung transplantation that is associated with poor survival. The International Society for Heart and Lung Transplantation, American Thoracic Society, and European Respiratory Society convened a committee of international experts...... to March, 2013. The expert committee discussed the available research evidence upon which the updated definition of BOS, identified risk factors and recommendations are based. The committee followed the GRADE (Grading of Recommendation, Assessment, Development and Evaluation) approach to develop specific......, and several risk factors have been identified that have a significant association with the onset of BOS. Currently available therapies have not been proven to result in significant benefit in the prevention or treatment of BOS. Adequately designed and executed randomised controlled trials that properly...

Vitamin D level and peculiarities of IFN-γ and IL-4 production in young children with recurrent broncho-obstructive syndrome

Directory of Open Access Journals (Sweden)

Yu.K. Bolbot

2018-02-01

Full Text Available Background. Broncho-obstructive syndrome (BOS, particularly, its recurrent course in young children, is an important question of modern pediatrics. The burdened allergic history, manifestations of atopy are traditionally considered as risk factors for recurrent episodes of BOS, which, however, are not present in all cases. Recently, the possible role of vitamin D (VD in susceptibility to recurrent episodes of BOS is discussed due to its anti-infective effect that is provided by activating immune mechanisms. Thus, purpose of the research was to study VD level and peculiarities of interferon gamma (INF-g and interleukin (IL 4 production in the blood serum of young children with recurrent episodes of BOS. Materials and methods. 120 children aged 6 months to 3 years with a clinical diagnosis of acute obstructive bronchitis (J20 were examined, they were divided into two groups (group I — 60 patients with episodic BOS, group II — 60 children with recurrent BOS. The control group consisted of 30 clinically healthy children from 6 months to 3 years old. All patients were evaluated for anamnestic data, including the level of insolation, the severity of BOS according to a 12-point scoring scale, general clinical examination, pulse oximetry, and the asthma predictive index (API was calculated. Laboratory studies included determination of 25-hydroxyvitamin-D (25(OHD concentration in the blood serum on days 2 and 3 of the disease using an electrochemiluminescence method on the Cobas e411 analyzer (serial number 1041-24, manufactured by Roche Diagnostics GmbH, Germany, serum concentrations of IFN-g, IL-4 by enzyme-linked immunosorbent assay method using IFA-Best sets (manufactured by Vector-Best, Russian Federation and total calcium (Ca according to the generally accepted method. Nonparametric statistical criteria were used in the analysis of the obtained data. The difference between the compared indicators was considered to be significant at a rate of p

Bronchiolitis obliterans syndrome after allogeneic hematopoietic SCT: phenotypes and prognosis.

Science.gov (United States)

Bergeron, A; Godet, C; Chevret, S; Lorillon, G; Peffault de Latour, R; de Revel, T; Robin, M; Ribaud, P; Socié, G; Tazi, A

2013-06-01

Bronchiolitis obliterans syndrome (BOS) after allogeneic hematopoietic SCT (HSCT) is recognized as a new-onset obstructive lung defect (OLD) in pulmonary function testing and is related to pulmonary chronic GVHD. Little is known about the different phenotypes of patients with BOS and their outcomes. We reviewed the data of all allogeneic HSCT recipients referred to our pulmonary department for a non-infectious bronchial disease between 1999 and 2010. We identified 103 patients (BOS (n=77), asthma (n=11) and chronic bronchitis (n=15)). In patients with BOS, we identified two functional phenotypes: a typical OLD, that is, forced expiratory volume in 1 s (FEV1)/forced vital capacity (FVC) ratio <0.7 (n=53), and an atypical OLD with a concomitant decrease in the FEV1 <80% and FVC <80% predicted with a normal total lung capacity (n=24). The typical OLD was characterized by more severe FEV1 and fewer centrilobular nodules on the computed tomography scan. The FEV1 was not significantly affected during the follow-up, regardless of the phenotype. In addition to acute and extensive chronic GVHD, only the occurrence of BOS soon after transplantation and the intentional treatment of BOS with steroids were associated with a poor survival. The determination of patient subgroups should be explored to improve the management of this condition.

Low-dose computed tomography volumetry for subtyping chronic lung allograft dysfunction.

Science.gov (United States)

Saito, Tomohito; Horie, Miho; Sato, Masaaki; Nakajima, Daisuke; Shoushtarizadeh, Hassan; Binnie, Matthew; Azad, Sassan; Hwang, David M; Machuca, Tiago N; Waddell, Thomas K; Singer, Lianne G; Cypel, Marcelo; Liu, Mingyao; Paul, Narinder S; Keshavjee, Shaf

2016-01-01

The long-term success of lung transplantation is challenged by the development of chronic lung allograft dysfunction (CLAD) and its distinct subtypes of bronchiolitis obliterans syndrome (BOS) and restrictive allograft syndrome (RAS). However, the current diagnostic criteria for CLAD subtypes rely on total lung capacity (TLC), which is not always measured during routine post-transplant assessment. Our aim was to investigate the utility of low-dose 3-dimensional computed tomography (CT) lung volumetry for differentiating RAS from BOS. This study was a retrospective evaluation of 63 patients who had developed CLAD after bilateral lung or heart‒lung transplantation between 2006 and 2011, including 44 BOS and 19 RAS cases. Median post-transplant follow-up was 65 months in BOS and 27 months in RAS. The median interval between baseline and the disease-onset time-point for CT volumetry was 11 months in both BOS and RAS. Chronologic changes and diagnostic accuracy of CT lung volume (measured as percent of baseline) were investigated. RAS showed a significant decrease in CT lung volume at disease onset compared with baseline (mean 3,916 ml vs 3,055 ml when excluding opacities, p volumetry is a useful tool to differentiate patients who develop RAS from those who develop BOS. Copyright © 2016 International Society for Heart and Lung Transplantation. Published by Elsevier Inc. All rights reserved.

Interaction between Pseudomonas and CXC Chemokines Increases Risk of Bronchiolitis Obliterans Syndrome and Death in Lung Transplantation

Science.gov (United States)

Wang, Xiaoyan; Weigt, S. Sam; Palchevskiy, Vyacheslav; Lynch, Joseph P.; Ross, David J.; Kubak, Bernard M.; Saggar, Rajan; Fishbein, Michael C.; Ardehali, Abbas; Li, Gang; Elashoff, Robert; Belperio, John A.

2013-01-01

Rationale: Pseudomonas aeruginosa is the most commonly isolated gram-negative bacterium after lung transplantation and has been shown to up-regulate glutamic acid–leucine–arginine–positive (ELR+) CXC chemokines associated with bronchiolitis obliterans syndrome (BOS), but the effect of pseudomonas on BOS and death has not been well defined. Objectives: To determine if the influence of pseudomonas isolation and ELR+ CXC chemokines on the subsequent development of BOS and the occurrence of death is time dependent. Methods: A three-state model was developed to assess the likelihood of transitioning from lung transplant (state 1) to BOS (state 2), from transplant (state 1) to death (state 3), and from BOS (state 2) to death (state 3). This Cox semi-Markovian approach determines state survival rates and cause-specific hazards for movement from one state to another. Measurements and Main Results: The likelihood of transition from transplant to BOS was increased by acute rejection, CXCL5, and the interaction between pseudomonas and CXCL1. The pseudomonas effect in this transition was due to infection rather than colonization. Movement from transplant to death was facilitated by pseudomonas infection and single lung transplant. Transition from BOS to death was affected by the length of time in state 1 and by the interactions between any pseudomonas isolation and CXCL5 and aspergillus, either independently or in combination. Conclusions: Our model demonstrates that common post-transplantation events drive movement from one post-transplantation state to another and influence outcomes differently depending upon when after transplantation they occur. Pseudomonas and the ELR+ CXC chemokines may interact to negatively influence lung transplant outcomes. PMID:23328531

A shift in the collagen V antigenic epitope leads to T helper phenotype switch and immune response to self-antigen leading to chronic lung allograft rejection.

Science.gov (United States)

Tiriveedhi, V; Angaswamy, N; Brand, D; Weber, J; Gelman, A G; Hachem, R; Trulock, E P; Meyers, B; Patterson, G; Mohanakumar, T

2012-01-01

Immune responses to human leucocyte antigen (HLA) and self-antigen collagen V (Col-V) have been proposed in the pathogenesis of chronic rejection (bronchiolitis obliterans syndrome, BOS) following human lung transplantation (LTx). In this study, we defined the role for the shift in immunodominant epitopes of Col-V in inducing T helper phenotype switch leading to immunity to Col-V and BOS. Sera and lavage from BOS(+) LTx recipients with antibodies to Col-V were analysed. Two years prior to BOS, patients developed antibodies to both Col-V,α1(V) and α2(V) chains. However, at clinical diagnosis of BOS, antibodies became restricted to α1(V). Further, lung biopsy from BOS(+) patients bound to antibodies to α1(V), indicating that these epitopes are exposed. Fourteen Col-V peptides [pep1-14, pep1-4 specific to α1(V), pep5-8 to α1,2(V) and pep9-14 to α2(V)] which bind to HLA-DR4 and -DR7, demonstrated that prior to BOS, pep 6, 7, 9, 11 and 14 were immunodominant and induced interleukin (IL)-10. However, at BOS, the response switched to pep1, 4 and 5 and induced interferon (IFN)-γ and IL-17 responses, but not IL-10. The T helper (Th) phenotype switch is accompanied by decreased frequency of regulatory T cells (T(regs) ) in the lavage. LTx recipients with antibodies to α1(V) also demonstrated increased matrix metalloproteinase (MMP) activation with decreased MMP inhibitor, tissue inhibitor of metalloproteinase (TIMP), suggesting that MMP activation may play a role in the exposure of new Col-V antigenic epitopes. We conclude that a shift in immunodominance of self-antigenic determinants of Col-V results in induction of IFN-γ and IL-17 with loss of tolerance leading to autoimmunity to Col-V, which leads to chronic lung allograft rejection. © 2011 The Authors. Clinical and Experimental Immunology © 2011 British Society for Immunology.

Bos frontalis

Indian Academy of Sciences (India)

SAMEEULLAH MEMON

2018-02-28

Feb 28, 2018 ... In rat, mouse, rabbit and pig, there was a single gene of the DQ genes, whereas in ... 1997). Hence, the polymorphisms as well as the duplication of DQ gene ... constructed using the commercial RevertAid First Strand. cDNA synthesis kit .... icance of maintaining their molecular conformation and function to ...

Functional and structural comparison of pyrrolnitrin- and iprodione-induced modifications in the class III histidine-kinase Bos1 of Botrytis cinerea.

Directory of Open Access Journals (Sweden)

Sabine Fillinger

Full Text Available Dicarboximides and phenylpyrroles are commonly used fungicides against plant pathogenic ascomycetes. Although their effect on fungal osmosensing systems has been shown in many studies, their modes-of-action still remain unclear. Laboratory- or field-mutants of fungi resistant to either or both fungicide categories generally harbour point mutations in the sensor histidine kinase of the osmotic signal transduction cascade.In the present study we compared the mechanisms of resistance to the dicarboximide iprodione and to pyrrolnitrin, a structural analogue of phenylpyrrole fungicides, in Botrytis cinerea. Pyrrolnitrin-induced mutants and iprodione-induced mutants of B. cinerea were produced in vitro. For the pyrrolnitrin-induced mutants, a high level of resistance to pyrrolnitrin was associated with a high level of resistance to iprodione. For the iprodione-induced mutants, the high level of resistance to iprodione generated variable levels of resistance to pyrrolnitrin and phenylpyrroles. All selected mutants showed hypersensitivity to high osmolarity and regardless of their resistance levels to phenylpyrroles, they showed strongly reduced fitness parameters (sporulation, mycelial growth, aggressiveness on plants compared to the parental phenotypes. Most of the mutants presented modifications in the osmosensing class III histidine kinase affecting the HAMP domains. Site directed mutagenesis of the bos1 gene was applied to validate eight of the identified mutations. Structure modelling of the HAMP domains revealed that the replacements of hydrophobic residues within the HAMP domains generally affected their helical structure, probably abolishing signal transduction. Comparing mutant phenotypes to the HAMP structures, our study suggests that mutations perturbing helical structures of HAMP2-4 abolish signal-transduction leading to loss-of-function phenotype. The mutation of residues E529, M427, and T581, without consequences on HAMP structure

Breeding programs for the main economically important traits of zebu dairy cattle

OpenAIRE

Ariosto Ardila Silva

2010-01-01

In tropical regions, Gyr and Guzerat breeds (Bos indicus) are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically...

Differential abundances of four forms of Binder of SPerm 1 in the seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability.

Science.gov (United States)

Magalhães, Marcos Jorge; Martins, Leonardo Franco; Senra, Renato Lima; Santos, Thaís Ferreira Dos; Okano, Denise Silva; Pereira, Paulo Roberto Gomes; Faria-Campos, Alessandra; Campos, Sérgio Vale Aguiar; Guimarães, José Domingos; Baracat-Pereira, Maria Cristina

2016-08-01

The Binder of SPerm 1 (BSP1) protein is involved in the fertilization and semen cryopreservation processes and is described to be both beneficial and detrimental to sperm. Previously, the relationship of BSP1 with freezability events has not been completely understood. The objective of this work was to determine the differential abundance of the forms of the BSP1 protein in cryopreserved seminal plasma of Bos taurus indicus bulls with different patterns of semen freezability using proteomics. A wide cohort of adult bulls with high genetic value from an artificial insemination center was used as donors of high quality, fresh semen. Nine bulls presenting different patterns of semen freezability were selected. Two-dimensional gel electrophoresis showed differential abundance in a group of seven protein spots in the frozen/thawed seminal plasma from the bulls, ranging from 15 to 17 kDa, with pI values from 4.6 to 5.8. Four of these spots were confirmed to be BSP1 using mass spectrometry, proteomics, biochemical, and computational analysis (Tukey's test at P semen freezability and its absence in bulls presenting high semen freezability. This is the first report showing that more than two forms of BSP1 are found in the seminal plasma of Nelore adult bulls and not all animals have a similar abundance of each BSP1 form. Different BSP1 forms may be involved in different events of fertilization and the cryopreservation process. Copyright © 2016 Elsevier Inc. All rights reserved.

Novel polymorphisms in UTR and coding region of inducible heat shock protein 70.1 gene in tropically adapted Indian zebu cattle (Bos indicus) and riverine buffalo (Bubalus bubalis).

Science.gov (United States)

Sodhi, M; Mukesh, M; Kishore, A; Mishra, B P; Kataria, R S; Joshi, B K

2013-09-25

Due to evolutionary divergence, cattle (taurine, and indicine) and buffalo are speculated to have different responses to heat stress condition. Variation in candidate genes associated with a heat-shock response may provide an insight into the dissimilarity and suggest targets for intervention. The present work was undertaken to characterize one of the inducible heat shock protein genes promoter and coding regions in diverse breeds of Indian zebu cattle and buffaloes. The genomic DNA from a panel of 117 unrelated animals representing 14 diversified native cattle breeds and 6 buffalo breeds were utilized to determine the complete sequence and gene diversity of HSP70.1 gene. The coding region of HSP70.1 gene in Indian zebu cattle, Bos taurus and buffalo was similar in length (1,926 bp) encoding a HSP70 protein of 641 amino acids with a calculated molecular weight (Mw) of 70.26 kDa. However buffalo had a longer 5' and 3' untranslated region (UTR) of 204 and 293 nucleotides respectively, in comparison to Indian zebu cattle and Bos taurus wherein length of 5' and 3'-UTR was 172 and 286 nucleotides, respectively. The increased length of buffalo HSP70.1 gene compared to indicine and taurine gene was due to two insertions each in 5' and 3'-UTR. Comparative sequence analysis of cattle (taurine and indicine) and buffalo HSP70.1 gene revealed a total of 54 gene variations (50 SNPs and 4 INDELs) among the three species in the HSP70.1 gene. The minor allele frequencies of these nucleotide variations varied from 0.03 to 0.5 with an average of 0.26. Among the 14 B. indicus cattle breeds studied, a total of 19 polymorphic sites were identified: 4 in the 5'-UTR and 15 in the coding region (of these 2 were non-synonymous). Analysis among buffalo breeds revealed 15 SNPs throughout the gene: 6 at the 5' flanking region and 9 in the coding region. In bubaline 5'-UTR, 2 additional putative transcription factor binding sites (Elk-1 and C-Re1) were identified, other than three common sites

Quantitative trait locus affecting birth weight on bovine chromosome 5 in a F2 Gyr x Holstein population

Directory of Open Access Journals (Sweden)

Gustavo Gasparin

2005-12-01

Full Text Available Segregation between a genetic marker and a locus influencing a quantitative trait in a well delineated population is the basis for success in mapping quantitative trait loci (QTL. To detect bovine chromosome 5 (BTA5 birth weight QTL we genotyped 294 F2 Gyr (Bos indicus x Holstein (Bos taurus crossbreed cattle for five microsatellite markers. A linkage map was constructed for the markers and an interval analysis for the presence of QTL was performed. The linkage map indicated differences in the order of two markers relative to the reference map (http://www.marc.usda.gov. Interval analysis detected a QTL controlling birth weight (p < 0.01 at 69 centimorgans (cM from the most centromeric marker with an effect of 0.32 phenotypic standard-error. These results support other studies with crossbred Bos taurus x Bos indicus populations.

PP167. A process evaluation of an innovative implementation strategy of the Dutch guidelines on hypertensive disorders in pregnancy using a computerized decision support system

DEFF Research Database (Denmark)

Luitjes, S.H.E.; Mesri, K; Wouters, M

2012-01-01

strategy of professional audit and feedback. In this study a process evaluation of BOS has been done, analyzing its efficiency, barriers and formulate improvement points.OBJECTIVES: Gynecologists, residents and clinical midwives from seven hospitals using BOS were asked to fill in the questionnaire...... by the respondents were mainly regarding the lay-out. Most respondents (85.3%) found it useful to make a computer based support system for other guidelines and 79.4% would also use this.CONCLUSION: BOS is regarded suitable as an instrument for implementing guidelines and respondents find it useful to develop...

Gene : CBRC-PABE-07-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA

Gene : CBRC-PTRO-07-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...

Heat-tolerant versus heat-sensitive Bos taurus cattle: influence of air temperature and breed on the acute phase response to a provocative immune challenge.

Science.gov (United States)

Carroll, J A; Burdick Sanchez, N C; Chaffin, R; Chase, C C; Coleman, S W; Spiers, D E

2013-10-01

The difference in the acute phase response of a heat-tolerant and a heat-sensitive Bos taurus breed to a lipopolysaccharide (LPS) challenge when housed at different air temperatures (Ta) was studied. Angus (ANG; heat-sensitive; n = 11; 306 ± 26 kg BW) and Romosinuano (RO; heat-tolerant; n = 10; 313 ± 32 kg BW) heifers were transported from the USDA Agricultural Research Service SubTropical Agricultural Research Station in Florida to the Brody Environmental Chambers at the University of Missouri, Columbia. Heifers were housed in stanchions in 4 temperature-controlled environmental chambers. Initially, Ta in the 4 chambers was cycling at thermoneutrality (TN; 18.5°C-23.5°C) for a 1-wk adjustment period, followed by an increase in 2 of the 4 chambers to cycling heat stress (HS; 24°C-38°C) for 2 wk. On day 19, heifers were fitted with jugular catheters and rectal temperature (RT) recording devices. On day 20, heifers were challenged with LPS (0.5 μg/kg BW; 0 h), sickness behavior scores (SBSs) were recorded, and blood samples were collected at 0.5-h intervals from -2 to 8 h and again at 24 h relative to LPS challenge at 0 h. Serum was isolated and stored at -80°C until analyzed for cortisol and cytokine concentrations. A breed by Ta interaction (P heat-tolerant RO and heat-sensitive ANG heifers under different Ta which may aid in elucidating differences in productivity, disease resistance, and longevity among cattle breeds. Published by Elsevier Inc.

crossbreeding wit}i africander dam as basis . 3. post-weaning ...

African Journals Online (AJOL)

'n stelsel van rntensiewe vetmesting, het laasgenoemde drie 8os taurus vaarras nageslaggroepe opvallend beter presteer as eersgenoemde twee Bos indicus vaarras nageslaggroepe. Onder ekstensiewe veldtoestande het alle krusgeteelde groepe egter die Afrikanerkontroles geklop. Die nageslag van beide Bos indicus ...

A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore (Bos indicus beef cattle

Directory of Open Access Journals (Sweden)

Artur J.M. Rosa

2007-01-01

Full Text Available We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS of Nellore (Bos indicus beef cattle embryos prior to transplantation to reduce the age at first calving (AFC. We found that MAS resulted in increased genetic gain as compared to selection without AFC quantitative trait loci (AFC-QTL information. With single-stage selection the genetic response (GR increased as follows: GR = 0.68% when the AFC-QTL explained 0.02 of the AFC additive genetic variance (sigma2A; GR = 1.76% for AFC-QTL explaining 0.05 sigma2A; GR = 3.7% for AFC-QTL explaining 0.1 sigma2A; and GR = 55.76% for AFC-QTL explaining 0.95 sigma2A. At the same total selected proportion, two-stage selection resulted in less genetic gain than single stage MAS at two-years of age. A single stage selection responses of > 95% occurred with pre-selected proportions of 0.4 (0.1 sigma2A explained by AFC-QTL, 0.2 (0.3 sigma2A explained by AFC-QTL and 0.1 (0.5 sigma2A explained by AFC-QTL, indicating that the combined use of MAS and pre-selection can substantially reduce the cost of keeping recipient heifers in MOET breeding schemes. When the number of recipients was kept constant, the benefit of increasing embryo production was greater for the QTL explaining a higher proportion of the additive genetic variance. However this advantage had a diminishing return especially for QTL explaining a small proportion of the additive genetic variance. Thus, marker assisted selection of embryos can be used to achieve increased genetic gain or a similar genetic response at reduced expense by decreasing the number of recipient cows and number of offspring raised to two-years of age.

Development and Application of a Sensitive, Second Antibody Format Enzymeimmunoassay (EIA) for Estimation of Plasma FSH in Mithun (Bos frontalis).

Science.gov (United States)

Mondal, Mohan; Baruah, Kishore Kumar; Prakash, B S

2016-01-01

Mithun (Bos frontalis) is a semi-wild rare ruminant species. A simple sensitive enzymeimmunoassay suitable for assaying FSH in the blood plasma of mithun is not available which thereby limits our ability to understand this species reproductive processes. Therefore, the aim of this article was to develop a simple and sensitive enzymeimmunoassay (EIA) for estimation of FSH in mithun plasma and apply the assay to understand the estrous cycle and superovulatory process in this species. To accomplish this goal, biotinylated FSH was bridged between streptavidin-peroxidase and immobilized antiserum in a competitive assay. Forty microlitre mithun plasma was used directly in the EIA. The FSH standards were prepared in hormone free plasma and ranged from 5-1280 pg/well/40 μL. The sensitivity of EIA was 5 pg/well FSH, which corresponds to 0.125 ng/mL plasma and the 50% relative binding sensitivity was 90 pg/well/40 μL. Although the shape of the standard curve was not influenced by different plasma volumes viz. 40 and 80 μL, a slight drop in the OD450 was observed with the increasing volume of plasma. Parallelism tests conducted between the endogenous mithun FSH and bovine FSH standards showed good homology between them. Plasma FSH estimated using the developed EIA and commercially available FSH EIA kit in the same samples were correlated (r = 0.98) and showed linearity. Both the Intra- and inter-assay CV were below 6%. Recovery of known concentrations of added FSH showed linearity (r = 0.99). The developed EIA was further validated biologically by estimating FSH in cyclic cows for the entire estrous cycle, in mithun heifers administered with GnRH analogues and in mithun cows during superovulatory treatment with FSH. In conclusion, the EIA developed for FSH determination in mithun blood plasma is simple and highly sensitive for estimation of mithun FSH in all physiological conditions.

Social relationships enhance the time spent eating and intake of a novel diet in pregnant Hanwoo (Bos taurus coreanae) heifers.

Science.gov (United States)

Shin, Dong-Han; Kang, Hyun-Min; Seo, Seongwon

2017-01-01

The objective of this study was to evaluate the effects of social relationships on the feed intake, eating behavior, and growth, upon exposure to a novel diet, in Hanwoo ( Bos taurus coreanae ) heifers during pregnancy. Twenty-four pregnant Hanwoo heifers, averaging 438 ± 27.8 kg in weight, 21 months in age, and 194 ± 8.5 days in pregnancy, were involved in a two-month (eight weeks) experiment. The heifers were randomly assigned to either the single housing group (SG; one individual per pen, n = 12), or the paired housing group (PG; two individuals per pen, n = 12). All pens were of the same size (5 × 5 m) and provided with one feed bin, which automatically recorded the individual feed intake and eating behavior. As the experiment began, the diet of the heifers was switched from a total mixed ration (TMR; 250 g/kg ryegrass straw and 750 g/kg concentrate mix) to a forage-only diet (mixed hay cubes composed of 500 g/kg alfalfa, 250 g/kg timothy, and 250 g/kg blue grass hay). The heifers were fed ad libitum twice a day. The individual feed intake and eating behavior were recorded daily throughout the experiment, and body weights (BWs) were measured every four weeks before the morning feeding. PG animals visited the feed bin 22% less often than SG. PG, however, stayed 39% longer in the feed bin and consumed 40% more feed per visit, compared with SG. Consequently, PG heifers spent 23% more time in eating and had 16% more daily dry matter intake than SG during the experiment. Average daily gain during the experimental period tended to be greater in PG than in SG. When pregnant Hanwoo heifers encountered a novel diet, social relationships (i.e., presence of a pen-mate) enhanced their time spent eating and feed intake. Social interactions, even with an unfamiliar individual, may be helpful for pregnant Hanwoo heifers cope with a diet challenge compared to solitary situation.

Aspiration, Localized Pulmonary Inflammation, and Predictors of Early-Onset Bronchiolitis Obliterans Syndrome after Lung Transplantation

Science.gov (United States)

Fisichella, P Marco; Davis, Christopher S; Lowery, Erin; Ramirez, Luis; Gamelli, Richard L; Kovacs, Elizabeth J

2014-01-01

BACKGROUND We hypothesized that immune mediator concentrations in the bronchoalveolar fluid (BALF) are predictive of bronchiolitis obliterans syndrome (BOS) and demonstrate specific patterns of dysregulation, depending on the presence of acute cellular rejection, BOS, aspiration, and timing of lung transplantation. STUDY DESIGN We prospectively collected 257 BALF samples from 105 lung transplant recipients. The BALF samples were assessed for absolute and differential white blood cell counts and 34 proteins implicated in pulmonary immunity, inflammation, fibrosis, and aspiration. RESULTS There were elevated BALF concentrations of interleukin (IL)-15, IL-17, basic fibroblast growth factor, tumor necrosis factor–α, and myeloperoxidase, and reduced concentrations of α1-antitrypsin, which were predictive of early-onset BOS. Patients with BOS had an increased percentage of BALF lymphocytes and neutrophils, with a reduced percentage of macrophages (p < 0.05). The BALF concentrations of IL-1β; IL-8; interferon-γ–induced protein 10; regulated upon activation, normal T-cell expressed and secreted; neutrophil elastase; and pepsin were higher in patients with BOS (p < 0.05). Among those with BOS, BALF concentrations of IL-1RA; IL-8; eotaxin; interferon-γ–induced protein 10; regulated upon activation, normal T-cell expressed and secreted; myeloperoxidase; and neutrophil elastase were positively correlated with time since transplantation (p < 0.01). Those with worse grades of acute cellular rejection had an increased percentage of lymphocytes in their BALF (p < 0.0001) and reduced BALF concentrations of IL-1β, IL-7, IL-9, IL-12, granulocyte colony-stimulating factor, granulocyte-macrophage colony-stimulating factor, interferon-γ, and vascular endothelial growth factor (p ≤ 0.001). Patients with aspiration based on detectable pepsin had increased percentage of neutrophils (p < 0.001) and reduced BALF concentrations of IL-12 (p < 0.001). CONCLUSIONS The BALF levels

A microsatellite-based analysis for the detection of selection on BTA1 and BTA20 in northern Eurasian cattle (Bos taurus populations

Directory of Open Access Journals (Sweden)

Li Meng-Hua

2010-08-01

Full Text Available Abstract Background Microsatellites surrounding functionally important candidate genes or quantitative trait loci have received attention as proxy measures of polymorphism level at the candidate loci themselves. In cattle, selection for economically important traits is a long-term strategy and it has been reported that microsatellites are linked to these important loci. Methods We have investigated the variation of seven microsatellites on BTA1 (Bos taurus autosome 1 and 16 on BTA20, using bovine populations of typical production types and horn status in northern Eurasia. Genetic variability of these loci and linkage disequilibrium among these loci were compared with those of 28 microsatellites on other bovine chromosomes. Four different tests were applied to detect molecular signatures of selection. Results No marked difference in locus variability was found between microsatellites on BTA1, BTA20 and the other chromosomes in terms of different diversity indices. Average D' values of pairwise syntenic markers (0.32 and 0.28 across BTA 1 and BTA20 respectively were significantly (P FST-test indicated elevated or decreased genetic differentiation, at SOD1 and AGLA17 markers respectively, deviating significantly (P SOD1 and AGLA17. Our data also indicate significant intergenic linkage disequilibrium around the candidate loci and suggest that hitchhiking selection has played a role in shaping the pattern of observed linkage disequilibrium. Conclusion Hitchhiking due to tight linkage with alleles at candidate genes, e.g. the POLL gene, is a possible explanation for this pattern. The potential impact of selective breeding by man on cattle populations is discussed in the context of selection effects. Our results also suggest that a practical approach to detect loci under selection is to simultaneously apply multiple neutrality tests based on different assumptions and estimations.

NCBI nr-aa BLAST: CBRC-OLAT-15-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-15-0022 ref|NP_001073692.1| solute carrier family 29 (nucleoside transporters...), member 3 [Bos taurus] gb|AAI26742.1| Solute carrier family 29 (nucleoside transporters), member 3 [Bos taurus] NP_001073692.1 9e-68 49% ...

Marginal costs of abating greenhouse gases in the global ruminant livestock sector

NARCIS (Netherlands)

Henderson, B.; Falcucci, A.; Early, L.; Gerber, P.J.

2017-01-01

Livestock [inclusive of ruminant species, namely cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), goats (Capra hircus), and buffaloes (Bubalus bubalis), and non-ruminant species, namely pigs (Sus scrofa domesticus) and chickens (Gallus domesticus)] are both affected by climate change and

NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0499 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-175 86% ...

NCBI nr-aa BLAST: CBRC-MDOM-07-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-07-0106 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2314 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2314 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-161 89% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-0894 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0894 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-176 84% ...

NCBI nr-aa BLAST: CBRC-RNOR-05-0235 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0235 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-169 83% ...

NCBI nr-aa BLAST: CBRC-GGAL-23-0005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-23-0005 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-120 65% ...

NCBI nr-aa BLAST: CBRC-MDOM-04-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0428 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-149 76% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1596 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1596 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 89% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-1190 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1190 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 96% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0287 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0287 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 0.0 94% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-1487 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1487 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-179 87% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1010 ref|NP_001071419.1| progestin and adipoQ receptor family member I...X [Bos taurus] gb|AAI22754.1| Progestin and adipoQ receptor family member IX [Bos taurus] NP_001071419.1 0.0 92% ...

Juliana Ströbele-Gregor, Olaf Kaltmeier y Cornelia Giebeler (comp.), Construyendo Interculturalidad: Pueblos Indígenas, Educación y Políticas de Identidad en América Latina, GTZ Programa Fortalecimiento de Organizaciones Indígenas en América La

OpenAIRE

Elizalde, Antonio

2011-01-01

Este libro, resultado de un esfuerzo compartido por diversas instituciones, investigadores y editores, encabezados por el Grupo de Investigación E Pluribus Unum? Ethnic Identities in Transnational Integration Processes in the Americas de la Universidad de Bielefeld, trata un tema central para el futuro de nuestras mestizas sociedades latinoamericanas: la necesaria construcción -en el presente que vivimos- de la interculturalidad en nuestra América Latina. Esto en el nuevo contexto  donde los ...

Background-Oriented Schlieren used in a hypersonic inlet test at NASA GRC

Science.gov (United States)

Clem, Michelle; Woike, Mark; Saunders, John

2016-01-01

Background Oriented Schlieren (BOS) is a derivative of the classical schlieren technology, which is used to visualize density gradients, such as shock wave structures in a wind tunnel. Changes in refractive index resulting from density gradients cause light rays to bend, resulting in apparent motion of a random background pattern. The apparent motion of the pattern is determined using cross-correlation algorithms (between no-flow and with-flow image pairs) producing a schlieren-like image. One advantage of BOS is its simplified setup which enables a larger field-of-view (FOV) than traditional schlieren systems. In the present study, BOS was implemented into the Combined Cycle Engine Large-Scale Inlet Mode Transition Experiment (CCE LIMX) in the 10x10 Supersonic Wind Tunnel at NASA Glenn Research Center. The model hardware for the CCE LIMX accommodates a fully integrated turbine based combined cycle propulsion system. To date, inlet mode transition between turbine and ramjet operation has been successfully demonstrated. High-speed BOS was used to visualize the behavior of the flow structures shock waves during unsteady inlet unstarts, a phenomenon known as buzz. Transient video images of inlet buzz were recorded for both the ramjet flow path (high speed inlet) and turbine flow path (low speed inlet). To understand the stability limits of the inlet, operation was pushed to the point of unstart and buzz. BOS was implemented in order to view both inlets simultaneously, since the required FOV was beyond the capability of the current traditional schlieren system. An example of BOS data (Images 1-6) capturing inlet buzz are presented.

Linear and nonlinear auditory response properties of interneurons in a high-order avian vocal motor nucleus during wakefulness.

Science.gov (United States)

Raksin, Jonathan N; Glaze, Christopher M; Smith, Sarah; Schmidt, Marc F

2012-04-01

Motor-related forebrain areas in higher vertebrates also show responses to passively presented sensory stimuli. However, sensory tuning properties in these areas, especially during wakefulness, and their relation to perception, are poorly understood. In the avian song system, HVC (proper name) is a vocal-motor structure with auditory responses well defined under anesthesia but poorly characterized during wakefulness. We used a large set of stimuli including the bird's own song (BOS) and many conspecific songs (CON) to characterize auditory tuning properties in putative interneurons (HVC(IN)) during wakefulness. Our findings suggest that HVC contains a diversity of responses that vary in overall excitability to auditory stimuli, as well as bias in spike rate increases to BOS over CON. We used statistical tests to classify cells in order to further probe auditory responses, yielding one-third of neurons that were either unresponsive or suppressed and two-thirds with excitatory responses to one or more stimuli. A subset of excitatory neurons were tuned exclusively to BOS and showed very low linearity as measured by spectrotemporal receptive field analysis (STRF). The remaining excitatory neurons responded well to CON stimuli, although many cells still expressed a bias toward BOS. These findings suggest the concurrent presence of a nonlinear and a linear component to responses in HVC, even within the same neuron. These characteristics are consistent with perceptual deficits in distinguishing BOS from CON stimuli following lesions of HVC and other song nuclei and suggest mirror neuronlike qualities in which "self" (here BOS) is used as a referent to judge "other" (here CON).

Época de nascimento, genótipo e sexo de terneiros cruzas taurinos e zebuínos sobre o peso ao nascer, à desmama e eficiência individual de primíparas Hereford

OpenAIRE

Mendonça,Gilson de; Pimentel,Marcelo Alves; Cardellino,Ricardo Alberto; Osório,José Carlos da Silveira

2003-01-01

O objetivo deste trabalho foi avaliar o efeito da época de nascimento, genótipo e sexo do terneiro sobre a eficiência individual das vacas à desmama (relação percentual entre o peso do terneiro à desmama e o peso da vaca), peso ao nascer e peso à desmama dos terneiros. Foram utilizadas 48 vacas da raça Hereford (Bos taurus), com idade de três anos, manejadas sobre campo natural, 16 inseminadas com um touro da raça Red Angus (Bos taurus) e 32 com Nelore (Bos indicus). Os fatores estudados fora...

Reactive Balance in Individuals With Chronic Stroke: Biomechanical Factors Related to Perturbation-Induced Backward Falling.

Science.gov (United States)

Salot, Pooja; Patel, Prakruti; Bhatt, Tanvi

2016-03-01

An effective compensatory stepping response is the first line of defense for preventing a fall during sudden large external perturbations. The biomechanical factors that contribute to heightened fall risk in survivors of stroke, however, are not clearly understood. It is known that impending sensorimotor and balance deficits poststroke predispose these individuals to a risk of fall during sudden external perturbations. The purpose of this study was to examine the mechanism of fall risk in survivors of chronic stroke when exposed to sudden, slip-like forward perturbations in stance. This was a cross-sectional study. Fourteen individuals with stroke, 14 age-matched controls (AC group), and 14 young controls (YC group) were exposed to large-magnitude forward stance perturbations. Postural stability was computed as center of mass (COM) position (XCOM/BOS) and velocity (ẊCOM/BOS) relative to the base of support (BOS) at first step lift-off (LO) and touch-down (TD) and at second step TD. Limb support was quantified as vertical hip descent (Zhip) from baseline after perturbation onset. All participants showed a backward balance loss, with 71% of the stroke group experiencing a fall compared with no falls in the control groups (AC and YC groups). At first step LO, no between-group differences in XCOM/BOS and ẊCOM/BOS were noted. At first step TD, however, the stroke group had a significantly posterior XCOM/BOS and backward ẊCOM/BOS compared with the control groups. At second step TD, individuals with stroke were still more unstable (more posterior XCOM/BOS and backward ẊCOM/BOS) compared with the AC group. Individuals with stroke also showed greater peak Zhip compared with the control groups. Furthermore, the stroke group took a larger number of steps with shorter step length and delayed step initiation compared with the control groups. Although the study highlights the reactive balance deficits increasing fall risk in survivors of stroke compared with healthy

Effects of retinol on the in vitro development of Bos indicus embryos to blastocysts in two different culture systems.

Science.gov (United States)

Lima, P F; Oliveira, M A L; Gonçalves, P B D; Montagner, M M; Reichenbach, H-D; Weppert, M; Neto, C C C; Pina, V M R; Santos, M H B

2004-10-01

The objective of this study was to evaluate the effect of retinol on the in vitro development of early embryos of cultured Bos indicus (Expt 1) to the blastocyst stage in medium simplex of optimization (KSOM) or sintetic fluid of oviduct (SOF) or co-cultured (Expt 2) with an oviduct cell monolayer (OCM) in KSOM or SOF. A total of 3149 cumulus-oocyte complexes obtained by aspirating follicles (2-5 mm diameter) from ovaries of slaughtered animals were selected for IVM and incubated in TCM 199 supplemented with 25 mM HEPES at 39 degrees C in air with 5% CO(2) and maximum humidity for 24 h. In vitro fertilization (IVF) was performed in modified defined medium (mDM) medium. Eighteen hours after IVF, cumulus cells were removed and presumptive zygotes were randomly allocated to the experimental groups. Zygotes cultured (Expt 1) in KSOM + retinol, KSOM, SOF + retinol and SOF were incubated in maximum humidity at 39 degrees C, 5% CO(2), 5% O(2) and 90% N(2). Zygotes co-cultured (Expt 2) in KSOM + retinol + OCM, KSOM + OCM, SOF + retinol + OCM and SOF + OCM were incubated at 39 degrees C, 5% CO(2). In both experiments media were partially changed 48 h after IVF and unfertilized ova were removed. Afterwards embryos were kept in culture or co-culture for further 9 days. In Expt 1, blastocyst rates (day 7) were 14.6% (KSOM + retinol), 15.8% (KSOM), 16.4% (SOF + retinol) and 15.9% (SOF). In Expt 2, the blastocyst rates (day 7) were 25.4% (KSOM + retinol + OCM) 14.2% (KSOM + OCM), 24.3% (SOF + retinol + OCM) and 15.9% (SOF + OCM). The same influence profile of retinol was observed in the formation of the expanded (day 9) and hatched (day 11) blastocysts. The results obtained in Expt 2 demonstrated that the addition of 0.28 microg/ml retinol to the embryo culture media used in this study had a significant (p < 0.05) positive effect on bovine early embryonic development, under the conditions tested, and can be used to enhance in vitro embryo production.

Effect of Concentrate Supplementation on Reproductive ...

African Journals Online (AJOL)

A study was conducted in Rungwe district in Tanzania, to assess the effect of concentrate supplementation on reproductive performance of smallholder dairy cattle. Cattle used were crossbreds, mainly between Friesian (Bos taurus) and indigenous Tanzania Short Horn Zebu (Bos indicus). All animals were managed under ...

The power and pain of market-based carbon policies

NARCIS (Netherlands)

Henderson, B.; Golub, A.; Pambudi, D.; Hertel, T.; Godde, C.; Herrero, M.; Cacho, O.; Gerber, P.

2018-01-01

The objectives of this research are to assess the greenhouse gas mitigation potential of carbon policies applied to the ruminant livestock sector [inclusive of the major ruminant species—cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), and goats (Capra hircus)]—with particular emphasis on

Genomic divergence of indicine and taurine cattle identified through high-density SNP genotyping

Science.gov (United States)

At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically adapted Bos primigenius indicus. Human selection exponentially...

Germline LEMD3 mutations are rare in sporadic patients with isolated melorheostosis

DEFF Research Database (Denmark)

Hellemans, Jan; Debeer, Philippe; Wright, Michael

2006-01-01

To further explore the allelic heterogeneity within the group of LEMD3-related disorders, we have screened a larger series of patients including 5 probands with osteopoikilosis or Buschke-Ollendorff syndrome (BOS), 2 families with the co-occurrence of melorheostosis and BOS, and 12 unrelated pati...

NCBI nr-aa BLAST: CBRC-TTRU-01-0672 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0672 ref|NP_001039933.1| protein kinase C and casein kinase substrate in neurons... 2 [Bos taurus] gb|AAI14746.1| Protein kinase C and casein kinase substrate in neurons 2 [Bos taurus] NP_001039933.1 1e-178 74% ...

Prevalencia de la deficiencia de glucosa - 6 - fosfato deshidrogenasa en donadores voluntarios de sangre que acuden a los hospitales nacionales Cayetano Heredia y Arzobispo Loayza: Lima - Perú

Directory of Open Access Journals (Sweden)

Wilson Ruiz

1997-01-01

Full Text Available Objetivos: El presente trabajo tuvo como objetivo, conocer la Prevalencia de la deficiencia de la G-6-PDH, en la población masculina mestiza, aparentemente sana que acude a los Bancos de Sangre de los hospitales nacionales Cayetano Heredia (HNCH y Arzobispo Loayza (HNAL. Material y métodos: Se examinó 140 muestras de hemodonadores entre junio y julio, 60 (42.85% correspondieron al HNCH y 80 (57.15% al HNCH. Se aplicó un cuestionario a todos los donantes indagando por: raza en los ancestros y antecedentes patológicos compatibles con episodios de hemólisis enzimopática. En todas las muestras se empleó el método cualitativo de Brewer (tamizaje y posteriormente fueron sometidos a la prueba cuantitativa SIGMA. Resultados: Con el método de Brewer resultaron 9 casos positivos (6.42% de los cuales sólo uno resultó positivo con el método confirmatorio, lo cual da una prevalencia de 0.71%. La totalidad de los participantes fueron de raza mestiza, carecían de antecedentes importantes, las edades estuvieron comprometidas entre los 18 y 58 años y el hematocrito entre 40 y 48%. Conclusiones: Se confirma que la prevalencia de esta deficiencia, en nuestra población es bastante baja. (Rev Med Hered 1997; 8: 11-18.

Inviscid Limit for Damped and Driven Incompressible Navier-Stokes Equations in mathbb R^2

Science.gov (United States)

Ramanah, D.; Raghunath, S.; Mee, D. J.; Rösgen, T.; Jacobs, P. A.

2007-08-01

Experiments to demonstrate the use of the background-oriented schlieren (BOS) technique in hypersonic impulse facilities are reported. BOS uses a simple optical set-up consisting of a structured background pattern, an electronic camera with a high shutter speed and a high intensity light source. The visualization technique is demonstrated in a small reflected shock tunnel with a Mach 4 conical nozzle, nozzle supply pressure of 2.2 MPa and nozzle supply enthalpy of 1.8 MJ/kg. A 20° sharp circular cone and a model of the MUSES-C re-entry body were tested. Images captured were processed using PIV-style image analysis to visualize variations in the density field. The shock angle on the cone measured from the BOS images agreed with theoretical calculations to within 0.5°. Shock standoff distances could be measured from the BOS image for the re-entry body. Preliminary experiments are also reported in higher enthalpy facilities where flow luminosity can interfere with imaging of the background pattern.

Mutation in LEMD3 (Man1 Associated with Osteopoikilosis and Late-Onset Generalized Morphea: A New Buschke-Ollendorf Syndrome Variant

Directory of Open Access Journals (Sweden)

Benjamin Korman

2016-01-01

Full Text Available Introduction. Buschke-Ollendorf syndrome (BOS is an uncommon syndrome characterized by osteopoikilosis and other bone abnormalities, accompanied by skin lesions, most frequently connective tissue nevi. BOS is caused by mutations in the LEMD3 gene, which encodes the inner nuclear membrane protein Man1. We describe a unique case of osteopoikilosis associated with late-onset localized scleroderma and familial LEMD3 mutations. Case Report. A 72-year-old woman presented with adult-onset diffuse morphea and bullous skin lesions. Evaluation revealed multiple hyperostotic lesions (osteopoikilosis suggestive of BOS. DNA sequencing identified a previously undescribed nonsense mutation (Trp621X in the LEMD3 gene encoding Man1. Two additional family members were found to have osteopoikilosis and carry the same LEMD3 mutation. Conclusions and Relevance. We report a unique familial LEMD3 mutation in an individual with osteopoikilosis and late-onset morphea. We propose that this constellation represents a novel syndromic variant of BOS.

9 CFR 94.0 - Definitions.

Science.gov (United States)

2010-01-01

... than poultry or game birds). Bovine. Bos taurus, Bos indicus, and Bison bison. Bovine spongiform... loaded with meat product, or the areas at various points along the belt in an oven chamber, slowest to.... Game birds. Migratory birds, including certain ducks, geese, pigeons, and doves (“migratory” refers to...

Dood hout in de bosreservaten

NARCIS (Netherlands)

Hees, van A.F.M.; Clerkx, A.P.P.M.

1999-01-01

Overzicht van de hoeveelheid dood hout, de sterfte van bomen en de verteringssnelheid van deze bomen in enkele niet meer beheerde Nederlandse bosreservaten. Voor drie typen bos (gemengd bos; grove den; zomereik) is op grond van een beheerscenario de te verwachten hoeveelheid hout in de loop van de

Bos primigenius in Ancient Egyptian art – historical evidence for the continuity of occurrence and ecology of an extinct key species

Directory of Open Access Journals (Sweden)

Carl Beierkuhnlein

2015-11-01

Full Text Available Knowledge of the habitat requirements and temporal stability of populations of extinct aurochs (Bos primigenius is surprisingly scarce. Reliable reports of this species, which by its domestication remains tremendously important for humans, are rare. As the species became extinct about 400 years ago and regionally disappeared much earlier, its behaviour and morphology are also under debate. Aurochs is also a crucial component of the mega-herbivore theory in nature conservation, but in fact its natural habitat and behaviour are unknown. Here, I report records of aurochs for the time period of Ancient Egypt. They are found in archaeological sites and literature, and in collections. Records of the species continue through all the periods of Ancient Egypt. In particular, hunting scenes illustrating the merits of high-ranking persons, in their graves (mastabas and temples, provide insights into the behaviour and ecology of the depicted game. Here, special attention is given to one outstanding hunting scene that is documented in a relief at the mortuary temple of Ramesses III (1175 BC, Medinet Habu, Egypt. Assisted by a group of hunters, the pharaoh kills three specimens of aurochs. The whole scene is stunningly realistic.  The adult specimen is fleeing towards the reed belt of the River Nile, suggesting that the species’ habitat was probably in large valley bottoms, where open grassland is regularly created by flooding. Endemic species of fish and game confirm that this scene took place in Lower Egypt. The regional populations of the North-African subspecies of aurochs probably went extinct shortly after this piece of art was produced. Records of species in ancient art can be very informative in terms of ecology and behaviour of species, especially when extinct species are addressed. In addition, the dating of old pieces of art containing biological information can be very precise, for instance when these refer to a historic personage. 

Endothelin-1 receptor antagonists protect the kidney against the nephrotoxicity induced by cyclosporine-A in normotensive and hypertensive rats.

Science.gov (United States)

Caires, A; Fernandes, G S; Leme, A M; Castino, B; Pessoa, E A; Fernandes, S M; Fonseca, C D; Vattimo, M F; Schor, N; Borges, F T

2017-12-11

Cyclosporin-A (CsA) is an immunosuppressant associated with acute kidney injury and chronic kidney disease. Nephrotoxicity associated with CsA involves the increase in afferent and efferent arteriole resistance, decreased renal blood flow (RBF) and glomerular filtration. The aim of this study was to evaluate the effect of Endothelin-1 (ET-1) receptor blockade with bosentan (BOS) and macitentan (MAC) antagonists on altered renal function induced by CsA in normotensive and hypertensive animals. Wistar and genetically hypertensive rats (SHR) were separated into control group, CsA group that received intraperitoneal injections of CsA (40 mg/kg) for 15 days, CsA+BOS and CsA+MAC that received CsA and BOS (5 mg/kg) or MAC (25 mg/kg) by gavage for 15 days. Plasma creatinine and urea, mean arterial pressure (MAP), RBF and renal vascular resistance (RVR), and immunohistochemistry for ET-1 in the kidney cortex were measured. CsA decreased renal function, as shown by increased creatinine and urea. There was a decrease in RBF and an increase in MAP and RVR in normotensive and hypertensive animals. These effects were partially reversed by ET-1 antagonists, especially in SHR where increased ET-1 production was observed in the kidney. Most MAC effects were similar to BOS, but BOS seemed to be better at reversing cyclosporine-induced changes in renal function in hypertensive animals. The results of this work suggested the direct participation of ET-1 in renal hemodynamics changes induced by cyclosporin in normotensive and hypertensive rats. The antagonists of ET-1 MAC and BOS reversed part of these effects.

Endothelin-1 receptor antagonists protect the kidney against the nephrotoxicity induced by cyclosporine-A in normotensive and hypertensive rats

Directory of Open Access Journals (Sweden)

A. Caires

2017-12-01

Full Text Available Cyclosporin-A (CsA is an immunosuppressant associated with acute kidney injury and chronic kidney disease. Nephrotoxicity associated with CsA involves the increase in afferent and efferent arteriole resistance, decreased renal blood flow (RBF and glomerular filtration. The aim of this study was to evaluate the effect of Endothelin-1 (ET-1 receptor blockade with bosentan (BOS and macitentan (MAC antagonists on altered renal function induced by CsA in normotensive and hypertensive animals. Wistar and genetically hypertensive rats (SHR were separated into control group, CsA group that received intraperitoneal injections of CsA (40 mg/kg for 15 days, CsA+BOS and CsA+MAC that received CsA and BOS (5 mg/kg or MAC (25 mg/kg by gavage for 15 days. Plasma creatinine and urea, mean arterial pressure (MAP, RBF and renal vascular resistance (RVR, and immunohistochemistry for ET-1 in the kidney cortex were measured. CsA decreased renal function, as shown by increased creatinine and urea. There was a decrease in RBF and an increase in MAP and RVR in normotensive and hypertensive animals. These effects were partially reversed by ET-1 antagonists, especially in SHR where increased ET-1 production was observed in the kidney. Most MAC effects were similar to BOS, but BOS seemed to be better at reversing cyclosporine-induced changes in renal function in hypertensive animals. The results of this work suggested the direct participation of ET-1 in renal hemodynamics changes induced by cyclosporin in normotensive and hypertensive rats. The antagonists of ET-1 MAC and BOS reversed part of these effects.

Maternal rigidity in infancy and level of intelligence at school age in children born preterm

NARCIS (Netherlands)

Butcher, P.R.; Wijnberg-Williams, B.J; Hegemann, N; Stremmelaar, E.F; Schoemaker, M.M.; Van der Meere, J.J.; Bambang Oetomo, S

2004-01-01

Forty-four children who had been born preterm and their mothers participated in the follow-up study. At 3 and 14 months (corrected age) cognitive development was assessed using the BOS 2-30, the Dutch version of the Bayley Scales of Infant Development. The BOS yields measures of mental and motor

Urinary catecholamine concentrations in three beef breeds at ...

African Journals Online (AJOL)

Handling and transport of live animals is a stressful experience for animals. The temperaments of cattle affect their behaviour and differ between breeds, i.e. studies have shown that Bos indicus types are more temperamental than Sanga and Bos taurus types. Catecholamines (CAT's) are considered as indicators of stress, ...

An extension of uncertainty management theory to the self : The relationship between justice, social comparison orientation, and antisocial work behaviors

NARCIS (Netherlands)

Thau, Stefan; Aquino, Karl; Wittek, Rafael; Aquino, 27021

A multisource field study of 103 employees and their supervisors tested an extension of uncertainty management theory (E. A. Lind & K. Van den Bos, 2002; K. Van den Bos & E. A. Lind, 2002). According to this theory, persons high in social comparison orientation (F. X. Gibbons & B. P. Buunk, 1999)

Oxygen-sensitive 3He-MRI in bronchiolitis obliterans after lung transplantation

International Nuclear Information System (INIS)

Gast, Klaus K.; Biedermann, Alexander; Herweling, Annette; Schreiber, Wolfgang G.; Schmiedeskamp, Joerg; Mayer, Eckhard; Heussel, Claus P.; Markstaller, Klaus; Eberle, Balthasar; Kauczor, Hans-Ulrich

2008-01-01

Oxygen-sensitive 3 He-MRI was studied for the detection of differences in intrapulmonary oxygen partial pressure (pO 2 ) between patients with normal lung transplants and those with bronchiolitis obliterans syndrome (BOS). Using software developed in-house, oxygen-sensitive 3 He-MRI datasets from patients with normal lung grafts (n = 8) and with BOS (n = 6) were evaluated quantitatively. Datasets were acquired on a 1.5-T system using a spoiled gradient echo pulse sequence. Underlying diseases were pulmonary emphysema (n 10 datasets) and fibrosis (n = 4). BOS status was verified by pulmonary function tests. Additionally, 3 He-MRI was assessed blindedly for ventilation defects. Median intrapulmonary pO 2 in patients with normal lung grafts was 146 mbar compared with 108 mbar in patients with BOS. Homogeneity of pO2 distribution was greater in normal grafts (standard deviation pO2 34 versus 43 mbar). Median oxygen decrease rate during breath hold was higher in unaffected patients (-1.75 mbar/s versus -0.38 mbar/s). Normal grafts showed fewer ventilation defects (5% versus 28%, medians). Oxygen-sensitive 3 He-MRI appears capable of demonstrating differences of intrapulmonary pO2 between normal lung grafts and grafts affected by BOS. Oxygen-sensitive 3 He-MRI may add helpful regional information to other diagnostic techniques for the assessment and follow-up of lung transplant recipients. (orig.)

The Induction of IgM and IgG Antibodies against HLA or MICA after Lung Transplantation

Directory of Open Access Journals (Sweden)

Annelieke W. M. Paantjens

2011-01-01

Full Text Available The production of IgG HLA antibodies after lung transplantation (LTx is considered to be a major risk factor for the development of chronic rejection, represented by the bronchiolitis obliterans syndrome (BOS. It has recently been observed that elevated levels of IgM HLA antibodies also correlates with the development of chronic rejection in heart and kidney transplantation. This study investigates the relationship between IgM and IgG antibodies against HLA and MICA after lung transplantation. Serum was collected from 49 patients once prior to transplantation and monthly for up to 1 year after lung transplantation was analyzed by Luminex to detect IgM and IgG antibodies against HLA and MICA. The presence of either IgM or IgG HLA and/or MICA antibodies prior to or after transplantation was not related to survival, gender, primary disease, or the development of BOS. Additionally, the production of IgG alloantibodies was not preceded by an increase in levels of IgM, and IgM levels were not followed by an increase in IgG. Under current immune suppressive regimen, although the presence of IgM antibodies does not correlate with BOS after LTx, IgM high IgG low HLA class I antibody titers were observed more in patients with BOS compared to patients without BOS.

Indvandring, integration og etnisk segregation

DEFF Research Database (Denmark)

Andersen, Hans Skifter

I denne publikation belyses udviklingen i indvandrernes bosætning i Danmark, analyserer årsagerne til at mange indvandrere er blevet bosat i den almene sektor og koncentreret i bestemte byområder og belyser sammenhængen mellem bosætningen og indvandrernes integration i samfundet. Vi tager afsæt i...

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

Directory of Open Access Journals (Sweden)

Ali Abdirahman A

2012-07-01

Full Text Available Abstract Background Infectious bovine keratoconjunctivitis (IBK or ‘pinkeye’ is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Conclusions Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects. Genetic correlations between IBK incidence

Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle.

Science.gov (United States)

Ali, Abdirahman A; O'Neill, Christopher J; Thomson, Peter C; Kadarmideen, Haja N

2012-07-27

Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species) eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects). Genetic correlations between IBK incidence and tick and helminth egg counts were moderate and opposite between pre

Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

Directory of Open Access Journals (Sweden)

Reinsch Norbert

2009-09-01

Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

The role of nonmagnetic d{sup 0} vs. d{sup 10}B-type cations on the magnetic exchange interactions in osmium double perovskites

Energy Technology Data Exchange (ETDEWEB)

Feng, Hai L., E-mail: Hai.Feng@cpfs.mpg.de [Max Planck Institute for Chemical Physics of Solids, Dresden 01187 (Germany); Yamaura, Kazunari [Research Center for Functional Materials, National Institute for Materials Science, Tsukuba, Ibaraki 305-0044 (Japan); Tjeng, Liu Hao [Max Planck Institute for Chemical Physics of Solids, Dresden 01187 (Germany); Jansen, Martin, E-mail: M.Jansen@fkf.mpg.de [Max Planck Institute for Chemical Physics of Solids, Dresden 01187 (Germany); Max Planck Institute for Solid State Research, Stuttgart 70569 (Germany)

2016-11-15

Polycrystalline samples of double perovskites Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) were synthesized by solid state reactions. They adopt the cubic double perovskite structures (space group, Fm-3m) with ordered B and Os arrangements. Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) show antiferromagnetic transitions at 93 K, 69 K, and 28 K, respectively. The Weiss-temperatures are −590 K for Ba{sub 2}ScOsO{sub 6}, −571 K for Ba{sub 2}YOsO{sub 6}, and −155 K for Ba{sub 2}InOsO{sub 6}. Sc{sup 3+} and Y{sup 3+} have the open-shell d{sup 0} electronic configuration, while In{sup 3+} has the closed-shell d{sup 10}. This indicates that a d{sup 0} B-type cation induces stronger overall magnetic exchange interactions in comparison to a d{sup 10}. Comparison of Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) to their Sr and Ca analogues shows that the structural distortions weaken the overall magnetic exchange interactions. - Graphical abstract: Magnetic properties of osmium double perovskites Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) were studied. Comparison of Ba{sub 2}BOsO{sub 6}indicates that a d{sup 0} B-type cation induces stronger overall magnetic exchange interactions in comparison to a d{sup 10}. - Highlights: • Magnetic properties of double perovskites Ba{sub 2}BOsO{sub 6} (B=Sc, Y, In) were studied. • A d{sup 0}B-type cation induces stronger magnetic interactions than a d{sup 10}. • Structural distortions weaken the overall Os{sup 5+}-Os{sup 5+} magnetic interactions.

Does aging with a cortical lesion increase fall-risk: Examining effect of age versus stroke on intensity modulation of reactive balance responses from slip-like perturbations.

Science.gov (United States)

Patel, Prakruti J; Bhatt, Tanvi

2016-10-01

We examined whether aging with and without a cerebral lesion such as stroke affects modulation of reactive balance response for recovery from increasing intensity of sudden slip-like stance perturbations. Ten young adults, older age-match adults and older chronic stroke survivors were exposed to three different levels of slip-like perturbations, level 1 (7.75m/s(2)), Level II (12.00m/s(2)) and level III (16.75m/s(2)) in stance. The center of mass (COM) state stability was computed as the shortest distance of the instantaneous COM position and velocity relative to base of support (BOS) from a theoretical threshold for backward loss of balance (BLOB). The COM position (XCOM/BOS) and velocity (ẊCOM/BOS) relative to BOS at compensatory step touchdown, compensatory step length and trunk angle at touchdown were also recorded. At liftoff, stability reduced with increasing perturbation intensity across all groups (main effect of intensity pbalance control, potentially contributing toward a higher fall risk in older stroke survivors. Copyright © 2016 IBRO. Published by Elsevier Ltd. All rights reserved.

Esophageal Dysmotility, Gastro-esophageal Reflux Disease, and Lung Transplantation: What Is the Evidence?

Science.gov (United States)

Wood, Richard K

2015-12-01

Lung transplantation is an effective and life-prolonging therapy for patients with advanced lung disease (ALD). However, long-term patient survival following lung transplantation is primarily limited by development of an inflammatory and fibrotic process involving the lung allograft known as bronchiolitis obliterans syndrome (BOS). Although the precise cause of BOS remains uncertain and is likely multifactorial, chronic aspiration of gastro-duodenal contents is one possible contributing factor. Multiple small, cross-sectional studies performed over the past two decades have reported a high prevalence of gastro-esophageal reflux disease (GERD) and esophageal dysmotility in the ALD population and several investigations suggest the prevalence may increase following lung transplantation. More recent studies evaluating the direct effect of gastro-duodenal contents on airways have demonstrated a possible biologic link between GERD and BOS. Despite the recent advances in our understanding of BOS, further investigations are needed to establish GERD as a causative factor in its development. This review will discuss the existing literature that has identified an association of GERD with ALD and post-transplant populations, with a focus on recent advances in the field.

Application of progesterone and testosterone in the diagnose and control of reproduction in crossbreds animal husbandry; Aplicacion de progesterona y testosterona en el diagnostico y control de la reproduccion en ganaderias mestizas

Energy Technology Data Exchange (ETDEWEB)

Madrid-Bury, Ninoska [Fondo Nacional de Investigaciones Agropecuarias (FONAIAP), Centro de Investigaciones Agropecuarias del Estado Zulia, Maracaibo (Venezuela)

1997-07-01

identificacion y control de los problemas reproductivos. En ganaderias mestizas la P4 ha servido para identificar: 1) Dinamica de los ciclos estrales normales, frecuencia de celos anovulatorios, silenciosos y ciclos cortos; 2) Estado reproductivo de las vacas en el hato (94% de exito para identificar gestacion, anestro o ciclicidad); 3) Momento del servicio, destacando error de 19-23% en las observaciones de celo y su reduccion hasta 6-11% aplicando medidas de manejo; 13,7% de vacas repetidoras fueron inseminadas con P4 elevada; 4) Estado de nogestacion (95% de exactitud); 5) Inicio de pubertad (628 d y 309 k), los celos anovulatorios no puberales (8,2%) y los ciclos cortos (16,5%) y su relacion con la Calificacion del Tracto Reproductivo (CTR), Condicion Corporal (CC) y con la mejora nutricional; 6) Reinicio de la ciclicidad posparto, destacando la disociacion celo-ovulacion al caracterizar la actividad luteal al inicio del posparto (63% de FL cortas); 7) Diferentes perfiles del ciclo en vacas repetidoras (10 categorias); 8) Frecuencia de mortalidad embrionaria con variaciones de 6,6-11 y 8-23%; 9) Diagnostico de problemas ovaricos, en especial la presencia de quistes; 10) Una mayor fertilidad (62%) se observa con niveles de 3 o mas ng/ml de P4 4-5 d antes del servicio; y 11) Su integracion en la estrategia para el manejo de los Programas de Control Reproductivo y seguimiento de los tratamientos de sincronizacion del celo. En toretes mestizos, los niveles sericos de testosterona (1,6-1,9 ng/ml) senalan el momento de pubertad.

The effect of dietary rations on the gut morphology of Zebu Cattle ...

African Journals Online (AJOL)

Studies in the Bos taurus cattle have shown the gut morphology to be affected by diet, but there is a paucity of such information in the Bos indicus cattle. A study was conducted to evaluate the morphology of digestive tract of the Tanzanian Short Horn Zebu (TSHZ) cattle under different dietary treatments. A total of 54 TSHZ ...

Factors influencing recalving rate in lactating beef cows in the sweet ...

African Journals Online (AJOL)

goups the majority was also late calving. Recalving rate was high in all other breeding groups and was not influenced by date of calving. In general, Bos taurus type cows calve significantly earlier in the calving season than Bos indicus types (Bonsma &. Skinner, 1969; Holroyd et al., 1979; Gotti el a/., 1985). This is to some ...

Quantitative trait loci mapping of calving and conformation traits on Bos taurus autosome 18 in the German Holstein population.

Science.gov (United States)

Brand, B; Baes, C; Mayer, M; Reinsch, N; Seidenspinner, T; Thaller, G; Kühn, Ch

2010-03-01

Linkage, linkage disequilibrium, and combined linkage and linkage disequilibrium analyses were performed to map quantitative trait loci (QTL) affecting calving and conformation traits on Bos taurus autosome 18 (BTA18) in the German Holstein population. Six paternal half-sib families consisting of a total of 1,054 animals were genotyped on 28 genetic markers in the telomeric region on BTA18 spanning approximately 30 Mb. Calving traits, body type traits, and udder type traits were investigated. Using univariately estimated breeding values, maternal and direct effects on calving ease and stillbirth were analyzed separately for first- and further-parity calvings. The QTL initially identified by separate linkage and linkage disequilibrium analyses could be confirmed by a combined linkage and linkage disequilibrium analysis for udder composite index, udder depth, fore udder attachment, front teat placement, body depth, rump angle, and direct effects on calving ease and stillbirth. Concurrence of QTL peaks and a similar shape of restricted log-likelihood ratio profiles were observed between udder type traits and for body depth and calving traits, respectively. Association analyses were performed for markers flanking the most likely QTL positions by applying a mixed model including a fixed allele effect of the maternally inherited allele and a random polygenic effect. Results indicated that microsatellite marker DIK4234 (located at 53.3 Mb) is associated with maternal effects on stillbirth, direct effects on calving ease, and body depth. A comparison of effects for maternally inherited DIK4234 alleles indicated a favorable, positive correlation of maternal and direct effects on calving. Additionally, the association of maternally inherited DIK4234 marker alleles with body depth implied that conformation traits might provide the functional background of the QTL for calving traits. For udder type traits, the strong coincidence of QTL peaks and the position of the QTL in a

Demographic consequences of increased winter births in a large aseasonally breeding mammal (Bos taurus) in response to climate change.

Science.gov (United States)

Burthe, Sarah; Butler, Adam; Searle, Kate R; Hall, Stephen J G; Thackeray, Stephen J; Wanless, Sarah

2011-11-01

1. Studies examining changes in the scheduling of breeding in response to climate change have focused on species with well-defined breeding seasons. Species exhibiting year-round breeding have received little attention and the magnitudes of any responses are unknown. 2. We investigated phenological data for an enclosed feral population of cattle (Bos taurus L.) in northern England exhibiting year-round breeding. This population is relatively free of human interference. 3. We assessed whether the timing of births had changed over the last 60 years, in response to increasing winter and spring temperatures, changes in herd density, and a regime of lime fertilisation. 4. Median birth date became earlier by 1·0 days per year. Analyses of the seasonal distribution of calving dates showed that significantly fewer calves were born in summer (decline from 44% of total births to 20%) and significantly more in winter (increase from 12% to 30%) over the study period. The most pronounced changes occurred in winter, with significant increases in both the proportion and number of births. Winter births arise from conceptions in the previous spring, and we considered models that investigated climate and weather variables associated with the winter preceding and the spring of conceptions. 5. The proportion of winter births was higher when the onset of the plant growing season was earlier during the spring of conceptions. This relationship was much weaker during years when the site had been fertilised with lime, suggesting that increased forage biomass was over-riding the impacts of changing plant phenology. When the onset of the growing season was late, winter births increased with female density. 6. Recruitment estimates from a stage-structured state-space population model were significantly negatively correlated with the proportion of births in the preceding winter, suggesting that calves born in winter are less likely to survive than those born in other seasons. 7.�

Resultados preliminares del forraje de Morus alba en la alimentación de vacas lecheras

Directory of Open Access Journals (Sweden)

M. Milera

2007-01-01

Full Text Available El objetivo del presente trabajo consistió en evaluar el potencial del forraje de M. alba con vacas mestizas para la producción de leche. El trabajo se desarrolló en Cuba, la cual se encuentra localizada entre los 19° y 81’ de longitud oeste. La Estación Experimental de Pastos y Forrajes “Indio Hatuey” está ubicada en el municipio de Perico, provincia de Matanzas, sobre un suelo ferralítico rojo, a los 22° 40’ 7’’ de latitud norte y 81° 2’ de longitud oeste, a una altura de 10.91 msnm. La evaluación se hizo con vacas mestizas del cruce Holstein x Cebú, que tenían 54 días de lactancia. El estudio se dividió en dos periodos: en el primero (que duró 53 días se suministró el forraje de morera ad libitum, sin trocear, y se pastoreó de forma restringida en gramíneas mejoradas de secano, sin fertilización; en el segundo periodo, los animales dispusieron de pastoreo de gramíneas mejoradas con un 10% de un área establecida con Leucaena leucocephala y recibieron forraje de morera restringido hasta el 1% del peso vivo; éste tuvo una duración de 87 días. Se determinó la disponibilidad de pasto, la composición bromatológica y el consumo de forraje de Morus alba, así como la producción de leche de las vacas. El forraje de morera presentó altos va- lores de proteína y bajos contenidos de fibra; los consumos en el primer periodo llegaron hasta 2.7% del peso vivo. La producción de leche promedio fue de 10.6 kg/vaca/día durante los 140 días de evaluación y la máxima producción se registró en los primeros 53 días (1 kg/vaca/día. Los resultados demostraron la alta calidad de la morera cuando se utiliza como forraje para la alimentación de vacas mestizas. En las condiciones evaluadas, es posible obtener producciones de 10 litros por animal diariamente, cuando se utiliza el forraje de morera en adición al pasto de especies mejoradas, sin suplementación de concentrados.

NCBI nr-aa BLAST: CBRC-AGAM-04-0111 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-AGAM-04-0111 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN Non-imprinted in Prader-Willi/Angelman syndrome region protein 2 hom...olog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 2e-72 51% ...

NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0762 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 2e-97 40% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-3294 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3294 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 1e-135 48% ...

Antibiogram profile of pathogens isolated from processed cow meat

African Journals Online (AJOL)

2016-06-30

Jun 30, 2016 ... Cow meat or beef is the culinary name for meat from bovines especially cattle. The generic name of cow meat is Bos taurus and the habitable weather of Bos taurus includes temperature of 101.50F (38.60C) and ability to live in a harsh terrains (Li et al., 2006). The processing of cow meat begins from ...

Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

Directory of Open Access Journals (Sweden)

Leslie Scarpelli

2009-01-01

Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

Evaluation of pregnancy rates of Bos indicus cows subjected to different synchronization ovulation protocols using injectable progesterone or an intravaginal device

Directory of Open Access Journals (Sweden)

Jefferson Tadeu Campos

2016-12-01

Full Text Available This study evaluated the pregnancy rate in Nelore cows (Bos indicus that were subjected to fixed-time artificial insemination (FTAI using different protocols consisting of injectable progesterone (P4 or an intravaginal device (impregnated with P4. Multiparous cows 72-84 months in age, 30-45 days postpartum, were selected on the basis of the absence of a corpus luteum (CL and follicles < 8 mm after transrectal palpation and ultrasound examinations. On a random day of the estrus cycle (D0, the selected animals (n = 135 were randomly assigned to one of three experimental groups (n = 45 each. Group I (injectable P4/FTAI 36 hours received 250 mg of injectable P4 and 2 mg EB on D0; on D7, they received 500 µg of cloprostenol; on D8, 300 IU of eCG and 1 mg of EB were administered; and finally, FTAI was performed 36 hours after the application of EB. Group II (injectable P4/FTAI 48 hours received the same protocol as Group I, except that the FTAI was performed 48 hours after ovulation induction. The animals of Group III (Control/CIDR received a conventional protocol for FTAI using an intravaginal device (D0: P4 and 2 mg EB; D8: device removal, 500 µg cloprostenol, 300 IU eCG, 1 mg EB; and FTAI performed 48 hours after removal of the device. The results showed that cows synchronized with the conventional protocol for FTAI (Control/CIDR had a higher pregnancy rate (60 %, 27/45 than those synchronized with an injectable P4/FTAI 36 hours (33.33 %; 15/45, P = 0.010. However, the group receiving injectable P4 group/FTAI 48 hours had a similar pregnancy rate (48.9 %; 22/45; P = 0.290 when compared to both the group receiving the conventional protocol and that receiving injectable P4/FTAI 36 hours (P = 0.134. Although the injectable P4 may affect pregnancy rate with the FTAI performed in 36 hours, we found similar pregnancy rates from cows inseminated 48 hours after induction ovulation, considering injectable or intravaginal P4. Therefore, we suggest that

Hiperplasia epitelial focal en la cavidad bucal. Reporte de casos en dos comunidades del Estado de México

Directory of Open Access Journals (Sweden)

Blanca Silvia González López

1999-01-01

Full Text Available Un total de 426 escolares de ascendencia mazahua y 2,856 escolares mestizos, entre 6 y 16 años de edad, originarios del Estado de México, fueron examinados para determinar si presentaban hiperplasia epitelial focal. En el grupo mazahua se detectó una prevalencia de 7.09%, la más alta reportada en el país; mientras que en el grupo mestizo fue de 1.08%, similar a la referida en la población mestiza de otros países de Latinoamérica.

Performance e identidad en la fiesta "carnavalesca" de la Virgen de la Candelaria en Puno : la puesta en escena de dos mundos que entran en tensión

OpenAIRE

Tito Mamani, Charo

2012-01-01

La problemática de la identidad y performance en una ―puesta en escena‖como lo es la fiesta de la Candelaria en Puno nos muestra todo un mundo de encuentros y desencuentros, de diálogo y de tensiones a la vez. Pues estas construcciones colectivas de identidad local– las identidades son tanto hegemónicas como subalternas; originarias, mestizas o modernas– buscan mecanismos de auto-afirmación situados en un espacio y en un tiempo determinado asignado por este magnífico evento como es la fies...

La genética de las poblaciones centroamericanas

OpenAIRE

Barrantes, Ramiro

2005-01-01

Las poblaciones centroamericanas no han sido objeto de muchos estudios genéticos con la excepción de análisis esporádicos de la variación entre y dentro de los grupos amerindios y de origen africano ubicados en el área. No obstante, en los últimos 15 años se efectuaron investigaciones sistemáticas en este sentido incluyendo poblaciones mestizas, particularmente las de Costa Rica y Panamá. En los amerindios se efectuaron estudios detallados de su estructura genética y las relaciones filogenéti...

Utilización de la leucaena leucocephala como suplemento en cabras en crecimiento

OpenAIRE

Clavero, Tyrone; Razz, Rosa

2009-01-01

Con el objeto de evaluar el crecimiento de cabras mestizas (Nubian x Criollo) suplementadas con Leucaena leucocephala, se realizó un ensayo en el Occidente de Venezuela en una zona caracterizada como Bosque muy Seco Tropical. Se evaluaron tres raciones: T1 (pastoreo en gramínea-Cenchrus cillaris), T2 (pastoreo en gramínea + 2 h/día en Leucaena), T3 (pastoreo en gramínea + alimento concentrado comercial, 300 g/animal/día). El diseño experimental fue de bloques completamente al azar. El peso de...

Pemodelan Sistem Informasi Untuk Mengukur Kualitas Kinerja Perguruan Tinggi dengan Pendekatan Balanced Scorecard dan Blue Ocean Strategy

Directory of Open Access Journals (Sweden)

Herlinah Baharuddin

2016-01-01

Full Text Available Semakin tingginya persaingan saat ini, khususnya perguruan tinggi bidang pendidikan, memunculkan kebutuhan strategi bisnis untuk bertahan. Pemodelan Sistem Informasi dengan pendekatan Balanced Scorecardkini merupakan salah satu tujuan dalam pencapaian pengukuran hasil kinerja untuk mencapai sasaran perguruan tinggi serta menciptakan inovasi solusi dengan menerapkan Blue Ocean sehingga selaras dengan strategi bisnis yang dijalankan. Pemodelan sistem informasi yang akan dibahas adalah menggunakan strategi bisnis Balanced Scorecard (BSC diintegrasikan dengan Blue Ocean Strategy (BOS. Dengan sifat-sifat pada BSC dan BOS, model ini menjawab kebutuhan Strategi Sistem Informasi pada perguruan tinggi yang berkarakteristik dinamis, inovatif, dan tingkat persaingan tinggi dengan hasil pencapaian kinerja yang terukur. Pemodelan sistem informasi diimplementasikan pada Universitas Pancasakti Makassar. Hasil menunjukkan komponen-komponen perguruan tinggi yang dipetakan ke dalam 4 perspektif BSC, yaitu perspektif pelanggan, finansial, proses bisnis internal, pembelajaran dan pertumbuhan dan kanvas strategi serta kerangka kerja 4 langkah pada BOS yaitu kurangi-tingkatkan-hapus-ciptakan. Hasil penelitian berupa pengukuran penilaian kinerja dengan program aplikasi berbasis web, yang merupakan bagian dari sistem informasi management perguruan tinggi. Sistem ini memberikan informasi kepada seluruh anggota yang terkait tentang kualitas kinerja. Kata kunci : Balanced Scorecard(BSC; Kualitas kinerja; Blue ocean strategy(BOS; Web; Perguruan tinggi

The Bosnian Train and Equip Program: A Lesson in Interagency Integration of Hard and Soft Power

Science.gov (United States)

2014-03-01

even before Bos- nia officially declared independence. Most of the weaponry and commanders from the former Yugoslav People’s Army in Bosnia, which was...ability, and disposition.” 505 It covers characteristics that research indicates affect team performance including attitudinal, de- mographic, and...The Train and Equip Program reduced foreign influence in the Federation, which helped remove impediments to reconciliation and integration in Bos- nia

Adgang til sundhedsservice i yderområder

DEFF Research Database (Denmark)

Sørensen, Jens Fyhn Lykke; Svendsen, Gunnar Lind Haase

Denne undersøgelse har til formål at belyse motiver bag landlig og urban bosætning. I særdeleshed fokuseres på, om udbuddet af sundhedsydelser har afgørende betydning for bosætningen og - i så fald - om anvendelsen af eHealth løsninger kan modvirke en fraflytning af borgere i egne, der er ramt af...

Functional assays for the assessment of the pathogenicity of variants of GOSR2, an ER-to-Golgi SNARE involved in progressive myoclonus epilepsies

Directory of Open Access Journals (Sweden)

Jörn M. Völker

2017-12-01

Full Text Available Progressive myoclonus epilepsies (PMEs are inherited disorders characterized by myoclonus, generalized tonic-clonic seizures, and ataxia. One of the genes that is associated with PME is the ER-to-Golgi Qb-SNARE GOSR2, which forms a SNARE complex with syntaxin-5, Bet1 and Sec22b. Most PME patients are homo­zygous for a p.Gly144Trp mutation and develop similar clinical presentations. Recently, a patient who was compound heterozygous for p.Gly144Trp and a previously unseen p.Lys164del mutation was identified. Because this patient presented with a milder disease phenotype, we hypothesized that the p.Lys164del mutation may be less severe compared to p.Gly144Trp. To characterize the effect of the p.Gly144Trp and p.Lys164del mutations, both of which are present in the SNARE motif of GOSR2, we examined the corresponding mutations in the yeast ortholog Bos1. Yeasts expressing the orthologous mutants in Bos1 showed impaired growth, suggesting a partial loss of function, which was more severe for the Bos1 p.Gly176Trp mutation. Using anisotropy and gel filtration, we report that Bos1 p.Gly176Trp and p.Arg196del are capable of complex formation, but with partly reduced activity. Molecular dynamics (MD simulations showed that the hydrophobic core, which triggers SNARE complex formation, is compromised due to the glycine-to-tryptophan substitution in both GOSR2 and Bos1. In contrast, the deletion of residue p.Lys164 (or p.Arg196del in Bos1 interferes with the formation of hydrogen bonds between GOSR2 and syntaxin-5. Despite these perturbations, all SNARE complexes stayed intact during longer simulations. Thus, our data suggest that the milder course of disease in compound heterozygous PME is due to less severe impairment of the SNARE function.

Selectivity of thiobencarb between two lettuce (Lactuca sativa, L.) cultivars

International Nuclear Information System (INIS)

Reiners, S.

1987-01-01

Thiobencarb [S-(4-chlorobenzyl)N,N-diethylthiocarbamate] was examined for weed control on muck grown lettuce. Weed control results were erratic though differential lettuce tolerance was observed in the field. This led to the testing of five lettuce cultivars for tolerance to the herbicide. Of the five lettuce cultivars evaluated, two were selected with the widest tolerance differences: Great Lakes 366 (GLA) (tolerant) and Dark Green Boston (BOS) (susceptible). Studies examining the mechanism of thiobencarb tolerance were conducted with these two cultivars. Within four days after the addition of thiobencarb to the nutrient solution, BOS had significant reductions in the foliar dry weight. In addition, growth abnormalities including fused leaves were observed, indicating inhibition early in leaf development. Greater amounts of 14 C-thiobencarb were absorbed from nutrient solution by BOS, likely due to a significantly greater root system at the time of treatment. The greater uptake and accumulation of 14 C-label in the leaves, as well as significantly greater amounts of unmetabolized 14 C-thiobencarb in the foliage of BOS may account for the selectivity observed. A thiobencarb sulfoxide was not identified in these studies. This indicates that the metabolism of thiobencarb in lettuce differs from other members of the thiocarbamate family of herbicides

Limitations in the use of 14C-glycocholate breath and stool bile acid determinations in patients with chronic diarrhea

International Nuclear Information System (INIS)

Ferguson, J.; Walker, K.; Thomson, A.B.

1986-01-01

Analysis of a modified 14 C-glycocholate breath test on 165 consecutive in-patients being investigated for chronic diarrhea showed that the measurement of 14 CO 2 between 3 and 6 h after oral dosing of 5 microCi of 14 C-glycocholic acid was of only limited use to distinguish between patients with Crohn's disease (CD), idiopathic bile salt wastage (IBW), or ileal resection (IR) from those with the irritable bowel syndrome (IBS). Continuing 14 CO 2 collections for up to 24 h was of little more help in establishing the presence of bacterial overgrowth syndrome (BOS) and in distinguishing between BOS and CD. Stool bile acid measurements were of use in differentiating between IBW and IBS, but did not distinguish between CD and BOS or between CD and IR. Since the range of normal values was defined by measurements in the IBS group, a positive test was specific for an organic cause of chronic diarrhea. Even so, the sensitivity of the test was relatively low: CD, 53%; IR, 23%; IBW, 14 %; and BOS, 10%. We believe that the 24-h 14 C-glycocholic breath test combined with the measurement of stool bile acids represents a screening test of only limited use for the identification of organic causes of chronic diarrhea

Low-cost modular array-field designs for flat-panel and concentrator photovoltaic systems

Science.gov (United States)

Post, H. N.; Carmichael, D. C.; Alexander, G.; Castle, J. A.

1982-09-01

Described are the design and development of low-cost, modular array fields for flat-panel and concentrator photovoltaic (PV) systems. The objective of the work was to reduce substantially the cost of the array-field Balance-of-System (BOS) subsystems and site-specific design costs as compared to previous PV installations. These subsystems include site preparation, foundations, support structures, electrical writing, grounding, lightning protection, electromagnetic interference considerations, and controls. To reduce these BOS and design costs, standardized modular (building-block) designs for flat-panel and concentrator array fields have been developed that are fully integrated and optimized for lowest life-cycle costs. Using drawings and specifications now available, these building-block designs can be used in multiples to install various size array fields. The developed designs are immediately applicable (1982) and reduce the array-field BOS costs to a fraction of previous costs.

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprint...ed in Prader-Willi/Angelman syndrome region protein 2 homolog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 1e-140 88% ...

Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds

OpenAIRE

Xu, Yao; Jiang, Yu; Shi, Tao; Cai, Hanfang; Lan, Xianyong; Zhao, Xin; Plath, Martin; Chen, Hong

2017-01-01

Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus) and Qinchuan (Bos taurus) are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 ...

Duplicidad parcial cefálicafacial (diprosopia) en bovinos: estudio clínico patológico de un caso

OpenAIRE

Vale Echeto, Oswaldo E.; Alvarado Morillo, Manuel S.; Vale Oviedo, Oswaldo R.; Arraga de Alvarado, Cruz María; Camacho Bracho, Jesús E.; Fernández Orozco, Edgar

2009-01-01

Se reporta un caso de malformación rara, con duplicidad incompleta cefálicafacial (Diprosopia) en un Bovino, hembra de 10 días de edad, la becerra fue producto de la segunda gestación de una vaca mestiza cebú, procedente de una explotación lechera con sistema extensivo de producción y monta natural. No pudo ser amamantada y se mantuvo con alimentación artificial. El animal nació con duplicidad incompleta cafálica facial, observándose dos maxilares inferiores con doble cavidad oral y nasal, do...

El culto de Maximón en Guatemala

OpenAIRE

Pédron‑Colombani, Sylvie

2009-01-01

Este artículo se enfoca en la figura de Maximón, deidad sincrética de Guatemala, en un contexto de desplazamiento de la religión católica popular por parte de las iglesias protestantes. Esta divinidad híbrida a la cual se agregan santos católicos como Judas Iscariote o el dios maya Mam, permite la apropiación de Maximón por segmentos diferenciados de la población (tanto indígena como mestiza). Permite igualmente ser símbolo de protestas sociales enmascaradas cuando se asocia Maximón con figur...

Observación de la conducta sexual en un rebaño bovino de doble propósito en el estado Trujillo

OpenAIRE

Linares, Eivar

2009-01-01

La identificación de la conducta sexual de los bovinos de la ganadería mestiza de doble propósito en la Republica Bolivariana de Venezuela, ha sido relativamente poco estudiada a pesar de constituir una de las tareas más importantes que se desarrollan en el control reproductivo en un sistema de explotación bajo la técnica de inseminación artificial. Para determinar los principales síntomas y signo del celo asociados a la primera monta de celo observada, en una finca de ganado mestizo de d...

Breeding programs for the main economically important traits of zebu dairy cattle

Directory of Open Access Journals (Sweden)

Ariosto Ardila Silva

2010-06-01

Full Text Available In tropical regions, Gyr and Guzerat breeds (Bos indicus are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically superior sires in the herds. A major objective of QTL (Quantitative Trait Loci and candidate genes is to find genes and markers that can be implemented in breeding programs across marker assisted selection (MAS. In Zebu dairy cattle MAS could be used to pre-select young candidate bulls to progeny testing, thus increasing selection differentials, shortening generation interval and increasing genetic gain

Independent mitochondrial origin and historical genetic differentiation in North Eastern Asian cattle.

Science.gov (United States)

Mannen, H; Kohno, M; Nagata, Y; Tsuji, S; Bradley, D G; Yeo, J S; Nyamsamba, D; Zagdsuren, Y; Yokohama, M; Nomura, K; Amano, T

2004-08-01

In order to clarify the origin and genetic diversity of cattle in North Eastern Asia, this study examined mitochondrial displacement loop sequence variation and frequencies of Bos taurus and Bos indicus Y chromosome haplotypes in Japanese, Mongolian, and Korean native cattle. In mitochondrial analyses, 20% of Mongolian cattle carried B. indicus mitochondrial haplotypes, but Japanese and Korean cattle carried only B. taurus haplotypes. In contrast, all samples revealed B. taurus Y chromosome haplotypes. This may be due to the import of zebu and other cattle during the Mongol Empire era with subsequent crossing with native taurine cattle. B. taurus mtDNA sequences fall into several geographically distributed haplogroups and one of these, termed here T4, is described in each of the test samples, but has not been observed in Near Eastern, European or African cattle. This may have been locally domesticated from an East Eurasian strain of Bos primigenius.

Imunoidentification of Albumin and Osteopontin in Seminal Plasma of Taurine and Zebuine Bulls/ Imunoidentificação de Albumina e Osteopontina no Plasma Seminal de Reprodutores Taurinos e Zebuínos

Directory of Open Access Journals (Sweden)

Rodrigo Costa Mattos

2002-05-01

Full Text Available Two dimensional polyacrylamide gel electrophoresis was performed in seminal plasma of seven Bos taurus taurus and seven Bos taurus indicus bulls with high semen freezability, from an artificialinsemination center. In a 8% polyacrylamide gels, three bands of 195, 66 and 55 kDa, present in 100% of the samples in both sub-species, were analyzed by their optical densities. In Bos taurus samples, the opticals densities of 55 kDa band, imunoidentified as osteopontin were superior (pAs proteínas do plasma seminal de 14 reprodutores (7 Bos taurus taurus e 7 Bos taurus indicus, foram analisadas por eletroforese bidimensional, em géis de poliacrilamida a 8%, corados por Comassie Blue. Três bandas protéicas, presentes em 100% das amostras de plasma seminal, foram quantificadas de acordo com a densidade óptica exibida: 195 kDa, pI 6,5-7,5 ; 66 kDa, pI 5,4 e 55 kDa, pI 4,5. As amostras de plasma seminal provenientes de taurinos apresentaram densidades ópticas significativamente superiores (p < 0,05 às dos zebuínos na banda de 55 kDa, que foi imunoidentificada como osteopontina. As demais proteínas analisadas não apresentaram variações significativas entre as subespécies. A banda protéica de 66 kDa, foi imunoidentificada como albumina. Nas amostras provenientes de taurinos, as densidades ópticas das três bandas protéicas quantificadas não evidenciaram variação significativa entre os reprodutores. Entretanto, nos zebuínos, as densidades ópticas da albumina apresentaram diferenças significativas entre os touros (p < 0,05.

PECULIARITIES OF THE COURSE OF THE UPPER ALIMENTARY TRACT DISEASES IN CHILDREN WITH BRONCHOOBSTRUCTIVE SYNDROME.

Science.gov (United States)

Vorotnikova, N A; Eiberman, A S; Chernenkov, Yu V; Rodionova, T V

2015-01-01

The aim of the study was to improve the tactics of treatment of bronchoobstructive syndrome (BOS) in associative course with gastroesophageal reflux disease (GERD) in children. 180 children aged 6-16 with diseases of the respiratory organs with BOS and GERD symptoms were examined: 85 of them--with bronchial asthma (BA), 34--with an acute course of pneumonia, 29--with recurrent obstructive bronchitis. Comparison groups were composed of 93 children, the number of practically healthy children (the control group) was 28 persons. The analysis of risk factors of associative pathology development, roentgenographic study, investigation of the function of external respiration (FER) (peak flowmetry, spirometry), intracavitary pH-metry, esophagofibrogastroduodenoscopy (EFGDS) and ultrasonic investigation (USI) of the organs of the gastro-intestinal tract (GIT) were carried out. Diseases of the respiratory organs with BOS in the groups of the patients under investigation in 43.9% of cases on an average associated with GERD. In a severe course of bronchial asthma GERD was detected 3,4 times more frequently in the boys, while in a lengthy course of pneumonia with BOS--1,9 times more frequently in the girls. Chronic gastritis (ChG) and chronic gastroduodenitis (ChGD) in BA were revealed in 40.6% of the patients, in pneumonia--in 45.7%, in recurrent bronchitis--in 33.3% of the patients. Peculiarities of pre-morbid background of BA and GERD associative course were exhibited by gestosis, threat of abortion, intrauterine hypoxia of the fetus, social troubles of the family. Manifestations of BA in children in 36% of cases were observed 6-12 months after the onset of GERD. The designed individual anti-reflux programs in complex therapy of respiratory organs' diseases with BOS associated with GERD reduce the frequency of exacerbations and hospitalizations of patients with BA, improve their life quality.

Description of Mycobacterium chelonae subsp. bovis subsp. nov., isolated from cattle (Bos taurus coreanae), emended description of Mycobacterium chelonae and creation of Mycobacterium chelonae subsp. chelonae subsp. nov.

Science.gov (United States)

Kim, Byoung-Jun; Kim, Ga-Na; Kim, Bo-Ram; Jeon, Che Ok; Jeong, Joseph; Lee, Seon Ho; Lim, Ji-Hun; Lee, Seung-Heon; Kim, Chang Ki; Kook, Yoon-Hoh; Kim, Bum-Joon

2017-10-01

Three rapidly growing mycobacterial strains, QIA-37 T , QIA-40 and QIA-41, were isolated from the lymph nodes of three separate Korean native cattle, Hanwoo (Bos taurus coreanae). These strains were previously shown to be phylogenetically distinct but closely related to Mycobacterium chelonae ATCC 35752 T by taxonomic approaches targeting three genes (16S rRNA, hsp6 and rpoB) and were further characterized using a polyphasic approach in this study. The 16S rRNA gene sequences of all three strains showed 99.7 % sequence similarity with that of the M. chelonae type strain. A multilocus sequence typing analysis targeting 10 housekeeping genes, including hsp65 and rpoB, revealed a phylogenetic cluster of these strains with M. chelonae. DNA-DNA hybridization values of 78.2 % between QIA-37 T and M. chelonae indicated that it belongs to M. chelonae but is a novel subspecies distinct from M. chelonae. Phylogenetic analysis based on whole-genome sequences revealed a 95.44±0.06 % average nucleotide identity (ANI) value with M. chelonae, slightly higher than the 95.0 % ANI criterion for determining a novel species. In addition, distinct phenotypic characteristics such as positive growth at 37 °C, at which temperature M. chelonae does not grow, further support the taxonomic status of these strains as representatives of a novel subspecies of M. chelonae. Therefore, we propose an emended description of Mycobacterium chelonae, and descriptions of M. chelonae subsp. chelonae subsp. nov. and M. chelonae subsp. bovis subsp. nov. are presented; strains ATCC 35752 T (=CCUG 47445 T =CIP 104535 T =DSM 43804 T =JCM 6388 T =NCTC 946 T ) and QIA-37 T (=KCTC 39630 T =JCM 30986 T ) are the type strains of the two novel subspecies.

Relative impact of human leukocyte antigen mismatching and graft ischemic time after lung transplantation.

Science.gov (United States)

Brugière, Olivier; Thabut, Gabriel; Suberbielle, Caroline; Reynaud-Gaubert, Martine; Thomas, Pascal; Pison, Christophe; Saint Raymond, Christel; Mornex, Jean-François; Bertocchi, Michèle; Dromer, Claire; Velly, Jean-François; Stern, Marc; Philippe, Bruno; Dauriat, Gaëlle; Biondi, Giuseppina; Castier, Yves; Fournier, Michel

2008-06-01

Recent data strongly suggest that human leukocyte antigen (HLA) mismatching has a negative impact on development of bronchiolitis obliterans syndrome (BOS) and survival after lung transplantation (LTx). Because HLA matching is sometimes achieved by extending ischemic time in other solid-organ transplantation models and ischemic time is a risk factor per se for death after LTx, we sought to compare the theoretical benefit of HLA matching with the negative impact of lengthened ischemic time. In this collaborative study we compared the relative impact of HLA mismatching and ischemic time on BOS and survival in 182 LTx recipients. Using multivariate analyses, we observed a lower incidence of BOS (hazard ratio [HR] = 1.70, 95% confidence interval [CI]: 1.1 to 2.7, p = 0.03) and enhanced survival (HR = 1.91, 95% CI: 1.24 to 2.92, p = 0.01) in patients with zero or one HLA-A mismatch compared with those having two HLA-A mismatches. This beneficial effect on survival was equivalent to a reduction of ischemic time of 168 minutes. We observed a reduced incidence of BOS and a better survival rate in patients well-matched at the HLA-A locus, associated with an opposite effect of an enhanced ischemic time. This suggests that graft ischemic time should be taken into account in future studies of prospective HLA matching in LTx.

Relationship between Metabolic Syndrome and Ocular Microcirculation Shown by Laser Speckle Flowgraphy in a Hospital Setting Devoted to Sleep Apnea Syndrome Diagnostics

Directory of Open Access Journals (Sweden)

Tomoaki Shiba

2017-01-01

Full Text Available Purpose. To clarify whether the incidence of metabolic syndrome (MetS and the overlap of MetS components are affecting the ocular circulation shown by laser speckle flowgraphy (LSFG. Materials and Methods. We studied 76 consistent patients. Blowout score (BOS and blowout time (BOT, which are the pulse waveform analysis parameters, and mean blur rate (MBR using LSFG in the optic nerve head (ONH and choroid were evaluated. Throughout, the ONH was separated out from the vessels and tissue for analysis and MBRs in the ONH were divided into four sections (superior, temporal, inferior, and nasal. Results. Thirty-two patients were diagnosed having Mets. MBR-Tissue (P=0.003, MBR-All (P=0.01, MBR-Choroid (P=0.04, and BOS-Choroid (P=0.03 were significantly lower in patients with MetS than in the patients without MetS. Multiple-regression analysis revealed the temporal side of MBR-Tissue and BOS-Choroid which were identified as factors contributing independently to the overlap of the MetS components. Multiple-regression analysis also revealed that the MetS components were identified to be factors independently contributing to the BOS-Choroid and temporal side of MBR-Tissue. Conclusion. Our study clarified that the incidence of MetS and the overlap of the MetS components are significantly affecting the ONH and choroidal microcirculation.

Detection and quantification of Duffy antigen on bovine red blood cell membranes using a polyclonal antibody

Directory of Open Access Journals (Sweden)

Ana Teresa B.F. Antonangelo

2012-09-01

Full Text Available Babesiosis is one of the most important diseases affecting livestock agriculture worldwide. Animals from the subspecies Bos taurus indicus are more resistant to babesiosis than those from Bos taurus taurus. The genera Babesia and Plasmodium are Apicomplexa hemoparasites and share features such as invasion of red blood cells (RBC. The glycoprotein Duffy is the only human erythrocyte receptor for Pasmodium vivax and a mutation which abolishes expression of this glycoprotein on erythrocyte surfaces is responsible for making the majority of people originating from the indigenous populations of West Africa resistant to P. vivax. The current work detected and quantified the Duffy antigen on Bos taurus indicus and Bos taurus taurus erythrocyte surfaces using a polyclonal antibody in order to investigate if differences in susceptibility to Babesia are due to different levels of Duffy antigen expression on the RBCs of these animals, as is known to be the case in human beings for interactions of Plasmodium vivax-Duffy antigen. ELISA tests showed that the antibody that was raised against Duffy antigens detected the presence of Duffy antigen in both subspecies and that the amount of this antigen on those erythrocyte membranes was similar. These results indicate that the greater resistance of B. taurus indicus to babesiosis cannot be explained by the absence or lower expression of Duffy antigen on RBC surfaces.

Uso de extratos vegetais, vitaminas e sua associação sobre o desempenho, temperamento e qualidade de carne de bovinos nelore confinados com dieta de alto grão

OpenAIRE

Silva, Maurícia Brandão da [UNESP

2015-01-01

Fifty-six Nellore (Bos taurus indicus) young bulls of 360 (±19,8) kg initial weight and 20 month of age were used to evaluate the effect of plant extract, vitamins A, D3 supplementation and their associations on the temperament, feedlot performance (finishing phase) and meat quality of Bos indicus cattle. Animals were located in individual pens during 105 days (21 and 84 days, for adaptation and trial period, respectively). Animals were individually weighed, and blocked by initial body weight...

Market Barriers to Solar in Michigan

Energy Technology Data Exchange (ETDEWEB)

Miller, E.; Nobler, E.; Wolf, C.; Doris, E.

2012-08-01

The solar industry in the United States is at a turning point; the cost of PV hardware has declined substantially in recent years, placing new attention on reducing the balance of system (BOS) costs of solar that now contribute to a growing percentage of installation expenses. How states address these costs through the creation of a favorable policy and regulatory environment is proving to be a critical determinant of a thriving statewide solar market. This report addresses the permitting and tax issues that may stimulate the solar market growth in Michigan. By making PV installations easier to complete through reduced BOS costs, Michigan would become a more attractive location for manufacturers and installers. As PV module costs decline and BOS costs make up a greater share of the cost of solar, action taken today on these issues will prove beneficial in the long term, providing Michigan an opportunity to establish a leadership position in the solar industry.

Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study

Directory of Open Access Journals (Sweden)

JOSEFA M. NASCIMENTO-ROCHA

2017-08-01

Full Text Available ABSTRACT Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli], and farm level i.e., milking room hygiene (-Milking room, dunghill location, and replacement female. Ureaplasma diversum was present in 41.1% of the samples. Independent risk factors for U. diversum were +GVV (odds ratio [OR], 1.31; +Mycoplasma spp (OR, 5.67; yearly milk production (4500 kg or more (OR, 1.99; +Bos taurus (OR, 1.68; +E. coli (OR, 4.96; -milking room (OR, 2.31; and replacement females (OR, 1.89. Ureaplasma diversum vaginal colonization was strongly associated with Mycoplasma spp., E. coli, and number of pregnant cows.

Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study.

Science.gov (United States)

Nascimento-Rocha, Josefa M; Oliveira, Benedito D DE; Arnhold, Emannuel; Pôrto, Regiani N G; Lima, Svetlana F; Gambarini, Maria Lucia

2017-01-01

Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli]), and farm level i.e., milking room hygiene (-Milking room), dunghill location, and replacement female). Ureaplasma diversum was present in 41.1% of the samples. Independent risk factors for U. diversum were +GVV (odds ratio [OR], 1.31); +Mycoplasma spp (OR, 5.67); yearly milk production (4500 kg or more) (OR, 1.99); +Bos taurus (OR, 1.68); +E. coli (OR, 4.96); -milking room (OR, 2.31); and replacement females (OR, 1.89). Ureaplasma diversum vaginal colonization was strongly associated with Mycoplasma spp., E. coli, and number of pregnant cows.

La acción política de las viudas de pilotos en la Ciudad de Guatemala

Directory of Open Access Journals (Sweden)

Manuela Camus

2014-10-01

Full Text Available The political action of the widows of bus drivers in the City of GuatemalaA wide range of violent acts is occurring within the context of a Guatemala caught in a post-conflictive problematic. Many urban transport drivers in Guatemala City have been executed by members of ‘pandillas’ or ‘maras’ (gangs to force the payment of the extortion money, leaving their families devastated by the trama and the difficulties of survival. This paper centres on the difficulties that the widows of these drivers organized in AVITRANS (Association of Transport Widows are facing in their political struggle for government support and social recognition when they are seen as being delegitimized for being poor, mestiza and coming from the ‘grey zone’ areas of this metropolis. This case study attempts to analyse the consequences of the neoliberal model in practice.Resumen La Guatemala postconflicto se encuentra abrumada por una amplia gama de violencias. Muchos pilotos del transporte urbano de la ciudad de Guatemala son ejecutados por miembros de las pandillas o maras para forzar el pago de las extorsiones quedando sus familiares devastados por el trauma y las dificultades de la sobrevivencia. Este texto se centra en las dificultades que las viudas de estos pilotos organizadas en AVITRANS (Asociación de Viudas del Transporte enfrentan en su lucha política por el apoyo del gobierno y el reconocimiento social al verse deslegitimadas por ser pobres, mestizas y procedentes de la ‘zona gris’ de las colonias de esta metrópolis. El caso permite considerar las consecuencias del modelo neoliberal en la práctica.

Red Beads and Love Magic. Cross-Cultural Exchanges Between Spain and new Spain in Modern Era

Directory of Open Access Journals (Sweden)

Carla Andreia Martins Torres

2018-01-01

Full Text Available This paper is about the significance of particular red beads used in love magic during the 17th and 18th centuries, specifically on the construction of symbolic universe through perceptions based on «others» materiality. It aims to provide a connected studied between Spain and New Spain through the histories of the gipsy Generosa Vicente and mestiza Margarita Palacios recovered from the Inquisition authorities notes. This is the way to understand the extent to which cross-cultural contacts privilege the transmission of ideas associated with objects, and how they were used apparently with similar purposes but with a very different meaning.

"Nuestra América": José Martí ante la Razón Moderna

OpenAIRE

Pedro Pablo Rodríguez

2015-01-01

Este artículo es un acercamiento al difícil y singular diálogo con el pensamiento moderno y sus procedimientos del escritor, pensador y político cubano José Martí. La tesis es que el ideario de Martí expresó los intereses y la perspectiva de los pueblos de Hispanoamérica, a la que llamó Nuestra América, por oposición, según escribió ¿a la otra América, que no es nuestra¿. Plenamente consciente de que la identidad de la región se sustentaba en una cultura nueva, mestiza de lo aborigen y lo esp...

Prólogo

OpenAIRE

Beverley, John

2013-01-01

En una entrevista hecha a Ángel Rama un poco antes de su muerte en 1983, se le preguntó si en la última novela de José María Arguedas, El zorro de arriba y el zorro de abajo, había todavía una esperanza para la cultura indígena. Rama respondió de la siguiente manera: Sin duda, pero no de la cultura indígena sino de la cultura mestiza, porque la cultura india ya no tenía sentido. Lo que él [Arguedas] comprendió es que efectivamente la salida era esa barrosa salida del mestizaje. Ese zigzaguean...

Addison disease’s in puppy, congenital adrenal hyperplasia (adrenal 21 alpha hydroxilase deficiency) and Hypoparathyroidism in Dogs

OpenAIRE

Castillo, Víctor; Ortemberg, L.

2009-01-01

La enfermedad de Addison (EA), la hiperplasia adrenal congénita (HAC) por déficit de 21 αhidroxilasa adrenal y el hipoparatiroidismo (HoPTH) son de diagnóstico poco frecuente, representando el 3% (EA) y 0,5% (tanto HAC como HoPTH) de las enfermedades endócrinas atendidas. Se describen 1 caso de EA congénito (collie de 6 meses de edad), 2 casos de HAC (una caniche toy y una labradora, ambas de 2 años) y 2 de HoPTH (cocker spaniel de 11 meses y una mestiza de 7 años). Por la signología clínica ...

Ablação cirúrgica dos bulbos olfatórios em coelhos: modelo para estudos de patogenia de infecções por vírus neurotrópicos

Directory of Open Access Journals (Sweden)

Fonseca Erika Toledo da

2006-01-01

Full Text Available Coelhos têm sido utilizados como modelo para o estudo da neuropatogenia da infecção pelo herpesvírus bovino tipo 5 (BHV-5, um importante agente de doença neurológica em bovinos. O sistema olfatório tem sido apontado como a principal via de acesso do vírus ao cérebro após replicação na cavidade nasal. Para investigar a importância da via olfatória na patogenia da infecção neurológica pelo BHV-5, foi elaborada e avaliada uma técnica operatória de craniotomia transfrontal para remoção dos bulbos olfatórios (BOs, definindo-se as órbitas como referência anatômica. Foram utilizados 45 coelhos com 30 dias de idade, sendo 23 submetidos à ablação cirúrgica dos BOs e posteriormente inoculados pela via intranasal (IN ou no saco conjuntival (IC com o BHV-5. Após incisões de pele, tecido subcutâneo e periósteo, a craniotomia foi realizada em um ponto eqüidistante entre os cantos mediais dos olhos, com uma broca sulcada de 3mm acoplada a uma perfuratriz elétrica de baixa rotação. A remoção dos BOs foi realizada com uma sonda uretral ndegrees6 acoplada a um aspirador. O estudo macroscópico de três animais após a cirurgia comprovou que o procedimento foi eficiente na remoção total dos BOs. Isso também foi comprovado pela interrupção do acesso do vírus ao córtex cerebral: apenas um animal (1/11 ou 9,1% no grupo submetido à ablação dos BOs com inoculação IN desenvolveu enfermidade neurológica, contra 100% (10/10 dos coelhos controle. Conclui-se que a técnica de craniotomia transfrontal utilizando a órbita como referência anatômica permite o acesso adequado para localização e remoção dos BOs e pode ser utilizada em estudos de patogenia de infecções por vírus neurotrópicos que exijam a interrupção completa da via olfatória.

Uros, genética, indígenas y colonos. A propósito de la Neolitización de Europa

OpenAIRE

Alday, Alfonso .; Carretero, José Miguel; Anderung, Cecilia .; Götherström, Anders .

2012-01-01

Las analíticas genéticas realizadas sobre los uros (Bos primigenius) del yacimiento de Mendandia (Treviño), han ofrecido un resultado sorprendente: uno de los individuos pertenece al haplotypo T3, generalmente asociado a animales domésticos (Bos taurus). La datación de la muestra (7265 ± 70 BP; Ua 34366) es acorde con las otras conocidas de su nivel, el III-superior, incidiendo en la antigüedad de su Neolítico. El dato es la excusa para reflexionar sobre el proceso neolitizador y adentrarnos ...

Estudo genômico do nível de infecção por Babesia bovis em bovinos da raça angus

OpenAIRE

Santana, Clarissa Helena [UNESP

2016-01-01

A bovinocultura é um setor com importante destaque no agronegócio brasileiro. O carrapato Ripicephalus (Boophilus) microplus é responsável por perdas econômicas significativas aos pecuaristas e é vetor de hemoparasitoses como Anaplasma spp e Babesia spp. Sabe-se que os bovinos Bos taurus taurus são mais susceptíveis à infestação por carrapatos do que Bos taurus indicus. Acredita-se que o mesmo ocorra para a infecção por Babesia bovis. Neste trabalho, foram avaliados, em duas colheitas, 355 bo...

PV experience curves for the Netherlands

International Nuclear Information System (INIS)

Gerwig, R.

2005-01-01

Experience curves are one of several tools used by policy makers to take a look at market development. Numerous curves have been constructed for PV but none specific to the Netherlands. The objective of this report is to take a look at the price development of grid-connected PV systems in the Netherlands using the experience curve theory. After a literature and internet search and attempts to acquire information from PV companies information on 51% of the totally installed capacity was found. Curves for the period 1991-2001 were constructed based on system price, BOS (balance-of-system) price and inverter price. The progress ratio of the locally learning BOS was similar to the globally learning module market. This indicates that the pace of development of the Dutch PV market is similar to the globally followed pace. Improvement of the detail of the data might help to get a better idea of which BOS components have declined most. The similar progress ratio also shows the importance of investing both in module and system research as is the case in the Netherlands

Nosewitness Identification: Effects of Lineup Size and Retention Interval.

Science.gov (United States)

Alho, Laura; Soares, Sandra C; Costa, Liliana P; Pinto, Elisa; Ferreira, Jacqueline H T; Sorjonen, Kimmo; Silva, Carlos F; Olsson, Mats J

2016-01-01

Although canine identification of body odor (BO) has been widely used as forensic evidence, the concept of nosewitness identification by human observers was only recently put to the test. The results indicated that BOs associated with male characters in authentic crime videos could later be identified in BO lineup tests well above chance. To further evaluate nosewitness memory, we assessed the effects of lineup size (Experiment 1) and retention interval (Experiment 2), using a forced-choice memory test. The results showed that nosewitness identification works for all lineup sizes (3, 5, and 8 BOs), but that larger lineups compromise identification performance in similarity to observations from eye- and earwitness studies. Also in line with previous eye- and earwitness studies, but in disagreement with some studies on odor memory, Experiment 2 showed significant forgetting between shorter retention intervals (15 min) and longer retention intervals (1-week) using lineups of five BOs. Altogether this study shows that identification of BO in a forensic setting is possible and has limits and characteristics in line with witness identification through other sensory modalities.

Hubungan Kekerabatan Sapi Aceh dengan Menggunakan Daerah Displacement-loop

Directory of Open Access Journals (Sweden)

Mohd. Agus Nashri Abdullah

2008-10-01

Full Text Available Relationship of aceh cattle using displacement-loop region ABSTRACT. The aims of this study were to describe relationship of D-loop of mtDNA Aceh cattle which is useful database for conducting conservation programme. The whole blood samples were collected (8 samples for D-loop analysis from four locations which were Aceh Besar, Pidie, North Aceh regencies and Banda Aceh city. Out group whole blood samples were collected from two samples from Bali cattles (Bali Island, Madura cattle (Madura Island, Pesisir cattle (West Sumatera respectively and one sample from PO cattle (West Java. Amplification of D-loop sequences of mtDNA with BIDLF and BIDLR primary have PCR product 980 bp. The Data were analyzed using Squint 1.02 and MEGA 4.0 programme. Result of analysis indicate that Aceh cattle have nearer relationship with zebu and there is items inset of genetik Bali cattle (Bos javanicus at the end sequences start ke-354 situs up to 483, so that the origin Aceh cattle was from Bos indicus which have hybridization with Bos javanicus.

Duality, phase structures, and dilemmas in symmetric quantum games

International Nuclear Information System (INIS)

Ichikawa, Tsubasa; Tsutsui, Izumi

2007-01-01

Symmetric quantum games for 2-player, 2-qubit strategies are analyzed in detail by using a scheme in which all pure states in the 2-qubit Hilbert space are utilized for strategies. We consider two different types of symmetric games exemplified by the familiar games, the Battle of the Sexes (BoS) and the Prisoners' Dilemma (PD). These two types of symmetric games are shown to be related by a duality map, which ensures that they share common phase structures with respect to the equilibria of the strategies. We find eight distinct phase structures possible for the symmetric games, which are determined by the classical payoff matrices from which the quantum games are defined. We also discuss the possibility of resolving the dilemmas in the classical BoS, PD, and the Stag Hunt (SH) game based on the phase structures obtained in the quantum games. It is observed that quantization cannot resolve the dilemma fully for the BoS, while it generically can for the PD and SH if appropriate correlations for the strategies of the players are provided

APROXIMACIÓN A LAS PRÁCTICAS EDUCATIVAS EN TRES CONTEXTOS CULTURALMENTE DIVERSOS DESDE LA PERSPECTIVA DE LOS ESTUDIANTES EN FORMACIÓN DE LA LICENCIATURA EN BIOLOGÍA. (Pag 94-107

Directory of Open Access Journals (Sweden)

Norma , Constanza Castaño

2013-08-01

Full Text Available La Universidad Pedagógica Nacional, a través de la Licenciatura en Biología, desarrolla procesos de formación inicial de maestros en Bogotá, con tres tipos de poblaciones en precarias condiciones socioeconómicas: campesinas mestizas del Valle de Tenza, comunidades indígenas de La Chorrera, en la Amazonía Colombiana, en condiciones que amenazan su supervivencia física y cultural y comunidades mestizas, indígenas y afrodescendientes en Puerto Asís en el Bajo Putumayo. Dada la importancia de bosquejar lo que acontece en estos contextos diversos y la pertinencia de los modelos y enfoques planteados, se han propuesto una serie de alternativas e innovaciones, teniendo en cuenta factores como la pertinencia y el contexto, la ciencia como construcción social, la interculturalidad, la biopolítica, entre otros aspectos que son cruciales en el momento de pensar una enseñanza con sentido para los niños y jóvenes colombianos. Esta investigación, se propuso entonces realizar una aproximación a los proyectos de práctica de los estudiantes de la Licenciatura en Biología en Bogotá, Valle de Tenza y Puerto Asís. Se usó una metodología basada en un enfoque cualitativo interpretativo. Los resultados muestran que se forman maestros que presentan formas distintas de desarrollar su práctica, vista desde la ética es decir, desde el reconocimiento del sujeto y de los contextos en los que habita, del otro, pero también de sí mismos, para reconstruir formas subjetivas que generan nuevas miradas y sentidos al quehacer del maestro, que permita visibilizarlo como agente de cambio en el ámbito social, cultural, pero además como un sujeto político continuamente activo

El territorio cultural en real de catorce-wirikuta

Directory of Open Access Journals (Sweden)

Guadalupe Salazar-González

2014-10-01

Full Text Available El presente trabajo expondrá el caso de la región Real de Catorce-Wirikuta, que incluye no sólo el poblado de dicho nombre (con población mestiza local y nacional, y extranjeros sino el territorio conocido como Wirikuta, que es la zona sagrada del pueblo indígena Wirrárika (conocido comúnmente como huicholes, además del entorno natural con fauna y flora endémica y otros asentamientos como son minas, socavones de minas, hacienda de beneficio minero, pueblos y rancherías, algunos habitados por población mestiza y otros abandonados. La idea es hacer la identificación del territorio, de su caracterización, funcionamiento y lo que le depara su futuro, pues actualmente está amenazado por: la explotación minera cielo abierto y el beneficio con cianuro (sistema metalúrgico; por el turismo “cultural peyotero” y religioso; por el tráfico de fauna silvestre; y por la llegada de pobladores de otras culturas. Las bases para ello están en la geografía, la historia de la apropiación del espacio geográfico por diversos grupos culturales e intereses y las prácticas sociales: su uso profano y sagrado; su uso cotidiano y cíclico; su significación y resignificación social; y el ejercicio del dominio territorial, la propiedad y la legislación que ahí opera. Todo lo cual manifiesta los diversos modos de vida, cosmovisión, usos y apropiación del territorio, y la relación con la naturaleza que cada cultura tiene, y por tanto entran en confrontación por el dominio del mismo espacio, pero sobre todo revela la incomprensión de el otro en todos esos aspectos.

The soil physics contributions of Edgar Buckingham

Science.gov (United States)

Nimmo, J.R.; Landa, E.R.

2005-01-01

During 1902 to 1906 as a soil physicist at the USDA Bureau of Soils (BOS), Edgar Buckingham originated the concepts of matric potential, soil-water retention curves, specific water capacity, and unsaturated hydraulic conductivity (K) as a distinct property of a soil. He applied a formula equivalent to Darcy's law (though without specific mention of Darcy's work) to unsaturated flow. He also contributed significant research on quasi-empirical formulas for K as a function of water content, water flow in capillary crevices and in thin films, and scaling. Buckingham's work on gas flow in soils produced paradigms that are consistent with our current understanding. His work on evaporation elucidated the concept of self-mulching and produced sound and sometimes paradoxical generalizations concerning conditions that favor or retard evaporation. Largely overshadowing those achievements, however, is that he launched a theory, still accepted today, that could predict transient water content as a function of time and space. Recently discovered documents reveal some of the arguments Buckingham had with BOS officials, including the text of a two-paragraph conclusion of his famous 1907 report on soil water, and the official letter documenting rejection of that text. Strained interpersonal relations motivated the departure of Buckingham and other brilliant physicists (N.E. Dorsey, F.H. King, and Lyman Briggs) from the BOS during 1903 to 1906. Given that Buckingham and his BOS colleagues had been rapidly developing the means of quantifying unsaturated flow, these strained relations probably slowed the advancement of unsaturated flow theory. ?? Soil Science Society of America.

[Treatment of bronchial obstruction in patients with pulmonary tuberculosis].

Science.gov (United States)

Shmelev, E I; Kuklina, G M; Kalinina, E E

2004-01-01

Whether the main points of treatment for bronchial obstructive syndrome (BOS) in chronic obstructive lung disease (COLD) can be adapted for patients with pulmonary tuberculosis (PT) was studied. For this purpose, 435 patients with PT with signs of BOS (forced expiratory volume at 1 second (FEV1) 70% of the normal values; 2) 229 patients with FEV1 69-50%; 3) 102 patients with FEV1 bronchial obstructive syndrome in patients with pulmonary tuberculosis was highly effective, promotes the amelioration of the degree of respiratory symptoms in patients with IPT by 2 to 8 times, in those with FCPT by more than 2-3 times, and in those with PS by 1.45-10 times. The differences in the efficiency of bronchodilator therapy depend on the baseline level of bronchial obstruction. In patients with pulmonary tuberculosis concurrent with BO, the use of current inhalation bronchodilator therapy results in a substantial increase in FEV1, which differentiates BOS in PT from COLD. The use of the proposed therapy in the multimodality treatment of patients with pulmonary tuberculosis showed no statistically significant differences in the changes in the degree of X-ray symptoms while this therapy permits acceleration of abacillation in patients with IPT by 16.8% and in those with FCPT by 14.8%. Effective bronchodilator therapy considerably enhances life quality in patients. Thus, early systematic and long-term performance of the bronchodilator therapy, based on the principles of bronchodilator therapy for COLD, in patients with PT concurrent with BOS may substantially enhance the efficiency of treatment in this category of patients.

On the Path to SunShot. The Role of Advancements in Solar Photovoltaic Efficiency, Reliability, and Costs

Energy Technology Data Exchange (ETDEWEB)

Woodhouse, Michael [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jones-Albertus, Rebecca [U.S. Dept. of Energy, Washington, DC (United States); Feldman, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Fu, Ran [National Renewable Energy Lab. (NREL), Golden, CO (United States); Horowitz, Kelsey [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chung, Donald [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jordan, Dirk [National Renewable Energy Lab. (NREL), Golden, CO (United States); Kurtz, Sarah [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-05-01

This report examines the remaining challenges to achieving the competitive photovoltaic (PV) costs and large-scale deployment envisioned under the U.S. Department of Energy's SunShot Initiative. Solar-energy cost reductions can be realized through lower PV module and balance-of-system (BOS) costs as well as improved system efficiency and reliability. Numerous combinations of PV improvements could help achieve the levelized cost of electricity (LCOE) goals because of the tradeoffs among key metrics like module price, efficiency, and degradation rate as well as system price and lifetime. Using LCOE modeling based on bottom-up cost analysis, two specific pathways are mapped to exemplify the many possible approaches to module cost reductions of 29%-38% between 2015 and 2020. BOS hardware and soft cost reductions, ranging from 54%-77% of total cost reductions, are also modeled. The residential sector's high supply-chain costs, labor requirements, and customer-acquisition costs give it the greatest BOS cost-reduction opportunities, followed by the commercial sector, although opportunities are available to the utility-scale sector as well. Finally, a future scenario is considered in which very high PV penetration requires additional costs to facilitate grid integration and increased power-system flexibility--which might necessitate even lower solar LCOEs. The analysis of a pathway to 3-5 cents/kWh PV systems underscores the importance of combining robust improvements in PV module and BOS costs as well as PV system efficiency and reliability if such aggressive long-term targets are to be achieved.

Dual Origins of Dairy Cattle Farming – Evidence from a Comprehensive Survey of European Y-Chromosomal Variation

DEFF Research Database (Denmark)

Edwards, Ceiridwen J; Genja, Catarina; Kantanen, Juha

2011-01-01

, with limited breed panels, identified two Bos taurus (taurine) haplogroups (Y1 and Y2; both composed of several haplotypes) and one Bos indicus (indicine/zebu) haplogroup (Y3), as well as a strong phylogeographic structuring of paternal lineages. Methodology and Principal Findings: Haplogroup data were......, the Nordic region and Russia, with the highest Ychromosomal diversity seen in the Iberian Peninsula. Conclusions: We propose that the homogeneous Y1 and Y2 regions reflect founder effects associated with the development and expansion of two groups of dairy cattle, the pied or red breeds from the North Sea...

Genome variability in European and American bison detected using the BovineSNP50 BeadChip

DEFF Research Database (Denmark)

Pertoldi, C.; Wójcik, Jan M; Tokarska, Małgorzata

2010-01-01

 The remaining wild populations of bison have all been through severe bottlenecks. The genomic consequences of these bottlenecks present an interesting area to study. Using a very large panel of SNPs developed in Bos taurus we have carried out a genome-wide screening on the European bison (Bison...... bonasus; EB) and on two subspecies of American bison: the plains bison (B. bison bison; PB) and the wood bison (B. bison athabascae; WB). One hundred bison samples were genotyped for 52,978 SNPs along with seven breeds of domestic bovine Bos taurus. Only 2,209 of the SNPs were polymorphic in the bison...

Modelo de gestão em bancos de olhos e seu impacto no resultado destas organizações

Directory of Open Access Journals (Sweden)

Christiana Velloso Rebello Hilgert

2012-02-01

Full Text Available OBJETIVO: Avaliar a eficácia do modelo de gestão adotado pelo Banco de Olhos de Sorocaba (BOS e Banco de Olhos da Santa Casa de Campo Grande (BOSC, segundo os critérios do Prêmio Nacional de Gestão em Saúde (PNGS e demonstrar as características comuns e discordantes entre os dois Bancos de Olhos e um paralelo entre a efetividade do modelo de gestão adotado e o resultado destas organizações na doação de córneas. MÉTODOS: Foi aplicado o questionário "Como estamos progredindo?", disponibilizado pela Fundação Malcolm Baldrige, composto por 40 questões fechadas agrupadas nos sete critérios do PNGS (Liderança, Planejamento Estratégico, Foco no Cliente e no Mercado, Foco em Recursos Humanos, Critério Gestão de Informações, Gestão de Processos, e Resultados em toda a força de trabalho das duas instituições (21 funcionários do BOS e 8 do BOSC. Os resultados foram analisados utilizando o Teste Exato de Fischer e Teste não-paramétrico U de Mann-Whitney para comparação das médias entre as duas instituições. RESULTADOS: Foram entrevistados 21 funcionários do BOS e 8 funcionários do BOSC. O teste de Mann-Whitney mostrou uma maior concordância às proposições do questionário pelos respondentes do BOS em 6 dos 7 itens estudados (Liderança, Planejamento Estratégico, Foco no Cliente e no Mercado, Foco em Recursos Humanos, Gestão de Processos, e Resultados. Não houve diferença estatisticamente significativa no Critério Gestão de Informações. A maior diferença entre as duas instituições foi encontrada no critério Gestão de Processos (p<0.001. CONCLUSÃO: O modelo de gestão presente no BOS apresenta aspectos distintos e estatisticamente significantes comparados ao BOSC, em 6 dos 7 critérios estudados pelo questionário aplicado. O BOS é o que mais se aproxima de conceitos internacionalmente aceitos de excelência em gestão baseados nos critérios do PNGS do que o BOSC, sendo um dos motivos prováveis do

Effects of temperament and acclimation to handling on feedlot performance of Bos taurus feeder cattle originated from a rangeland-based cow-calf system.

Science.gov (United States)

Francisco, C L; Cooke, R F; Marques, R S; Mills, R R; Bohnert, D W

2012-12-01

= 0.03) and tended to have decreased DMI (P = 0.07) compared with controls. Acclimated steers had greater plasma haptoglobin on d 4 (P = 0.04) and greater ceruloplasmin from d 0 to 10 (P ≤ 0.04) and tended to have greater cortisol on d 1 (P = 0.08) than controls. In conclusion, temperament affects productivity of beef operations based on Bos taurus feeder cattle reared in extensive rangeland systems until weaning whereas acclimation to handling ameliorated cattle temperament but did not benefit feedlot receiving performance.

BOS MOrth cases prize 2011.

Science.gov (United States)

Patel, Jigar Vipinchandra

2013-12-01

This paper describes the orthodontic treatment of two cases awarded the prize by the British Orthodontic Society for best treated cases submitted for the Membership in Orthodontics. The first case reports on the treatment of a class III malocclusion with increased vertical lower anterior facial proportions and dentoalveolar compensation that was treated with orthodontic camouflage. The second case reports on the treatment of a class II division II malocclusion with reduced vertical lower anterior facial proportions and an overbite complete to the palate, which was treated with orthodontic camouflage.

Etniske minoriteters bosætning

DEFF Research Database (Denmark)

Børresen, Sølvi Karin

Etniske minoriteter synes at samles i bestemte dele af boligbestanden og i bestemte boligområder. Hvorfor forholder det sig sådan? Forskningen viser, at forklaringerne er sammensatte. I denne rapport gøres rede for udvalgte danske og udenlandske undersøgelser vedrørende etniske minoriteters...

Efeito estacional sobre características ovarianas e produção de oócitos em vacas Bos indicus no Mato Grosso do Sul

Directory of Open Access Journals (Sweden)

Carlos Eurico Fernandes

2001-01-01

Full Text Available Verificou-se o efeito de duas distintas estações do ano (seca e chuvosa sobre algumas características ovarianas em vacas Bos indicus abatidas na região de Campo Grande, MS. Ovários (n = 10 foram obtidos nos meses de novembro e dezembro de 1998 e de janeiro a outubro de 1999. No laboratório, os ovários foram avaliados quanto ao peso (g, volume (Vol. (cm³ = 3/4 p x comprimento/2 x largura/2 x espessura/2, número de corpos lúteos, número de folículos com >; 9 mm de diâmetro, número total de folículos com menos de 9 mm, número de oócitos, oócitos viáveis e oócitos degenerados. O efeito principal da estação (seca ou chuvosa foi estimado pela análise de variância (teste t, para modelos completamente ao acaso. Utilizou-se a análise da correlação simples entre as variáveis estudadas, ajustadas para o efeito da estação. Os resultados revelaram que o peso dos ovários (5,1 x 6,5 g, folículos totais (10,1 x 13,7, corpos lúteos (0,32 x 0,47, p < 0,05 e a percentagem de oócitos viáveis (19,6% x 35,6% sobre o total de oócitos variaram significativamente (p < 0,01 entre as estações seca e chuvosa, respectivamente. A análise da correlação (r mostrou coeficientes significativos (p < 0,01 entre peso e volume (r = 0,78, peso e total de folículos (r = 0,32, peso e corpos lúteos (r = 0,41, total de folículos e oócitos viáveis (r = 57, entre outros. Concluiu-se que importantes modificações na função ovariana, com base na produção e qualidade dos oócitos, podem ser estimadas entre a estação seca e chuvosa. Com base nestas características, a estação chuvosa torna-se mais favorável para a implantação de programas reprodutivos em rebanhos comerciais.

ANALISIS DE COSTEO PARA UN SISTEMA DE PRODUCCION DE LECHERIA ESPECIALIZADA "UN ACERCAMIENTO AL ANÁLISIS ECONÓMICO EN GANADERÍA DE LECHE": ESTUDIO DE CASO

Directory of Open Access Journals (Sweden)

GLORIA P. RÍOS ATEHORTÚA

2008-01-01

Full Text Available Con este estudio se pretende mostrar a pequeños y medianos productores de sistemas de producción de lechería especializada, un método adecuado para determinar costos de producción, mediante la estructuración de centros de costos de los procesos productivos allí identificados (praderas, cría y levante y centros de utilidades (producción de leche; herramienta que se convierte en la mayor fuente de información interna en las empresas, con el fin de posibilitar la toma de decisiones administrativas adecuadas. Para el estudio de caso, fue seleccionada La Pradera, finca ubicada en la vereda La Almería, municipio de la Unión, Antioquia. Los análisis económicos muestran el comportamiento de los diferentes elementos de costo en la obtención del costo unitario de producción por: litro de leche, kilogramo de pasto, mantenimiento promedio por día de un ternero y de una novilla.

Gene : CBRC-TTRU-01-1304 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

Association of udder traits with single nucleotide polymorphisms in crossbred Bos indicus-Bos taurus cows.

Science.gov (United States)

Tolleson, M W; Gill, C A; Herring, A D; Riggs, P K; Sawyer, J E; Sanders, J O; Riley, D G

2017-06-01

The size, support, and health of udders limit the productive life of beef cows, especially those with background, because, in general, such cows have a reputation for problems with udders. Genomic association studies of bovine udder traits have been conducted in dairy cattle and recently in Continental European beef breeds but not in cows with background. The objective of this study was to determine associations of SNP and udder support scores, teat length, and teat diameter in half (Nellore), half (Angus) cows. Udders of cows ( = 295) born from 2003 to 2007 were evaluated for udder support and teat length and diameter ( = 1,746 records) from 2005 through 2014. These included a subjective score representing udder support (values of 1 indicated poorly supported, pendulous udders and values of 9 indicated very well-supported udders) and lengths and diameters of individual teats in the 4 udder quarters as well as the average. Cows were in full-sibling or half-sibling families. Residuals for each trait were produced from repeated records models with cow age category nested within birth year of cows. Those residuals were averaged to become the dependent variables for genomewide association analyses. Regression analyses of those dependent variables included genotypic values as explanatory variables for 34,980 SNP from a commercially available array and included the genomic relationship matrix. Fifteen SNP loci on BTA 5 were associated (false discovery rate controlled at 0.05) with udder support score. One of those was also detected as associated with average teat diameter. Three of those 15 SNP were located within genes, including one each in (), (), and (). These are notable for their functional role in some aspect of mammary gland formation or health. Other candidate genes for these traits in the vicinity of the SNP loci include () and (). Because these were detected in Nellore-Angus crossbred cows, which typically have very well-formed udders with excellent support across their productive lives, similar efforts in other breeds should be completed, because that may facilitate further refinement of genomic regions responsible for variation in udder traits important in multiple breeds.

Application of schlieren techniques for improved understanding of underground mine ventilation

Energy Technology Data Exchange (ETDEWEB)

Jong, E.C.; Luxbacher, K.D. [Virginia Tech, Blacksburg, VA (United States)

2010-07-01

Mine ventilation systems must be maintained in optimal running order in order to suppress dusts and provide fresh air to mine workers. However, it is difficult to gather representative ventilation data because of the dynamic nature of mines, including geologic conditions, equipment operations, personnel movements, advance of mine openings and atmospheric changes. Errors and imprecision in computer codes can be detrimental to mine forecasting. The best way to improve the validity of ventilation models is to increase the quality of survey data. This study examined the feasibility of using the background-oriented schlieren (BOS) flow visualization method to reach this objective. Schlieren techniques involve the use of refractive properties of different air densities to enhance the distortions of light, thereby allowing airflow to be visualized. In this study, the BOS technique was used to image flow with 2 fans, an axivane fan and a custom built axial flow fan. The results showed that the BOS technique can clearly display air flow under the correct conditions. Producing an accurate picture of air flow can improve the industry's overall understanding of air flow and resistance, thus improving mine safety and productivity. 8 refs., 7 figs.

Application of schlieren techniques for improved understanding of underground mine ventilation

International Nuclear Information System (INIS)

Jong, E.C.; Luxbacher, K.D.

2010-01-01

Mine ventilation systems must be maintained in optimal running order in order to suppress dusts and provide fresh air to mine workers. However, it is difficult to gather representative ventilation data because of the dynamic nature of mines, including geologic conditions, equipment operations, personnel movements, advance of mine openings and atmospheric changes. Errors and imprecision in computer codes can be detrimental to mine forecasting. The best way to improve the validity of ventilation models is to increase the quality of survey data. This study examined the feasibility of using the background-oriented schlieren (BOS) flow visualization method to reach this objective. Schlieren techniques involve the use of refractive properties of different air densities to enhance the distortions of light, thereby allowing airflow to be visualized. In this study, the BOS technique was used to image flow with 2 fans, an axivane fan and a custom built axial flow fan. The results showed that the BOS technique can clearly display air flow under the correct conditions. Producing an accurate picture of air flow can improve the industry's overall understanding of air flow and resistance, thus improving mine safety and productivity. 8 refs., 7 figs.

Activity in a premotor cortical nucleus of zebra finches is locally organized and exhibits auditory selectivity in neurons but not in glia.

Directory of Open Access Journals (Sweden)

Michael H Graber

Full Text Available Motor functions are often guided by sensory experience, most convincingly illustrated by complex learned behaviors. Key to sensory guidance in motor areas may be the structural and functional organization of sensory inputs and their evoked responses. We study sensory responses in large populations of neurons and neuron-assistive cells in the songbird motor area HVC, an auditory-vocal brain area involved in sensory learning and in adult song production. HVC spike responses to auditory stimulation display remarkable preference for the bird's own song (BOS compared to other stimuli. Using two-photon calcium imaging in anesthetized zebra finches we measure the spatio-temporal structure of baseline activity and of auditory evoked responses in identified populations of HVC cells. We find strong correlations between calcium signal fluctuations in nearby cells of a given type, both in identified neurons and in astroglia. In identified HVC neurons only, auditory stimulation decorrelates ongoing calcium signals, less for BOS than for other sound stimuli. Overall, calcium transients show strong preference for BOS in identified HVC neurons but not in astroglia, showing diversity in local functional organization among identified neuron and astroglia populations.

Gastrointestinal Strongyle Egg Output and its Relationship with Tick Burden in Gambian N'dama and Gobra Zebu Cattle

Directory of Open Access Journals (Sweden)

Mattioli, RC.

1995-01-01

Full Text Available Fortnightly quantitative analysis of rectal faecal samples for the presence of strongyle eggs were carried out from May 1992 to April 1993 on 11 Gambian N'dama Bos taurus and 11 Gobra zebu Bos indicus cattle. Significantly (P <0.001 lower strongyle egg outputs were found in N'dama in comparison with zebu cattle. No correlation was found between individual cumulative tick burden and strongyle egg output in either breed, although individual variations in parasite burdens were lower in N'dama than in zebu cattle. This study strenghtens the evidence for the presence of a natural resistant trait to strongyle infection in N'dama cattle.

Dicty_cDB: Contig-U05787-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 534 ) Bos taurus clone CH240-467E17, WORKING DRAFT SEQU... 32 2.9 2 ( BD142887 ) Method of simple and quick determ.... 34 3.1 3 ( AR634817 ) Sequence 19 from patent US 6852489. 34 3.1 3 ( BD142885 ) Method of simple and quick determ...clone SSL573. 172 9e-64 2 ( EK498372 ) 1095505197154 Global-Ocean-Sampling_GS-32-...0.049 12 ( AC161851 ) Bos taurus clone CH240-99E24, WORKING DRAFT SEQUE... 44 0.049 2 ( EK274769 ) 1095462272251 Global-Ocean-Sampli...95458103663 Global-Ocean-Sampling_GS-26-01-01-1... 44 0.23 2 ( AC208960 ) Nomascu

SUSCEPTIBILIDADE DE BOVINOS DAS RAÇAS JERSEY E GIR À ACIDOSE LÁCTICA RUMINAL: II - ACIDOSE METABÓLICAE METABOLIZAÇÃO DO LACTATO-L SUSCEPTIBILITY OF JERSEY AND GIR STEERS TO RUMEN LACTIC ACIDOSIS: II - METABOLIC ACIDOSIS AND L-LACTATE METABOLISM

Directory of Open Access Journals (Sweden)

Celso Akio Maruta

2002-02-01

Full Text Available Quatro garrotes Jersey (J (Bos taurus e quatro Gir (G (Bos indicus foram utilizados para comparar a susceptibilidade de zebuínos e taurinos à acidose láctica ruminal (ALR. Neste trabalho, acompanhou-se o grau da acidose metabólica (AM e a metabolização do lactato-L. A ALR foi induzida com a administração de sacarose intraruminal. Amostras de sangue foram colhidas nos seguintes momentos: zero, 14, 16, 18, 20, 22 e 24 horas. Foram determinadas as concentrações de lactato total, de seus isômeros L e D e o perfil hemogasométrico. Nos momentos mais críticos observados (14ªh a 18ªh, a AM foi severa em ambas as raças, porém, ao término do experimento, esta passou a grau moderado nos garrotes G, mantendo-se severa nos J. Os animais J absorveram, do rúmen, maiores quantidades de lactato-D, o qual apresentou correlação negativa com o pH sangüíneo (r = - 0,78. Por outro lado, o lactato-L foi mais absorvido e utilizado nos bovinos G, contribuindo para a restauração parcial do equilíbrio ácido-básico e gerando alterações nas pCO2 e pO2. Os garrotes zebuínos da raça Gir apresentaram menor susceptibilidade à AM que os taurinos da raça Jersey.In order to compare the susceptibility to acute rumen lactic acidosis (RLA, four Jersey (J (Bos taurus and four Gir (G (Bos indicus steers were used to evaluate the degree of metabolic acidosis (MA and the metabolism of L-lactate during the RLA. The RLA was induced by the administration of sucrose into the rumen. Blood samples were collected at following times: zero, 14th,16th, 18th, 20th, 22nd and 24th h. Total lactic acid and its isomers, and blood gas determination were measured. At the most critical moments (14th to 18th h the MA was severe in both breeds, but the MA became moderate in the G steers and remained severe in the J steers at the end of the trial. Higher amounts of D-lactate was absorbed from the rumen to the blood of the J steers; the higher the D-lactate plasma level, the

Solar, Install, Mount, Production, Labor, Equipment Balance of Systems

Energy Technology Data Exchange (ETDEWEB)

Gentry, Russell [Georgia Tech Applied Research Corporation, Atlanta, GA (United States); Al-Haddad, Tristan [Georgia Tech Applied Research Corporation, Atlanta, GA (United States); Valdes, Francisco [Georgia Tech Applied Research Corporation, Atlanta, GA (United States); Caravati, Kevin [Georgia Tech Applied Research Corporation, Atlanta, GA (United States); Goodman, Joseph [Georgia Tech Applied Research Corporation, Atlanta, GA (United States)

2015-08-27

The GTRI led project team in partnership with the DOE, universities, and numerous industry leaders, have advanced the mission of the DOE EERE, the Solar Energy Technologies Program, and the SunShot Initiative by accelerating the research, development, and demonstration of solar PV technologies that provide Extreme Balance of Systems Cost Reductions (BOS-X). The research produced 132 design concepts, resulting in 19 invention disclosures, five patent applications, four 90% pre-commercial designs, and three licensed technologies. Technology practice rights were obtained by an industry partner, and a new solar commercial start-up company was launched in Atlanta as a result of this project. Innovations in residential, commercial, and utility scale balance of systems technologies were realized through an unprecedented multi-disciplinary university/industry partnership with over 50 students and 24 faculty members that produced 18 technical publications, a PhD thesis, and two commercially deployed operating prototypes. The technical effectiveness and economic feasibility of the multidisciplinary systems based approach executed by the project team was realized through 1) a comprehensive evaluation of industry, regulatory, and public stakeholder requirements; 2) numerous industry/student/faculty engagements in design studios, technical conferences, and at solar PV installation sites; 3) time and motion studies with domain experts that provided technical data and costs for each phase and component of the solar PV installation processes; 4) extensive wind tunnel and systems engineering modeling; and 5) design, construction, and demonstration of the selected technologies in the field at high profile sites in Atlanta. The SIMPLE BOS project has benefitted the public in the following ways: • Workforce development: The launch of a start-up company to commercialize the DOE funded SIMPLE BoS designs has directly created 9 new jobs in the State of Georgia. As of November 2014, the

77 FR 17492 - Expansion of Global Entry to Additional Airports

Science.gov (United States)

2012-03-26

...--Logan International Airport, Boston, Massachusetts (BOS); Las Vegas--McCarran International Airport, Las... following four additional airports: St. Paul International Airport, Minneapolis, Minnesota (MSP); Charlotte...

Effect of heat stress on rumen temperature of three breeds of cattle

Science.gov (United States)

Lees, A. M.; Lees, J. C.; Lisle, A. T.; Sullivan, M. L.; Gaughan, J. B.

2018-02-01

Thirty-six steers (12 of each Angus, Charolais, and Brahman) with an initial BW of 318.5 ± 6.7 kg were used in a 130-day study. Two treatments were imposed: un-shaded and shaded (3 m2/animal; 90% solar block shade cloth). On day 1, steers were administered with rumen temperature boluses. Rumen temperatures ( T RUM) were obtained at 10 min intervals over the duration of the study to determine differences in T RUM between Bos indicus and Bos taurus cattle. Six feedlot pens (162 m2) were used with six steers (2/breed) per pen with three pens/treatment. Ambient dry bulb temperature ( T A; °C), relative humidity (RH; %), wind speed (WS; m/s) and direction, and solar radiation (SR; W/m2) were recorded at 10 min intervals. Rainfall (mm) was collected daily at 0900 h. From these data, black globe temperature (BGT; °C), temperature humidity index (THI), heat load index (HLI), and accumulated heat load (AHL) were calculated. Individual T RUM were converted to an hourly average and then mean hourly T RUM were converted to a mean within hour T RUM across the 130 days. Rumen temperatures were analyzed using an autoregressive repeated measures model. The model analyzed the effect of breed ( P < 0.0002), treatment ( P = 0.3543), time of day (hour, h; P < 0.0001), breed × treatment ( P < 0.3683), breed × h ( P < 0.0001), treatment × h ( P < 0.0001), breed × treatment × h ( P = 0.0029), pen within treatment ( P = 0.0195), and animal × breed × treatment within pen ( P = 0.1041). Furthermore, there were breed × treatment × hour differences in T RUM ( P = 0.0036), indicating that Bos indicus and Bos taurus regulate T RUM differently.

[Burnout syndrome. Legal medicine: analysis and evaluation INAIL protection in cases of suicide induced by burnout within the helping professions].

Science.gov (United States)

Carlini, Luigi; Fidenzi, Luca; Gualtieri, Giacomo; Nucci, Giulia; Fagiolini, Andrea; Coluccia, Anna; Gabbrielli, Mario

2016-01-01

After a survey of the definition and etiopathogenesis of burnout syndrome (BOS) carried out with the support of the most reliable available literature on the subject, the essay focuses on clinical evaluation (psychometric identification and quantification) of burn-out. In accordance with Circular 71/2003 of INAIL, it is assumed to be essential both legally and scientifically knowledge that the syndrome of burnout, knowledge, which involves an analysis of the case conducted with objective strictness and critical sensibility. It is carried out by collecting data on work history, physiological history, remote and proximal pathological history and performing a physical examination including neuro-psychiatric and psycho-diagnostic tests surveys. Only after the ascertainment of an effective existence of a psychiatric syndrome related to burnout phenomenon indeed, it will be possible (and necessary) to quantify the period of illness and the potential temporary biological damage or, more rarely, a permanent one. Given the difficulty of applying the forensic methodology to BOS (among which: the evaluation of the previous state of the person, the assessment of the causal link, the difficulties of nosographic of mental illness, the near impossibility of adequate prognostic evaluation, the difficulty to identify suitable criteria for establishing the importance and nature of limitations of daily living), in order to quantify the damage as objective as possible, it will be necessary to: 1) reconstruct the previous mental state of the subject; 2) assess the psychopathological condition following the event which the action of recognition focuses on; 3) express the clinical severity graduation judgment of the framework as well as a prognosis regarding the mental disorder found. The second part of the analysis focuses on the relationship between BOS and "helping profession"; specific attention is paid, in this section of work, to the analysis of the relationship between a typical

Gene : CBRC-CPOR-01-1484 [SEVENS

Lifescience Database Archive (English)

Full Text Available 2e-35 41% ref|XP_870944.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 6e-71 60% M...SIPKATNQSKKITLHILFLSTLFIISNTLRQPRCPSMETCECAFYSSVVVPKLLENLLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTRFRAVCHPLLYMVAY

Comparison of nitrogen utilization and urea kinetics between yaks (Bos grunniens) and indigenous cattle (Bos taurus).

Science.gov (United States)

Zhou, J W; Zhong, C L; Liu, H; Degen, A A; Titgemeyer, E C; Ding, L M; Shang, Z H; Guo, X S; Qiu, Q; Li, Z P; Yang, G; Long, R J

2017-10-01

Under traditional management on the Qinghai-Tibetan Plateau, yaks () graze only on natural pasture without supplements and are forced to cope with sparse forage of low N content, especially in winter. In contrast, indigenous Tibetan yellow cattle () require supplements during the cold season. We hypothesized that, in response to harsh conditions, yaks cope with low N intakes better than cattle. To test this hypothesis, a study of whole-body N retention and urea kinetics was conducted in 2 concurrent 4 × 4 Latin squares, with 1 square using yaks and 1 square using cattle. Four isocaloric forage-concentrate diets differing in N concentrations (10.3, 19.5, 28.5, and 37.6 g N/kg DM) were formulated, and by design, DMI were similar between species and across diets. Urea kinetics were determined with continuous intravenous infusion of NN urea for 104 h, and total urine and feces were concomitantly collected. Urea production, urea recycling to the gut, and ruminal microbial protein synthesis all linearly increased ( Urea production was greater in yaks than in cattle at the 3 lowest N diets but greater in cattle than in yaks at the highest N diet (species × diet, Urea N recycled to the gut ( urea N captured by ruminal bacteria ( urea recycling was through saliva, with no difference between species ( = 0.61). Glomerular filtration rate was lower ( = 0.05) in yaks than in cattle. The higher urea recycling and greater capture of recycled urea by ruminal microbes in yaks than in cattle suggest that yaks use mechanisms to utilize dietary N more efficiently than cattle, which may partially explain the better survival of yaks than cattle when fed low-N diets.

Gene : CBRC-DNOV-01-1811 [SEVENS

Lifescience Database Archive (English)

Full Text Available _HUMAN 1e-69 68% ref|XP_588566.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 2e-7...9 78% MQHCLSSWCPSWTLNSTLLCIFFLSHFSFLDLCFLSSIIPQLLVNLKCSDKSITYVDCMIQLYVSLVMGYTECIHLAVMTYDHYVAVCHPLHYIFFMHLWLRHVLASME

Sexual behaviour in cattle

International Nuclear Information System (INIS)

King, G.J.

1990-01-01

Short duration or weak expression of oestrus are frequently cited as major reasons for poor results when artificial insemination of Bos indicus breeds is attempted. The existing literature on sexual behaviour certainly indicates that oestrus sometimes lasts for only a few hours in Bos indicus, but similar patterns are also reported in Bos taurus animals. The period of sexual receptivity in suckled Hereford or Hereford-dairy cross-breds maintained in small, totally confined groups ranged from 1 to 18 h, with a mean of 4.4 h and a median of 3.5 h. In totally confined Holstein cows the onset of the LH surge always followed the beginning of homosexual activity by 1 or 2 h even when the period of receptivity was very short. Thus, the beginning rather than the end of oestrus should be used for estimating ovulation time. The expression of sexual behaviour is modified by many factors, including environmental conditions, the number of peri-oestrous females in the group and the presence of observers. In Hereford beef, Holstein dairy and probably all other cattle breeds, the variability in duration and intensity of oestrous activity is very large, so generalizations on a typical individual behavioural pattern are not possible. (author). 39 refs, 1 fig., 2 tabs

Spatiotemporal evolution of a laser-induced shock wave measured by the background-oriented schlieren technique

Science.gov (United States)

Tagawa, Yoshiyuki; Yamamoto, Shota; Kameda, Masaharu

2014-11-01

We investigate the spatiotemporal evolution of a laser-induced shock wave in a liquid filled thin tube. In order to measure pressure distribution at shock front, we adopt the background-oriented schlieren (BOS) technique. This technique provides two- or three-dimensional pressure field in a small region with a simple setup. With an ultra high-speed video camera and a laser stroboscope, we successfully capture the spatial evolution of the shock every 0.2 μs. We find an angular variation of the pressure at the shock front. The maximum pressure is in the direction of the laser shot while the minimum value is in the perpendicular direction. We compare the temporal evolution of the pressure measured by BOS technique with those obtained by another method, i.e. pressure estimation from the shock front position. Overall trend from both methods show a good agreement. The pressure from the shock front position exists between the maximum and minimum values from BOS technique. It indicates that our quantification method can measure more detailed pressure field in two- or three-dimensions. Our results might be used for the efficient generation systems for the microjet, which can be applicable for needle free injection devices.

Lung transplantation for bronchiolitis obliterans syndrome after allo-SCT.

Science.gov (United States)

Holm, A M; Riise, G C; Hansson, L; Brinch, L; Bjørtuft, O; Iversen, M; Simonsen, S; Fløisand, Y

2013-05-01

Chronic GVHD (cGVHD) associated bronchiolitis obliterans syndrome (BOS) is a serious complication after allo-SCT, and lung transplantation (LTx) may be the ultimate treatment option. To evaluate this treatment, data on all patients with LTx after allo-SCT ever performed in Sweden, Norway, Denmark and Finland were recorded and compared with survival data from the Scandiatransplant registry. In total, LTx after allo-SCT had been performed in 13 patients. Allo-SCT was done because of AML (n=6), CML (n=3), ALL (n=2), immunodeficiency (n=1) and aplastic anemia (n=1). All developed clinical cGVHD, with median interval from allo-SCT to LTx of 8.2 (0.7-16) years. Median age at LTx was 34 (16-55) years, and the median postoperative observation time was 4.2 (0.1-15) years. Two patients died, one due to septicemia, the other of relapsing leukemia, after 2 and 14 months, respectively. Four developed BOS, one of these was retransplanted. The survival did not significantly differ from the survival in matched LTx controls, being 90% 1 year and 75% 5 years after LTx compared with 85% and 68% in the controls. We therefore suggest that LTx may be considered in carefully selected patients with BOS due to cGVHD after allo-SCT.

3He-MRI in follow-up of lung transplant recipients

International Nuclear Information System (INIS)

Gast, Klaus Kurt; Zaporozhan, Julia; Ley, Sebastian; Biedermann, Alexander; Knitz, Frank; Eberle, Balthasar; Schmiedeskamp, Joerg; Heussel, Claus-Peter; Mayer, Eckhard; Schreiber, Wolfgang Guenter; Thelen, Manfred; Kauczor, Hans-Ulrich

2004-01-01

The aim of this study was to evaluate the possible contribution of 3 He-MRI to detect obliterative bronchiolitis (OB) in the follow-up of lung transplant recipients. Nine single- and double-lung transplanted patients were studied by an initial and a follow-up 3 He-MRI study. Images were evaluated subjectively by estimation of ventilation defect area and quantitatively by individually adapted threshold segmentation and subsequent calculation of ventilated lung volume. Bronchiolitis obliterans syndrome (BOS) was diagnosed using pulmonary function tests. At 3 He-MRI, OB was suspected if ventilated lung volume had decreased by 10% or more at the follow-up MRI study compared with the initial study. General accordance between pulmonary function testing and 3 He-MRI was good, although subjective evaluation of 3 He-MRI underestimated improvement in ventilation as obtained by pulmonary function tests. The 3 He-MRI indicated OB in 6 cases. According to pulmonary function tests, BOS was diagnosed in 5 cases. All diagnoses of BOS were also detected by 3 He-MRI. In 2 of these 5 cases, 3 He-MRI indicated OB earlier than pulmonary function tests. The results support the hypothesis that 3 He-MRI may be sensitive for early detection of OB and emphasize the need for larger prospective follow-up studies. (orig.)

Lipid raft facilitated ligation of K-{alpha}1-tubulin by specific antibodies on epithelial cells: Role in pathogenesis of chronic rejection following human lung transplantation

Energy Technology Data Exchange (ETDEWEB)

Tiriveedhi, Venkataswarup; Angaswamy, Nataraju [Department of Surgery, Pathology and Immunology, Washington University School of Medicine, St. Louis, MO (United States); Weber, Joseph [Department of Medicine, Washington University School of Medicine, St. Louis, MO (United States); Mohanakumar, T., E-mail: kumart@wustl.edu [Department of Surgery, Pathology and Immunology, Washington University School of Medicine, St. Louis, MO (United States)

2010-08-20

Research highlights: {yields} Addition of KAT Abs (+) sera to NHBE culture causes upregulation of growth factors. {yields} Cholesterol depletion causes down regulation of growth factor expression. {yields} Cholesterol depletion is accompanied by loss of membrane bound caveolin. {yields} Thus, we demonstrate lipid raft are critical for efficient ligation of the KAT Abs. -- Abstract: Long term function of human lung allografts is hindered by development of chronic rejection manifested as Bronchiolitis Obliterans Syndrome (BOS). We have previously identified the development of antibodies (Abs) following lung transplantation to K-{alpha}1-tubulin (KAT), an epithelial surface gap junction cytoskeletal protein, in patients who develop BOS. However, the biochemical and molecular basis of the interactions and signaling cascades mediated by KAT Abs are yet to be defined. In this report, we investigated the biophysical basis of the epithelial cell membrane surface interaction between KAT and its specific Abs. Towards this, we analyzed the role of the lipid raft-domains in the membrane interactions which lead to cell signaling and ultimately increased growth factor expression. Normal human bronchial epithelial (NHBE) cells, upon specific ligation with Abs to KAT obtained either from the serum of BOS(+) patients or monoclonal KAT Abs, resulted in upregulation of growth factors VEGF, PDGF, and bFGF (6.4 {+-} 1.1-, 3.2 {+-} 0.9-, and 3.4 {+-} 1.1-fold increase, respectively) all of which are important in the pathogenesis of BOS. To define the role for lipid raft in augmenting surface interactions, we analyzed the changes in the growth factor expression pattern upon depletion and enrichment with lipid raft following the ligation of the epithelial cell membranes with Abs specific for KAT. NHBE cells cultured in the presence of {beta}-methyl cyclodextran ({beta}MCD) had significantly reduced growth factor expression (1.3 {+-} 0.3, vs {beta}MCD untreated being 6.4 {+-} 1.1-fold

Lipid raft facilitated ligation of K-α1-tubulin by specific antibodies on epithelial cells: Role in pathogenesis of chronic rejection following human lung transplantation

International Nuclear Information System (INIS)

Tiriveedhi, Venkataswarup; Angaswamy, Nataraju; Weber, Joseph; Mohanakumar, T.

2010-01-01

Research highlights: → Addition of KAT Abs (+) sera to NHBE culture causes upregulation of growth factors. → Cholesterol depletion causes down regulation of growth factor expression. → Cholesterol depletion is accompanied by loss of membrane bound caveolin. → Thus, we demonstrate lipid raft are critical for efficient ligation of the KAT Abs. -- Abstract: Long term function of human lung allografts is hindered by development of chronic rejection manifested as Bronchiolitis Obliterans Syndrome (BOS). We have previously identified the development of antibodies (Abs) following lung transplantation to K-α1-tubulin (KAT), an epithelial surface gap junction cytoskeletal protein, in patients who develop BOS. However, the biochemical and molecular basis of the interactions and signaling cascades mediated by KAT Abs are yet to be defined. In this report, we investigated the biophysical basis of the epithelial cell membrane surface interaction between KAT and its specific Abs. Towards this, we analyzed the role of the lipid raft-domains in the membrane interactions which lead to cell signaling and ultimately increased growth factor expression. Normal human bronchial epithelial (NHBE) cells, upon specific ligation with Abs to KAT obtained either from the serum of BOS(+) patients or monoclonal KAT Abs, resulted in upregulation of growth factors VEGF, PDGF, and bFGF (6.4 ± 1.1-, 3.2 ± 0.9-, and 3.4 ± 1.1-fold increase, respectively) all of which are important in the pathogenesis of BOS. To define the role for lipid raft in augmenting surface interactions, we analyzed the changes in the growth factor expression pattern upon depletion and enrichment with lipid raft following the ligation of the epithelial cell membranes with Abs specific for KAT. NHBE cells cultured in the presence of β-methyl cyclodextran (βMCD) had significantly reduced growth factor expression (1.3 ± 0.3, vs βMCD untreated being 6.4 ± 1.1-fold increase) upon stimulation with KAT Abs. Depletion

k-Casein, b-lactoglobulin and growth hormone allele frequencies and genetic distances in Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis cattle

Directory of Open Access Journals (Sweden)

Paola Augusta Kemenes

1999-12-01

Full Text Available The genotypes for k-casein (k-CN, b-lactoglobulin (b-LG and growth hormone (GH were determined by polymerase chain reaction (PCR and restriction enzyme digestion in seven breeds of cattle (Nelore, Gyr, Guzerá, Caracu, Charolais, Canchim and Santa Gertrudis. k-Casein had two alleles with the A allele occurring at a higher frequency in Bos indicus breeds (0.93, 0.92 and 0.91% for Gyr, Guzerá and Nelore, respectively. The b-lactoglobulin locus had two alleles in all of the breeds. European breeds had a higher frequency of the b-LG A allele than Zebu breeds. The GH locus had two alleles (L and V in Bos taurus and was monomorphic (L allele only in all of the Bos indicus breeds evaluated. The highest frequency for the V allele was observed in Charolais cattle. The markers used revealed a considerable similarity among breeds, with two main groups being discernible. One group consisted of Zebu and Santa Gertrudis breeds and the other consisted of European and Canchim breeds.Os genótipos de k-caseína (k-CN, b-lactoglobulina (b-LG e hormônio de crescimento foram determinados por reação em cadeia de polimerase (PCR e digestão com enzima de restrição em sete raças de bovinos (Nelore, Gir, Guzerá, Caracu, Charolesa, Canchim and Santa Gertrudis. A k-caseína apresentou dois alelos e as freqüências mais elevadas para o alelo A foram observadas em Bos indicus (0,93, 0,92 e 0,91% para as raças Gir, Guzerá e Nelore, respectivamente. A b-lactoglobulina apresentou dois alelos em todas as raças estudadas, sendo a freqüência do alelo A mais elevada nas raças européias. O loco de hormônio de crescimento apresentou dois alelos em Bos taurus e foi monomórfico (alelo L em todas as raças zebuínas. A maior freqüência para o alelo V foi observado na raça Charolesa. Os marcadores investigados revelaram alta similaridade entre as raças, com a formação de dois grupos principais: um composto de raças zebuínas e a raça Santa Gertrudis e outro

Over ontmoetingen tussen mensen met en zonder verstandelijke beperking in omgekeerde-integratiesettingen

Directory of Open Access Journals (Sweden)

Gerda Scholtens

2016-09-01

Full Text Available Gustaaf Bos. Antwoorden op andersheid. Over ontmoetingen tussen mensen met en zonder verstandelijke beperking in omgekeerde-integratiesettingen. Nieuwegein: EPC, 2016, 379 p. ISBN: 9789462287358

Neurofibromatosis tipo I: Mutación de splicing detectada por MLPA y secuenciación en la Argentina

Directory of Open Access Journals (Sweden)

Sergio Laurito

2015-04-01

Full Text Available La neurofibromatosis tipo 1 (NF1 es un desorden genético autosómico dominante, con una prevalencia de 1 en 2500-3000 nacidos vivos. La dificultad diagnóstica se debe al tamaño extenso del gen NF1 con pocos sitios hot-spot, la ausencia de una clara relación genotipo-fenotipo y rasgos clínicos con un espectro muy heterogéneo. Un caso sospechoso de NF1 procedente de la provincia de Jujuy fue analizado por MLPA (multiplex ligation-dependent probe amplification en nuestro laboratorio. Mujer, adolescente mestiza (Amerindia/Europea, con un osteoma maxilar, lordosis lumbar, neurofibromas cutáneos y manchas café con leche. Por MLPA se detectó una alteración en el exón 13 del gen NF1. Por secuenciación del exón 13 se identificó una mutación "missense" en la posición 1466 del ARNm (NM_000267.3:c.1466A>G que introduce un sitio de splicing aberrante. La patogenicidad de la mutación fue corroborada en la base de datos de variantes clínicas del National Center for Biotechnology Information. En nuestro conocimiento, este es el primer registro de una mutación NF1 en un paciente proveniente de poblaciones mestizas del Noroeste Argentino. La alteración ha sido reportada en individuos de otras poblaciones de origen muy disímil al del caso presentado, como la europea, sugiriendo que el sitio podría considerarse un sitio hot-spot del gen. Donde exista baja disponibilidad de diagnósticos moleculares, como en nuestro caso, se puede aplicar un algoritmo que comience por el estudio del gen NF1 por MLPA, metodología relativamente sencilla y de costo accesible. Con ella se evita enviar muestras al extranjero para análisis genéticos.

An extension of uncertainty management theory to the self: the relationship between justice, social comparison orientation, and antisocial work behaviors.

Science.gov (United States)

Thau, Stefan; Aquino, Karl; Wittek, Rafael

2007-01-01

A multisource field study of 103 employees and their supervisors tested an extension of uncertainty management theory (E. A. Lind & K. Van den Bos, 2002; K. Van den Bos & E. A. Lind, 2002). According to this theory, persons high in social comparison orientation (F. X. Gibbons & B. P. Buunk, 1999) experience chronic uncertainty about the self. It was hypothesized that this should strengthen the effects of interactional and procedural justice perceptions on antisocial work behaviors. As predicted, the negative relationship between employee perceptions of interactional justice and supervisory ratings of antisocial work behaviors was stronger for people who are high as compared with low in social comparison orientation. Results provide evidence for an extension of uncertainty management theory to the self-domain. 2007 APA, all rights reserved

Aspectos clínicos da indução experimental de acidose láctica ruminal em zebuínos e taurinos

Directory of Open Access Journals (Sweden)

Enrico Lippi Ortolani

2010-08-01

Full Text Available To compare the clinical signs and the susceptibility to acute rumen lactic acidosis (ARLA, experimentally induced, five Jersey (J (Bos taurus and five Gir (G (Bos indicus steers were used. The ARLA caused in all animals tachycardia, decreased rumen movement, diarrhoea, and dehydration; Although G steers presented higher tachycardia and tendency to a more severe dehydration, the J steers exhibited a pronounced depression in the general state, requiring an intense treatment to recover. J steers needed more time to recover the normal appetite. Thus, regarding clinical picture, was observed that J steers are more susceptible to ARLA than G. Positive correlation was found between plasma volume deficit and tachycardia (r = 0.67; blood pH did not influence heart rate (r= - 0.25.

Population Structure Analysis of Bull Genomes of European and Western Ancestry

DEFF Research Database (Denmark)

Chung, Neo Christopher; Szyda, Joanna; Frąszczak, Magdalena

2017-01-01

Since domestication, population bottlenecks, breed formation, and selective breeding have radically shaped the genealogy and genetics of Bos taurus. In turn, characterization of population structure among diverse bull (males of Bos taurus) genomes enables detailed assessment of genetic resources...... and origins. By analyzing 432 unrelated bull genomes from 13 breeds and 16 countries, we demonstrate genetic diversity and structural complexity among the European/Western cattle population. Importantly, we relaxed a strong assumption of discrete or admixed population, by adapting latent variable models...... harboring largest genetic differentiation suggest positive selection underlying population structure. We carried out gene set analysis using SNP annotations to identify enriched functional categories such as energy-related processes and multiple development stages. Our population structure analysis of bull...

(obese) gene of mithun (Bos frontalis)

African Journals Online (AJOL)

Nishant-3

2Division of Animal Genetics, Indian Veterinary Research Institute, Izatnagar, Bareilly-243 122, India. 3Department of Animal ... closely associated with social, cultural, religious and livelihood of the tribes .... Southeast Asia (Gupta et al., 1999).

(Bos grunniens) in Qinghai-Tibetan Plateau

African Journals Online (AJOL)

DR. NJ TONUKARI

2012-10-30

Oct 30, 2012 ... Qinghai-Tibetan Plateau, as it represents a unique bovine species adapted to ..... al., 1993; Udina et al., 2003), mastitis caused by. Staphylococcus sp. ... for prevention and treatment in many cases (Gerald et al., 2003). But in ...

Efectividad de una mezcla de cipermetrina y clorpirifós para el control de la mosca Haematobia irritans

Directory of Open Access Journals (Sweden)

Gustavo López V.

2011-05-01

Full Text Available Objetivo. Determinar la eficacia de una mezcla de Cipermetrina y Clorpirifós contra la mosca de los cuernos Haematobia irritans. Materiales y métodos. Se utilizaron 24 novillas Holstein con infestación natural de moscas Haematobia irritans y se asignaron aleatoriamente a dos grupos, tratado y control, de 12 animales cada uno. El grupo tratado recibió el producto por aspersión en dilución 1:800, utilizando 1 litro por cada 100 kilos de peso. Se hicieron conteos de moscas antes del tratamiento y en los días 7, 14 y 21 post-aplicación para evaluar la eficacia del producto. Resultados. Los porcentajes de eficacia del producto fueron de 89.9, 97.4 y 99.5%, para los días 7, 14 y 21 post-tratamiento, respectivamente. Conclusiones. La mezcla de Cipermetrina y Clorpirifós resultó altamente eficaz contra la mosca de los cuernos Haematobia irritans y surge como una nueva alternativa para el control del parásito, especialmente donde se presente resistencia a las diferentes moléculas que contienen los productos comerciales.

Soubor kostí z časně eneolitického objektu v Suchomastech, okr. Beroun

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2015-01-01

Roč. 19, č. 2 (2015), s. 505-506 ISSN 1214-3553 Institutional support: RVO:67985912 Keywords : archaeozoology * Copper Age * cattle (Bos) * Jordanów culture Subject RIV: AC - Archeology, Anthropology, Ethnology

Pa2G4 is a novel Six1 co-factor that is required for neural crest and otic development☆

Science.gov (United States)

Neilson, Karen M.; Abbruzzesse, Genevieve; Kenyon, Kristy; Bartolo, Vanessa; Krohn, Patrick; Alfandari, Dominique; Moody, Sally A.

2016-01-01

Mutations in SIX1 and in its co-factor, EYA1, underlie Branchiootorenal Spectrum disorder (BOS), which is characterized by variable branchial arch, otic and kidney malformations. However, mutations in these two genes are identified in only half of patients. We screened for other potential co-factors, and herein characterize one of them, Pa2G4 (aka Ebp1/Plfap). In human embryonic kidney cells, Pa2G4 binds to Six1 and interferes with the Six1-Eya1 complex. In Xenopus embryos, knock-down of Pa2G4 leads to down-regulation of neural border zone, neural crest and cranial placode genes, and concomitant expansion of neural plate genes. Gain-of-function leads to a broader neural border zone, expanded neural crest and altered cranial placode domains. In loss-of-function assays, the later developing otocyst is reduced in size, which impacts gene expression. In contrast, the size of the otocyst in gain-of-function assays is not changed but the expression domains of several otocyst genes are reduced. Together these findings establish an interaction between Pa2G4 and Six1, and demonstrate that it has an important role in the development of tissues affected in BOS. Thereby, we suggest that pa2g4 is a potential candidate gene for BOS. PMID:27940157

British Orthodontic Society national audit of temporary anchorage devices (TADs): report of the first thousand TADs placed.

Science.gov (United States)

Bearn, David R; Alharbi, Fahad

2015-09-01

To provide data from the British Orthodontic Society (BOS) national clinical audit on temporary anchorage device (TAD) use following the recommendations of the National Institute for Health and Clinical Excellence (NIHCE) Design and setting: The Audit commenced on 1 January 2008 and is still ongoing. This article reports the data for TADs placed from 1 January 2008 to 1 November 2013. Audit data was collected from participants using a system of both on-line data entry and hard copy forms. The criteria and standards for the audit were set following the NIHCE report in conjunction with the Development and Standards Committee of the BOS. Virtually all participants used the on-line data entry available on the BOS website. The data submitted was checked and entered manually into an Excel spreadsheet, and transferred to SPSS for analysis. Written information and documented discussion of risks were provided in over 90% of TADs placed, but 17.4% were placed without a specific signed consent form. Temporary anchorage device failure rate was 24.2% overall. Among failed TADs, 93.1% were lost or removed due to excess mobility. Infection or inflammation resulting in loss or removal was reported in 6% of TADs. The only audit standard that was met was failures due to infection of inflammation. The rest of the audit standards were not met. Recommendations are made to address these issues.

Biennaal Berliinis / Maria-Kristiina Soomre

Index Scriptorium Estoniae

Soomre, Maria-Kristiina, 1978-

2001-01-01

20. IV-20. VI Berliinis toimuv Saskia Bos'i kureeritud II rahvusvahelise kaasaegse kunsti biennaal keskendub kunstile, mis on sotsiaalselt aktiivne ning tegeleb senise kunstisüsteemi kriitikaga. Osaleb 50 kunstnikku 28 riigist.

Zvířecí kosterní pozůstatky z popraviště ve Vodňanech

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2006-01-01

Roč. 58, č. 4 (2006), s. 813-814 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : scaffold * Bos taurus * burned bones * archaeozoology Subject RIV: AC - Archeology, Anthropology, Ethnology

Influence of cow breed type, age and previous lactation status on cow height, calf growth, and patterns of body weight, condition, and blood metabolites for cows grazing bahiagrass pastures.

Science.gov (United States)

Coleman, S W; Chase, C C; Riley, D G; Williams, M J

2017-01-01

This study was initiated to evaluate performance and patterns of cow traits and blood metabolites of 3 breeds of cows grazing bahiagrass (Paspalum notatum Flügge) pastures in central Florida. Purebred cows (n = 411) of either Angus (Bos taurus), Brahman (Bos indicus), or Romosinuano (Bos taurus) breeding, rotationally grazed (moved twice weekly) bahiagrass pastures year-round, and received bahiagrass hay supplemented with molasses and soyhulls or legume hay supplemented with unfortified molasses from October to June each production year. At monthly intervals, all cows were weighed, measured at the hip (HH), scored for BCS, and blood samples collected by jugular puncture from 10 cows per cow breed/block group for plasma urea N (PUN), glucose and non-esterified fatty acids (NEFA). Data were analyzed on cows that calved with a statistical model that included fixed effects of year, cowage, cow breed, month, block, supplement group (n = 2, but not presented), and whether the cow weaned a calf the previous year. Cow was a repeated observation over mo. Three-way interactions involving monthly patterns for cowage x year, year x lactation status the previous year, cowage × cow breed, year × cow breed, and cow breed × lactation status the previous year were significant (P cow breed × month was important (P cows compared to 3-yr old cows; 2) greater BW and BCS before calving for cows that did not lactate the previous year; 3) PUN levels were above 11 mg/dl except for February, August and September, and was generally greater in tropically adapted breeds; 4) GLU was greatest in Brahman, lowest in Angus, and intermediate in Romosinuano cows; and 5) plasma levels of NEFA escalated at calving and then declined, but Brahman cows maintained greater (P Cows that lactated the previous year had less NEFA than those that did not lactate. Brahman cows were less fertile than Bos taurus breeds, and weaned heavier calves.

Membracidos de Colombia - I. Revisión parcial de las especies del género Alchisme Kirkaldy (Homoptera: Membracidae: Hoplophorioninae Membracidos de Colombia - I. Revisión parcial de las especies del género Alchisme Kirkaldy (Homoptera: Membracidae: Hoplophorioninae

Directory of Open Access Journals (Sweden)

Restrepo Mejía Ruben

1980-09-01

Full Text Available Se revisó el género Alchisme Kirkaldy. De las diecinueve especies anotadas por Metcalf (1965 no se obtuvieron especímenes de A. apicalis (Walker, A. costaricensis Goding, A. elevata Goding, A. laticornis Funkhouser, A. pinguicornisFunkhouser, A. recurva (Stäl, A. spinosa Funkhouser y A. truncaticornis (Germar. Se incluyen las descripciones originales de estas especies y tentativamente se localizan en la clave presentada. Se redescriben: A. bos (Fairmaire, A. fastidiosa (Fairmaire, A. grossa (Fairmaire, A. inermis (Fairmaire, A. nigrocarinata (Fairmaire, A. rubrocostata (Spinola, A. turrita (Germar, A. ustulata (Fairmaire, A. virescens (Fairmaire y A. nigrocarinata var. tridentata (Fairmaire, para la cual se usa su combinación original A. tridentata (Fairmaire. Se sinonimizóa A. projecta Funkhouser en favor de A. bos (Fairmaire.Se ilustran las principales características del pronoto y de los genitales de los machos; se observaron y se obtuvieron fotografías de los edeagos en un microscopio electrónico "rastreador" (Scanning Electro Microscope, las cualesse incluyen como parte de las ilustraciones. Se analizó la distribución geográfica del género y se ilustró por medio de mapas.The genus Alchisme Kirkaldy was revised. From nineteen species listed by Metcalf (1965 not specimens were obtained of eight of them. Original descriptions of these species are included and tentatively are localized in the key.  A redescription is given for the species A. bos (Fairmaire, A. fastidiosa (Fairmaire, A. grossa (Fairmaire, A. inermis (Fairmaire, A. nigrocarinata (Fairmaire, A. rubrocostata (Spinola, A. turrita (Germar, A. ustulata (Fairmaire, A. virescens (Fairmaire y A. nigrocarinata var. tridentata (Fairmaire, for which was used the original combination A. tridentata (Fairmaire. A. projecta Funkhouser was synonymized in A. bos (Fairmaire. The main pronotum characters and male genitalia are illustred; Scanning Electro Microscope pictures of the

An artificial neural network estimation of gait balance control in the elderly using clinical evaluations.

Directory of Open Access Journals (Sweden)

Vipul Lugade

Full Text Available The use of motion analysis to assess balance is essential for determining the underlying mechanisms of falls during dynamic activities. Clinicians evaluate patients using clinical examinations of static balance control, gait performance, cognition, and neuromuscular ability. Mapping these data to measures of dynamic balance control, and the subsequent categorization and identification of community dwelling elderly fallers at risk of falls in a quick and inexpensive manner is needed. The purpose of this study was to demonstrate that given clinical measures, an artificial neural network (ANN could determine dynamic balance control, as defined by the interaction of the center of mass (CoM with the base of support (BoS, during gait. Fifty-six elderly adults were included in this study. Using a feed-forward neural network with back propagation, combinations of five functional domains, the number of hidden layers and error goals were evaluated to determine the best parameters to assess dynamic balance control. Functional domain input parameters included subject characteristics, clinical examinations, cognitive performance, muscle strength, and clinical balance performance. The use of these functional domains demonstrated the ability to quickly converge to a solution, with the network learning the mapping within 5 epochs, when using up to 30 hidden nodes and an error goal of 0.001. The ability to correctly identify the interaction of the CoM with BoS demonstrated correlation values up to 0.89 (P<.001. On average, using all clinical measures, the ANN was able to estimate the dynamic CoM to BoS distance to within 1 cm and BoS area to within 75 cm2. Our results demonstrated that an ANN could be trained to map clinical variables to biomechanical measures of gait balance control. A neural network could provide physicians and patients with a cost effective means to identify dynamic balance issues and possible risk of falls from routinely collected clinical

SEB-l luhtus taas Poola panga ülevõtmine / Tõnis Arnover

Index Scriptorium Estoniae

Arnover, Tõnis, 1952-

2006-01-01

Rootsi SEB oli sunnitud loobuma 47,5% Poola panga (BOS) aktsiatest, sest tal ei õnnestunud Poola valitsuse sekkumise tõttu enamusaktsiapakki endale saada. Vt. samas: SEB uus juht võttis Saksa panga pihtide vahele

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_776444.1| chondroadherin [Bos taurus] sp|Q27972|CHAD_BOVIN Chondroad...herin precursor (Cartilage leucine-rich protein) (38 kDa bone protein) [Contains: Chondroadherin m

A comparison of data management systems used in high energy physics

International Nuclear Information System (INIS)

Hansl-Kozanecka, T.

1992-04-01

Data-management systems for defining data and manipulating them with FORTRAN programs have become increasingly important. We compare three systems that were developed within the high-energy physics community: BOS, JAZELLE and ZEBRA. (orig.)

Characterization of a Dairy Gyr herd with respect to its mitochondrial DNA (mt DNA origin

Directory of Open Access Journals (Sweden)

Anibal Eugênio Vercesi Filho

2010-01-01

Full Text Available The Zebu breeds were introduced in Brazil mainly in the last century by imports from the Indian subcontinent. When the Zebu cattle arrived, the national herd suffered a significative change by backcrossing the national cows of taurine origin with Zebu sires. These processes created a polymorphism in the mitochondrial DNA (mtDNA in the Zebu animals with are in a major part derived from backcrossing and sharing mtDNA of taurine origin. To verify the maternal origin of cows belonging to the Dairy Gyr herd of APTA, Mococa 60 females were analyzed and 33 presented mtDNA from Bos taurus origin and 27 presented mtDNA from Bos indicus origin. None of these animals presented patterns of both mtDNA origins, indicating absence of heteroplasmy for these mitochondrial genotypes.

Measurement of the ratios of branching fractions and.

Science.gov (United States)

Abulencia, A; Acosta, D; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Bachacou, H; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Ben-Haim, E; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bishai, M; Blair, R E; Blocker, C; Bloom, K; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Bourov, S; Boveia, A; Brau, B; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chapman, J; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Chu, P H; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Connolly, A; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Cruz, A; Cuevas, J; Culbertson, R; Cyr, D; Daronco, S; D'Auria, S; D'onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Demers, S; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Dionisi, C; Dittmann, J; DiTuro, P; Dörr, C; Dominguez, A; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Ebina, K; Efron, J; Ehlers, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Flores-Castillo, L R; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Fujii, Y; Furic, I; Gajjar, A; Gallinaro, M; Galyardt, J; Garcia, J E; Sciverez, M Garcia; Garfinkel, A F; Gay, C; Gerberich, H; Gerchtein, E; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Ginsburg, C; Giolo, K; Giordani, M; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Gotra, Y; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; da Costa, J Guimaraes; Haber, C; Hahn, S R; Hahn, K; Halkiadakis, E; Hamilton, A; Han, B-Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hatakeyama, K; Hauser, J; Hays, C; Hayward, H; Heijboer, A; Heinemann, B; Heinrich, J; Hennecke, M; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Huston, J; Ikado, K; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jones, M; Joo, K K; Jun, S Y; Junk, T R; Kamon, T; Kang, J; Karagoz-Unel, M; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, M S; Kim, S B; Kim, S H; Kim, Y K; Kirby, M; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kobayashi, H; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraus, J; Kravchenko, I; Kreps, M; Kreymer, A; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kuhlmann, S E; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecci, C; LeCompte, T; Lee, J; Lee, J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Li, K; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Liss, T M; Lister, A; Litvintsev, D O; Liu, T; Liu, Y; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Maksimovic, P; Manca, G; Margaroli, F; Marginean, R; Marino, C; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McGivern, D; McIntyre, P; McNamara, P; McNulty, R; Mehta, A; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; von der Mey, M; Miao, T; Miladinovic, N; Miles, J; Miller, R; Miller, J S; Mills, C; Milnik, M; Miquel, R; Miscetti, S; Mitselmakher, G; Miyamoto, A; Moggi, N; Mohr, B; Moore, R; Morello, M; Fernandez, P Movilla; Mülmenstädt, J; Mukherjee, A; Mulhearn, M; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nahn, S; Nakano, I; Napier, A; Naumov, D; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Ogawa, T; Oh, S H; Oh, Y D; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Paoletti, R; Papadimitriou, V; Papikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pitts, K; Plager, C; Pondrom, L; Pope, G; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Rakitin, A; Rappoccio, S; Ratnikov, F; Reisert, B; Rekovic, V; van Remortel, N; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Rinnert, K; Ristori, L; Robertson, W J; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Rott, C; Ruiz, A; Russ, J; Rusu, V; Ryan, D; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Salto, O; Saltzberg, D; Sanchez, C; Santi, L; Sarkar, S; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Semeria, F; Sexton-Kennedy, L; Sfiligoi, I; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Skiba, A; Slaughter, A J; Sliwa, K; Smirnov, D; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; Denis, R St; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sumorok, K; Sun, H; Suzuki, T; Taffard, A; Tafirout, R; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Tether, S; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tollefson, K; Tomura, T; Tonelli, D; Tönnesmann, M; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vacavant, L; Vaiciulis, A; Vallecorsa, S; Varganov, A; Vataga, E; Velev, G; Veramendi, G; Veszpremi, V; Vickey, T; Vidal, R; Vila, I; Vilar, R; Vollrath, I; Volobouev, I; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wallny, R; Walter, T; Wan, Z; Wang, M J; Wang, S M; Warburton, A; Ward, B; Waschke, S; Waters, D; Watts, T; Weber, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Worm, S; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, Y; Yang, C; Yang, U K; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zetti, F; Zhang, X; Zhou, J; Zucchelli, S

2006-05-19

We report an observation of the decay B(O)(S) --> D(-)(s)pi(+) in pp collisions at radical S = 1.96 TeV using 115 pb(-1) of data collected by the CDF II detector at the Fermilab Tevatron. We observe 83 +/- 11(stat) B(O)(s) --> D(-)(s)pi(+) candidates, representing a large increase in statistics over previous measurements and the first observation of this decay at a pp collider. We present the first measurement of the relative branching fraction Beta(B(O)(s) --> D(-)(s)pi(+))/Beta(B(0) --> D(-)(pi)(+)) = 1.32 +/- 0.18(stat) +/- 0.38(syst). We also measure Beta(B(+) --> D(0)pi(+))/Beta(B(0) -->D(-)pi(+)) = 1.97 +/- 0.10(stat) +/- 0.21(syst), which is consistent with previous measurements.

Glomerular filtration rate and renal recovery of [14C]-allantoin in Bali and Zebu cattle of Indonesia

International Nuclear Information System (INIS)

Prasitkusol, P.; Chen, X.B.; Orskov, E.R.; Kyle, D.J.; Yusiati, L.M.

2004-01-01

The urinary recovery of [ 14 C]-allantoin injected into the blood of Bali Cattle (Bos banteng) and Zebu cattle (Bos indicus), and the glomerular filtration rate (GFR) of these animals, were determined. The cattle were fed with king grass at 95% of ad libitum intake. The recovery of [ 14 C]-allantoin in the urine was significantly higher for Bali (83 ± SE 0.94 %) than for Zebu Cattle (74 ± SE 0.79 %). There were no significant differences in GFR between Bali and Zebu cattle (302 ± SE23.8 and 285 ± SE18.7 L/d). Within each species, there was no significant effect of GFR on the [ 14 C]-allantoin recovery. It remains to be investigated whether the differences in [ 14 C]-allantoin recovery between species is affected by GFR. (author)

Trends in burnout syndrome and emotional factors: an assessment of anesthesiologists in Southern Brazil, 2012.

Science.gov (United States)

Freire, Patrícia Larrosa; Trentin, Jessica Puchalski; de Avila Quevedo, Luciana

2016-06-01

Burnout syndrome (BOS) is the result of chronic stress at work, and is characterized by emotional exhaustion (EE), depersonalization (DP), and low professional accomplishment. Anesthesiologyis a stressful profession. The aim of this study was to assess the prevalence of burnout as well as the sociodemographic and working characteristics associated with this syndrome's emotional factors, in anesthesiologists from Southern Brazil. We assessed burnout severity, depressive symptoms, and self-esteem using the Maslach burnout inventory, the Beck depression inventory, and the Rosenberg self-esteem scale, respectively. Of the 198 anesthesiologists included in this study, 48.7% were positive for burnout, 26.9% for EE, 41.3% for DP and 32.7% for low personal accomplishment. Trends in BOS was associated with a younger age, difficulty to conciliate family and work demands, low self-esteem, and depressive symptoms.

Identification and characterization of variants in the 5' flanking region ...

African Journals Online (AJOL)

enoh

2012-04-05

Apr 5, 2012 ... productivity, reduction in costs, enrichment of milk compositions and extension of ... from six bovine species, 18 samples of Leiqiong cattle (Bos indicus) ..... growth hormone receptor genes with blood serum insulin-like growth.

Parametric Response Mapping as an Indicator of Bronchiolitis Obliterans Syndrome after Hematopoietic Stem Cell Transplantation

NARCIS (Netherlands)

Galban, Craig J.; Boes, Jennifer L.; Bule, Maria; Kitko, Carrie L.; Couriel, Daniel R.; Johnson, Timothy D.; Lama, Vihba; Telenga, Eef D.; van den Berge, Maarten; Rehemtulla, Alnawaz; Kazerooni, Ella A.; Ponkowski, Michael J.; Ross, Brian D.; Yanik, Gregory A.

2014-01-01

The management of bronchiolitis obliterans syndrome (BOS) after hematopoietic cell transplantation presents many challenges, both diagnostically and therapeutically. We developed a computed tomography (CT) voxel-wise methodology termed parametric response mapping (PRM) that quantifies normal

Evaluación de vacas de doble propósito de genotipos Holstein x Cebú en sistemas de pastoreo arborizado: I. Primíparas Evaluation of double-purpose Holstein x Zebu cows in grazing systems with trees: I. Primiparous

Directory of Open Access Journals (Sweden)

L Simón

2010-03-01

Full Text Available Con el objetivo de evaluar el comportamiento productivo y reproductivo de diferentes genotipos raciales de doble propósito de los cruzamientos Holstein x Cebú se seleccionaron 75 novillas gestantes, 25 por grupo de los genotipos Siboney (5/8 H x 3/8 C, Mambí (¾ H x ¼ C y Siboney mestizo (5/8 H x 3/8 C, en un diseño totalmente aleatorizado, las cuales conformaron un grupo común con acceso al mismo manejo y alimentación. Las novillas se incorporaron a la reproducción cuando alcanzaron 300 kg de peso vivo y una edad promedio de 28,6 meses; estas fueron manejadas en una vaquería arborizada, con una carga de 1,6 UGM/ha, y rotaron en 28 cuartones. Mensualmente se midió la disponibilidad de pastos y la oferta diaria de los forrajes y los suplementos. Se controló la condición corporal y se midió el perímetro toráxico; la producción de leche por vaca se comprobó quincenalmente, y se determinó la duración y producción por lactancia y los indicadores reproductivos. El genotipo Mambí fue superior (PWith the objective of evaluating the productive and reproductive performance of different double purpose breed genotypes from the Holstein x Zebu crossings, 75 pregnant heifers were selected, 25 per group from genotypes Siboney (5/8 H x 3/8 Z, Mambí (¾ H x ¼ Z and crossbred Siboney (5/8 H x 3/8 Z, in a completely randomized design, which made up a common group with access to the same management and feeding. The heifers were incorporated to reproduction after reaching 300 kg live weight and an average age of 28,6 months; they were managed in a dairy unit with trees, with a stocking rate of 1,6 animals/ha, and rotated in 28 paddocks. Pasture availability and daily offer of forages and supplements were measured monthly. Body condition was controlled and the thoracic perimeter was measured; milk production per cow was fortnightly checked, and the lactation duration and production and reproductive indicators were determined. The Mamb

Aurochs and potential crossbreeding with domestic cattle in Central Europe in the Eneolithic period. A metric analysis of bones from the archaeological site of Kutná Hora–Denemark (Czech Republic)

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2008-01-01

Roč. 43, č. 2 (2008), s. 7-37 ISSN 0761-3032 Institutional research plan: CEZ:AV0Z80020508 Keywords : Bos primigenius * local domestic ation * crossbreeding * cattle * Eneolithic * osteometry Subject RIV: AC - Archeology, Anthropology, Ethnology

Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2011-01-01

Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

Nature conservation and grazing management. Free-ranging cattle as a driving force for cyclic vegetation seccession

NARCIS (Netherlands)

Bokdam, J.

2003-01-01

Key-words : biodiversity, herbivory, wilderness, non-linear dynamics, mosaic cycling, grassland, wood encroachment, forest, Bos taurus , Calluna vulgaris , Deschampsia flexuosa.This thesis examines the suitability of controlled and wilderness grazing as conservation management tool for open,

FRONTERAS DIFUSAS Y ACTORES SOCIALES MESTIZOS: DEBATES CONCEPTUALES Y DESARROLLOS ANALÍTICOS EN TORNO A LOS ESPACIOS DE FRONTERA Y SUS VINCULACIONES CON LOS INDIOS-BLANCOS EN LA REGIÓN DEL CHACO DURANTE LA SEGUNDA MITAD DEL SIGLO XIX

Directory of Open Access Journals (Sweden)

Julio César Spota

2010-12-01

Full Text Available En la frontera establecida entre el Estado argentino y las distintas parcialidades aborígenes de la región del Chaco durante la segunda parte del siglo XIX, se configuraron identidades étnicas mestizas que escapaban a la simple esquematización de blancos e indios, civilizados y salvajes. La praxis histórica de los actores sociales como los indios-blancos (soldados desertores, criminales fugitivos de la ley, perseguidos y refugiados políticos y comerciantes que fueron incorporados dentro de los grupos indígenas proporciona un espacio privilegiado de reflexión antropológica poco explorado hasta el momento. En el presente artículo nos proponemos determinar las causas históricas que motivaron la migración de los criollos y recuperar la perspectiva de los actores sociales que protagonizaron los hechos estudiados.

Diversidades visibles e invisibles

Directory of Open Access Journals (Sweden)

Anita Krainer

2013-09-01

Full Text Available Trece millones de personas viven en Ecuador, territorio caracterizado por poseer una mega diversidad biológica y cultural. En el país conviven población blanca, mestiza, indígena y afro ecuatoriana. Los pueblos indígenas se asientan en las cuatro regiones geográficas del país. La población afro ecuatoriana se asienta en la provincia de Esmeraldas, en la Costa, y en la provincia de Imbabura, en la Sierra, por efectos de la migración existen también importantes asentamientos afro ecuatorianos en Quito y Guayaquil. Los territorios que limitan con Colombia han recibido en los últimos años refugiados y desplazados campesinos e indígenas. Debemos considerar que los pueblos awa kwaiker, siona, secoya y shuar se asientan en los dos territorios

Seeking a "Mexicana"/"Mestiza" Ethic of Care: Rosa's "Revolución" of Carrying Alongside

Science.gov (United States)

Sosa-Provencio, Mia Angélica

2017-01-01

This Chicana Critical Feminist "Testimonio" reveals a Mexican/Mexican-American Ethic of Care particular to the needs and strengths of "Mexicana/o" students and "Testimonios" of struggle, survival informing one Mexican/Mexican-American female educator of predominantly Mexican/Mexican-American students. This work,…

Las mestizas y el concubinato en el patriarcal Santafé de Bogota, siglo XVIII

OpenAIRE

Dueñas Vargas, Guiomar

1997-01-01

El cortejo, el matrimonio y la formación de familias en Santafé, Nueva Granada no se acogían a la norma única del rito católico promulgado por la Corona española y por la iglesia. La diversidad de formas de unión era lo usual. Estas uniones «irregulares» estaban asociadas a la raza de los contrayentes, a la situación socioeconómica y a la diferencia genérica. El rito católico al alcance sólo de una minoría blanca sirvió a los fines de la diferenciación social y fue dispositivo de las “gentes ...

Identification and isolation of gene differentially expressed on scrotal ...

African Journals Online (AJOL)

Yomi

2012-01-05

Jan 5, 2012 ... 1Laboratory of Molecular Biology and Bovine Breeding, Institute ... there were eight sequences highly identified to be Bos taurus mRNA for proline-rich protein P-B and ..... orchestrate microtubule dynamics and determine the.

Comparison of methanogen diversity of yak (Bos grunniens) and cattle (Bos taurus) from the Qinghai-Tibetan plateau, China

Science.gov (United States)

2012-01-01

Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak) and normal animal (cattle) in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones) and four cattle (205 clones) from the Qinghai-Tibetan Plateau area (QTP). Overall, a total of 414 clones (i.e. sequences) were examined and assigned to 95 operational taxonomic units (OTUs) using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC) were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110) was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle. PMID:23078429

Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

Directory of Open Access Journals (Sweden)

Huang Xiao

2012-10-01

Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle.

the occurrence of post partum anoestrus in bonsmara cows

African Journals Online (AJOL)

duration of post partum anoestrus than gain in body mass. Post pactum ... and Bos Taurus cattle to improve fertility and milk pro- duction in high .... The occurrence of post partum anoestrus in beef cows under ranching conditions. Proc.

UniProt search blastx result: AK289096 [KOME

Lifescience Database Archive (English)

Full Text Available AK289096 J090096D02 Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 precursor... (EC 3.4.23.-) (PAG 1) (Pregnancy-specific protein B) (PSP-B) - Bos taurus (Bovine) 9.00E-45 ...

[Is burnout a syndrome or an occupational disease? Instructions for occupational physicians].

Science.gov (United States)

Chirico, Francesco

2017-01-01

Since Herbert Freudenberger described Burnout Syndrome (BOS) in 1974, thousands of scientific papers have been published on this syndrome and this trend does not seem to diminish. After being internationally known as a syndrome characterized by emotional exhaustion, depersonalization, and reduced personal accomplishment in helping professions, its construct has been criticized, questioned, and subjected to profound modifications. To date, however, in Italy and in many other Countries it is not possible to diagnose this syndrome, because World Health Organization, in its last ICD-10, did not indicate any clinical criteria to diagnose it. Unfortunately, not even in the recent DSM- 5 by American Psychiatric Association, contrary to what was expected, BOS found room as a specific psychiatric disorder. As a consequence, framing this syndrome from a medical-legal point of view is still widely debated from scholars.

A comparative review between the updated models of Brazilian, United Kingdom and American eye banks and lamellar transplants

Directory of Open Access Journals (Sweden)

Gustavo Victor

2014-12-01

Full Text Available The corneal transplantation (CT is the most commonly performed type of transplant in the world and the Eye Banks are organizations whose capture, evaluate, preserve, store and distribute ocular tissues. With the evolution of surgical techniques and equipment for CT, the BOs had to evolve to keep up with these requirements. This evolution goes from tissues capture techniques, donating money and clarification to the patient (e.g. internet-based, use of current equipment for more adequate tissues supply for the most current surgical techniques, integration of BOs of certain country and real-time management of stocks of ocular tissues, and adequacy of laws that manage the entire process. This review aims to make a comparative review between the updated models of Brazilian, United Kingdon and American Eye Banks. Like, check what the trend towards lamellar transplants in these three countries.

AcEST: DK954898 [AcEST

Lifescience Database Archive (English)

Full Text Available d A4FV84 Definition sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus Align length 160 Scor...t alignments: (bits) Value sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taur... 153 6e-37 sp|...Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musc... 152 8e-37 sp|Q9UKD2|MRT4_HUMAN mRNA turno...ver protein 4 homolog OS=Homo sap... 151 2e-36 sp|Q86HD3|MRT4_DICDI mRNA turnover p...rotein 4 homolog OS=Dictyost... 140 5e-33 sp|Q7S302|MRT4_NEUCR mRNA turnover protein 4 homolog OS=Neurospo..

Metalloproteinase Profiling in Lung Transplant Recipients With Good Outcome and Bronchiolitis Obliterans Syndrome

NARCIS (Netherlands)

Heijink, Irene H.; Rozeveld, Dennie; van der Heide, Sicco; Bij, van der Wim; Bischoff, Rainer; Oosterhout, van Antoon J,; van der Toorn, Marco

Background. Bronchiolitis obliterans syndrome (BOS), the major cause of death on lung transplantation, is characterized by bronchiolar inflammation and tissue remodeling. Matrix metalloproteinases (MMPs) have been implicated in these processes, although it is still unclear whether MMP activity and

The size of domestic cattle, sheep, goats and pigs in the Czech Neolithic and Eneolithic Periods: Temporal variations and their causes

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2016-01-01

Roč. 25, Junio (2016), s. 33-78 ISSN 1132-6891 Institutional support: RVO:67985912 Keywords : osteometry * body mass * domestication * cross-breeding * Chalcolithic * Bos taurus * Ovis aries * Capra hircus * Sus domesticus * aurochs * wild boar * archaeozoology Subject RIV: AC - Archeology, Anthropology, Ethnology

MtDNA haplotype identification of aurochs remains originating from the Czech Republic (Central Europe)

Czech Academy of Sciences Publication Activity Database

Kyselý, René; Hájek, M.

2012-01-01

Roč. 17, č. 2 (2012), s. 118-125 ISSN 1461-4103 Institutional research plan: CEZ:AV0Z80020508 Institutional support: RVO:67985912 Keywords : wild cattle (Bos primigenius) * aDNA * haplotype P * domestication Subject RIV: AC - Archeology, Anthropology, Ethnology

A national survey on the allelic, genotypic, and haplotypic ...

Indian Academy of Sciences (India)

to be an important factor in preventing disease recurrence. (Goldmann ... objective of this study is to examine sequence variants of the. PRNP gene in ..... Fund. References. Belt P. B., Muileman I. H., Schreuder B. E., Bos-de Ruijter J.,. Gielkens ...

Bronchiolitis obliterans syndrome after lung transplantation and health-related quality of life

NARCIS (Netherlands)

van den Berg, JWK; van der Bij, W; Koeter, GH; Postma, DS; ten Vergert, EM

The present study was undertaken to assess the relationship between health-related quality of life (HRQOL) and bronchiolitis obliterans syndrome (BOS), as both represent important parameters of outcome after lung transplantation. HRQOL was measured both cross-sectionally and longitudinally by

Dicty_cDB: VHM242 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 74 3e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 74 4e-12 protein upda

Dicty_cDB: VHM737 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein upda

Efeito da idade de desmame e suplementação no desenvolvimento de novilhas de corte Effect of weaning age and supplementation on beef heifers growth

Directory of Open Access Journals (Sweden)

Luciane Salgueiro Pio de Almeida

2004-12-01

Full Text Available O experimento foi conduzido com o objetivo de avaliar o desempenho de 47 novilhas de corte cruzas Bos taurus x Bos indicus até os dois anos de idade, desmamadas precocemente (DP, com idade média de 91 dias e peso mínimo de 70 kg de peso vivo, ou desmamadas à idade convencional (DC, com média de 170 dias de idade e 130,3 kg, suplementadas (Su ou não (NSu com suplemento comercial com 14% de proteína bruta e 75% de NDT, durante 91 dias no primeiro inverno pós-desmame. Os animais do DP e o grupo não-suplementado apresentaram menores pesos vivos até um ano de idade. A idade do desmame não influenciou a taxa de prenhez das novilhas (77,3 e 72%, para o DP e DC, respectivamente. A suplementação no primeiro inverno não influenciou o desempenho das novilhas aos dois anos de idade. O desmame precoce não afetou o desenvolvimento e a fertilidade das novilhas aos dois anos de idade, quando comparado ao desmame à idade convencional.The experiment was conducted to evaluate the performance of 47 Bos taurus x Bos indicus beef heifers until two years of age. Heifers were early weaned (EW with average age of 91 days and minimum of 70 kg of liveweight or weaned at conventional age with average of 170 days and average liveweight of 130.3 kg (CW, supplemented (Su or not (NSu with concentrate containing 14% crude protein and 75% total digestible nutrients (TDN during 91 days in the first winter. The early weaning and the no supplemented group were lightier until one year of age. Weaning age did not affect pregnancy rate (77.3% and 72% to EW and CW, respectively. The supplementation during the first winter did not affect the heifers performance until two years of age. Early weaning did not affected the growth and the fertility of heifers until two years of age when compaired with the weaning at the conventional age.

Evaluación de la tasa de concepción de tres razas bovinas receptoras de embriones en el Trópico Alto

Directory of Open Access Journals (Sweden)

Oscar Orlando Farfan-Rojas

2015-04-01

Full Text Available El presente estudio se realizó con el fin de evaluar la eficiencia reproductiva, medida en porcentaje de novillas preñadas, de tres razas bovinas, como receptoras de embriones. En el altiplano Cundiboyacense se han realizado pocos estudios tendientes a determinar cuáles razas, aptas para el medio, son las que pueden brindar mejores tasas de concepción, como receptoras, en transferencia de embriones. Los resultados se sometieron a un análisis estadístico descriptivo, utilizando los programas Excel y Minitab (Chi cuadrado x2, con variables de tipo cuantitativo. La selección de receptoras se hizo con base en la calidad de cuerpo lúteo, normalidad del tracto reproductivo, CC entre 2 y 3 en una escala de 1 (muy flaca a 5 (cebada. La transferencia de embriones se realizó por el método no quirúrgico y se obtuvo un porcentaje de gestación en la raza Normando de 63%; en la Holstein, de 55.5%, y en la raza Brangus, de 44.4%. El protocolo utilizado fue Ovisynch, y los embriones transferidos fueron congelados y descongelados para el momento de transferirlos.

Fibroblasts express OvHV-2 capsid protein in vasculitis lesions of American bison (Bison bison) with experimental sheep-associated malignant catarrhal fever

Science.gov (United States)

Sheep-associated malignant catarrhal fever (SA-MCF) caused by ovine herpesvirus-2 (OvHV-2), a '-herpesvirus, is an often fatal disease characterized by lymphoproliferation, vasculitis, and mucosal ulceration in American bison (Bison bison), cattle (Bos taurus), and other clinically susceptible speci...

Diepe grondwatervervuiling door een bouwlandperceel in de 10-jaarszone van waterwingebied Putten

NARCIS (Netherlands)

Krajenbrink GJW

1988-01-01

In het kader van het stikstofproject heeft het RIVM onderzoek verricht naar de grondwaterverontreiniging tot max. 70 meter diepte onder- en benedenstrooms van een bouwlandperceel, omgeven door bos. Het water in de 180 meter dikke grofzandige freatische aquifer is gedetailleerd bemonsterd met

NCBI nr-aa BLAST: CBRC-RNOR-05-0198 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0198 ref|XP_596853.2| PREDICTED: similar to T-cell acute lymphocytic leukemia...-1 protein (TAL-1 protein) (Stem cell protein) (T-cell leukemia/lymphoma-5 protein) [Bos taurus] XP_596853.2 1e-168 89% ...

Baardvleermuizen in Ginneken en omgeving : ecologisch en toxicologisch onderzoek naar de kraamverblijfplaats van baardvleermuizen op de Hervormde Kerk te Ginneken

NARCIS (Netherlands)

Korsten, E.; Brink, van den N.G.M.

2010-01-01

Doel van dit onderzoek was: 1. Meer inzicht in het leefgebied van de populatie baardvleermuizen in Ginneken en het Ulvenhoutse Bos, in het bijzonder in de locaties van de kraamverblijfplaatsen en andere zomerverblijfplaatsen zodat de bescherming van deze verblijfplaatsen en een verdere uitbreiding

Note on the chemotaxonomy of Huaceae

NARCIS (Netherlands)

Beijersbergen, A.

1972-01-01

A comparative study of acetone, ethanol, and hydrolysis extracts of Hua gahonii Pierre ( Bos 6677, leaves) and Afrostyrax lepidophyllus Mildbr. (Brookman Amissah s.n., bark) has been carried out. The presence of the following compounds could not be demonstrated: gallic acid, ellagic acid,

Dicty_cDB: VHO851 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available d:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...14006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 prote

Dicty_cDB: VHM169 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available one) Homo sapiens full open reading fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic...06_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein

Dicty_cDB: VHI393 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein

Dicty_cDB: VHO630 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein

Dicty_cDB: VHA439 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 CR457155_1( CR457155 |...pid:none) Homo sapiens full open reading fra... 76 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHC785 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 75 1e-1...one) Homo sapiens full open reading fra... 75 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic

Dicty_cDB: VHD838 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid.....06 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein update 2009. 6.29 PSORT psg: 0.67 gvh:

Dicty_cDB: VHF111 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available id:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from ...Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

Dicty_cDB: VHL517 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available d:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...14006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 prote

Lignin peroxidase mediated biotransformations useful in the biocatalytic production of vanillin

NARCIS (Netherlands)

Have, ten R.

2000-01-01

This research concentrates on lignin peroxidase (LiP) mediated biotrans-formations that are useful in producing vanillin.

In order to obtain this extracellular enzyme, the white-rot fungus Bjerkandera sp. strain BOS55 was cultivated on nitrogen rich

Bohring-Opitz (Oberklaid-Danks) syndrome: clinical study, review of the literature, and discussion of possible pathogenesis

DEFF Research Database (Denmark)

Hastings, Rob; Cobben, Jan-Maarten; Gillessen-Kaesbach, Gabriele

2011-01-01

Bohring-Opitz syndrome (BOS) is a rare congenital disorder of unknown etiology diagnosed on the basis of distinctive clinical features. We suggest diagnostic criteria for this condition, describe ten previously unreported patients, and update the natural history of four previously reported patients...

stress and adaptation in beef heifers: 1. effect of pen conditions on ...

African Journals Online (AJOL)

Korthoring). Bos indicus (Afrikaner) en intermedibre (Bonsmara) tipe, is ingekraal teen. 'n vloer- .... body mass on average, and were in a state of sub-mainte- nance nutrition for 87 /, of the 2l week trial period. (Fig. l). At termination, Afrikaner heifers ...

Experimental Vision Studies of Flow and Structural Effects on Wind Turbines

DEFF Research Database (Denmark)

Najafi, Nadia

In the present thesis, two modern vision technologies are developed and used to study wind turbines: 1- Stereo vision to study vibrations and dynamics of the Vertical Axes Wind Turbine (VAWT) via operational modal analysis (OMA) 2- Background-oriented Schlieren (BOS) method to study the tip...... vortices that are shed from a Horizontal Axis Wind Turbine (HAWT) blades The thesis starts with an introduction to the stereo vision and OMA and is followed by two practical implementations of the basics derived in the introduction. In the first experiment, we developed the image processing tools...... a Nordtank horizontal axis wind turbine based on the density gradient in the vortex. The BOS method does not need complicated equipment such as special cameras or seeded flow, which makes it a convenient method to study large scale flows. However, the challenging part in the current case is the small...

Smartphone schlieren and shadowgraph imaging

Science.gov (United States)

Settles, Gary S.

2018-05-01

Schlieren and shadowgraph techniques are used throughout the realm of scientific experimentation to reveal transparent refractive phenomena, but the requirement of large precise optics has kept them mostly out of reach of the public. New developments, including the ubiquity of smartphones with high-resolution digital cameras and the Background-Oriented Schlieren technique (BOS), which replaces the precise optics with digital image processing, have changed these circumstances. This paper demonstrates a number of different schlieren and shadowgraph setups and image examples based only on a smartphone, its software applications, and some inexpensive accessories. After beginning with a simple traditional schlieren system the emphasis is placed on what can be visualized and measured using BOS and digital slit-scan imaging on the smartphone. Thermal plumes, liquid mixing and glass are used as subjects of investigation. Not only recreational and experimental photography, but also serious scientific imaging can be done.

Belatacept for Maintenance Immunosuppression in Lung Transplantation

Directory of Open Access Journals (Sweden)

Christine Hui PharmD

2014-06-01

Full Text Available Belatacept is a novel immunosuppressant that blocks a T-cell costimulation pathway and is approved for use in adult kidney transplant recipients. Its safety and efficacy have not been established after lung transplantation. We present a case of a lung transplant recipient treated with belatacept. A 56-year-old man underwent bilateral lung retransplantation for bronchiolitis obliterans syndrome (BOS. In the third year posttransplant, he developed hemolytic uremic syndrome (HUS attributed to tacrolimus. Tacrolimus was changed to sirolimus. One month later, he presented with worsening renal function and HUS attributed to sirolimus. Plasmapheresis and steroid pulse were initiated with clinical improvement, and sirolimus was switched to belatacept. He experienced no episodes of cellular rejection but developed recurrent BOS. Complications during treatment included anemia and recurrent pneumonias. The safety and efficacy of belatacept in lung transplantation remains unclear; further studies are needed.

¿DE PAISANO A PAISANO? EXPLOTACIÓN LABORAL Y EXCLUSIÓN SOCIAL DE JORNALEROS CHIAPANECOS EN JALISCO

Directory of Open Access Journals (Sweden)

Rafael Alonso Hernández López

2011-01-01

Full Text Available El objetivo del presente artículo es poner de manifiesto y analizar las relaciones sociales y laborales entre una población mestiza de Los Altos de Jalisco (México y una población indígena migrante procedente de Chiapas en el sureste mexicano. Se constata que los migrantes chiapanecos se han convertido en mano de obra para aquellas tareas cuya exigencia física es mayor y por las cuales hay menor retribución económica; además, su presencia ha generado reacciones mayoritariamente negativas entre la población de recepción. Estas actitudes, según se concluye, recrean y dan forma a nuevas relaciones de sumisión, exclusión, subordinación y discriminación, enmarcadas en un contexto de reconversión productiva en torno al tequila.

¿De paisano a paisano? Explotación laboral y exclusión social de jornaleros chiapanecos en Jalisco

Directory of Open Access Journals (Sweden)

Rafael Alonso Hernández López

2011-04-01

Full Text Available El objetivo del presente artículo es poner de manifiesto y analizar las relaciones sociales y laborales entre una población mestiza de Los Altos de Jalisco (México y una población indígena migrante procedente de Chiapas en el sureste mexicano. Se constata que los migrantes chiapanecos se han convertido en mano de obra para aquellas tareas cuya exigencia física es mayor y por las cuales hay menor retribución económica; además, su presencia ha generado reacciones mayoritariamente negativas entre la población de recepción. Estas actitudes, según se concluye, recrean y dan forma a nuevas relaciones de sumisión, exclusión, subordinación y discriminación, enmarcadas en un contexto de reconversión productiva en torno al tequila.

Osteomielitis hematógena de la rama íleo-isquiopubiana: A propósito de un caso Hematogenous osteomyelitis of the ischiopubic ramus: Apropos of a case

Directory of Open Access Journals (Sweden)

Ana Videaux Tamayo

2005-12-01

Full Text Available Se presenta el caso del paciente Y. P. T., del sexo femenino, raza mestiza, 11 años de edad, quien ingresa en la Sala de Misceláneas por traumatismo en la región glútea, diagnosticado inicialmente como una miositis de los aductores del muslo derecho. Según la evolución clínica, humoral y radiológica, desarrolla signos y síntomas de osteomielitis aguda de la rama íleo-isquiopubiana derecha, comprobada por velocidad de sedimentación globular acelerada y alteraciones radiológicas en esa zona, así como por la presencia de un cuadro febril intermitente. Se aplica tratamiento con penicilinas, quinolonas y betalactámicos. La paciente se encuentra en estos momentos en franca recuperación. Se significa la cooperación entre distintas disciplinas para la solución de los problemas de salud.

Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

Directory of Open Access Journals (Sweden)

Roberto César Araujo Lima

2014-02-01

Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

Impact of Donor Arterial Partial Pressure of Oxygen on Outcomes After Lung Transplantation in Adult Cystic Fibrosis Recipients.

Science.gov (United States)

Hayes, Don; Kopp, Benjamin T; Kirkby, Stephen E; Reynolds, Susan D; Mansour, Heidi M; Tobias, Joseph D; Tumin, Dmitry

2016-08-01

Donor PaO2 levels are used for assessing organs for lung transplantation (LTx), but survival implications of PaO2 levels in adult cystic fibrosis (CF) patients receiving LTx are unclear. UNOS registry data spanning 2005-2013 were used to test for associations of donor PaO2 with patient survival and bronchiolitis obliterans syndrome (BOS) in adult (age ≥ 18 years) first-time LTx recipients diagnosed with CF. The analysis included 1587 patients, of whom 1420 had complete data for multivariable Cox models. No statistically significant differences among donor PaO2 categories of ≤200, 201-300, 301-400, or >400 mmHg were found in univariate survival analysis (log-rank test p = 0.290). BOS onset did not significantly differ across donor PaO2 categories (Chi-square p = 0.480). Multivariable Cox models of patient survival supported the lack of difference across donor PaO2 categories. Interaction analysis found a modest difference in survival between the two top categories of donor PaO2 when examining patients with body mass index (BMI) in the lowest decile (≤16.5 kg/m(2)). Donor PaO2 was not associated with survival or BOS onset in adult CF patients undergoing LTx. Notwithstanding statistically significant interactions between donor PaO2 and BMI, there was no evidence of post-LTx survival risk associated with donor PaO2 below conventional thresholds in any subgroup of adults with CF.

Does resource availability, resource heterogeneity or species turnover mediate changes in plant species richness in grazed grasslands?

NARCIS (Netherlands)

Bakker, C; Blair, JM; Knapp, AK

2003-01-01

Grazing by large ungulates often increases plant species richness in grasslands of moderate to high productivity. In a mesic North American grassland with and without the presence of bison (Bos bison), a native ungulate grazer, three non-exclusive hypotheses for increased plant species richness in

Interview with Patrick Blackburn

DEFF Research Database (Denmark)

Hendricks, Vincent F.; Hansen, Pelle Guldborg

2005-01-01

In 2005 Patrick Blackburn, who is Directeur de Recherche for INRIA Lorraine (France's national organization for research in computer science), published together with Johan Bos (Università di Roma "La Sapienza") the book Representation and Inference for Natural Language: A First Course in Computa...

Browse Title Index

African Journals Online (AJOL)

Items 1 - 50 of 519 ... Mohammed Ali, Teklehaimanot Asefaw, Hagos Beyene, Peter Byass, Mohammed Shishay, Mohammed Shishay Hasibu, Freddy Karup Pedersen. Vol 22 (2008): Special Edition: Bovine Tuberculosis in Ethiopia, A comparative study on the epidemiology and immuno-pathology of bovine tuberculosis in Bos ...

A novel polymorphism of resistin gene and its association with meat ...

African Journals Online (AJOL)

Searching for candidate gene polymorphisms and their relationship with meat quality traits is an important issue for Bos taurus industry. In this study, we evaluated polymorphism of resistin (RETN) gene involved in energy metabolism. Using the polymerase chain reaction-single strand conformation polymorphism ...

Biopsy-verified bronchiolitis obliterans and other noninfectious lung pathologies after allogeneic hematopoietic stem cell transplantation

DEFF Research Database (Denmark)

Uhlving, Hilde Hylland; Andersen, Claus B; Christensen, Ib Jarle

2015-01-01

Institutes of Health's consensus criteria for BO syndrome (BOS) based exclusively on noninvasive measures. We included 44 patients transplanted between 2000 and 2010 who underwent lung biopsy for suspected BO. Of those, 23 were diagnosed with BO and 21 presented other noninfectious pulmonary pathologies...

Thresholds and Q values of nuclear reactions induced by neutrons, protons, deuterons, tritons, 3He ions, alpha particles, and photons

International Nuclear Information System (INIS)

Howerton, R.J.

1981-01-01

The 1977 Wapstra and Bos nuclear mass data tables were used to derive tables for thresholds and Q values of nuclear reactions induced by neutrons, protons, deuterons, tritons, 3 He ions, alpha particles, and photons. The tables are displayed on microfiche included with the report

Bohring-Opitz (Oberklaid-Danks) syndrome: clinical study, review of the literature, and discussion of possible pathogenesis

DEFF Research Database (Denmark)

Hastings, Rob; Cobben, Jan-Maarten; Gillessen-Kaesbach, Gabriele

2011-01-01

. This is the largest series reported to date, providing a unique opportunity to document the key clinical features and course through childhood. Investigations undertaken to try and elucidate the underlying pathogenesis of BOS using array comparative genomic hybridization and tandem mass spectrometry of cholesterol...

The value of ventilation scintigraphy after single lung transplantation

NARCIS (Netherlands)

Ouwens, JP; van der Bij, W; van der Mark, TW; Piers, DA; Koeter, GH

Background: A decrease in forced expiratory volume in 1 second (FEV1) as a diagnostic criterion for bronchiolitis obliterans syndrome (BOS) after single lung transplantation may be influenced significantly by the presence of the native lung. To quantify and to discriminate between the relative

Breeds of cattle

NARCIS (Netherlands)

Buchanan, David S.; Lenstra, Johannes A.

2015-01-01

This chapter gives an overview on the different breeds of cattle (Bos taurus and B. indicus). Cattle breeds are presented and categorized according to utility and mode of origin. Classification and phylogeny of breeds are also discussed. Furthermore, a description of cattle breeds is provided.

Congenital bovine spinal dysmyelination is caused by a missense mutation in the SPAST gene

DEFF Research Database (Denmark)

Thomsen, Bo; Nissen, Peter H.; Agerholm, Jørgen S

2010-01-01

 Bovine spinal dysmyelination (BSD) is a recessive congenital neurodegenerative disease in cattle (Bos taurus) characterized by pathological changes of the myelin sheaths in the spinal cord. The occurrence of BSD is a longstanding problem in the American Brown Swiss (ABS) breed and in several...

Antibiogram profile of pathogens isolated from processed cow meat ...

African Journals Online (AJOL)

... the antibiotic resistance tests revealed varied, but interesting susceptibility patterns. Our findings does highlight the fact that there exist obvious vehicles for pathogenic bacteria proliferation within our abattoirs, and hence, the need for caution. Key words: Abattoirs, Bos taurus, Pathogenic bacteria, Antibiotics, Resistance ...

Evaluatie van bemesting en bekalking in bossen en de ontwikkeling van onbehandelde bossen

NARCIS (Netherlands)

Olsthoorn, A.F.M.; Berg, van den C.A.; Gruijter, de J.J.

2006-01-01

Dit rapport doet verslag van een deelonderzoek uit de Evaluatie van effectgerichte maatregelen in multifunctionele bossen 2004-2005 en is gericht op de effecten van de maatregelen bemesting en bekalking in bossen als overbruggingsmaatregel in het kader van het Overlevingsplan Bos en Natuur (OBN). Na

50 CFR 14.4 - What terms do I have to understand?

Science.gov (United States)

2010-10-01

... under contract to and accredited by an accredited scientific institution for the purpose of conducting... an exhibit for the purpose of soliciting sales, without regard to quantity or weight. There is a... domesticus; Cattle—Bos taurus; Dog (domestic)—Canis familiaris; European rabbit—Ortyctolagus cuniculus...

UniProt search blastx result: AK287891 [KOME

Lifescience Database Archive (English)

Full Text Available AK287891 J065209I11 P47865|AQP1_BOVIN Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water c...hannel protein for red blood cells and kidney proximal tubule) (Water channel protein CHIP29) - Bos taurus (Bovine) 1.00E-19 ...

Facilitative and competitive interactions between sympatric cattle, red deer and wild boar in Dutch woodland pastures

NARCIS (Netherlands)

Kuiters, A.T.; Groot Bruinderink, G.W.T.A.; Lammertsma, D.R.

2005-01-01

Use of cattle-grazed and ungrazed woodland pastures by red deer Cervus elaphus Linnaeus, 1758 and wild boar Sus scrofa Linnaeus, 1758 was investigated monthly by measuring dung-deposition rates. Cattle Bos taurus grazed pastures year-round, with peak intensities during the growing season

NUTGRANJA 2.0

NARCIS (Netherlands)

Prado, del A.; Corré, W.J.; Gallejones, P.; Pardo, G.; Pinto, M.; Hierro, del O.; Oenema, O.

2016-01-01

Farm nutrient management has been identified as one of the most important factors determining the economic and environmental performance of dairy cattle (Bos taurus) farming systems. Given the environmental problems associated with dairy farms, such as emissions of greenhouse gases (GHG), and the

Dicty_cDB: VHK777 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 75 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas.....ll open reading fra... 75 4e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 75 4e-

Dicty_cDB: SFL375 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 15 |pid:none) Rhodococcus opacus B4 DNA, comp... 88 4e-16 BC088249_1( BC088249 |pid:none) Rattus norvegicus pipecoli... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 87 1e-15 BC116493_1( B

Dicty_cDB: VHP706 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 |pid:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...3 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13

Dicty_cDB: VHF631 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 6e-13 AY892312_1( AY892312 |pid:none...ing fra... 74 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid

Dicty_cDB: VHJ864 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pid:none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 pro

Dicty_cDB: VHC661 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 5e-13 AX882278_1( ...AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 5e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Diet and habitat-niche relationships within an assemblage of large herbivores in a seasonal tropical forest

NARCIS (Netherlands)

Ahrestani, F.S.; Heitkonig, I.M.A.; Prins, H.H.T.

2012-01-01

There is little understanding of how large mammalian herbivores in Asia partition habitat and forage resources, and vary their diet and habitat selection seasonally in order to coexist. We studied an assemblage of four large herbivores, chital (Axis axis), sambar (Cervus unicolor), gaur (Bos gaurus)

Stručná poznámka k staročeským slabičným likvidám

Czech Academy of Sciences Publication Activity Database

Vykypěl, Bohumil

2017-01-01

Roč. 23, č. 2 (2017), s. 361-363 ISSN 0354-0448 Institutional support: RVO:68378092 Keywords : Old Czech * phonology * graphemics * liquids * language contact Subject RIV: AI - Linguistics OBOR OECD: Linguistics http://bos.zrc-sazu.si/knjige/JZ%2023.2%20(2017)_Kurkina.pdf

TRES HISTORIAS SOBRE EL ESPAÑOL DEL PERÚ: LA INDIA, LA BLANCA Y LA MESTIZA

Directory of Open Access Journals (Sweden)

Carlos Garatea G.

2017-06-01

Full Text Available Muchas veces los historiadores de la lengua olvidan la diversidad textual; en otras, la presión ideológica puede deformar el valor de los textos y adscribirlos a expresiones de distinto origen. En este trabajo se muestra cómo se complementan y varían los registros y los niveles, de acuerdo con los tipos de textos, con la función de cada uno de ellos y, sobre todo, con la voluntad expresiva y la creatividad de los autores. Si bien el centro es la historia del español en el Perú, los criterios expuestos trascienden cualquier delimitación espacial y remiten a consideraciones teóricas y metodológicas de importancia en la historia de las lenguas.

Discovery of skin lymphocytes was a game changer in experimental dermatology

NARCIS (Netherlands)

Matos, Tiago R.; de Rie, Menno A.

2017-01-01

A substantial part of ongoing research in experimental dermatology focuses on skin T cellsfor that reason, we find important to highlight the pioneering work of Jan D. Bos et al. from 1987 (The skin immune system (SIS): Distribution and immunophenotype of lymphocyte subpopulations in normal skin)

In situ rumen degradability characteristics of rice straw, soybean ...

African Journals Online (AJOL)

In situ rumen degradability characteristics of rice straw, soybean curd residue and peppermint (Mentha piperita) in Hanwoo steer (Bos Taurus coreanae). Byong Tae Jeon, KyoungHoon Kim, Sung Jin Kim, Na Yeon Kim, Jae Hyun Park, Dong Hyun Kim, Mi Rae Oh, Sang Ho Moon ...

Total and size-resolved particle number and black carbon concentrations in urban areas near Schiphol airport (the Netherlands)

NARCIS (Netherlands)

Keuken, M.P.; Moerman, M.; Zandveld, P.; Henzing, J.S.; Hoek, G.

2015-01-01

The presence of black carbon, and size-resolved and total particle number concentrations (PNC) were investigated in the vicinity of Schiphol airport in the Netherlands, the fourth busiest airport in Europe. Continuous measurements were conducted between March and May 2014at Adamse Bos, located 7km

Characterization and sequence analysis of cysteine and glycine-rich ...

African Journals Online (AJOL)

Primers specific for CSRP3 were designed using known cDNA sequences of Bos taurus published in database with different accession numbers. Polymerase chain reaction (PCR) was performed and products were purified and sequenced. Sequence analysis and alignment were carried out using CLUSTAL W (1.83).

Reproductive Performance And Superovulatory Response Of ...

African Journals Online (AJOL)

This study was undertaken to determine the reproductive performance of the endangered Bos-taurus Namshi breed of Cameroon. Ovarian response to superovulatory treatment was also evaluated. The following observations were recorded. The average calf mortality rate was 25.71% while the average birth weight was ...

Breed x sex effects on birth weight in Brahman-Simmental embryo transfer calves

Science.gov (United States)

Brahman cross calves exhibit unusual inheritance of birth weight: Brahman-sired crossbreds out of Bos taurus females are heavier with greater difference between sexes than calves of the reciprocal cross. The objective of this work was to compare birth weight in various crosses of Brahman, Simmenta...

Dicty_cDB: VHI816 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available omal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... ...pid:none) Homo sapiens full open reading fra... 75 5e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHO717 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 1e-12 AX882278_1( AX882278 |pid:none) Sequenc...e 17183 from Patent EP10746... 76 1e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Actieplan Hout 2000; een plan voor de hele sector?

NARCIS (Netherlands)

Wijk, van M.N.; Vliet, van C.M.

1999-01-01

Aan de hand van vier thema's wordt een aantal concrete actiepunten besproken om te komen tot een verbetering van de economische situatie in de Nederlandse bos- en houtsector en een verhoging van het houtgebruik in Nederland. Het gaat bij de thema's om voorlichting en promotie (duurzaamheid!),

Characterization of PRLR and PPARGC1A genes in buffalo (Bubalus bubalis

Directory of Open Access Journals (Sweden)

Ruheena Javed

2011-01-01

Full Text Available More than 40 million households in India depend at least partially on livestock production. Buffaloes are one of the major milk producers in India. The prolactin receptor (PRLR gene and peroxisome proliferators activated receptor-γ coactivator 1-alpha (PPARGC1A gene are reportedly associated with milk protein and milk fat yields in Bos taurus. In this study, we sequenced the PRLR and PPARGC1A genes in the water buffalo Bubalus bubalis. The PRLR and PPARGC1A genes coded for 581 and 819 amino acids, respectively. The B. bubalis PRLR gene differed from the corresponding Bos taurus at 21 positions and four differences with an additional arginine at position 620 in the PPARGC1A gene were found in the amino acid sequence. All of the changes were confirmed by cDNA sequencing. Twelve buffalo-specific single nucleotide polymorphisms (SNPs were identified in both genes, with five of them being non-synonymous.

A review of recent developments in schlieren and shadowgraph techniques

International Nuclear Information System (INIS)

Settles, Gary S; Hargather, Michael J

2017-01-01

Schlieren and shadowgraph techniques are used around the world for imaging and measuring phenomena in transparent media. These optical methods originated long ago in parallel with telescopes and microscopes, and although it might seem that little new could be expected of them on the timescale of 15 years, in fact several important things have happened that are reviewed here. The digital revolution has had a transformative effect, replacing clumsy photographic film methods with excellent—though expensive—high-speed video cameras, making digital correlation and processing of shadow and schlieren images routine, and providing an entirely-new synthetic schlieren technique that has attracted a lot of attention: background-oriented schlieren or BOS. Several aspects of modern schlieren and shadowgraphy depend upon laptop-scale computer processing of images using an image-capable language such as MATLAB ™ . BOS, shock-wave tracking, schlieren velocimetry, synthetic streak-schlieren, and straightforward quantitative density measurements in 2D flows are all recent developments empowered by this digital and computational capability. (topical review)

A review of recent developments in schlieren and shadowgraph techniques

Science.gov (United States)

Settles, Gary S.; Hargather, Michael J.

2017-04-01

Schlieren and shadowgraph techniques are used around the world for imaging and measuring phenomena in transparent media. These optical methods originated long ago in parallel with telescopes and microscopes, and although it might seem that little new could be expected of them on the timescale of 15 years, in fact several important things have happened that are reviewed here. The digital revolution has had a transformative effect, replacing clumsy photographic film methods with excellent—though expensive—high-speed video cameras, making digital correlation and processing of shadow and schlieren images routine, and providing an entirely-new synthetic schlieren technique that has attracted a lot of attention: background-oriented schlieren or BOS. Several aspects of modern schlieren and shadowgraphy depend upon laptop-scale computer processing of images using an image-capable language such as MATLAB™. BOS, shock-wave tracking, schlieren velocimetry, synthetic streak-schlieren, and straightforward quantitative density measurements in 2D flows are all recent developments empowered by this digital and computational capability.

AcEST: BP912479 [AcEST

Lifescience Database Archive (English)

Full Text Available |P81282|CSPG2_BOVIN Versican core protein OS=Bos taurus GN=VCA... 35 0.22 sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS...PSVNQRCLGG 325 + + + E+ KVPSV + G Sbjct: 2452 STTFVSD---RSLEKHPKVPSVEAVTVNG 2477 >sp|Q9Y2K

Marketing Transformation (Fact Sheet)

Energy Technology Data Exchange (ETDEWEB)

DOE Solar Energy Technologies Program

2011-10-13

Through the SunShot Initiative, the U.S. Department of Energy (DOE) works with manufacturers, communities, states, utilities, and other partners to enable the solar market by reducing non-hardware balance-of-system (BOS) costs, developing a skilled workforce, and eliminating market barriers to widespread adoption of solar technologies.

Morphological assessment of Niger Kuri cattle using multivariate ...

African Journals Online (AJOL)

This work confirms that at type trait level Kuri cattle is a unique population within the West African taurine cattle group. The implementation of genetic analyses aiming at ascertaining the degree of uniqueness of the breed is advised. Keywords: Body measurements, Bos taurus, multivariate analyses, qualitative traits, West ...

AcEST: BP921779 [AcEST

Lifescience Database Archive (English)

Full Text Available rotein D OS=Bos tauru... 31 1.7 sp|Q66810|VGP_EBOIC Envelope glycoprotein OS=Ivory Coast ebolavi... 30 3.8 s...p|Q66810|VGP_EBOIC Envelope glycoprotein OS=Ivory Coast ebolavirus (strain Cote d'Ivoire-94) GN=GP PE=1 SV=1

Rice yellow mottle virus is transmitted by cows, donkeys, and grass rats in irrigated rice crops

NARCIS (Netherlands)

Sarra, S.; Peters, D.

2003-01-01

Rice yellow mottle virus (RYMV), endemic in Africa, is believed to be spread by chrysomelid beetles, although the infections in a field often cannot be explained by the prevailing number of beetles. We show that the grass rat Arvicanthis niloticus, domestic cows (Bos spp.), and donkeys (Asinus spp.)

Livestock and elk grazing effects on stream morphology, brown trout population dynamics, movement, and growth rate, Valles Caldera National Preserve, New Mexico

Science.gov (United States)

Michael C. Anderson

2009-01-01

Ungulate grazing in riparian areas has been shown to detrimentally impact stream morphology and fish populations. Goals of this research were to assess changes in stream morphology and responses of a brown trout (Salmo trutta) population to exclusion of cattle (Bos taurus) and elk (Cervus elaphus) from riparian...

Chopped or long roughage: what do calves prefer? Using cross point analysis of double demand functions

NARCIS (Netherlands)

Webb, L.E.; Bak Jensen, M.; Engel, B.; Reenen, van C.G.; Gerrits, W.J.J.; Boer, de I.J.M.; Bokkers, E.A.M.

2014-01-01

The present study aimed to quantify calves'(Bos taurus) preference for long versus chopped hay and straw, and hay versus straw, using cross point analysis of double demand functions, in a context where energy intake was not a limiting factor. Nine calves, fed milk replacer and concentrate, were

Ghana - Kumasi

DEFF Research Database (Denmark)

Eskemose Andersen, Jørgen

2007-01-01

Bosætningen i Kumasi (1 mill. indb.) var indtil 1990'erne domineret af det traditionelle flerfamilies gårdhus, som siden er blevet afløst af sprawl med store grundudstykninger, hvor der bygges villaer designet til enkelte familier. Mulighederne for familier med almindelige indkomster er reduceret...

Factors affecting conception rates in cattle following embryo transfer ...

African Journals Online (AJOL)

Embryo Transfer Technology (ETT) plays an important role in improving productivity of dairy cattle (Bos indicus). Embryo Transfer Technology allows top quality female livestock to improve a herd or flock in much the same way that artificial insemination has allowed greater use of superior sires. The technology hastens ...

Dicty_cDB: VHJ505 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available arcosine oxidase; S... 73 5e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 73 5e-...none) Homo sapiens full open reading fra... 72 9e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: AHA771 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 9e-13 AX882278_1( AX882278 |pid...:none) Sequence 17183 from Patent EP10746... 76 9e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

Dicty_cDB: VHN454 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 93_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 72 2e-11 AX882278_1( AX882278 |pid:none) Seq...uence 17183 from Patent EP10746... 72 2e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHD308 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available eroxisomal sarcosine oxidase; S... 75 9e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxid...7155 |pid:none) Homo sapiens full open reading fra... 75 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

Dicty_cDB: VHK674 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 77 2e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...0746... 77 2e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 77 3e-13 CP001291_518

Dicty_cDB: VHQ355 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ens full open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... ... 1e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein update 2009. 7

Dicty_cDB: VHA709 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 6e-13 A...X882278_1( AX882278 |pid:none) Sequence 17183 from Patent EP10746... 76 6e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Compression distance can discriminate animals by genetic profile, build relationship matrices and estimate breeding values.

Science.gov (United States)

Hudson, Nicholas J; Porto-Neto, Laercio; Kijas, James W; Reverter, Antonio

2015-10-13

Genetic relatedness is currently estimated by a combination of traditional pedigree-based approaches (i.e. numerator relationship matrices, NRM) and, given the recent availability of molecular information, using marker genotypes (via genomic relationship matrices, GRM). To date, GRM are computed by genome-wide pair-wise SNP (single nucleotide polymorphism) correlations. We describe a new estimate of genetic relatedness using the concept of normalised compression distance (NCD) that is borrowed from Information Theory. Analogous to GRM, the resultant compression relationship matrix (CRM) exploits numerical patterns in genome-wide allele order and proportion, which are known to vary systematically with relatedness. We explored properties of the CRM in two industry cattle datasets by analysing the genetic basis of yearling weight, a phenotype of moderate heritability. In both Brahman (Bos indicus) and Tropical Composite (Bos taurus by Bos indicus) populations, the clustering inferred by NCD was comparable to that based on SNP correlations using standard principal component analysis approaches. One of the versions of the CRM modestly increased the amount of explained genetic variance, slightly reduced the 'missing heritability' and tended to improve the prediction accuracy of breeding values in both populations when compared to both NRM and GRM. Finally, a sliding window-based application of the compression approach on these populations identified genomic regions influenced by introgression of taurine haplotypes. For these two bovine populations, CRM reduced the missing heritability and increased the amount of explained genetic variation for a moderately heritable complex trait. Given that NCD can sensitively discriminate closely related individuals, we foresee CRM having possible value for estimating breeding values in highly inbred populations.

Infestation by Haematopinus quadripertusus on cattle in São Domingos do Capim, state of Pará, Brazil Infestação por Haematopinus quadripertusus em bovinos de São Domingos do Capim, Estado do Pará, Brasil

Directory of Open Access Journals (Sweden)

Alessandra Scofield

2012-09-01

Full Text Available Severe infestation with lice was observed on crossbred cattle (Bos taurus indicus ×Bos taurus taurus in the municipality of São Domingos do Capim, state of Pará, Brazil. Sixty-five animals were inspected and the lice were manually collected, preserved in 70% alcohol and taken to the Animal Parasitology Laboratory, School of Veterinary Medicine, Federal University of Pará, Brazil, for identification. The adult lice were identified as Haematopinus quadripertusus, and all the cattle examined were infested by at least one development stage of this ectoparasite. The specimens collected were located only on the tail in 80% (52/65 of the cattle, while they were around the eyes as well as on the ears and tail in 20% (13/65. Nits, nymphs and adults of the parasite were respectively collected from 98.46% (64/65, 38.46% (25/65 and 23.08% (15/65 of the animals examined. This is the first report of bovine pediculosis caused by H. quadripertusus in the state of Pará, Brazil. Further studies should be conducted to determine the occurrence pattern of this species in Brazil and its importance to livestock production.Alta infestação por piolhos foi observada em vacas mestiças Bos taurus indicus e Bos taurus taurus do município de São Domingos do Capim, Estado do Pará, Brasil. Sessenta e cinco animais foram inspecionados e os piolhos foram coletados manualmente, armazenados em álcool 70% e transportados ao Laboratório de Parasitologia Animal da Faculdade de Medicina Veterinária da Universidade Federal do Pará para a identificação. Os exemplares adultos foram identificados como Haematopinus quadripertusus e todos os animais examinados apresentaram pelo menos um estágio de desenvolvimento do ectoparasito. Em 80% (52/65 dos animais, os exemplares coletados localizavam-se somente na cauda e em 20% (13/65 na região periocular, orelha e cauda. Lêndeas, ninfas e adultos foram coletados, respectivamente, em 98,46% (64/65, em 38,46% (25/65 e em 23

Morphological dimorphism in the Y chromosome of "pé-duro" cattle in the Brazilian State of Piauí

Directory of Open Access Journals (Sweden)

Carmen M.C. Britto

1999-09-01

Full Text Available "Pé-duro" (hard foot is a rare breed of beef cattle of European (Bos taurus taurus origin, originated in northern and northeastern Brazil. Y chromosome morphology, outer genital elements and other phenotypic characteristics were examined in 75 "pé-duro" bulls from the Empresa Brasileira de Pesquisa Agropecuária (Embrapa herd in the Brazilian State of Piauí. The purpose was to investigate possible racial contamination with Zebu animals (Bos taurus indicus in a cattle that has been considered closest to its European origin (B. t. taurus. The presence of both submetacentric and acrocentric Y chromosomes, typical of B. t. taurus and B. t. indicus, respectively, and the larger preputial sheath in bulls with an acrocentric Y chromosome indicated racial contamination of the "pé-duro" herd with Zebu cattle. Phenotypic parameters involving horn, dewlap, ear, chamfer, and coat color characteristics, indicative of apparent racial contamination, were not associated with acrocentric Y chromosome.Um plantel de touros "pé-duro", consistindo de 75 animais do núcleo da Embrapa envolvido com a preservação desse gado no Estado do Piauí, foi examinado quanto à morfologia do seu cromossomo Y, bem como em relação a elementos da genitália externa e outras características fenotípicas dos machos. O objetivo era investigar a contaminação racial por animais zebuínos (Bos taurus indicus num gado bovino que tem sido considerado mais próximo de sua origem européia (Bos taurus taurus. Tanto a forma submetacêntrica quanto a forma acrocêntrica do cromossomo Y, típicas das sub-espécies B. t. taurus e B. t. indicus, respectivamente, bem como maior bainha prepucial nos espécimes portadores do cromossomo Y acrocêntrico, indicativa de contaminação racial por gado zebuíno, foram detectadas no rebanho "pé-duro" mantido no núcleo da Embrapa. Outras características fenotípicas analisadas que podem informar sobre a contaminação racial aparente n

Physiological Responses and Lactation to Cutaneous Evaporative Heat Loss in , , and Their Crossbreds

Directory of Open Access Journals (Sweden)

Wang Jian

2015-11-01

Full Text Available Cutaneous evaporative heat loss in Bos indicus and Bos taurus has been well documented. Nonetheless, how crossbreds with different fractional genetic proportions respond to such circumstances is of interest. A study to examine the physiological responses to cutaneous evaporative heat loss, also lactation period and milk yield, were conducted in Sahiwal (Bos indicus, n = 10, 444±64.8 kg, 9±2.9 years, Holstein Friesian (Bos taurus, HF100% (n = 10, 488±97.9 kg, 6±2.8 years and the following crossbreds: HF50% (n = 10, 355±40.7 kg, 2±0 years and HF87.5% (n = 10, 489±76.8 kg, 7±1.8 years. They were allocated so as to determine the physiological responses of sweating rate (SR, respiration rate (RR, rectal temperature (RT, and skin temperature (ST with and without hair from 06:00 h am to 15:00 h pm. And milk yield during 180 days were collected at days from 30 to 180. The ambient temperature-humidity-index (THI increased from less than 80 in the early morning to more than 90 in the late afternoon. The interaction of THI and breed were highly affected on SR, RR, RT, and ST (p0.05 but did change over time. The ST with and without hair were similar, and was higher in HF100% (37.4°C; 38.0°C and their crossbred HF50% (35.5°C; 35.5°C and HF87.5% (37.1°C; 37.9°C than Sahiwal (34.8°C; 34.8°C (p<0.01. Moreover, the early lactation were higher at HF100% (25 kg and 87.5% (25 kg than HF50% (23 kg which were higher than Sahiwal (18 kg while the peak period of lactation was higher at HF100% (35 kg than crossbreds both HF87.5% and HF50% (32 kg which was higher than Sahiwal (26 kg (p<0.05. In conclusion, sweating and respiration were the main vehicle for dissipating excess body heat for Sahiwal, HF and crossbreds, respectively. The THI at 76 to 80 were the critical points where the physiological responses to elevated temperature displayed change.

Heterosis para pesos a los 18 meses y sacrificio en un hato cebú-cruzado.

Directory of Open Access Journals (Sweden)

Llano Arango Juan David

2003-12-01

Full Text Available El objetivo de la presente investigación fue evaluar comparativamente los pesos o los 18 meses y al sacrificio de machos cruzados ¼ , bos taurus (aberdeen angus. holstein, simmental americano, simmental alemán por cebú y animales brahman puros cebú comercial y mestizos.

AcEST: BP911627 [AcEST

Lifescience Database Archive (English)

Full Text Available 1-like protein OS=Bos taurus GN=TRM1L P... 30 5.0 sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolas...HVRRHVNKGETKSRYIAASAAKPPKE 233 >sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapie

Strategic control of ticks with synthetic pyrethroids in Theileria parva ...

African Journals Online (AJOL)

The effect of tick control by strategic dipping in synthetic pyrethroids on growth and survival rates of calves in Eastern Tanzania where Theileria parva and other tick borne infections (babesiosis, anaplasmosis and ehrlichiosis) are endemic was measured. One day to five months old Tanganyika short horn zebu (Bos indicus) ...

Genomic divergence of zebu and taurine cattle identified through high-density SNP genotyping

Science.gov (United States)

Natural selection has molded the evolution across all taxa. At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically ad...

Natural (auto)antibodies in calves are affected by age and diet

NARCIS (Netherlands)

Khobondo, J.O.; Nieuwland, M.G.B.; Webb, L.E.; Bokkers, E.A.M.; Parmentier, H.K.

2015-01-01

Background: Natural autoantibodies (N(a)ab) were found in every species tested so far, and are likely important in maintaining homeostasis. Objectives: (1) To determine N(a)ab in Bos taurus calves, (2) evaluate effects of diet and age on N(a)ab binding repertoires in calves, and (3) delineate bovine

75 FR 43853 - Endangered and Threatened Wildlife and Plants; Final Rule to List the Medium Tree-Finch...

Science.gov (United States)

2010-07-27

... confirmation of the success of the goat eradication program, was provided by one peer reviewer and has been... habitat is unprotected. A large amount of the highlands has been cleared or altered for farming. Much of... animals include goats (Capra hircus), donkeys (Equus asinus), cattle (Bos taurus), and pigs (Sus scrofa...

Dicty_cDB: VHL117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ing fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 6e-13 AX882278_... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 8e-13 protein update 2009. 7.15 PSORT psg: 0.6

Dicty_cDB: VHN233 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ns full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 7...7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13 protein update 2009. 7.

Dicty_cDB: VHA135 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ll open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 1e-... BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein update 2009. 6.26 PS

Dicty_cDB: VHM587 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ns full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 7...7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13 protein update 2009. 7.

Dicty_cDB: VHD682 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...id:none) Homo sapiens L-pipecolic acid oxid... 75 5e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from

Dietary nitrate supplementation reduces methane emission in beef cattle fed sugarcane-based diets

NARCIS (Netherlands)

Hulshof, R.B.A.; Berndt, A.; Gerrits, W.J.J.; Dijkstra, J.; Zijderveld, van S.M.; Newbold, J.R.; Perdok, H.B.

2012-01-01

The objective of this study was to determine the effect of dietary nitrate on methane emission and rumen fermentation parameters in Nellore × Guzera (Bos indicus) beef cattle fed a sugarcane based diet. The experiment was conducted with 16 steers weighing 283 ± 49 kg (mean ± SD), 6 rumen cannulated

Poznámka k etymologii staroslověnského v7sod7 ´svaté přijímání´

Czech Academy of Sciences Publication Activity Database

Boček, Vít

2017-01-01

Roč. 23, č. 2 (2017), s. 95-100 ISSN 0354-0448 R&D Projects: GA ČR(CZ) GA13-17435S Institutional support: RVO:68378092 Keywords : etymology * borrowing * Old Church Slavic Subject RIV: AI - Linguistics OBOR OECD: Linguistics http://bos.zrc-sazu.si/knjige/JZ%2023.2%20(2017)_Kurkina.pdf

Partial characterization of three β-defensin gene transcripts in river ...

African Journals Online (AJOL)

In this study, the tracheal tissues from Egyptian river buffalo and cattle were screened for the presence of three bovine β-defensin gene transcripts. Three primer pairs were designed on the basis of published Bos taurus sequences for partial amplification of β-defensin 4, β-defensin 10 and β-defensin 11 complementary DNA ...

Llllan, w. WAIBOCPH, Keith, T. BALLINGALI, Niall, n. MACHUGA ...

African Journals Online (AJOL)

African cattle are a hi ghly divergent population possibly due tointrogression by Asian Bos indicus Oiumped) cattle and more recently European B. taurus ... highly divergent Asian, African and European allelic families. This describes signiñcant allelic ..... J. Tïssue Culture Methods Il: 101. 13. Bembridge, G.P. Parsons, K,R., ...

New functions to estimate 305-days milk production of Gir cows : Novas Funções para Estimar a Produção de Leite, em 305 Dias de Lactação, de Vacas da Raça Gir

NARCIS (Netherlands)

Reboucas, G.F.; Moraes Goncalves, de T.; Martines, M.L.; Azevedo Junior, J.; Koops, W.J.

2008-01-01

This study aimed to calculate new accumulated and daily functions based on the Michaelis-Menten equation to estimate the 305-days production of Gir cows using test day milk yields. Data consisted of 7,412 lactation records of 3,416 Gir cows (Bos indicus) collected from 1987 to 2004 in 51 herds

Dicty_cDB: VHC115 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -13 (Q29RU9) RecName: Full=Peroxisomal sarcosine oxidase; S... 62 6e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...2 |pid:none) Synthetic construct Homo sapiens c... 60 3e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecoli

Dicty_cDB: VHM609 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 5 |pid:none) Homo sapiens full open reading fra... 76 7e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...m Patent EP10746... 76 7e-13 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 9e-13

Dicty_cDB: VHB165 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |p...id:none) Sequence 17183 from Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

Dicty_cDB: VHG519 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available L1... 69 8e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 69 8e-11 CR457155_1( CR...4593 |pid:none) Homo sapiens L-pipecolic acid oxid... 69 8e-11 protein update 2009. 7.12 PSORT psg: 0.67 gvh

Dicty_cDB: VHE245 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 4e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 71 4e-11 AY892312_1( AY892312 |p... reading fra... 70 8e-11 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 70 8e-11 prot

Dicty_cDB: VHI596 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 295 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 62 9e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...one) Synthetic construct Homo sapiens c... 61 2e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic a

Dicty_cDB: Contig-U06144-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pid:none) Homo sapiens infertility-related s... 54 9e-06 AK057482_1( AK057482 |pid:none) Homo sapiens cDNA F... 7e-06 BC149464_1( BC149464 |pid:none) Bos taurus FK506 binding protein l... 54 7e-06 AF311312_1( AF311312 |

Field Research Studying Whales in an Undergraduate Animal Behavior Laboratory

Science.gov (United States)

MacLaren, R. David; Schulte, Dianna; Kennedy, Jen

2012-01-01

This work describes a new field research laboratory in an undergraduate animal behavior course involving the study of whale behavior, ecology and conservation in partnership with a non-profit research organization--the Blue Ocean Society for Marine Conservation (BOS). The project involves two weeks of training and five weekend trips on whale watch…

DISTRIBUCIÓN Y ABUNDANCIA DE LOS HUEVOS DE ESTRÓNGILOS DIGESTIVOS EN BOVINOS INFECTADOS NATURALMENTE

Directory of Open Access Journals (Sweden)

Jessica Quijada P

2008-08-01

Full Text Available Objetivo. Determinar la prevalencia, cargas parasitarias y distribución de las infecciones naturales con estróngilos digestivos dentro de rebaños bovinos de una zona ganadera del Estado Falcón en Venezuela Materiales y métodos. Se evaluaron cuatro fincas de bovinos doble propósito. Los animales son tipo “Carora” (mestizaje de razas: Holstein, Pardo Suizo, Cebuínos. Durante siete meses se analizaron (Técnica de Mc Master un total de 1140 muestras. La muestra de cada finca se estratificó en cuatro grupo etarios (1: Becerros 0-6 meses; 2: Mautes 7-12; 3: Novillas 13-24 y 4: Adultos >25 meses. Resultados. Los valores de prevalencia promedio fueron: 31.06-50.36%. Se halló diferencia estadística (p<0,05 entre los niveles de prevalencia entre fincas y entre grupos etarios. Las infecciones se distribuyeron de forma sobredispersada en cada rebaño, evidenciado por los bajos valores de K (0.001-0.01. Conclusiones. Los valores de abundancia se afectaron más por el número de animales con altas cargas que por la prevalencia. La mayoría de las infecciones no revistió importancia clínica, las altas cargas parasitarias representaron 1.75-28.56% de todas las infecciones.

De prijsvorming van hout uit het Nederlandse bos

NARCIS (Netherlands)

Slangen, L.H.G.

1987-01-01

The aim of this study is to elucidate the price formation of home- grown Dutch timber. First, Dutch forestry is typified. Then, the functions and structure of the roundwood trade are discussed. An econometric model is specified in order to analyse the factors that determine the 'passing on', the

Ancient DNA extracted from Danish aurochs (Bos primigenius)

DEFF Research Database (Denmark)

Nielsen, Peter Gravlund; Aaris-Sørensen, Kim; Hofreiter, Michael

2012-01-01

study of genetic variation of Danish aurochs. In addition, for all specimens we address correlations between the ability to obtain DNA sequences and various parameters such as the age of the sample, the collagen content, the museum storage period, Danish geography and whether the specimens were found...... in an archeological or geological context. We find that aurochs from southern Scandinavia display a star-shaped population genetic structure, that is indicative of a local and relatively recent diversification from a few ancestral haplotypes that may have originated in the ancestral Western European population before...... migration northwards during the retreat of the glaciers. Scenarios suggesting several invasions of genetically distinct aurochs are not supported by these analyses. Rather, our results suggest that a single continuous migration northward occurred. Our findings also suggest, although with only limited...

Building a Foundation for Knowledge Co-Creation in Collaborative Water Governance: Dimensions of Stakeholder Networks Facilitated through Bridging Organizations

Directory of Open Access Journals (Sweden)

Wietske Medema

2017-01-01

Full Text Available The sustainable governance of water resources relies on processes of multi-stakeholder collaborations and interactions that facilitate the sharing and integration of diverse sources and types of knowledge. In this context, it is essential to fully recognize the importance of fostering and enhancing critical connections within and between networks of relationships between different government and non-government agencies, as well as the dynamics that are in support of the development of new knowledge and practices. In Quebec, a network of watershed organizations (WOs has been put in place to serve as bridging organizations (BOs for stakeholder groups in their watershed territories. Using the WOs as a case study, this research aims to contribute to a greater understanding of how stakeholder groups can be effectively connected to support knowledge co-creation through networked relationships facilitated by BOs. In line with this overall research aim, the following research objectives are proposed: (1 to assess the quality of the knowledge that is developed and shared through the WOs and their stakeholder networks; (2 to determine the characteristics of stakeholders participating in the WOs’ networks that either hinder or support collaborations and knowledge co-creation; (3 to describe the collaborative processes and mechanisms through which the WOs facilitate stakeholder interactions and knowledge co-creation; and (4 to assess the quality of the relationships and interactions between stakeholders participating in the WOs’ collaborative networks. A comprehensive literature review is provided of collaborative network dimensions that are in support of knowledge co-creation that forms the foundation of a research framework to assess knowledge co-creation processes that are facilitated through BOs and their collaborative networks. Documented experiences have been gathered through face-to-face semi-structured interviews, as well as a Quebec-wide survey

Urbanization effects on stream habitat characteristics in Boston, Massachusetts; Birmingham, Alabama; and Salt Lake City, Utah

Science.gov (United States)

Short, T.M.; Giddings, E.M.P.; Zappia, H.; Coles, J.F.

2005-01-01

Relations between stream habitat and urban land-use intensity were examined in 90 stream reaches located in or near the metropolitan areas of Salt Lake City, Utah (SLC); Birmingham, Alabama (BIR); and Boston, Massachusetts (BOS). Urban intensity was based on a multi-metric index (urban intensity index or UII) that included measures of land cover, socioeconomic organization, and urban infrastructure. Twenty-eight physical variables describing channel morphology, hydraulic properties, and streambed conditions were examined. None of the habitat variables was significantly correlated with urbanization intensity in all three study areas. Urbanization effects on stream habitat were less apparent for streams in SLC and BIR, owing to the strong influence of basin slope (SLC) and drought conditions (BIR) on local flow regimes. Streamflow in the BOS study area was not unduly influenced by similar conditions of climate and physiography, and habitat conditions in these streams were more responsive to urbanization. Urbanization in BOS contributed to higher discharge, channel deepening, and increased loading of fine-grained particles to stream channels. The modifying influence of basin slope and climate on hydrology of streams in SLC and BIR limited our ability to effectively compare habitat responses among different urban settings and identify common responses that might be of interest to restoration or water management programs. Successful application of land-use models such as the UII to compare urbanization effects on stream habitat in different environmental settings must account for inherent differences in natural and anthropogenic factors affecting stream hydrology and geomorphology. The challenge to future management of urban development is to further quantify these differences by building upon existing models, and ultimately develop a broader understanding of urbanization effects on aquatic ecosystems. ?? 2005 by the American Fisheries Society.