WorldWideScience

Sample records for notholca acuminata rotifera

  1. Musculature of Notholca acuminata (Rotifera : Ploima : Brachionidae) revealed by confocal scanning laser microscopy

    DEFF Research Database (Denmark)

    Sørensen, M.V.; Funch, P.; Hooge, M.

    2003-01-01

    The body-wall and visceral musculature of Notholca acuminata was visualized using phalloidin-linked fluorescent dye under confocal laser scanning microscopy. The body-wall musculature includes dorsal, lateral, and ventral pairs of longitudinally oriented body retractor muscles, two pairs of head...

  2. Atividade antiviral de Musa acuminata Colla, Musaceae

    Directory of Open Access Journals (Sweden)

    Fernanda Otaviano Martins

    Full Text Available O presente trabalho avalia a atividade antiviral de extratos e frações de Musa acuminata Colla, Musaceae, coletada em duas regiões do Estado do Rio de Janeiro (Petrópolis e Santo Antônio de Pádua. As inflorescências de M. acuminata apresentaram excelente atividade para os dois vírus avaliados: herpesvírus simples humano tipo 1 e herpesvírus simples humano tipo 2, ambos resistentes ao Aciclovir. Os resultados indicam que os extratos de M. acuminata testados podem constituir alvo potencial para uso em terapias antivirais.

  3. Protective role of Spondias mombin leaf and Cola acuminata seed ...

    African Journals Online (AJOL)

    The leaves of Spondias mombin L. (Anacardiaceae) when chewed with Cola acuminata (P. Beauv.) Schott & Endl. (Sterculiaceae) seeds have memory enhancing and anti-ageing properties. This study sought to investigate the protective effect of hydroethanolic leaf extract of Spondias mombin (SM) and Cola acuminata ...

  4. Kirkia acuminata Oliv.: a review of its ethnobotany and pharmacology

    African Journals Online (AJOL)

    Preliminary phytochemical assessment of roots and stem bark of K. acuminata showed presence of lignans, neo-lignans, nor-carotinoids and other compounds. The extracts of K. acuminata exhibited antibacterial and antimycobacterial activities. These phytochemical compounds may be responsible for the medicinal uses ...

  5. Intraurethral condylomata acuminata associated with genital piercings.

    Science.gov (United States)

    Takahashi, S; Hirano, Y; Kawamura, T; Homma, Y

    2013-01-01

    A 33-year-old man was referred to our institution with papillary masses at the urethral meatus and difficulty urinating. Genital examination showed two piercings on the frenulum, which were penetrating the external urethra. Endoscopic examination revealed papillary tumours over the entire circumference of the penile urethra and the piercing site. The tumours were resected transurethrally. Microscopic examination revealed condylomata acuminata. Human papillomavirus types 6 and 66 were detected in the lesions. Retrograde urethral viral infection is rare because of the protection provided by the mucosal immune system. Genital piercing may have facilitated spread of the human papillomavirus into the urethra.

  6. KIRKIA ACUMINATA OLIV.: A REVIEW OF ITS ETHNOBOTANY AND PHARMACOLOGY.

    Science.gov (United States)

    Maroyi, Alfred

    2017-01-01

    Local communities in sub-Saharan Africa have a long history of medicinal plant usage. Like in other parts of the developing world, rural and urban communities are still dependent on herbal medicines for primary health care, and the use of herbal medicines is still an integral part of their daily life and socio-cultural life style. The objective of this paper is to summarise information on the ethnobotany and pharmacology of Kirkia acuminata Oliv. throughout its distributional range. The information documented in this article is derived from books, theses, scientific journals and reports obtained from library collections, Scopus, Pubmed, MEDLINE, ISI Web of Science, Google Scholar and Science Direct. Kirkia acuminata is the most known and widely distributed Kirkia species in the genus and is one of the most popular and promising plant resources due to its several beneficial uses. Kirkia acuminata is used to treat abdominal pains, backache, cholera, constipation, cough, diarrhea, dysentery, snake bites, toothache and wounds. Other applications include its use as charcoal; hedge, ornamental or shade; stock feed, timber and source of water during drought periods. Preliminary phytochemical assessment of roots and stem bark of K. acuminata showed presence of lignans, neo-lignans, nor-carotinoids and other compounds. The extracts of K. acuminata exhibited antibacterial and antimycobacterial activities. These phytochemical compounds may be responsible for the medicinal uses and biological activities demonstrated by K. acuminata . Detailed research is required aimed at exploring mode of action of bioactive compounds of Kirkia acuminata that are responsible for the documented pharmacological effects. Kirkia acuminata is an important plant species that has potential to contribute to the primary health care and livelihood improvement of local communities in the geographical areas where it is indigenous and found in abundance.

  7. Otostephanos (Rotifera, Bdelloidea, Habrotrochidae) with the description of two new species

    Czech Academy of Sciences Publication Activity Database

    Iakovenko, N.; Kašparová, Eva; Plewka, M.; Janko, Karel

    2013-01-01

    Roč. 11, č. 4 (2013), s. 477-494 ISSN 1477-2000 R&D Projects: GA AV ČR KJB600450903 Institutional support: RVO:67985904 Keywords : macrotrachela Quadricornifera rotifera * Bdelloid taxonomy * biodiversity Subject RIV: EG - Zoology Impact factor: 2.153, year: 2013

  8. Fluorescence of the 'fire-chaser' beetle Melanophila acuminata

    International Nuclear Information System (INIS)

    Israelowitz, Meir; Rizvi, Syed H.W.; Schroeder, Herbert P. von

    2007-01-01

    Melanophila acuminata beetles are attracted to forest fires over long distances by a pair of specialized infrared sensory organs. To date, there is no knowledge of their ability to detect or emit fluorescent radiation. We studied the Melanophila acuminata infrared sensory organs histologically and by using fluorescent microscopy, acoustic-optic tunable filter microscopy, and two-photon microscopy to identify fluorescence. We found fluorescent absorption at radiation wavelengths of 480 nm and emission at 570 nm. The functional role of this novel fluorescence is, as of yet, unknown but may be applied to species classification, identification and behavioral studies

  9. Antinociceptive effect of critoniella acuminata, physalis peruviana and salvia rubescens

    OpenAIRE

    Munóz, Carol; Vergel, Nadezdha E.; Aragón, Diana Marcela; Ospina, Luis Fernando

    2010-01-01

    Se evaluó el efecto antinociceptivo de extractos, fracciones y compuestos de Critoniella acuminata, Physalis peruviana y Salvia rubescens mediante los métodos de placa caliente, contorsiones abdominales inducidas por ácido acético y ensayo de la formalina. La fracción de Critoniella acuminata en dosis de 100 mg/kg p.o. presentó actividad antinociceptiva al aumentar el tiempo de reacción del animal ante la aplicación de un estímulo térmico (método de la placa caliente), mient...

  10. Life-cycle stages of Dinophysis acuminata (Dinophyceae) in the ...

    African Journals Online (AJOL)

    Despite many observations of different life-cycle stages of Dinophysis species, the complete life history of the genus is still unknown owing to the difficulties encountered in culturing these species. The seasonal distribution of D. acuminata was followed at two offshore stations in the brackish Baltic Sea by means of in situ ...

  11. The diversity of Indian Brachionidae (Rotifera: Eurotatoria: Monogononta and their distribution

    Directory of Open Access Journals (Sweden)

    B.K. Sharma

    2014-11-01

    Full Text Available We evaluate diversity status of the Brachionidae of India and present an annotated checklist of 46 species excluding dubious and unconfirmed reports. These merit biodiversity value as ~27% of the global diversity of the taxon and ~81% of its Oriental species. We observed two Australasian elements, two Oriental endemics, one Indian endemic, one paleotropical and one cosmo (sub tropical species. The cold-water Keratella serrulata and Notholca squamula are new records from eastern Himalayas. Maximum brachionid diversity (32 species from Assam state of northeast India (NEI is followed by the reports of 27 and 26 species from Tamil Nadu and West Bengal, respectively; 25 species each from Tripura and Maharashtra; and 24 species from Jammu & Kashmir. Brachionus, the most diverse brachionid genus, is widely distributed in India with low richness in hill states of NEI and coastal waters in particular. The Indian brachionid taxonomy is confounded with unconfirmed reports, misidentifications, invalid taxa, and inconsistent treatment of morphological variants, while analysis of cryptic diversity in Brachionus calyciflorus, B. caudatus, B. forficula, B. plicatilis, B. quadridentatus, B. urceolaris, Keratella cochlearis and K. quadrata species-groups awaits attention.

  12. Development and characterization of EST-SSR markers for Ottelia acuminata var. jingxiensis (Hydrocharitaceae).

    Science.gov (United States)

    Li, Zhi-Zhong; Lu, Meng-Xue; Saina, Josphat K; Gichira, Andrew W; Wang, Qing-Feng; Chen, Jin-Ming

    2017-11-01

    Simple sequence repeat (SSR) markers were derived from transcriptomic data for Ottelia acuminata (Hydrocharitaceae), a species comprising five endemic and highly endangered varieties in China. Sixteen novel SSR markers were developed for O. acuminata var. jingxiensis . One to eight alleles per locus were found, with a mean of 2.896. The observed and expected heterozygosity ranged from 0.000 to 1.000 and 0.000 to 0.793, respectively. Interestingly, in cross-varietal amplification, 13 out of the 16 loci were successfully amplified in O. acuminata var. acuminata , and 12 amplified in each of the other three varieties of O. acuminata . These newly developed SSR markers will facilitate further study of genetic variation and provide important genetic data needed for appropriate conservation of natural populations of all varieties of O. acuminata .

  13. Condyloma acuminata in child end laser therapy: a case report

    OpenAIRE

    Ferizi, Mybera; Gercari, Antigona; Pajaziti, Laura; Blyta, Ymrane; Kocinaj, Allma; Dobruna, Shkendije

    2009-01-01

    Background Condyloma acuminata are soft, skin colored, fleshy warts that are caused by the Human Papilloma Virus (HPV). The disease is highly contagious, can appear singly or in groups, small or large. The incubation period may be from 1?6 months. Although anogenital warts are considered to be sexually transmitted in adults, this may not be the case for children. Genital warts in children may result from several modes of transmission: from the maternal genital tract autoinoculation, from fing...

  14. Traditional uses, phytochemistry and pharmacology of wild banana (Musa acuminata Colla): A review.

    Science.gov (United States)

    Mathew, Nimisha Sarah; Negi, Pradeep Singh

    2017-01-20

    Musa acuminata, the wild species of banana is a plant of the tropical and subtropical regions. Over the past few decades, the health benefits of M. acuminata have received much attention. All parts of the plant including fruits, peel, pseudostem, corm, flowers, leaves, sap and roots have found their use in the treatment of many diseases in traditional medicine. Literature review have indicated use of M. acuminata in the treatment of various diseases such as fever, cough, bronchitis, dysentery, allergic infections, sexually transmitted infections, and some of the non-communicable diseases. The reported pharmacological activities of M. acuminata include antioxidant, antidiabetic, immunomodulatory, hypolipidemic, anticancer, and antimicrobial especially anti-HIV activity. This review presents information on the phytochemicals and pharmacological studies to validate the traditional use of different parts of M. acuminata in various diseases and ailments. A comprehensive assessment of the biological activities of M. acuminata extracts is included and possible mechanisms and phytochemicals involved have also been correlated to provide effective intervention strategies for preventing or managing diseases. A literature search was performed on M. acuminata using ethnobotanical textbooks, published articles in peer-reviewed journals, local magazines, unpublished materials, and scientific databases such as Pubmed, Scopus, Web of Science, ScienceDirect, and Google Scholar. The Plant List, Promusa, Musalit, the Integrated Taxonomic Information System (ITIS) databases were used to validate the scientific names and also provide information on the subspecies and cultivars of M. acuminata. The edible part of M. acuminata provides energy, vitamins and minerals. All other parts of the plant have been used in the treatment of many diseases in traditional medicine. The rich diversity of phytochemicals present in them probably contributes to their beneficial effects, and validates the

  15. PENYIMPANAN ROTIFERA INSTAN (Brachionus rotundiformis PADA SUHU YANG BERBEDA DENGAN PEMBERIAN PAKAN MIKROALGA KONSENTRAT

    Directory of Open Access Journals (Sweden)

    Erlania Erlania

    2016-11-01

    Full Text Available Keberhasilan kegiatan budidaya perikanan harus ditunjang dengan ketersediaan benih yang berkesinambungan. Oleh karena itu, diperlukan juga ketersediaan pakan alami larva berupa rotifera (Brachionus rotundiformis. Desain percobaan berupa rancangan faktorial dengan dua faktor dan lima ulangan diaplikasikan dalam penelitian ini. Sebagai perlakuan berupa suhu ruang penyimpanan (suhu kamar, suhu ruang AC, dan suhu refrigerator/lemari es dan pakan mikroalga konsentrat (monospesies dan multispesies. Bakteri probiotik juga digunakan sebagai pengontrol kualitas air. Spesies mikroalga yang digunakan adalah Nannochloropsis sp., Dunaliella sp., Isochrysis sp., dan Pavlova sp. Parameter yang diukur adalah kelimpahan rotifera dan parameter kualitas air media kultur (pH, salinitas, DO, dan NH3. Analisis data terdiri atas analisis regresi, analisis ragam, dan uji keparalelan. Hasil pengukuran parameter kualitas air selama penyimpanan menunjukkan kondisi media yang relatif stabil dan merupakan kisaran optimum bagi pertumbuhan B. rotundiformis. Kelimpahan maksimum tertinggi dari B. rotundiformis baik pada perlakuan pakan monospesies maupun multispesies alga adalah pada suhu kamar. Dari interaksi kedua perlakuan, diperoleh kelimpahan akhir tertinggi pada suhu ruang AC–pakan multispesies. Hal ini menunjukkan bahwa rotifera dapat disimpan lebih lama pada suhu ruang AC dengan pemberian pakan multispesies alga. The success of any aquaculture practices should be supported by sustainable supply of fish fry. Therefore, the availability of rotifers (Brachionus rotundiformis as natural feed for fish larvae is required. The research was arranged in factorial design with two treatments and five replications. Treatments consisted of different room storage temperatures (refrigerator, room temperature, and room with air conditioner/AC and microalgae concentrate added as rotifer feed (monospecies and multispecies algae. Probiotic bacteria was used to control water quality

  16. Structural and Function Prediction of Musa acuminata subsp. Malaccensis Protein

    Directory of Open Access Journals (Sweden)

    Anum Munir

    2016-03-01

    Full Text Available Hypothetical proteins (HPs are the proteins whose presence has been anticipated, yet in vivo function has not been built up. Illustrating the structural and functional privileged insights of these HPs might likewise prompt a superior comprehension of the protein-protein associations or networks in diverse types of life. Bananas (Musa acuminata spp., including sweet and cooking types, are giant perennial monocotyledonous herbs of the order Zingiberales, a sister grouped to the all-around considered Poales, which incorporate oats. Bananas are crucial for nourishment security in numerous tropical and subtropical nations and the most prominent organic product in industrialized nations. In the present study, the hypothetical protein of M. acuminata (Banana was chosen for analysis and modeling by distinctive bioinformatics apparatuses and databases. As indicated by primary and secondary structure analysis, XP_009393594.1 is a stable hydrophobic protein containing a noteworthy extent of α-helices; Homology modeling was done utilizing SWISS-MODEL server where the templates identity with XP_009393594.1 protein was less which demonstrated novelty of our protein. Ab initio strategy was conducted to produce its 3D structure. A few evaluations of quality assessment and validation parameters determined the generated protein model as stable with genuinely great quality. Functional analysis was completed by ProtFun 2.2, and KEGG (KAAS, recommended that the hypothetical protein is a transcription factor with cytoplasmic domain as zinc finger. The protein was observed to be vital for translation process, involved in metabolism, signaling and cellular processes, genetic information processing and Zinc ion binding. It is suggested that further test approval would help to anticipate the structures and functions of other uncharacterized proteins of different plants and living being.

  17. Checklist dos Rotifera (Animalia do Estado de Mato Grosso do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Kennedy Francis Roche

    Full Text Available RESUMO Este estudo listou os táxons de Rotifera encontrado da literatura científica no estado de Mato Grosso do Sul. O estudo foi dividido em cinco áreas gerais: (1 rio Paraguai, (2 Pantanal de Nhecolândia, (3 rio Miranda, rio Negro, rio Abobral e Itaqueri, (4 represa Lago do Amor na cidade de Campo Grande, e (5 rios, lagos e canais do rio Paraná. Foram registrados um total de 364 táxons, sendo as famílias Lecanidae, Trichocercidae e Brachionidae as mais ricas, com 72, 32 e 30 táxons respectivamente. A maior riqueza de táxons foi registrada na área do rio Paraná (244 táxons, e em seguida no rio Paraguai na região da cidade de Corumbá (com 154 táxons encontrados, e nos lagos de água doce do Pantanal da Nhecolândia (com 148 táxons. É altamente provável que estes resultados são reflexos da quantidade e qualidade dos estudos nestas áreas.

  18. Speciation in ancient cryptic species complexes: evidence from the molecular phylogeny of Brachionus plicatilis (Rotifera).

    Science.gov (United States)

    Gómez, Africa; Serra, Manuel; Carvalho, Gary R; Lunt, David H

    2002-07-01

    Continental lake-dwelling zooplanktonic organisms have long been considered cosmopolitan species with little geographic variation in spite of the isolation of their habitats. Evidence of morphological cohesiveness and high dispersal capabilities support this interpretation. However, this view has been challenged recently as many such species have been shown either to comprise cryptic species complexes or to exhibit marked population genetic differentiation and strong phylogeographic structuring at a regional scale. Here we investigate the molecular phylogeny of the cosmopolitan passively dispersing rotifer Brachionus plicatilis (Rotifera: Monogononta) species complex using nucleotide sequence variation from both nuclear (ribosomal internal transcribed spacer 1, ITS1) and mitochondrial (cytochrome c oxidase subunit I, COI) genes. Analysis of rotifer resting eggs from 27 salt lakes in the Iberian Peninsula plus lakes from four continents revealed nine genetically divergent lineages. The high level of sequence divergence, absence of hybridization, and extensive sympatry observed support the specific status of these lineages. Sequence divergence estimates indicate that the B. plicatilis complex began diversifying many millions of years ago, yet has showed relatively high levels of morphological stasis. We discuss these results in relation to the ecology and genetics of aquatic invertebrates possessing dispersive resting propagules and address the apparent contradiction between zooplanktonic population structure and their morphological stasis.

  19. Radiation dose assessment of musa acuminata - triploid (AAA)

    International Nuclear Information System (INIS)

    Maravillas, Mart Andrew S.; Locaylocay, Jocelyn R.; Mendoza, Concepcion S.

    2008-01-01

    Bananas are radioactive due to the presence of the radioisotope- 40 K. This imposes a possible health risk to the general public. This study intended to assess the annual equivalent dosages and the annual effective dosage committed by the body. This seeks to benefit the general public, students and researchers, and entrepreneurs. Using atomic absorption spectrophotometry, lakatan banana (Musa acuminata-triploid (AAA), the most purchased variety cultivated in Barangay Adlawon, Cebu City, Philippines, was found to contain 0.53 g of total potassium for every 100 g of its fresh fruit wherein 6.2 x 10 -5 g of which is potassium-40. Based on its 40 K content banana was calculated to have a radioactivity of 16 Bq/100 g. it was found out that the body is exposed to radiation dosages ranging from 2.8 x 10 -3 rem annually by eating 100 g of lakatan bananas everyday. Conversely, it is equivalent to the annual effective dosage of 0.0043 rem; the amount at which the body of an individual is uniformly exposed. However, no or extremely minute health risk was determined by just eating bananas. In fact, to exceed the radiation dose limits set by the International Commission on Radiation Protection, an individual may eat 116 kg of lakatan bananas everyday for a year. Fertilizers may be the major source of the radioisotope - 40 K and assimilated by the plants. (author)

  20. Loktak Lake, Manipur, northeast India: a Ramsar site with rich rotifer (Rotifera: Eurotatoria diversity and its meta-analysis

    Directory of Open Access Journals (Sweden)

    Bhushan Kumar Sharma

    2016-04-01

    Full Text Available A total of 162 species (S of Rotifera belonging to 40 genera and 20 families examined from Loktak Lake, an important floodplain lake of northeast India (NEI that is one of the richest assemblages of the taxon known from the Indian sub-region. It merits biodiversity value as ~40.0% and ~62.0% of species recorded from India and NEI, respectively. One species is new to India, 23 species are new to Manipur and 14 species are new to Loktak basin. Biogeographically interesting elements included three Australasian, five Oriental, ten palaeotropical and one cosmo-subtropical species. Lecanidae > Lepadellidae > Brachionidae > Trichocercidae collectively comprised 65.4% of S; Lecane > Lepadella > Trichocerca are diverse genera; and paucity of Brachionus spp. is distinct. Loktak Rotifera indicated importance of cosmopolitan, the littoral-periphytonic and small-sized species, and ‘tropical character’. ANOVA recorded significant variations of the rotifer richness amongst three sampling sites of Loktak during June 2010–May 2012 survey. The richness followed osscillaring monthly variations and indicated lack of significant influence of any individual abioitic parameter at all three stations.

  1. Effect of surface coating on ripening and early peel spotting in 'Sucrier' banana (Musa acuminata)

    NARCIS (Netherlands)

    Promyou, S.; Ketsa, S.; Doorn, van W.G.

    2007-01-01

    Sucrier¿ bananas (Musa acuminata, AA Group) show peel spotting when the peel is just about as yellow as green, which coincides with optimum eating quality. As consumers might relate the spotting to overripe fruit, early spotting is considered undesirable, especially for export markets. Fruit were

  2. Potential roles of fish, birds, and water in swamp privet (Forestiera acuminata) seed dispersal

    Science.gov (United States)

    Susan B. Adams; Paul B. Hamel; Kristina Connor; Bryce Burke; Emile S. Gardiner; David Wise

    2007-01-01

    Forestiera acuminata (swamp privet) is a common wetland shrub/small tree native to the southeastern United States. We examined several possible dispersal avenues for the plant. We tested germination of seeds exposed to various treatments, including passage through Ictalurus punctatus (Channel Catfi sh) guts, and conducted other...

  3. Progression of Intravesical Condyloma Acuminata to Locally Advanced Poorly Differentiated Squamous Cell Carcinoma

    Directory of Open Access Journals (Sweden)

    A. Khambati

    2016-07-01

    Full Text Available Condyloma acuminata (CA is a common sexually transmitted disease caused by Human Papilloma Virus (HPV infection. CA of the bladder, however, is an exceedingly rare lesion. We present a rare case of poorly differentiated locally invasive squamous cell carcinoma (SCC arising from recurrent CA of the bladder in an immunocompetent patient and discuss pathophysiology and management of this unusual condition.

  4. Evolution of the Banana Genome (Musa acuminata) Is Impacted by Large Chromosomal Translocations.

    Science.gov (United States)

    Martin, Guillaume; Carreel, Françoise; Coriton, Olivier; Hervouet, Catherine; Cardi, Céline; Derouault, Paco; Roques, Danièle; Salmon, Frédéric; Rouard, Mathieu; Sardos, Julie; Labadie, Karine; Baurens, Franc-Christophe; D'Hont, Angélique

    2017-09-01

    Most banana cultivars are triploid seedless parthenocarpic clones derived from hybridization between Musa acuminata subspecies and sometimes M. balbisiana. M. acuminata subspecies were suggested to differ by a few large chromosomal rearrangements based on chromosome pairing configurations in intersubspecies hybrids. We searched for large chromosomal rearrangements in a seedy M. acuminata ssp. malaccensis banana accession through mate-pair sequencing, BAC-FISH, targeted PCR and marker (DArTseq) segregation in its progeny. We identified a heterozygous reciprocal translocation involving two distal 3 and 10 Mb segments from chromosomes 01 and 04, respectively, and showed that it generated high segregation distortion, reduced recombination and linkage between chromosomes 01 and 04 in its progeny. The two chromosome structures were found to be mutually exclusive in gametes and the rearranged structure was preferentially transmitted to the progeny. The rearranged chromosome structure was frequently found in triploid cultivars but present only in wild malaccensis ssp. accessions, thus suggesting that this rearrangement occurred in M. acuminata ssp. malaccensis. We propose a mechanism for the spread of this rearrangement in Musa diversity and suggest that this rearrangement could have played a role in the emergence of triploid cultivars. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  5. Growth, physiological and biochemical responses of Camptotheca acuminata seedlings to different light environments

    Directory of Open Access Journals (Sweden)

    Xiaohua eMa

    2015-05-01

    Full Text Available Light intensity critically affects plant growth. Camptotheca acuminata is a light-demanding species, but its optimum light intensity is not known. To investigate the response of C. acuminata seedlings to different light intensities, specifically 100% irradiance (PAR, 1500±30 μmol m-2 s-1, 75% irradiance, 50% irradiance, and 25% irradiance, a pot experiment was conducted to analyze growth parameters, photosynthetic pigments, gas exchange, chlorophyll fluorescence, stomatal structure and density, chloroplast ultrastructure, ROS concentrations, and antioxidant activities. Plants grown under 75% irradiance had significantly higher total biomass, seedling height, ground diameter, photosynthetic capacity, photochemical efficiency and photochemical quenching than those grown under 100%, 25%, and 50% irradiance. Malondialdehyde (MDA content, relative electrolyte conductivity (REC, superoxide anion (O2.- production, and peroxide (H2O2 content were lower under 75% irradiance. The less pronounced plant growth under 100% and 25% irradiance was associated with a decline in photosynthetic capacity and photochemical efficiency, with increases in the activity of specific antioxidants (i.e., superoxidase dismutase, peroxidase, and catalase, and with increases in MDA content and REC. Lower levels of irradiance were associated with significantly higher concentrations of chlorophyll (Chl a and b and lower Chla/b ratios. Stomatal development was most pronounced under 75% irradiance. Modification of chloroplast development was found to be an important mechanism of responding to different light intensities in C. acuminata. The results indicated that 75% irradiance is optimal for the growth of C. acuminata seedlings. The improvement in C. acuminata growth under 75% irradiance was attributable to increased photosynthesis, less accumulation of ROS, and the maintenance of the stomatal and chloroplast structure.

  6. Improvement of the banana "Musa acuminata" reference sequence using NGS data and semi-automated bioinformatics methods

    Czech Academy of Sciences Publication Activity Database

    Martin, G.; Baurens, F.C.; Droc, G.; Rouard, M.; Cenci, A.; Kilian, A.; Hastie, A.; Doležel, Jaroslav; Aury, J. M.; Alberti, A.; Carreel, F.; D'Hont, A.

    2016-01-01

    Roč. 17, MAR 16 (2016), s. 243 ISSN 1471-2164 Institutional support: RVO:61389030 Keywords : Musa acuminata * Genome assembly * Bioinformatics tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.729, year: 2016

  7. New records of rotifers (Rotifera: Eurotatoria from Deepor Beel - a Ramsar site of India with an update on its rich rotifer diversity.

    Directory of Open Access Journals (Sweden)

    B.K. Sharma

    2015-03-01

    Full Text Available Plankton samples collected from Deepor Beel (a Ramsar site, during July 2011 to June 2013, revealed 155 species of Rotifera, belonging to 35 genera and 20 families.  Of these, 16 species belonging to eight genera and seven families are new records to the rotifer fauna of this wetland of northeast India.  Our observations raise the total richness of the phylum known till date from this important floodplain lake (beel of the Brahmaputra river basin to 171 species and thus highlight its biodiversity value as one of the globally rich Rotifera habitats.  The updated list is interesting for following meta-analyses of rotifer occurrence in this only well sampled freshwater ecosystem of the Indian sub-region. 

  8. The natural impact of banana inflorescences (Musa acuminata) on human nutrition.

    Science.gov (United States)

    Fingolo, Catharina E; Braga, João M A; Vieira, Ana C M; Moura, Mirian R L; Kaplan, Maria Auxiliadora C

    2012-12-01

    Banana inflorescences are popularly known as 'navels,' and they are used in Brazil as nutritional complements. However, the nutritional value of banana inflorescences (male flowers and bracts) has never been studied. Therefore, plant material of Musa acuminata, cultivar "ouro", was collected in Rio de Janeiro state, Brazil, and then submitted to chemical procedures to determine its nutritional composition. The experiment was arranged a completely randomized design and performed in triplicate. The sample composition analysis showed percentual average value for moisture, protein, fat and ash as 8.21, 14.50, 4.04 and 14.43, respectively. The dehydrated inflorescences were found to contain a significant nutritive complement based on their high content of potassium (5008.26 mg / 100 g) and fiber 49.83% (lignin, cellulose and hemicelluloses) revealing important functional and nutritional properties. In a parallel evaluation, the anatomical study revealed key elements for the recognition of Musa acuminata when reduced to fragments.

  9. Behavioural responses of the snail Lymnaea acuminata to carbohydrates in snail-attractant pellets

    Science.gov (United States)

    Tiwari, Farindra; Singh, D. K.

    Snail control is one of the most important tools in the campaign to reduce the incidence of fascioliasis. In order to attain this objective, the method of bait formulation in order to contain an attractant and a molluscicide is an expedient approach to lure the target snail population to the molluscicide. This study identifies certain carbohydrates, namely sucrose, maltose, glucose, fructose and starch, for preparing such baits. These were tested on Lymnaea acuminata, an intermediate host of the digenean trematodes Fasciola hepatica and Fasciola gigantica. The behavioural responses of snails to these carbohydrates were examined. Significant variations in behavioural responses were observed in the snail even when the five carbohydrates were used in low concentrations in snail-attractant pellets. Starch emerged as the strongest attractant for Lymnaea acuminata, followed by maltose.

  10. Toxicity of Bauhinia variegata and Mimusops elengi with plant molluscicides against Lymnaea acuminata

    Directory of Open Access Journals (Sweden)

    Kanchan Lata Singh

    2012-01-01

    Full Text Available Molluscicidal activity of binary combination of Bauhinia variegata and Mimusops elengi with other plant molluscicides Saraca asoca and Thuja orientalis against snail Lymnaea acuminata have been studied. It was observed that toxicity of binary combinations of plant molluscicides with other plant molluscicides were toxic against fresh water snail L. acuminata. Among all combinations of toxicity Mimusops elengi leaf + Saraca asoca bark (24h LC50: 98.25 mg/l; 96h LC50: 40.40 mg/l and Bauhinia variegata leaf powder + Saraca asoca leaf (24h LC50: 123.98 mg/l; 96h LC50: 57.91 mg/l was more toxic than other binary combinations of plant molluscicides. Mimusops elengi leaf powder + Saraca asoca leaf powder and Bauhinia variegata leaf powder + Saraca asoca leaf powder are more potent molluscicides.

  11. A saturated SSR/DArT linkage map of Musa acuminata addressing genome rearrangements among bananas

    Directory of Open Access Journals (Sweden)

    Matsumoto Takashi

    2010-04-01

    Full Text Available Abstract Background The genus Musa is a large species complex which includes cultivars at diploid and triploid levels. These sterile and vegetatively propagated cultivars are based on the A genome from Musa acuminata, exclusively for sweet bananas such as Cavendish, or associated with the B genome (Musa balbisiana in cooking bananas such as Plantain varieties. In M. acuminata cultivars, structural heterozygosity is thought to be one of the main causes of sterility, which is essential for obtaining seedless fruits but hampers breeding. Only partial genetic maps are presently available due to chromosomal rearrangements within the parents of the mapping populations. This causes large segregation distortions inducing pseudo-linkages and difficulties in ordering markers in the linkage groups. The present study aims at producing a saturated linkage map of M. acuminata, taking into account hypotheses on the structural heterozygosity of the parents. Results An F1 progeny of 180 individuals was obtained from a cross between two genetically distant accessions of M. acuminata, 'Borneo' and 'Pisang Lilin' (P. Lilin. Based on the gametic recombination of each parent, two parental maps composed of SSR and DArT markers were established. A significant proportion of the markers (21.7% deviated (p Conclusions We propose a synthetic map with 11 linkage groups containing 489 markers (167 SSRs and 322 DArTs covering 1197 cM. This first saturated map is proposed as a "reference Musa map" for further analyses. We also propose two complete parental maps with interpretations of structural rearrangements localized on the linkage groups. The structural heterozygosity in P. Lilin is hypothesized to result from a duplication likely accompanied by an inversion on another chromosome. This paper also illustrates a methodological approach, transferable to other species, to investigate the mapping of structural rearrangements and determine their consequences on marker

  12. A saturated SSR/DArT linkage map of Musa acuminata addressing genome rearrangements among bananas.

    Science.gov (United States)

    Hippolyte, Isabelle; Bakry, Frederic; Seguin, Marc; Gardes, Laetitia; Rivallan, Ronan; Risterucci, Ange-Marie; Jenny, Christophe; Perrier, Xavier; Carreel, Françoise; Argout, Xavier; Piffanelli, Pietro; Khan, Imtiaz A; Miller, Robert N G; Pappas, Georgios J; Mbéguié-A-Mbéguié, Didier; Matsumoto, Takashi; De Bernardinis, Veronique; Huttner, Eric; Kilian, Andrzej; Baurens, Franc-Christophe; D'Hont, Angélique; Cote, François; Courtois, Brigitte; Glaszmann, Jean-Christophe

    2010-04-13

    The genus Musa is a large species complex which includes cultivars at diploid and triploid levels. These sterile and vegetatively propagated cultivars are based on the A genome from Musa acuminata, exclusively for sweet bananas such as Cavendish, or associated with the B genome (Musa balbisiana) in cooking bananas such as Plantain varieties. In M. acuminata cultivars, structural heterozygosity is thought to be one of the main causes of sterility, which is essential for obtaining seedless fruits but hampers breeding. Only partial genetic maps are presently available due to chromosomal rearrangements within the parents of the mapping populations. This causes large segregation distortions inducing pseudo-linkages and difficulties in ordering markers in the linkage groups. The present study aims at producing a saturated linkage map of M. acuminata, taking into account hypotheses on the structural heterozygosity of the parents. An F1 progeny of 180 individuals was obtained from a cross between two genetically distant accessions of M. acuminata, 'Borneo' and 'Pisang Lilin' (P. Lilin). Based on the gametic recombination of each parent, two parental maps composed of SSR and DArT markers were established. A significant proportion of the markers (21.7%) deviated (p DArTs) covering 1197 cM. This first saturated map is proposed as a "reference Musa map" for further analyses. We also propose two complete parental maps with interpretations of structural rearrangements localized on the linkage groups. The structural heterozygosity in P. Lilin is hypothesized to result from a duplication likely accompanied by an inversion on another chromosome. This paper also illustrates a methodological approach, transferable to other species, to investigate the mapping of structural rearrangements and determine their consequences on marker segregation.

  13. Characterization of novel microsatellite markers in Musa acuminata subsp. burmannicoides, var. Calcutta 4

    Directory of Open Access Journals (Sweden)

    Amorim Edson P

    2010-05-01

    Full Text Available Abstract Background Banana is a nutritionally important crop across tropical and sub-tropical countries in sub-Saharan Africa, Central and South America and Asia. Although cultivars have evolved from diploid, triploid and tetraploid wild Asian species of Musa acuminata (A genome and Musa balbisiana (B genome, many of today's commercial cultivars are sterile triploids or diploids, with fruit developing via parthenocarpy. As a result of restricted genetic variation, improvement has been limited, resulting in a crop frequently lacking resistance to pests and disease. Considering the importance of molecular tools to facilitate development of disease resistant genotypes, the objectives of this study were to develop polymorphic microsatellite markers from BAC clone sequences for M. acuminata subsp. burmannicoides, var. Calcutta 4. This wild diploid species is used as a donor cultivar in breeding programs as a source of resistance to diverse biotic stresses. Findings Microsatellite sequences were identified from five Calcutta 4 BAC consensi datasets. Specific primers were designed for 41 loci. Isolated di-nucleotide repeat motifs were the most abundant, followed by tri-nucleotides. From 33 tested loci, 20 displayed polymorphism when screened across 21 diploid M. acuminata accessions, contrasting in resistance to Sigatoka diseases. The number of alleles per SSR locus ranged from two to four, with a total of 56. Six repeat classes were identified, with di-nucleotides the most abundant. Expected heterozygosity values for polymorphic markers ranged from 0.31 to 0.75. Conclusions This is the first report identifying polymorphic microsatellite markers from M. acuminata subsp. burmannicoides, var. Calcutta 4 across accessions contrasting in resistance to Sigatoka diseases. These BAC-derived polymorphic microsatellite markers are a useful resource for banana, applicable for genetic map development, germplasm characterization, evolutionary studies and marker

  14. Characterization of novel microsatellite markers in Musa acuminata subsp. burmannicoides, var. Calcutta 4.

    Science.gov (United States)

    Miller, Robert Ng; Passos, Marco An; Menezes, Natalia Np; Souza, Manoel T; do Carmo Costa, Marcos M; Rennó Azevedo, Vânia C; Amorim, Edson P; Pappas, Georgios J; Ciampi, Ana Y

    2010-05-27

    Banana is a nutritionally important crop across tropical and sub-tropical countries in sub-Saharan Africa, Central and South America and Asia. Although cultivars have evolved from diploid, triploid and tetraploid wild Asian species of Musa acuminata (A genome) and Musa balbisiana (B genome), many of today's commercial cultivars are sterile triploids or diploids, with fruit developing via parthenocarpy. As a result of restricted genetic variation, improvement has been limited, resulting in a crop frequently lacking resistance to pests and disease. Considering the importance of molecular tools to facilitate development of disease resistant genotypes, the objectives of this study were to develop polymorphic microsatellite markers from BAC clone sequences for M. acuminata subsp. burmannicoides, var. Calcutta 4. This wild diploid species is used as a donor cultivar in breeding programs as a source of resistance to diverse biotic stresses. Microsatellite sequences were identified from five Calcutta 4 BAC consensi datasets. Specific primers were designed for 41 loci. Isolated di-nucleotide repeat motifs were the most abundant, followed by tri-nucleotides. From 33 tested loci, 20 displayed polymorphism when screened across 21 diploid M. acuminata accessions, contrasting in resistance to Sigatoka diseases. The number of alleles per SSR locus ranged from two to four, with a total of 56. Six repeat classes were identified, with di-nucleotides the most abundant. Expected heterozygosity values for polymorphic markers ranged from 0.31 to 0.75. This is the first report identifying polymorphic microsatellite markers from M. acuminata subsp. burmannicoides, var. Calcutta 4 across accessions contrasting in resistance to Sigatoka diseases. These BAC-derived polymorphic microsatellite markers are a useful resource for banana, applicable for genetic map development, germplasm characterization, evolutionary studies and marker assisted selection for traits.

  15. Condyloma acuminata in a 3-year-old female: Sexual abuse or not?

    Directory of Open Access Journals (Sweden)

    Alia Abbas Rizvi

    2016-01-01

    Full Text Available Condyloma acuminata (also known as anogenital warts or venereal warts a sexually transmitted disease (STD is usually seen in younger adults. However, genital warts have been reported in all age groups of children including infants. The possibility of sexual abuse is a major concern in the evaluation of children with genital warts. We hereby report a case of genital warts in a three year old female child.

  16. Climate Variability and Oceanographic Settings Associated with Interannual Variability in the Initiation of Dinophysis acuminata Blooms

    Directory of Open Access Journals (Sweden)

    Henrick Berger

    2013-08-01

    Full Text Available In 2012, there were exceptional blooms of D. acuminata in early spring in what appeared to be a mesoscale event affecting Western Iberia and the Bay of Biscay. The objective of this work was to identify common climatic patterns to explain the observed anomalies in two important aquaculture sites, the Galician Rías Baixas (NW Spain and Arcachon Bay (SW France. Here, we examine climate variability through physical-biological couplings, Sea Surface Temperature (SST anomalies and time of initiation of the upwelling season and its intensity over several decades. In 2012, the mesoscale features common to the two sites were positive anomalies in SST and unusual wind patterns. These led to an atypical predominance of upwelling in winter in the Galician Rías, and increased haline stratification associated with a southward advection of the Gironde plume in Arcachon Bay. Both scenarios promoted an early phytoplankton growth season and increased stability that enhanced D. acuminata growth. Therefore, a common climate anomaly caused exceptional blooms of D. acuminata in two distant regions through different triggering mechanisms. These results increase our capability to predict intense diarrhetic shellfish poisoning outbreaks in the early spring from observations in the preceding winter.

  17. Physiological response to drought stress in Camptotheca acuminata seedlings from two provenances

    Directory of Open Access Journals (Sweden)

    Yeqing eYing

    2015-05-01

    Full Text Available Drought stress is a key environmental factor limiting the growth and productivity of plants. The purpose of this study was to investigate the physiological responses of Camptotheca acuminata (C. acuminata to different drought stresses and compare the drought tolerance between the provenances Kunming (KM and Nanchang (NC, which are naturally distributed in different rainfall zones with annual rainfalls of 1000-1100 mm and 1600-1700 mm, respectively. We determined relative water content (RWC, chlorophyll content (Chl(a+b, net photosynthesis (Pn, gas exchange parameters, relative leakage conductivity (REC, malondialdehyde (MDA content and superoxide dismutase (SOD and peroxidase (POD activities of C. acuminata seedlings under both moderate (50% of maximum field capacity and severe drought stress (30% of maximum field capacity. As the degree of water stress increased, RWC, Chl(a+b content, Pn, stomatal conductance (Gs, transpiration rate (Tr and intercellular CO2 concentration (Ci values decreased, but water use efficiency (WUE, REC, MDA content and SOD and POD activities increased in provenances KM and NC. Under moderate and severe drought stress, provenance KM had higher RWC, Chl(a+b, Pn, WUE, SOD and POD and lower Gs, Tr, Ci and REC in leaves than provenance NC. The results indicated that provenance KM may maintain stronger drought tolerance via improvements in water-retention capacity, antioxidant enzyme activity and membrane integrity.

  18. Pastas de Rhodomonas salina (Cryptophyta como alimento para Brachionus plicatilis (Rotifera

    Directory of Open Access Journals (Sweden)

    Miguel Guevara

    2011-12-01

    Full Text Available Pastas de Rhodomonas salina, obtenidas mediante centrifugación y floculación con quitosano y preservadas con o sin vitamina C, a -20°C fueron evaluadas bioquímicamente y proporcionadas como alimento al rotífero Brachionus plicatilis. Las pastas microalgales: (1 centrifugada y con vitamina C (CV, (2 centrifugada y sin vitamina C (C, (3 floculada y con vitamina C (FV y (4 floculada y sin adición de vitamina C (F; mantuvieron sus contenidos de proteínas y lípidos totales similares al cultivo control, con valores de 40.0±2.32% y 12.0±1.45%, respectivamente. La relación feofitina a/clorofila a fue similar (0.09-0.11 entre las pastas centrifugadas y el cultivo control, pero mayor en las pastas floculadas (1.28-1.48. Las pastas centrifugadas presentaron porcentajes de PUFAs totales, EPA y DHA similares al cultivo control (PUFAs: 47%, EPA: 4% y DHA: 4.7% y superiores al de las pastas floculadas. Las pastas obtenidas por centrifugación indujeron un crecimiento del rotífero igual al obtenido con el alimento control (densidad máxima: 320rotíferos/mL; tasa instantánea de crecimiento: 0.23rotíferos/día, fecundidad: 1.49huevos/ hembra y productividad: 43x103rotíferos/L/día. Se concluye que la pasta de R. salina centrifugada y congelada a -20°C, durante cuatro semanas, sin adición de vitamina C, mantiene su calidad nutricional similar a la del alga fresca y puede ser usada como alimento de Brachionus plicatilis.Rhodomonas salina (Cryptophyta pastes as feed for Brachionus plicatilis (Rotifera. Rotifers are an important live feed for first feeding larvae of many fish species. The use of concentrated algae cells in the mass culture of the rotifer Brachionus plicatilis (Brachionidae has opened new horizons for research on this organism. Pastes of Rhodomonas salina (Pyrenomonadaceae obtained either by centrifugation or flocculation with chitosan were preserved, with or without vitamin C, at -20°C for four weeks and were evaluated

  19. Analysis of traumatic ulcer healing time under the treatment of the Mauli banana (Musa acuminata 25% stem extract gel

    Directory of Open Access Journals (Sweden)

    Dewi Puspitasari

    2017-03-01

    Full Text Available ABSTRACT Introduction: Traumatic ulcer is one of oral disorders that often occur. The prevalence is quite high, between 3-24% of population. Therapy of traumatic ulcer is symptomatic. People usually use Aloe vera extract gel. Previous research showed that the Aloe vera gel is equivalent with ethanol extract of 25% Mauli banana (Musa acuminata stem in accelerating wound healing based on the number of macrophages and neovascular. The objective of the study is to find out the time difference of traumatic ulcer healing using 25% Musa acuminata stem extract gel compared to a gel containing Aloe vera extract. Methods: The research was post test design. Subjects were patients of Oral Medicine Installation in Gusti Hasan Aman Dental Hospital Banjarmasin with diagnosis of traumatic ulcer using completely random sampling method. Eight patients as samples were determined by the formula of Lemeshow. Results: there was no significant difference with p=0,724 (p>0,05 between healing time using Aloe vera gel and 25% Musa acuminata stem extract. Conclusion: At the concentration of 25% Musa acuminata stem extract gel concentration has the same healing time with Aloe vera gel, therefore can be recommended as a topical use for traumatic ulcer healing. Keywords: Musa acuminata stem, Healing time, Traumatic ulcer

  20. Rotifer assemblages (Rotifera: Eurotatoria of the floodplain lakes of Majuli River Island, the Brahmaputra river basin, northeast India

    Directory of Open Access Journals (Sweden)

    Bhushan Kumar Sharma

    2014-12-01

    Full Text Available Our plankton and semi-plankton collections from twelve floodplain lakes (beels of Majuli River Island, Upper Assam reveal 124 rotifer species (32 genera and 17 families; these merit biodiversity value as ~52.0% and ~30.0% of species, ~68.0 and ~45.0% of  genera and ~74.0 and ~65.0% of the families of the Phylum known from northeast India (NEI and India, respectively. Two species are new to India with Trichocerca uncinata as new record to the Oriental region.  Eleven species are new to the study area and we provide an updated list (144 species for following meta-analyses of Majuli Rotifera. Biogeographically important elements include one Australasian, four Oriental, four Palaeotropical and one cosmo (sub tropical species while several species are of regional distribution interest. The rotifer fauna is predominantly tropical and Lecanidae > Lepadellidae collectively include ~53.0% species but it records paucity of Brachionus species. Individual beels record total richness of 60-100 (77 ± 12 species, monthly richness between 24 ± 7-34 ± 7 species and maximum up to 54 species/sample. The results are characterized by high community similarities (59.7-90.4% vide Sørensen’s index, more rotifer homogeneity amongst beels, lack of any pattern of temporal richness variations and much limited influence of abiotic parameters.

  1. Postembryonic development of hard jaws (trophi) in a species belonging to the Brachionus plicatilis complex (Rotifera, Monogononta): a morphometric analysis.

    Science.gov (United States)

    Fontaneto, Diego; Melone, Giulio

    2006-04-01

    The presence of hard jaws (trophi), with species-specific shape and size, is a taxonomic feature of Rotifera, a group of microscopic metazoans. Since trophi are used to discriminate among species, it is important to know whether these structures change in taxonomically important ways during postembryonic development. Using both SEM and optical images, we analyzed more than 100 individuals of a single clonal lineage of a monogonont rotifer, Brachionus plicatilis, in order to describe body and trophi development after hatching. Body size, expressed as lorica width and length, was isometrically related to age of the animals only during preadult stages. Trophi size, expressed as length of the different parts, was unrelated to either age or body size. Therefore, trophi elements do not grow after hatching in B. plicatilis. Despite the dimensional invariance with age, some differences in trophi size among individuals of the same clone were recorded. No difference in left-right asymmetry of the trophi was shown; the asymmetric elements of the trophi named rami consistently had the right ramus longer than the left. This constancy is in contrast to the reported trophi asymmetries in bdelloid rotifers, in which left-right asymmetries are not constant within clonal lineages. In conclusion, we suggest that also trophi size, constant within the analyzed clone, may be used as an additional taxonomic feature to help in the discrimination of taxa within the B. plicatilis complex of cryptic species. Copyright (c) 2006 Wiley-Liss, Inc.

  2. The toxic dinoflagellate Dinophysis acuminata harbors permanent chloroplasts of cryptomomad prigin, not kleptochloroplasts

    DEFF Research Database (Denmark)

    Garcia, Lydia; Moestrup, Øjvind; Hansen, Per Juel

    2010-01-01

    of Dinophysis acuminata was established by feeding it the phototrophic ciliate Mesodinium rubrum (= Myrionecta rubra), which again was fed the cryptophyte Teleaulax amphioxeia. Molecular analysis comprising the nucleomorph LSU and two chloroplast markers (tufA gene and a fragment from the end of 16S r......DNA to the beginning of 23S rDNA) resulted in identical sequences for the three organisms. Yet, transmission electron microscopy of the three organisms revealed that several chloroplast features separated D. acuminata from both T. amphioxeia and M. rubrum. The thylakoid arrangement, the number of membranes around...

  3. Antifungal constituents in alnus acuminata H.B.K. nodules Constituyentes antifungicos en nódulos radicales de Alnus Acuminata H.B.K.

    Directory of Open Access Journals (Sweden)

    Gonzalez Jaime

    1988-12-01

    Full Text Available Alnus acuminata. H.B.K. is a native specimen of economic importance. that is characterized for having root nodules
    that can fix nitrogen. The nodules chemical composition has not been sstablished, but, it has been seen that it has influence over the soil microflora. In order to establish the chemical composition and the activity of the obtained fractions, there were made extractions of the alder nodules. The insulated compounds were; xylose and ribose; an aromatic carboxylicaeid, an fatty aeid, an phenolic biarylheptanoid and a flavonoid glycosic. were also founded. The Fusarium oxysporum and Pythium sp. growing was inhibited by this last one sustance.Alnus acuminata. H.B.K. es una especie nativa de importancia económica que se caracteriza por tener nódulos radicales
    fijadores de nitrógeno. La composición química de los nódulos no se ha establecido; sin embargo, se ha observado que actúa sobre la microflora del suelo. Con el fin de establecer la composición química de las fracciones obtenidas, se.realizaron extracciones a partir de nódulos de Aliso. Los compuestos
    aislados 'fueron: xilosa y ribosa; además se caracterizaron un ácido carboxílico aromático, un ácido graso, un biariheptanoide
    fenólico y un glicósido de flavonoide. Esta última sustancia inhibió el crecimiento de Fusarium oxvsporum y Pythium sp.

  4. The complete chloroplast genome of banana (Musa acuminata, Zingiberales): insight into plastid monocotyledon evolution.

    Science.gov (United States)

    Martin, Guillaume; Baurens, Franc-Christophe; Cardi, Céline; Aury, Jean-Marc; D'Hont, Angélique

    2013-01-01

    Banana (genus Musa) is a crop of major economic importance worldwide. It is a monocotyledonous member of the Zingiberales, a sister group of the widely studied Poales. Most cultivated bananas are natural Musa inter-(sub-)specific triploid hybrids. A Musa acuminata reference nuclear genome sequence was recently produced based on sequencing of genomic DNA enriched in nucleus. The Musa acuminata chloroplast genome was assembled with chloroplast reads extracted from whole-genome-shotgun sequence data. The Musa chloroplast genome is a circular molecule of 169,972 bp with a quadripartite structure containing two single copy regions, a Large Single Copy region (LSC, 88,338 bp) and a Small Single Copy region (SSC, 10,768 bp) separated by Inverted Repeat regions (IRs, 35,433 bp). Two forms of the chloroplast genome relative to the orientation of SSC versus LSC were found. The Musa chloroplast genome shows an extreme IR expansion at the IR/SSC boundary relative to the most common structures found in angiosperms. This expansion consists of the integration of three additional complete genes (rps15, ndhH and ycf1) and part of the ndhA gene. No such expansion has been observed in monocots so far. Simple Sequence Repeats were identified in the Musa chloroplast genome and a new set of Musa chloroplastic markers was designed. The complete sequence of M. acuminata ssp malaccensis chloroplast we reported here is the first one for the Zingiberales order. As such it provides new insight in the evolution of the chloroplast of monocotyledons. In particular, it reinforces that IR/SSC expansion has occurred independently several times within monocotyledons. The discovery of new polymorphic markers within Musa chloroplast opens new perspectives to better understand the origin of cultivated triploid bananas.

  5. The complete chloroplast genome of banana (Musa acuminata, Zingiberales: insight into plastid monocotyledon evolution.

    Directory of Open Access Journals (Sweden)

    Guillaume Martin

    Full Text Available Banana (genus Musa is a crop of major economic importance worldwide. It is a monocotyledonous member of the Zingiberales, a sister group of the widely studied Poales. Most cultivated bananas are natural Musa inter-(sub-specific triploid hybrids. A Musa acuminata reference nuclear genome sequence was recently produced based on sequencing of genomic DNA enriched in nucleus.The Musa acuminata chloroplast genome was assembled with chloroplast reads extracted from whole-genome-shotgun sequence data. The Musa chloroplast genome is a circular molecule of 169,972 bp with a quadripartite structure containing two single copy regions, a Large Single Copy region (LSC, 88,338 bp and a Small Single Copy region (SSC, 10,768 bp separated by Inverted Repeat regions (IRs, 35,433 bp. Two forms of the chloroplast genome relative to the orientation of SSC versus LSC were found. The Musa chloroplast genome shows an extreme IR expansion at the IR/SSC boundary relative to the most common structures found in angiosperms. This expansion consists of the integration of three additional complete genes (rps15, ndhH and ycf1 and part of the ndhA gene. No such expansion has been observed in monocots so far. Simple Sequence Repeats were identified in the Musa chloroplast genome and a new set of Musa chloroplastic markers was designed.The complete sequence of M. acuminata ssp malaccensis chloroplast we reported here is the first one for the Zingiberales order. As such it provides new insight in the evolution of the chloroplast of monocotyledons. In particular, it reinforces that IR/SSC expansion has occurred independently several times within monocotyledons. The discovery of new polymorphic markers within Musa chloroplast opens new perspectives to better understand the origin of cultivated triploid bananas.

  6. The natural impact of banana inflorescences (Musa acuminata on human nutrition

    Directory of Open Access Journals (Sweden)

    Catharina E. Fingolo

    2012-12-01

    Full Text Available Banana inflorescences are popularly known as 'navels,' and they are used in Brazil as nutritional complements. However, the nutritional value of banana inflorescences (male flowers and bracts has never been studied. Therefore, plant material of Musa acuminata, cultivar "ouro", was collected in Rio de Janeiro state, Brazil, and then submitted to chemical procedures to determine its nutritional composition. The experiment was arranged a completely randomized design and performed in triplicate. The sample composition analysis showed percentual average value for moisture, protein, fat and ash as 8.21, 14.50, 4.04 and 14.43, respectively. The dehydrated inflorescences were found to contain a significant nutritive complement based on their high content of potassium (5008.26 mg / 100 g and fiber 49.83% (lignin, cellulose and hemicelluloses revealing important functional and nutritional properties. In a parallel evaluation, the anatomical study revealed key elements for the recognition of Musa acuminata when reduced to fragments.Inflorescências de bananeira são popularmente conhecidas como "umbigos", e esses são usados no Brasil como complementos nutricionais. No entanto, o valor nutricional das inflorescências (flores masculinas e brácteas de bananeira nunca foi estudado. Portanto, o material vegetal de Musa acuminata cultivar "ouro" foi coletado no Rio de Janeiro, Brasil e, em seguida, submetido aos procedimentos químicos para determinar a sua composição nutricional. As análises foram realizadas em triplicata. A análise da composição da amostra apresentou teor percentual médio de umidade, proteína, lipídeos e cinza de 8,21, 14,50, 4,04 e 14,43, respectivamente. As inflorescências secas mostraram significativo complemento nutritivo baseado no alto conteúdo de potássio (5.008,26 mg / 100 g e de fibra 49,83% (lignina, celulose e hemiceluloses revelando importantes propriedades funcional e nutritiva. Em uma avaliação paralela, o estudo

  7. EXTRACTION AND QUANTITATIVE DETERMINATION OF ASCORBIC ACID FROM BANANA PEEL MUSA ACUMINATA ‘KEPOK’

    Directory of Open Access Journals (Sweden)

    Khairul Anwar Mohamad Said

    2016-04-01

    Full Text Available This paper discusses the extraction of an antioxidant compound, which is ascorbic acid or vitamin C, from a banana peel using an ultrasound-assisted extraction (UAE method. The type of banana used was Musa acuminata also known as “PisangKepok” in Malaysia. The investigation includes the effect of solvent/solid ratio (4.5, 5 g and 10  ml/g, sonication time (15, 30 and 45 mins and temperature variation (30 , 45  and 60oC on the extraction of ascorbic acid compounds from the banana peel to determine the best or optimum condition of the operation. Out of all extract samples analyzed by redox titration method using iodine solution, it was found that the highest yield was 0.04939 ± 0.00080 mg that resulted from an extraction at 30oC for 15 mins with 5 ml/g solvent-to-solute ratio.KEYWORDS:  Musa acuminata; ultrasound-assisted extraction; vitamin C; redox titration

  8. Pi-pi* orbital transitions and photo-degeneracy of C.acuminata sensitized solar cells

    Science.gov (United States)

    Abodunrin, T.; Boyo, A.; Usikalu, M.; Obafemi, L.; Oladapo, O.; Kotsedi, L.; Yenus, Z.; Maaza, M.

    2017-04-01

    Dye-sensitized solar cells (DSSCs) have acquired great prominence as favourable low-cost photovoltaics due to their ease of fabrication, all- year -availability, ease of obtaining raw materials and adjustable optical properties like transparency and colour. These advantages coupled with the ability to work under poor lighting makes them a suitable candidate for next generation of research. In this research, C.acuminata-sensitized photo anodes play an important role for achieving high performance since the porous metal oxide films provide a large specific surface area for dye loading and the possibility to extend the absorption threshold of past studies of sensitizers. The doctor blade method and high-temperature sintering were some of the methods used in the fabrication of the photo anode. A study of the performance of the C.acuminata-DSSCs with four different electrolyte sensitizers based on iodide redox mediator is determined. The result is DSSCs that exhibit a maximum power output of 39.37 W, fill factor of 0.7 and a power conversion efficiency of 0.6% under unfavourable sunlight intensity conditions and photo-degradation of about 37.5 % in absorbance after 425 suns.

  9. Attraction to amino acids by Lymnaea acuminata, the snail host of Fasciola species

    Directory of Open Access Journals (Sweden)

    Tiwari F.

    2004-01-01

    Full Text Available Adult Lymnaea acuminata (average length 20-22 mm were collected locally from lakes and low-lying submerged fields from Gorakhpur. The chemoattraction studies were made in round glass aquaria measuring 30 cm in diameter and filled to a depth of 10 mm with 500 ml dechlorinated tap water. Each aquarium was divided into four concentric zones. At the starting time of the assay 10 snails were placed on the circumference of outermost zone 0. Snail attractant pellets (SAP were added simultaneously in the center of central zone 3. SAP of different amino acids were prepared at concentrations of 10, 20, 50, 80 and 100 mM/2% agar solution and, subsequently, spread to a uniform thickness of 5 mm. After cooling, SAP were cut in small pieces of 5 mm in diameter. Lymnaea acuminata's attraction to amino acids was studied using different amino acid concentrations in SAP. Pellets containing amino acids with non-polar R groups (proline and tryptophan, a charged polar group (arginine and uncharged polar R groups (serine, citrulline and asparagine were tested. The snails were more attracted to the uncharged polar R group amino acid serine than to other groups of amino acids. The preferred amino acid concentration was 80 mM. The attraction of snails to different amino acids was concentration dependent. Snails could discriminate amongst the different amino acids at > or = 50 mM.

  10. Palynomorphological features of Suaeda acuminata (C.A. Mey. Moq., Suaeda prostrata Pall. and Tamarix ramosissima Ledeb.

    Directory of Open Access Journals (Sweden)

    Tatyana I. Tsymbalyuk

    2012-03-01

    Full Text Available The pollen morphology of Suaeda acuminata , S. prostratа and Tamarix ramosissima from Ukrainian flora has been studied with light and scanning electron microscopy. The main morphological features of pollen grains of three taxa, which spread within halophytes vegetation, are determined. The results has considered as potential useful for identification of the fossil pollen under paleopalynological or paleoecological study.

  11. Diurnal productivity and apparent 14C-calcification in the staghorn coral, Acropora acuminata

    International Nuclear Information System (INIS)

    Barnes, D.J.; Crossland, C.J.

    1978-01-01

    The rate of 14 C-fixation by Acropora acuminata tissues showed a marked increase after dawn. However, maximum 14 C-fixation was not achieved until early afternoon. The apparent 14 C-incorporation rate into the skeleton of whole branches reached a peak around noon. However, the major period of 14 C-deposition occurred from noon to mid-afternoon. The broad peak of 14 C-incorporation into skeleton of whole branches reflects two rate maxima; a late-morning maximum of zooxanthellae-free terminal calices, probably related to translocation of fixed carbon from basal tissues; and an early afternoon maximum for the zooxanthellae-containing basal areas of branches. (author)

  12. Cellular localisation of the anti-cancer drug camptothecin in Camptotheca acuminata Decne (Nyssaceae

    Directory of Open Access Journals (Sweden)

    G Pasqua

    2009-06-01

    Full Text Available In Camptotheca acuminata, we studied the cellular sites of accumulation of the alkaloid camptothecin (CPT, in both plants grown in the field and those grown in a greenhouse, subjecting the latter to stress (i.e., draught, nutritional deficit, and pruning. Fresh sections of the leaf, stem, and root were analysed for the presence of CPT by examining the autofluorescence that the CPT molecule emits when exposed to UV radiation. In the plants grown in the field, CPT was observed only rarely. In the greenhouse plants, CPT had accumulated in crystalline form in the vacuole of specialised cells (i.e., segregator idioblasts, which were not morphologically distinguishable from the cells of the surrounding tissues. In the organs examined, the segregator idioblasts were localised in parenchymatic and epidermal tissues. CPT crystals were also detected in the glandular trichomes on both the stem and leaf.

  13. Analysis of the leaf transcriptome of Musa acuminata during interaction with Mycosphaerella musicola: gene assembly, annotation and marker development.

    Science.gov (United States)

    Passos, Marco A N; de Cruz, Viviane Oliveira; Emediato, Flavia L; de Teixeira, Cristiane Camargo; Azevedo, Vânia C Rennó; Brasileiro, Ana C M; Amorim, Edson P; Ferreira, Claudia F; Martins, Natalia F; Togawa, Roberto C; Júnior, Georgios J Pappas; da Silva, Orzenil Bonfim; Miller, Robert N G

    2013-02-05

    Although banana (Musa sp.) is an important edible crop, contributing towards poverty alleviation and food security, limited transcriptome datasets are available for use in accelerated molecular-based breeding in this genus. 454 GS-FLX Titanium technology was employed to determine the sequence of gene transcripts in genotypes of Musa acuminata ssp. burmannicoides Calcutta 4 and M. acuminata subgroup Cavendish cv. Grande Naine, contrasting in resistance to the fungal pathogen Mycosphaerella musicola, causal organism of Sigatoka leaf spot disease. To enrich for transcripts under biotic stress responses, full length-enriched cDNA libraries were prepared from whole plant leaf materials, both uninfected and artificially challenged with pathogen conidiospores. The study generated 846,762 high quality sequence reads, with an average length of 334 bp and totalling 283 Mbp. De novo assembly generated 36,384 and 35,269 unigene sequences for M. acuminata Calcutta 4 and Cavendish Grande Naine, respectively. A total of 64.4% of the unigenes were annotated through Basic Local Alignment Search Tool (BLAST) similarity analyses against public databases.Assembled sequences were functionally mapped to Gene Ontology (GO) terms, with unigene functions covering a diverse range of molecular functions, biological processes and cellular components. Genes from a number of defense-related pathways were observed in transcripts from each cDNA library. Over 99% of contig unigenes mapped to exon regions in the reference M. acuminata DH Pahang whole genome sequence. A total of 4068 genic-SSR loci were identified in Calcutta 4 and 4095 in Cavendish Grande Naine. A subset of 95 potential defense-related gene-derived simple sequence repeat (SSR) loci were validated for specific amplification and polymorphism across M. acuminata accessions. Fourteen loci were polymorphic, with alleles per polymorphic locus ranging from 3 to 8 and polymorphism information content ranging from 0.34 to 0.82. A large set

  14. A μ-biomimetic uncooled infrared sensor based on the infrared receptors of Melanophila acuminata

    International Nuclear Information System (INIS)

    Siebke, Georg

    2015-11-01

    The pyrophilous beetle Melanophila acuminata possesses an organ sensitive to IR radiation. It employs a photomechanic detection principle: A liquid filled pressure chamber is heated by absorbing the radiation. The liquid expands and leads to the deflection of a mechanosensitive dendrite. In addition, a sophisticated compensation mechanism prevents the build-up of large pressures. In this work, a biomimetic IR sensor based on the IR receptors of Melanophila acuminata is developed by means of microsystems technology. The sensor consists of two liquid-filled chambers that are connected by a micro-fluidic system. Absorption of IR radiation by one of the chambers leads to the heating and expansion of a liquid. The increasing pressure deflects a membrane which is part of a plate capacitor with a diameter of 500 μm and an electrode distance of 500 nm. The micro-fluidic system and the second chamber represent a fluidic low-pass filter, preventing slow, but large pressure changes. A theoretical model is developed which is able to predict the modulation frequency dependent response. It allows to calculate the filter properties of the compensation mechanism which is verified by an experimental test. A simplified sensor without the compensation mechanism is manufactured to analyse the influence of several parameters on the sensor's sensitivity. Finally, a solution for the fabrication of the μ-capacitor is presented. The large aspect ratio between electrode diameter and distance prevents to use a standard sacrificial layer process. The obtained capacitors pave the way to fabricate the complete full-featured sensor.

  15. A μ-biomimetic uncooled infrared sensor based on the infrared receptors of Melanophila acuminata

    Energy Technology Data Exchange (ETDEWEB)

    Siebke, Georg

    2015-11-15

    The pyrophilous beetle Melanophila acuminata possesses an organ sensitive to IR radiation. It employs a photomechanic detection principle: A liquid filled pressure chamber is heated by absorbing the radiation. The liquid expands and leads to the deflection of a mechanosensitive dendrite. In addition, a sophisticated compensation mechanism prevents the build-up of large pressures. In this work, a biomimetic IR sensor based on the IR receptors of Melanophila acuminata is developed by means of microsystems technology. The sensor consists of two liquid-filled chambers that are connected by a micro-fluidic system. Absorption of IR radiation by one of the chambers leads to the heating and expansion of a liquid. The increasing pressure deflects a membrane which is part of a plate capacitor with a diameter of 500 μm and an electrode distance of 500 nm. The micro-fluidic system and the second chamber represent a fluidic low-pass filter, preventing slow, but large pressure changes. A theoretical model is developed which is able to predict the modulation frequency dependent response. It allows to calculate the filter properties of the compensation mechanism which is verified by an experimental test. A simplified sensor without the compensation mechanism is manufactured to analyse the influence of several parameters on the sensor's sensitivity. Finally, a solution for the fabrication of the μ-capacitor is presented. The large aspect ratio between electrode diameter and distance prevents to use a standard sacrificial layer process. The obtained capacitors pave the way to fabricate the complete full-featured sensor.

  16. Phylogenetic placement of two previously described intranuclear bacteria from the ciliate Paramecium bursaria (Protozoa, Ciliophora): 'Holospora acuminata' and 'Holospora curviuscula'.

    Science.gov (United States)

    Rautian, Maria S; Wackerow-Kouzova, Natalia D

    2013-05-01

    'Holospora acuminata' infects micronuclei of Paramecium bursaria (Protozoa, Ciliophora), whereas 'Holospora curviuscula' infects the macronucleus in other clones of the same host species. Because these micro-organisms have not been cultivated, their description has been based only on some morphological properties and host and nuclear specificities. One16S rRNA gene sequence of 'H. curviuscula' is present in databases. The systematic position of the representative strain of 'H. curviuscula', strain MC-3, was determined in this study. Moreover, for the first time, two strains of 'H. acuminata', KBN10-1 and AC61-10, were investigated. Phylogenetic analysis indicated that all three strains belonged to the genus Holospora, family Holosporaceae, order Rickettsiales within the Alphaproteobacteria.

  17. Effect of microgravity simulation using 3D clinostat on cavendish banana (Musa acuminata AAA Group) ripening process

    Science.gov (United States)

    Dwivany, Fenny Martha; Esyanti, Rizkita R.; Prapaisie, Adeline; Puspa Kirana, Listya; Latief, Chunaeni; Ginaldi, Ari

    2016-11-01

    The objective of the research was to determine the effect of microgravity simulation by 3D clinostat on Cavendish banana (Musa acuminata AAA group) ripening process. In this study, physical, physiological changes as well as genes expression were analysed. The result showed that in microgravity simulation condition ripening process in banana was delayed and the MaACOl, MaACSl and MaACS5 gene expression were affected.

  18. Study of Post-Harvest Ambon Banana ( Musa acuminata ) Preservation Using X-Ray

    International Nuclear Information System (INIS)

    Dwijananti, P.; Handayani, L.; Marwoto, P.; Iswari, R.S.

    2016-01-01

    An exposure to Ambon banana ( Musa Acuminata ) samples has been done by using X-rays with current, voltage and exposure time are control parameters. This study aimed to determine storage ability of the post-harvest sample. Five samples were exposured by x-rays with the dose of (3-5) × 10 -14 Gy. The samples were stored at room temperature. Their mass and physical condition (color and smell) were evaluated every 3 days. It was found that the control sample which was not exposured by X-ray was ripe in the sixth day indicated by the yellow color and good smell of the banana. Meanwhile, the samples which were exposured by (3 - 5) × 10 -14 Gy doze of X-ray looked fresher and still had green color. These samples showed their ripening in the ninth day and their mass decrease was (12-13)% which is lower than the control sample. The preservation of banana can be done through low-dose X-ray exposure. (paper)

  19. SOURCES OF MYCORRHIZAL INFECTION OF SHOREA ACUMINATA SEEDLINGS UNDER LABORATORY CONDITIONS

    Directory of Open Access Journals (Sweden)

    LEE Su SEE

    1995-01-01

    Full Text Available Uninoculated dipterocarp seedlings raised in normal field soil in nurseries were always found to have mycorrhizas after a few months. This study set out to determine whether dipterocarp seedlings could continue to grow and develop in the absence of mycorrhizas and also to determine possible sources of mycorrhizal infection of dipterocarp seedlings raised under laboratory conditions using Shorea acuminata as a typical example. Seedlings were planted in capped or uncapped perspex boxes containing sterile or non-sterile field soil and watered daily with sterile water or tap water. Seedling growth and development of mycorrhizas were monitored at monthly intervals for up to seven months. Seedlings grown in sterile soil remained uninfected after seven months while infection was found in some of the seedlings grown in normal soil regardless of whether they had been watered with tap water or sterile water. This showed that field soil (i.e. under grass far from the forest contained suitable inoculum for forest tree seedlings. Tap water and the air were not important sources of infection. However, mycorrhizal infection was very uneven indicating that the inoculum was probably very unevenly distributed in the soil or that the inoculum density was rather low. Seedlings grown in sterile soil showed better growth than those grown in normal soil and infection of roots by parasitic fungi in the latter was also observed.

  20. Chemical composition and nutritional value of unripe banana flour (Musa acuminata, var. Nanicão).

    Science.gov (United States)

    Menezes, Elizabete Wenzel; Tadini, Carmen Cecília; Tribess, Tatiana Beatris; Zuleta, Angela; Binaghi, Julieta; Pak, Nelly; Vera, Gloria; Dan, Milana Cara Tanasov; Bertolini, Andréa C; Cordenunsi, Beatriz Rosana; Lajolo, Franco M

    2011-09-01

    Banana flour obtained from unripe banana (Musa acuminata, var. Nanicão) under specific drying conditions was evaluated regarding its chemical composition and nutritional value. Results are expressed in dry weight (dw). The unripe banana flour (UBF) presented a high amount of total dietary fiber (DF) (56.24 g/100 g), which consisted of resistant starch (RS) (48.99 g/100 g), fructans (0.05 g/100 g) and DF without RS or fructans (7.2 g/100 g). The contents of available starch (AS) (27.78 g/100 g) and soluble sugars (1.81 g/100 g) were low. The main phytosterols found were campesterol (4.1 mg/100 g), stigmasterol (2.5 mg/100 g) and β-sitosterol (6.2 mg/100 g). The total polyphenol content was 50.65 mg GAE/100 g. Antioxidant activity, by the FRAP and ORAC methods, was moderated, being 358.67 and 261.00 μmol of Trolox equivalent/100 g, respectively. The content of Zn, Ca and Fe and mineral dialyzability were low. The procedure used to obtain UBF resulted in the recovery of undamaged starch granules and in a low-energy product (597 kJ/100 g).

  1. The banana (Musa acuminata) genome and the evolution of monocotyledonous plants.

    Science.gov (United States)

    D'Hont, Angélique; Denoeud, France; Aury, Jean-Marc; Baurens, Franc-Christophe; Carreel, Françoise; Garsmeur, Olivier; Noel, Benjamin; Bocs, Stéphanie; Droc, Gaëtan; Rouard, Mathieu; Da Silva, Corinne; Jabbari, Kamel; Cardi, Céline; Poulain, Julie; Souquet, Marlène; Labadie, Karine; Jourda, Cyril; Lengellé, Juliette; Rodier-Goud, Marguerite; Alberti, Adriana; Bernard, Maria; Correa, Margot; Ayyampalayam, Saravanaraj; Mckain, Michael R; Leebens-Mack, Jim; Burgess, Diane; Freeling, Mike; Mbéguié-A-Mbéguié, Didier; Chabannes, Matthieu; Wicker, Thomas; Panaud, Olivier; Barbosa, Jose; Hribova, Eva; Heslop-Harrison, Pat; Habas, Rémy; Rivallan, Ronan; Francois, Philippe; Poiron, Claire; Kilian, Andrzej; Burthia, Dheema; Jenny, Christophe; Bakry, Frédéric; Brown, Spencer; Guignon, Valentin; Kema, Gert; Dita, Miguel; Waalwijk, Cees; Joseph, Steeve; Dievart, Anne; Jaillon, Olivier; Leclercq, Julie; Argout, Xavier; Lyons, Eric; Almeida, Ana; Jeridi, Mouna; Dolezel, Jaroslav; Roux, Nicolas; Risterucci, Ange-Marie; Weissenbach, Jean; Ruiz, Manuel; Glaszmann, Jean-Christophe; Quétier, Francis; Yahiaoui, Nabila; Wincker, Patrick

    2012-08-09

    Bananas (Musa spp.), including dessert and cooking types, are giant perennial monocotyledonous herbs of the order Zingiberales, a sister group to the well-studied Poales, which include cereals. Bananas are vital for food security in many tropical and subtropical countries and the most popular fruit in industrialized countries. The Musa domestication process started some 7,000 years ago in Southeast Asia. It involved hybridizations between diverse species and subspecies, fostered by human migrations, and selection of diploid and triploid seedless, parthenocarpic hybrids thereafter widely dispersed by vegetative propagation. Half of the current production relies on somaclones derived from a single triploid genotype (Cavendish). Pests and diseases have gradually become adapted, representing an imminent danger for global banana production. Here we describe the draft sequence of the 523-megabase genome of a Musa acuminata doubled-haploid genotype, providing a crucial stepping-stone for genetic improvement of banana. We detected three rounds of whole-genome duplications in the Musa lineage, independently of those previously described in the Poales lineage and the one we detected in the Arecales lineage. This first monocotyledon high-continuity whole-genome sequence reported outside Poales represents an essential bridge for comparative genome analysis in plants. As such, it clarifies commelinid-monocotyledon phylogenetic relationships, reveals Poaceae-specific features and has led to the discovery of conserved non-coding sequences predating monocotyledon-eudicotyledon divergence.

  2. Post harvest changes of banana prata (Musa acuminata x Musa balbisiana group AAB) γ-irradiated

    International Nuclear Information System (INIS)

    Barros Villas Boas, Eduardo Valerio de.

    1995-01-01

    Pre-climateric bananas (Musa acuminata x Musa balbisiana [AAB group] cv. Prata) were stored without treatment (no radiation) or were exposed at 0.25 and 0.50 kGy of γ -irradiation, with a dose rate of 1 kGy.h -1 before storage. The fruits were analysed for CO 2 and ethylene production during maturation and pulp-to-peel ratio, starch, total soluble sugars, pectins, pectin methyl esterase and poly galacturonase activities on 6 colour score of peel. The radiation dose/peel-colour interaction affected the pulp-to-peel ratio significantly, while the fruits subjected at 0.25 Gy had the highest increase on the colour scores 5, 6, and 7. A predictable increase in the conversion of starch to sugar took place during maturation and a delaying on the soluble sugar accumulation was noted on the fruits submitted to 0.50 kGy, in the 6 and 7 colour scores only. A decrease on the total pectin content and a trend of a higher solubilization of pectins was observed in the fruits γ-irradiated at 0.50 kGy. Higher pectin methyl esterase activities were exhibited by irradiated fruits, although the γ-irradiation has suppressed the poly galacturonase activity throughout the maturation period. (author). 110 refs., 11 figs., 5 tabs

  3. Improvement of the banana "Musa acuminata" reference sequence using NGS data and semi-automated bioinformatics methods.

    Science.gov (United States)

    Martin, Guillaume; Baurens, Franc-Christophe; Droc, Gaëtan; Rouard, Mathieu; Cenci, Alberto; Kilian, Andrzej; Hastie, Alex; Doležel, Jaroslav; Aury, Jean-Marc; Alberti, Adriana; Carreel, Françoise; D'Hont, Angélique

    2016-03-16

    Recent advances in genomics indicate functional significance of a majority of genome sequences and their long range interactions. As a detailed examination of genome organization and function requires very high quality genome sequence, the objective of this study was to improve reference genome assembly of banana (Musa acuminata). We have developed a modular bioinformatics pipeline to improve genome sequence assemblies, which can handle various types of data. The pipeline comprises several semi-automated tools. However, unlike classical automated tools that are based on global parameters, the semi-automated tools proposed an expert mode for a user who can decide on suggested improvements through local compromises. The pipeline was used to improve the draft genome sequence of Musa acuminata. Genotyping by sequencing (GBS) of a segregating population and paired-end sequencing were used to detect and correct scaffold misassemblies. Long insert size paired-end reads identified scaffold junctions and fusions missed by automated assembly methods. GBS markers were used to anchor scaffolds to pseudo-molecules with a new bioinformatics approach that avoids the tedious step of marker ordering during genetic map construction. Furthermore, a genome map was constructed and used to assemble scaffolds into super scaffolds. Finally, a consensus gene annotation was projected on the new assembly from two pre-existing annotations. This approach reduced the total Musa scaffold number from 7513 to 1532 (i.e. by 80%), with an N50 that increased from 1.3 Mb (65 scaffolds) to 3.0 Mb (26 scaffolds). 89.5% of the assembly was anchored to the 11 Musa chromosomes compared to the previous 70%. Unknown sites (N) were reduced from 17.3 to 10.0%. The release of the Musa acuminata reference genome version 2 provides a platform for detailed analysis of banana genome variation, function and evolution. Bioinformatics tools developed in this work can be used to improve genome sequence assemblies in

  4. Comparative anatomy of leaflets of Zamia acuminata and Z. pseudomonticola (Zamiaceae in Costa Rica

    Directory of Open Access Journals (Sweden)

    Rafael Acuña-Castillo

    2013-06-01

    Full Text Available The genus Zamia is morphologically and ecologically the most diverse of the order Cycadales. Throughout its history this genus has been restricted to the New World and is presently almost entirely restricted to the Neotropics. Unusual anatomical traits of the leaflets, such as the sunken stomata and thick cuticle, are common in this and related genera. The objective of this research was to study and compare the leaflet anatomy of Zamia acuminata and Z. pseudomonticola and establish possible phylogenetic relationships between the anatomical traits and the near relatives of these species. The leaf material was obtained from living plants and then processed for electron microscopy study. We found that both species are very similar to each other and to Z. fairchildiana, and that they share several unusual traits with other species of the genus, such as the parenchyma morphology, the spatial distribution of tissues between the veins and the stomata morphology. The main differences between these species were seen in their fiber clusters and in the abundance of trichome basal cells on the epidermis. The anatomical similarities between the three species could be the result of their close phylogenetic relationship and the divergences between them could be the result of recent speciation during the Pleistocene, resulting from geological changes in Southern Costa Rica.Zamia es morfológica y ecológicamente el género más diverso del orden Cycadales. Este género siempre ha estado restringido a América, pero en la actualidad habita principalmente en la región neotropical. Características anatómicas inusuales en los foliolos como los estomas hundidos y las cutículas gruesas son comunes en Zamia y géneros afines. El objetivo de este trabajo consiste en comparar la anatomía de los foliolos de Zamia acuminata y Z. pseudomonticola y establecer posibles relaciones filogenéticas entre las características anatómicas y los parientes cercanos de esta

  5. Repetitive part of the banana (Musa acuminata) genome investigated by low-depth 454 sequencing.

    Science.gov (United States)

    Hribová, Eva; Neumann, Pavel; Matsumoto, Takashi; Roux, Nicolas; Macas, Jirí; Dolezel, Jaroslav

    2010-09-16

    Bananas and plantains (Musa spp.) are grown in more than a hundred tropical and subtropical countries and provide staple food for hundreds of millions of people. They are seed-sterile crops propagated clonally and this makes them vulnerable to a rapid spread of devastating diseases and at the same time hampers breeding improved cultivars. Although the socio-economic importance of bananas and plantains cannot be overestimated, they remain outside the focus of major research programs. This slows down the study of nuclear genome and the development of molecular tools to facilitate banana improvement. In this work, we report on the first thorough characterization of the repeat component of the banana (M. acuminata cv. 'Calcutta 4') genome. Analysis of almost 100 Mb of sequence data (0.15× genome coverage) permitted partial sequence reconstruction and characterization of repetitive DNA, making up about 30% of the genome. The results showed that the banana repeats are predominantly made of various types of Ty1/copia and Ty3/gypsy retroelements representing 16 and 7% of the genome respectively. On the other hand, DNA transposons were found to be rare. In addition to new families of transposable elements, two new satellite repeats were discovered and found useful as cytogenetic markers. To help in banana sequence annotation, a specific Musa repeat database was created, and its utility was demonstrated by analyzing the repeat composition of 62 genomic BAC clones. A low-depth 454 sequencing of banana nuclear genome provided the largest amount of DNA sequence data available until now for Musa and permitted reconstruction of most of the major types of DNA repeats. The information obtained in this study improves the knowledge of the long-range organization of banana chromosomes, and provides sequence resources needed for repeat masking and annotation during the Musa genome sequencing project. It also provides sequence data for isolation of DNA markers to be used in genetic

  6. Direct Effects Of Chronic Gamma Radiation On Musa Acuminata Var. Berangan, A Local Malaysia Banana Cultivar

    International Nuclear Information System (INIS)

    Maimum Tahir; Azhar Mohamad; Rozeita Laboh; Umikalsum Mohd Bahari

    2014-01-01

    Musa acuminata var. Berangan, is a popular variety of our local banana known as Pisang Berangan. The variety is a triploid banana, use mainly for dessert and has a great value for commodity fruit crops. However, production of PisangBerangan has been threatened by diseases such as Fusarium wilt, black sigatoka, Fusarium wilt, burrowing nematodes and viral diseases like Banana streak virus, Banana bunch top virus and Banana bract mosaic virus. The scenario becoming worst as Musa has a narrow genetic background for breeding and/or selection program. The banana breeding program of edible bananas is hampered by high sterility, and very limited amounts of seeds. Mutation induction via chronic gamma radiation is an alternative ways in creating more variants for selections towards a better quality and disease tolerance. A total number of 75 samples at nursery stage (1 month) were exposed to chronic gamma radiation in Gamma Greenhouse at Malaysian Nuclear Agency for 28 weeks. The samples were accordingly arranged with distance ranging from 1 m to 15 m from gamma source (Cesium-137). Plant height and new buds were used as measurement parameters in evaluating the direct effects of the chronic gamma radiation. Results showed effective dose of chronic gamma radiation in Pisang Berangan was 20 Gy. Number of new emerging sucker was ranging from 1-3 pieces with the highest at ring-4 and ring-5. Plant height was observed ranging from 22.1 to 110.5 cm. Effects of chronic radiation were observed after 3-4 months in the GGH. The samples revealed as striking leaves, short inter node and new emergence of suckers. The objective of this work is to get a dose response for chronic gamma radiation in Pisang Berangan. As for selection of potential mutant variants, new emerging suckers were tissue cultured in segregating chimeras and to get required numbers of samples for further field evaluation. (author)

  7. Genomic analysis of NAC transcription factors in banana (Musa acuminata) and definition of NAC orthologous groups for monocots and dicots.

    Science.gov (United States)

    Cenci, Albero; Guignon, Valentin; Roux, Nicolas; Rouard, Mathieu

    2014-05-01

    Identifying the molecular mechanisms underlying tolerance to abiotic stresses is important in crop breeding. A comprehensive understanding of the gene families associated with drought tolerance is therefore highly relevant. NAC transcription factors form a large plant-specific gene family involved in the regulation of tissue development and responses to biotic and abiotic stresses. The main goal of this study was to set up a framework of orthologous groups determined by an expert sequence comparison of NAC genes from both monocots and dicots. In order to clarify the orthologous relationships among NAC genes of different species, we performed an in-depth comparative study of four divergent taxa, in dicots and monocots, whose genomes have already been completely sequenced: Arabidopsis thaliana, Vitis vinifera, Musa acuminata and Oryza sativa. Due to independent evolution, NAC copy number is highly variable in these plant genomes. Based on an expert NAC sequence comparison, we propose forty orthologous groups of NAC sequences that were probably derived from an ancestor gene present in the most recent common ancestor of dicots and monocots. These orthologous groups provide a curated resource for large-scale protein sequence annotation of NAC transcription factors. The established orthology relationships also provide a useful reference for NAC function studies in newly sequenced genomes such as M. acuminata and other plant species.

  8. Genome-wide BAC-end sequencing of Musa acuminata DH Pahang reveals further insights into the genome organization of banana

    NARCIS (Netherlands)

    Arnago, R.E.; Togawa, R.C.; Carpentier, S.C.; Lintel Hekkert, te B.; Kema, G.H.J.; Souza, M.T.

    2011-01-01

    Banana and plantain (Musa spp.) are grown in more than 120 countries in tropical and subtropical regions and constitute an important staple food for millions of people. A Musa acuminata ssp. malaccencis DH Pahang bacterial artificial chromosome (BAC) library (MAMB) was submitted for BAC-end

  9. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  10. Metabolomic Profiles of Dinophysis acuminata and Dinophysis acuta Using Non-Targeted High-Resolution Mass Spectrometry: Effect of Nutritional Status and Prey

    Directory of Open Access Journals (Sweden)

    María García-Portela

    2018-04-01

    Full Text Available Photosynthetic species of the genus Dinophysis are obligate mixotrophs with temporary plastids (kleptoplastids that are acquired from the ciliate Mesodinium rubrum, which feeds on cryptophytes of the Teleaulax-Plagioselmis-Geminigera clade. A metabolomic study of the three-species food chain Dinophysis-Mesodinium-Teleaulax was carried out using mass spectrometric analysis of extracts of batch-cultured cells of each level of that food chain. The main goal was to compare the metabolomic expression of Galician strains of Dinophysis acuminata and D. acuta that were subjected to different feeding regimes (well-fed and prey-limited and feeding on two Mesodinium (Spanish and Danish strains. Both Dinophysis species were able to grow while feeding on both Mesodinium strains, although differences in growth rates were observed. Toxin and metabolomic profiles of the two Dinophysis species were significantly different, and also varied between different feeding regimes and different prey organisms. Furthermore, significantly different metabolomes were expressed by a strain of D. acuminata that was feeding on different strains of the ciliate Mesodinium rubrum. Both species-specific metabolites and those common to D. acuminata and D. acuta were tentatively identified by screening of METLIN and Marine Natural Products Dictionary databases. This first metabolomic study applied to Dinophysis acuminata and D.acuta in culture establishes a basis for the chemical inventory of these species.

  11. Antitumor Effects and Biological Mechanism of Action of the Aqueous Extract of the Camptotheca acuminata Fruit in Human Endometrial Carcinoma Cells

    Directory of Open Access Journals (Sweden)

    Chi-Shian Lin

    2014-01-01

    Full Text Available The aqueous extracts of the leaves and fruit of Camptotheca acuminata have long been used in traditional Chinese medicine (TCM for treating cancer patients. The chemotherapeutic drug, camptothecin (CPT, and related analogs were first isolated from C. acuminata in the 1970s. Although the antitumor effects of CPT have been characterized in recent years, the antitumor effects of aqueous extracts of C. acuminata have not been clarified. The aims of our current study were to determine the tumor-suppression efficiency of an aqueous extract of the fruit of C. acuminata (AE-CA in the human endometrial carcinoma cell lines, HEC-1A, HEC-1B, and KLE, and compare its antitumor effects with those of CPT. Cell viability assays indicated that a dosage of AE-CA containing 0.28 mg/mL of CPT demonstrated enhanced cytotoxicity, compared with CPT treatment. The effects of AE-CA on the induction of cell cycle arrest, the accumulation of cyclin-A2 and -B1, and the activation of caspase-3 and caspase-7 were similar to those of CPT. Furthermore, AE-CA exhibited a synergistic effect on the cytotoxicity of cisplatin in HEC-1A and HEC-1B cells. These results indicated that AE-CA is a potent antitumor agent and can be combined with cisplatin for the treatment of human endometrial cancer.

  12. Alnus acuminata in dual symbiosis with Frankia and two different ectomycorrhizal fungi (Alpova austroalnicola and Alpova diplophloeus) growing in soilless growth medium

    Science.gov (United States)

    Alejandra G. Becerra; Euginia Menoyo; Irene Lett; Ching Y. Li

    2009-01-01

    In this study we investigated the capacity of Andean alder (Alnus acuminata Kunth), inoculated with Frankia and two ectomycorrhizal fungi (Alpova austroalnicola Dominguez and Alpova diplophloeus [Zeller and Dodge] Trappe and Smith), for nodulation and growth in pots of a soilless medium...

  13. Metabolomic Profiles of Dinophysis acuminata and Dinophysis acuta Using Non-Targeted High-Resolution Mass Spectrometry: Effect of Nutritional Status and Prey.

    Science.gov (United States)

    García-Portela, María; Reguera, Beatriz; Sibat, Manoella; Altenburger, Andreas; Rodríguez, Francisco; Hess, Philipp

    2018-04-26

    Photosynthetic species of the genus Dinophysis are obligate mixotrophs with temporary plastids (kleptoplastids) that are acquired from the ciliate Mesodinium rubrum , which feeds on cryptophytes of the Teleaulax-Plagioselmis-Geminigera clade. A metabolomic study of the three-species food chain Dinophysis-Mesodinium-Teleaulax was carried out using mass spectrometric analysis of extracts of batch-cultured cells of each level of that food chain. The main goal was to compare the metabolomic expression of Galician strains of Dinophysis acuminata and D. acuta that were subjected to different feeding regimes (well-fed and prey-limited) and feeding on two Mesodinium (Spanish and Danish) strains. Both Dinophysis species were able to grow while feeding on both Mesodinium strains, although differences in growth rates were observed. Toxin and metabolomic profiles of the two Dinophysis species were significantly different, and also varied between different feeding regimes and different prey organisms. Furthermore, significantly different metabolomes were expressed by a strain of D. acuminata that was feeding on different strains of the ciliate Mesodinium rubrum . Both species-specific metabolites and those common to D. acuminata and D. acuta were tentatively identified by screening of METLIN and Marine Natural Products Dictionary databases. This first metabolomic study applied to Dinophysis acuminata and D.acuta in culture establishes a basis for the chemical inventory of these species.

  14. EIN3-like gene expression during fruit ripening of Cavendish banana (Musa acuminata cv. Grande naine).

    Science.gov (United States)

    Mbéguié-A-Mbéguié, Didier; Hubert, Olivier; Fils-Lycaon, Bernard; Chillet, Marc; Baurens, Franc-Christophe

    2008-06-01

    Ethylene signal transduction initiates with ethylene binding at receptor proteins and terminates in a transcription cascade involving the EIN3/EIL transcription factors. Here, we have isolated four cDNAs homologs of the Arabidopsis EIN3/EIN3-like gene, MA-EILs (Musa acuminata ethylene insensitive 3-like) from banana fruit. Sequence comparison with other banana EIL gene already registered in the database led us to conclude that, at this day, at least five different genes namely MA-EIL1, MA-EIL2/AB266318, MA-EIL3/AB266319, MA-EIL4/AB266320 and AB266321 exist in banana. Phylogenetic analyses included all banana EIL genes within a same cluster consisting of rice OsEILs, a monocotyledonous plant as banana. However, MA-EIL1, MA-EIL2/AB266318, MA-EIL4/AB266320 and AB266321 on one side, and MA-EIL3/AB266319 on the other side, belong to two distant subclusters. MA-EIL mRNAs were detected in all examined banana tissues but at lower level in peel than in pulp. According to tissues, MA-EIL genes were differentially regulated by ripening and ethylene in mature green fruit and wounding in old and young leaves. MA-EIL2/AB266318 was the unique ripening- and ethylene-induced gene; MA-EIL1, MA-EIL4/Ab266320 and AB266321 genes were downregulated, while MA-EIL3/AB266319 presented an unusual pattern of expression. Interestingly, a marked change was observed mainly in MA-EIL1 and MA-EIL3/Ab266319 mRNA accumulation concomitantly with changes in ethylene responsiveness of fruit. Upon wounding, the main effect was observed in MA-EIL4/AB266320 and AB266321 mRNA levels, which presented a markedly increase in both young and old leaves, respectively. Data presented in this study suggest the importance of a transcriptionally step control in the regulation of EIL genes during banana fruit ripening.

  15. Micropropagación de la planta medicinalPsychotria acuminata

    Directory of Open Access Journals (Sweden)

    Alfonso Lara

    2003-01-01

    Full Text Available Psychotria acuminata es una planta medicinal que produce los alcaloides emetina, cephaelina y psychotrina, usados como expectorantes y eméticos. Hoy día estos alcaloides son extraídos de plantas silvestres pues esta especie no ha sido domesticada. Debido al uso potencial de los principios fitoquímicos, y a la escasa población de esta especie en el país, se desarrolló métodos de cultivo de tejidos para la reproducción clonal y masiva de esta planta. El material vegetal fue recolectado en 4 localidades de Costa Rica. En un medio de cultivo de Murashige y Skoog (MS, 1962, suplementado con 3 mg l-1 de BAP, 0,01 mg l-1 de ANA, 3% de azúcar y 2 g l-1 de phytagel, se logró la inducción de múltiples brotes a partir de las yemas axilares de microestacas (segmentos nodales de 1 cm de largo y de hojas provenientes de plántulas de 5 cm establecidas in vitro para 3 localidades. La formación de los brotes en las hojas ocurrió mediante organogénesis y embriogénesis. El enraizamiento in vitro de los brotes fue de un 100% cuando se utilizó un MS/2 suplementado con 6 mg l-1 de AIA. Debido a que el sistema radical generado in vitro muere una vez que las plántulas son sembradas en el sustrato en el invernadero, se utilizó Agriroot 1 DP® para generar raíces nuevas. Después de 8 semanas fue posible aclimatizar un 80% de las plántulas. La tasa de multiplicación, cuando se utiliza microestacas como explante, así como el tiempo para que ocurrieran los eventos morfogenéticos, fueron diferentes para los materiales de las 3 procedencias, lo que indica que las plantas de cada localidad son genéticamente diferentes.

  16. Size-related flowering and fecundity in the tropical canopy tree species, Shorea acuminata (Dipterocarpaceae) during two consecutive general flowerings.

    Science.gov (United States)

    Naito, Yoko; Kanzaki, Mamoru; Numata, Shinya; Obayashi, Kyoko; Konuma, Akihiro; Nishimura, Sen; Ohta, Seiichi; Tsumura, Yoshihiko; Okuda, Toshinori; Lee, Soon Leong; Muhammad, Norwati

    2008-01-01

    We monitored the reproductive status of all trees with diameters at breast height (dbh) >30 cm in a 40-ha plot at Pasoh, west Malaysia, and investigated the individual fecundity of 15 Shorea acuminata Dyer (Dipterocarpaceae) trees using seed-trapping methods during two consecutive general flowering periods in 2001 (GF2001) and 2002 (GF2002). The proportion of flowering trees was higher, and not dependent on size, in GF2002 (84.2%), than in GF2001 (54.5%), when flowering mainly occurred in trees with a dbh investment during the two consecutive reproductive events clearly differed between medium-sized and large trees; the former concentrated their reproductive investment in one of the reproductive events whereas the latter allocated their investment more evenly to both reproductive events. Our results suggest size-related differences in the resource allocation pattern for reproduction.

  17. New and highly efficient column chromatographic extraction and simple purification of camptothecin from Camptotheca acuminata and Nothapodytes pittosporoides.

    Science.gov (United States)

    Zeng, Xue-Hua; Li, Yue-Hong; Wu, Shan-Shan; Hao, Rui-Lin; Li, Hui; Ni, He; Han, Han-Bing; Li, Hai-Hang

    2013-01-01

    Camptothecin, a widely used natural anti-cancer drug, is difficult to extract and purify effectively from plants. To develop new and highly efficient extraction and purification methods for analysis and production of camptothecin from leaves and fruits of Camptotheca acuminata and Nothapodytes pittosporoides roots. Dried materials were loaded in empty columns with fivefold 60% ethanol for leaves or 70% ethanol for fruits of C. acumnata, and sixfold 70% ethanol for N. pittosporoides roots. The columns were eluted with the same solvents at room temperature. Eluent was collected as extraction solution. Extraction solution from leaves and fruits of C. acuminata was vacuum-evaporated to remove ethanol, precipitated at pH 8.0 to remove alkaline insolubles and fractionated with chloroform at pH 3.0, which yields a crude product with 70% purity. Extraction solution from N. pittosporoides roots was concentrated to 1/10 volume and precipitated at pH 3.0, which yields a crude product with 60% purity. All crude products were purified by crystallisation. All steps were monitored by HPLC. Camptothecin was extracted from the three plant materials at a 98% rate with 15- or 18-fold solvent for content analysis, or at a 97% rate with five- or sixfold solvent for production. All crude products were purified to 98%. The overall recovery rates of camptothecin from plant materials to purified products reached 92% or higher. The new procedures are simple and highly efficient, and have multiple advantages for quantitative analysis and large production of camptothecin from plants. Copyright © 2013 John Wiley & Sons, Ltd.

  18. In vitro propagation and assessment of the genetic fidelity of Musa acuminata (AAA) cv. Vaibalhla derived from immature male flowers.

    Science.gov (United States)

    Hrahsel, Lalremsiami; Basu, Adreeja; Sahoo, Lingaraj; Thangjam, Robert

    2014-02-01

    An efficient in vitro propagation method has been developed for the first time for Musa acuminata (AAA) cv. Vaibalhla, an economically important banana cultivar of Mizoram, India. Immature male flowers were used as explants. Murashige and Skoog's (MS) medium supplemented with plant growth regulators (PGRs) were used for the regeneration process. Out of different PGR combinations, MS medium supplemented with 2 mg L(-1) 6-benzylaminopurine (BAP) + 0.5 mg L(-1) α-naphthalene acetic acid (NAA) was optimal for production of white bud-like structures (WBLS). On this medium, explants produced the highest number of buds per explant (4.30). The highest percentage (77.77) and number (3.51) of shoot formation from each explants was observed in MS medium supplemented with 2 mg L(-1) kinetin + 0.5 mg L(-1) NAA. While MS medium supplemented with a combination of 2 mg L(-1) BAP + 0.5 mg L(-1) NAA showed the maximum shoot length (14.44 cm). Rooting efficiency of the shoots was highest in the MS basal medium without any PGRs. The plantlets were hardened successfully in the greenhouse with 96% survival rate. Random amplified polymorphic DNA (RAPD) and inter-simple sequence repeat (ISSR) markers were employed to assess the genetic stability of in vitro regenerated plantlets of M. acuminata (AAA) cv. Vaibalhla. Eight RAPD and 8 ISSR primers were successfully used for the analysis from the 40 RAPD and 30 ISSR primers screened initially. The amplified products were monomorphic across all the regenerated plants and were similar to the mother plant. The present standardised protocol will find application in mass production, conservation and genetic transformation studies of this commercially important banana.

  19. Effects of Aqueous Extract of Three Cultivars of Banana (Musa acuminata) Fruit Peel on Kidney and Liver Function Indices in Wistar Rats.

    Science.gov (United States)

    Edenta, Chidi; Okoduwa, Stanley I R; Okpe, Oche

    2017-10-23

    Background: Musa acuminata fruit peels are used in the northern part of Nigeria for the treatment of hypertension and other cardiovascular related diseases. The effects of aqueous extracts of ripped fruit peel of three cultivars of Musa acuminata ( Saro, Ominni and Oranta ) on the hepatic and renal parameters of normal rats were examined. Methods: Fruit peel aqueous extracts (FPAE) of the 3 cultivars of Bananas (100 mg/kg b.w.) were administered by oral intubation (that is through esophageal cannula) to normal rats (140-180 g) for a period of 28 days. Blood samples were collected for determination of plasma aspartate amino transferase (AST), alanine amino transferase (ALT), alkaline phosphatase ALK-P), total protein, albumin, creatinine as well as urea. Results: From the results obtained, there were no significant ( p < 0.05) changes in the ALK-P, AST, ALT, total protein and albumin among the experimental rats administered FPAE of the 3 cultivars of Musa acuminata when compared with the normal control group. There was a significant ( p < 0.05) increase in the level of serum creatinine (in mg/dL) (1.53 ± 0.23) when compared to the normal control (0.72 ± 0.15), Ominni (0.92 ± 0.39) and Oranta (0.74 ± 0.22). Similarly, there was a significant ( p < 0.05) increase in the level of serum urea (in mg/dL) of Saro (41.56 ± 4.68) when compared to the normal control (26.05 ± 0.73), Ommini (28.44 ± 2.43) and Oranta (26.10 ± 2.94). Conclusion: The findings reveal the Saro cultivar of Musa acuminata to be nephrotoxic and not a good potential drug candidate among the cultivars studied hence should be discouraged in the treatment of hypertension and other cardiovascular related diseases.

  20. Effects of Aqueous Extract of Three Cultivars of Banana (Musa acuminata) Fruit Peel on Kidney and Liver Function Indices in Wistar Rats

    Science.gov (United States)

    Edenta, Chidi; Okpe, Oche

    2017-01-01

    Background: Musa acuminata fruit peels are used in the northern part of Nigeria for the treatment of hypertension and other cardiovascular related diseases. The effects of aqueous extracts of ripped fruit peel of three cultivars of Musa acuminata (Saro, Ominni and Oranta) on the hepatic and renal parameters of normal rats were examined. Methods: Fruit peel aqueous extracts (FPAE) of the 3 cultivars of Bananas (100 mg/kg b.w.) were administered by oral intubation (that is through esophageal cannula) to normal rats (140–180 g) for a period of 28 days. Blood samples were collected for determination of plasma aspartate amino transferase (AST), alanine amino transferase (ALT), alkaline phosphatase ALK-P), total protein, albumin, creatinine as well as urea. Results: From the results obtained, there were no significant (p < 0.05) changes in the ALK-P, AST, ALT, total protein and albumin among the experimental rats administered FPAE of the 3 cultivars of Musa acuminata when compared with the normal control group. There was a significant (p < 0.05) increase in the level of serum creatinine (in mg/dL) (1.53 ± 0.23) when compared to the normal control (0.72 ± 0.15), Ominni (0.92 ± 0.39) and Oranta (0.74 ± 0.22). Similarly, there was a significant (p < 0.05) increase in the level of serum urea (in mg/dL) of Saro (41.56 ± 4.68) when compared to the normal control (26.05 ± 0.73), Ommini (28.44 ± 2.43) and Oranta (26.10 ± 2.94). Conclusion: The findings reveal the Saro cultivar of Musa acuminata to be nephrotoxic and not a good potential drug candidate among the cultivars studied hence should be discouraged in the treatment of hypertension and other cardiovascular related diseases. PMID:29065553

  1. Effects of Aqueous Extract of Three Cultivars of Banana (Musa acuminata Fruit Peel on Kidney and Liver Function Indices in Wistar Rats

    Directory of Open Access Journals (Sweden)

    Chidi Edenta

    2017-10-01

    Full Text Available Background: Musa acuminata fruit peels are used in the northern part of Nigeria for the treatment of hypertension and other cardiovascular related diseases. The effects of aqueous extracts of ripped fruit peel of three cultivars of Musa acuminata (Saro, Ominni and Oranta on the hepatic and renal parameters of normal rats were examined. Methods: Fruit peel aqueous extracts (FPAE of the 3 cultivars of Bananas (100 mg/kg b.w. were administered by oral intubation (that is through esophageal cannula to normal rats (140–180 g for a period of 28 days. Blood samples were collected for determination of plasma aspartate amino transferase (AST, alanine amino transferase (ALT, alkaline phosphatase ALK-P, total protein, albumin, creatinine as well as urea. Results: From the results obtained, there were no significant (p < 0.05 changes in the ALK-P, AST, ALT, total protein and albumin among the experimental rats administered FPAE of the 3 cultivars of Musa acuminata when compared with the normal control group. There was a significant (p < 0.05 increase in the level of serum creatinine (in mg/dL (1.53 ± 0.23 when compared to the normal control (0.72 ± 0.15, Ominni (0.92 ± 0.39 and Oranta (0.74 ± 0.22. Similarly, there was a significant (p < 0.05 increase in the level of serum urea (in mg/dL of Saro (41.56 ± 4.68 when compared to the normal control (26.05 ± 0.73, Ommini (28.44 ± 2.43 and Oranta (26.10 ± 2.94. Conclusion: The findings reveal the Saro cultivar of Musa acuminata to be nephrotoxic and not a good potential drug candidate among the cultivars studied hence should be discouraged in the treatment of hypertension and other cardiovascular related diseases.

  2. Bait formulations of molluscicides and their effects on biochemical changes in the ovotestis of snail Lymnaea acuminata (Mollusca; Gastropoda:Lymnaeidae

    Directory of Open Access Journals (Sweden)

    Pradeep Kumar

    2011-10-01

    Full Text Available The effect of sub-lethal feeding of bait formulations containing molluscicidal component of Ferula asafoetida (ferulic acid, umbelliferone, Syzygium aromaticum (eugenol and Carum carvi (limonene on biochemical changes in the ovotestis of snail Lymnaea acuminata were studied. Bait formulations feeding to L. acuminata were studied in clear glass aquaria having diameter of 30 cm. Baits were prepared from different binary combinations of attractant amino acid (valine, aspartic acid, lysine and alanine 10 mM in 100 mL of 2% agar solution + sub-lethal (20% and 60% of 24h LC50 doses of different molluscicides (ferulic acid, umbelliferone, eugenol and limonene. These baits caused maximum significant reduction in free amino acid, protein, DNA, RNA levels i.e. 41.37, 23.56, 48.36 and 14.29% of control in the ovotestis of the snail, respectively. Discontinuation of feeding after treatment of 60% of 96h LC50 of molluscicide containing bait for next 72h caused a significant recovery in free amino acid, protein, DNA and RNA levels in the ovotestis of L. acuminata.

  3. Analysis of non-TIR NBS-LRR resistance gene analogs in Musa acuminata Colla: Isolation, RFLP marker development, and physical mapping

    Directory of Open Access Journals (Sweden)

    Souza Manoel T

    2008-01-01

    Full Text Available Abstract Background Many commercial banana varieties lack sources of resistance to pests and diseases, as a consequence of sterility and narrow genetic background. Fertile wild relatives, by contrast, possess greater variability and represent potential sources of disease resistance genes (R-genes. The largest known family of plant R-genes encode proteins with nucleotide-binding site (NBS and C-terminal leucine-rich repeat (LRR domains. Conserved motifs in such genes in diverse plant species offer a means for isolation of candidate genes in banana which may be involved in plant defence. Results A computational strategy was developed for unbiased conserved motif discovery in NBS and LRR domains in R-genes and homologues in monocotyledonous plant species. Degenerate PCR primers targeting conserved motifs were tested on the wild cultivar Musa acuminata subsp. burmannicoides, var. Calcutta 4, which is resistant to a number of fungal pathogens and nematodes. One hundred and seventy four resistance gene analogs (RGAs were amplified and assembled into 52 contiguous sequences. Motifs present were typical of the non-TIR NBS-LRR RGA subfamily. A phylogenetic analysis of deduced amino-acid sequences for 33 RGAs with contiguous open reading frames (ORFs, together with RGAs from Arabidopsis thaliana and Oryza sativa, grouped most Musa RGAs within monocotyledon-specific clades. RFLP-RGA markers were developed, with 12 displaying distinct polymorphisms in parentals and F1 progeny of a diploid M. acuminata mapping population. Eighty eight BAC clones were identified in M. acuminata Calcutta 4, M. acuminata Grande Naine, and M. balbisiana Pisang Klutuk Wulung BAC libraries when hybridized to two RGA probes. Multiple copy RGAs were common within BAC clones, potentially representing variation reservoirs for evolution of new R-gene specificities. Conclusion This is the first large scale analysis of NBS-LRR RGAs in M. acuminata Calcutta 4. Contig sequences were

  4. Post harvest changes of banana prata (Musa acuminata x Musa balbisiana group AAB) {gamma}-irradiated; Modificacoes pos-colheita de banana prata (Musa acuminata x Musa balbisiana grupo AAB) {gamma}-irradiada

    Energy Technology Data Exchange (ETDEWEB)

    Barros Villas Boas, Eduardo Valerio de

    1995-12-31

    Pre-climateric bananas (Musa acuminata x Musa balbisiana [AAB group] cv. Prata) were stored without treatment (no radiation) or were exposed at 0.25 and 0.50 kGy of {gamma} -irradiation, with a dose rate of 1 kGy.h {sup -1} before storage. The fruits were analysed for CO{sub 2} and ethylene production during maturation and pulp-to-peel ratio, starch, total soluble sugars, pectins, pectin methyl esterase and poly galacturonase activities on 6 colour score of peel. The radiation dose/peel-colour interaction affected the pulp-to-peel ratio significantly, while the fruits subjected at 0.25 Gy had the highest increase on the colour scores 5, 6, and 7. A predictable increase in the conversion of starch to sugar took place during maturation and a delaying on the soluble sugar accumulation was noted on the fruits submitted to 0.50 kGy, in the 6 and 7 colour scores only. A decrease on the total pectin content and a trend of a higher solubilization of pectins was observed in the fruits {gamma}-irradiated at 0.50 kGy. Higher pectin methyl esterase activities were exhibited by irradiated fruits, although the {gamma}-irradiation has suppressed the poly galacturonase activity throughout the maturation period. (author). 110 refs., 11 figs., 5 tabs.

  5. Characterization of the molluscicidal activity of Bauhinia variegata and Mimusops elengi plant extracts against the fasciola vector Lymnaea acuminata.

    Science.gov (United States)

    Singh, Kanchan Lata; Singh, D K; Singh, Vinay Kumar

    2012-01-01

    The molluscicidal activity of Bauhinia variegata leaf and Mimusops elengi bark was studied against vector snail Lymnaea acuminata. The toxicity of both plants was time and concentration-dependent. Among organic extracts, ethanol extracts of both plants were more toxic. Toxicity of B. variegata leaf ethanolic extract (96h LC50- 14.4 mg/L) was more pronounced than M. elengi bark ethanolic extract (96h LC50-15.0 mg/L). The 24h LC50 of column purified fraction of B. variegata and M. elengi bark were 20.3 mg/L and 18.3 mg/L, respectively. Saponin and quercetin were characterized and identified as active molluscicidal component. Co-migration of saponin (Rf 0.48) and quercetin (Rf 0.52) with column purified bark of M. elengi and leaf of B. variegata on thin layer chromatography demonstrate same Rf value i.e. 0.48 and 0.52, respectively. The present study clearly indicates the possibility of using M. elengi and/or B. variegata as potent molluscicide.

  6. Evaluation of physico-chemical and antioxidant properties in different varieties of banana (musa acuminata), indigenous to pakistan

    International Nuclear Information System (INIS)

    Azizuddin, A.; Ghafoor, S.; Mahmood, T.

    2014-01-01

    The antioxidant capacity, phenolic and flavonoid contents, and physico-chemical analysis on the pulp of three different varieties of Musa acuminata, were studied namely Cavendish basrai, Grand naine and Plantain, collected from Gharo, Adam Khas Kheli Road near Karachi (Pakistan). DPPH (2,2-diphenyl-1-picrylhydrazyl) radical scavenging, reducing power (RPA) and phosphomolybdenum assays were used for determination of their antioxidant capacity. Cavendish basrai characterized the highest antioxidant capacity among three varieties, DPPH (82.46 % inhibition at 0.1 mM conc.), RPA (43.59 mg/100 g) and phosphomolybdenum (38.90 mg/100 g) in methanolic extract and DPPH (67.27 % inhibition at 0.1 mM conc.), RPA (27.03 mg/100 g) and phosphomolybdenum (24.27 mg/100 g) in water extract. The phenolic (83.04 mg/100 g, 19.50 mg/100 g) and flavonoid contents (11.66 mg/100 g, 4.77 mg/100 g) were also high in Cavendish basrai in methanolic and water extracts, respectively showed the direct relation of antioxidant capacity to the phenolic and flavonoid contents, and the DPPH assay revealed more power full assay for determination of antioxidant capacity among these assays. In correlation with antioxidant capacity, Plantain showed comparatively high physico-chemical characteristics revealed high nutritional contents such as total dry matter, total sugar contents, TSS, titratable acidity and % NaCl. (author)

  7. Calcification in the staghorn coral Acropora acuminata: variations in apparent skeletal incorporation of radioisotopes due to different methods of processing

    International Nuclear Information System (INIS)

    Crossland, C.J.; Barnes, D.J.

    1977-01-01

    Pieces of branch from the staghorn coral Acropora acuminata were incubated with 45 CaCl 2 and NaH 14 CO 3 under identical conditions in the light or in the dark. Specimens were then processed in different ways. All specimens were placed in N KOH to digest tissues. Some were placed in KOH immediately after incubation; others were placed in KOH after 2 h washing, or after 2 h extraction with methanol-chloroform-water. Specimens were washed in running fresh water or running seawater; some were killed in liquid N 2 before washing. Radioactivity associated with skeleton and tissues was determined. The method of processing profoundly affected the results. In dark incubations, there was up to a four-fold difference in apparent skeletal incorporation of 45 Ca ++ between average values obtained for the different treatments. For 14 C incorporation, there was a difference of up to 2.5 times. In light incubations, skeletal incorporation of both radioisotopes showed a two-fold difference between high and low average values obtained for the different treatments. (orig.) [de

  8. Glycosidases in Brachionus plicatilis (Rotifera).

    Science.gov (United States)

    Kühle, K; Kleinow, W

    1990-01-01

    1. Tests for glycosidases were performed in homogenates of Brachionus plicatilis. 2. Hydrolytic activity was detected with the following substrates: (a) with synthetic substrates (NP = 4-nitrophenyl): NP-alpha- and NP-beta-D-glucopyranoside, NP-alpha- and NP-beta-D-galactopyranoside, NP-N-acetyl-beta-D-glucosaminide, NP-N-acetyl-beta-D-galactosaminide, NP-alpha- and NP-beta-D-mannopyranoside and NP-alpha-L-fucopyranoside; (b) with disaccharides: sucrose, maltose, trehalose, isomaltose, cellobiose, gentiobiose and lactose; (c) with polysaccharides: laminarine, carboxymethyl-cellulose, avicel, Micrococcus luteus (for lysozyme) and 4-nitrophenyl-alpha-D-maltoheptaoside (for amylase). 3. The pH dependence of the glycosidase activities was determined. 4. The distribution of enzyme activities within fractions from the homogenate was studied in order to localize them within the cell. 5. Proteins from Brachionus homogenate were separated by SDS-gel electrophoresis and the positions of the following glycosidase activities were detected by assays performed on the gels (estimated molecular weights in parentheses): alpha-glucosidase (250,000); beta-glucosidase (200,000); beta-galactosidase (70,000); N-acetyl-beta-glucosaminidase (60,000).

  9. Effects of gamma irradiation followed by climatization on the quality of 'Prata' banana (Musa acuminata x Musa balbisiana, AAB)

    International Nuclear Information System (INIS)

    Martineli, Maristella; Coneglian, Regina C.C.; Vasconcellos, Marco A.S.; Silva, Eduardo; Rocha, Janielio G.; Melo, Maruzanete P.; Vital, Helio C.

    2009-01-01

    Banana is a highly perishable climacteric fruit. In order to ensure fast and homogeneous ripening that will make its processing and commercialization easier, it is usually treated by climatization. On the other hand, irradiation is an interesting physical process capable of delaying ripening and extending the shelf life of fruits. This work investigated the competing effects of irradiation followed by climatization on the quality of 'Prata' banana (Musa acuminata x Musa balbisiana, AAB). All fruits were harvested in the preclimacteric stage, rinsed and stored at 27 deg C after being submitted to five different treatments. After hygienization, four out of five samples were exposed to gamma-ray at doses of 0.25 and 0.50 kGy. The unirradiated fruits were left for control and half of the irradiated samples were then climatized by exposure to CaC 2 . Measurements of fresh mass loss, total soluble solids, peel coloration and disease index were performed on five different dates for up to nine days in order to monitor quality and the degree of ripening. It was found that high temperatures prevailing during climatization and storage accelerated maturation in all fruits in spite of the use of irradiation, with the control becoming ripe in 3 days only. In addition, based on the consistent results from the experiments performed, it can be concluded that irradiation at the doses tested was unable to overcome the maturation effects produced by climatization. However, the sole use of irradiation with 0.25 kGy yielded the lowest figures for fresh mass loss and disease index in the samples, thus becoming the most attractive among the treatments tested. (author)

  10. Cloning of an ADP-ribosylation factor gene from banana (Musa acuminata) and its expression patterns in postharvest ripening fruit.

    Science.gov (United States)

    Wang, Yuan; Wu, Jing; Xu, Bi-Yu; Liu, Ju-Hua; Zhang, Jian-Bin; Jia, Cai-Hong; Jin, Zhi-Qiang

    2010-08-15

    A full-length cDNA encoding an ADP-ribosylation factor (ARF) from banana (Musa acuminata) fruit was cloned and named MaArf. It contains an open reading frame encoding a 181-amino-acid polypeptide. Sequence analysis showed that MaArf shared high similarity with ARF of other plant species. The genomic sequence of MaArf was also obtained using polymerase chain reaction (PCR). Sequence analysis showed that MaArf was a split gene containing five exons and four introns in genomic DNA. Reverse-transcriptase PCR was used to analyze the spatial expression of MaArf. The results showed that MaArf was expressed in all the organs examined: root, rhizome, leaf, flower and fruit. Real-time quantitative PCR was used to explore expression patterns of MaArf in postharvest banana. There was differential expression of MaArf associated with ethylene biosynthesis. In naturally ripened banana, expression of MaArf was in accordance with ethylene biosynthesis. However, in 1-methylcyclopropene-treated banana, the expression of MaArf was inhibited and changed little. When treated with ethylene, MaArf expression in banana fruit significantly increased in accordance with ethylene biosynthesis; the peak of MaArf was 3 d after harvest, 11 d earlier than for naturally ripened banana fruits. These results suggest that MaArf is induced by ethylene in regulating postharvest banana ripening. Finally, subcellular localization assays showed the MaArf protein in the cytoplasm. Copyright 2010 Elsevier GmbH. All rights reserved.

  11. A Comparative Study of Liquid Nitrogen Cryotherapy as Monotherapy versus in Combination with Podophyllin in the Treatment of Condyloma Acuminata.

    Science.gov (United States)

    Sharma, Nidhi; Sharma, Sanjeev; Singhal, Chetna

    2017-03-01

    Condyloma Acuminata (CA) is a common viral sexually transmitted disease. Although various treatment modalities are available for treating CA, but none of them can achieve 100% response rate. In a search for better response rate and less recurrence rate, the combination of cytotoxic agent Podophyllin with ablative liquid nitrogen cryotherapy was evaluated over cryotherapy alone. To evaluate the synergistic effect of Podophyllin as a chemotherapeutic adjunct to an ablative therapy of liquid nitrogen cryotherapy versus liquid nitrogen cryotherapy alone in the treatment of CA. Sixty patients with multiple CA were randomly assigned to two groups in the study. Thirty patients in group A received double freeze thaw cycle of 25 seconds of liquid nitrogen cryotherapy. Thirty patients in Group B were subjected to liquid nitrogen cryotherapy in a similar manner followed by application of not more than 0.5 ml of 25% Podophyllin solution. All patients were followed up at 1, 4, 8, 12 and 24 weeks after the treatment to monitor the response to therapy and evaluation for any recurrence. When the number of unresponsive lesions were more than 30% of original lesions at 4 weeks follow-up, then the whole procedure was repeated again. The complete response rate and the recurrence rate in the Group B in our study were comparable to Group A as the difference was statistically insignificant. But the differentiating point was that the similar results were obtained in Group B with an average1.2 sessions per patient in comparison to an average of 1.67 sessions per patient in Group A. Cryotherapy represents a simple, safe and effective regimen for the treatment of multiple CA which in combination with Podophyllin is even more effective as a single session procedure; thereby shortening the treatment regimen.

  12. Composición química y actividad antibacteriana del aceite esencial de Peperomia acuminata de los Andes venezolanos

    Directory of Open Access Journals (Sweden)

    Flor D. Mora-Vivas

    2016-12-01

    Full Text Available El género Peperomia (Piperaceae, es bien conocido por sus especies ornamentales y usos etnomedicinales. En el presente trabajo se describe la caracterización química y la actividad antibacteriana del aceite esencial de Peperomia acuminata Ruiz & Pav. proveniente del Estado Mérida Venezuela. El aceite esencial se obtuvo por hidrodestilación de las hojas y la separación de los componentes se realizó por Cromatografía de gases-Espectrometría de Masas (CG/EM. Se logró la elucidación de ocho compuestos (96,7%, siendo el 2E-dodecenal el componente mayoritario (65% seguido de dodecanal (14,8% y tetradecanal (9,2%. Esta investigación muestra el potencial del aceite esencial de P. acuminata frente a bacterias Gram positivas (Staphylococcus aureus ATCC 25923 y Enterococcus faecalis 29212, con un valor de Concentración inhibitoria mínima de 1μL/mL. Este es el primer reporte sobre la composición química del aceite esencial de esta especie, por lo tanto una contribución importante al estudio del género Peperomia.

  13. Alterations in carbohydrates and the protein metabolism of the harmful freshwater vector snail Lymnaea acuminata induced by the Euphorbia tirucalli latex extract.

    Science.gov (United States)

    Tiwari, Sudhanshu; Singh, A

    2005-11-01

    To know the short- as well as long-term effect of aqueous latex extracts of Euphorbia tirucalli on carbohydrate and protein metabolism, the snail Lymnaea acuminata was exposed to sublethal doses of 0.37 and 0.55 mg/L for a 24-h and 0.20 and 0.31 mg/L for a 96-h exposure period. Significant (P<0.05) alterations in the glycogen, pyruvate, lactate, total protein, and free amino acid level, as well as in the activity of enzyme lactic dehydrogenase, succinic dehydrogenase, cytochrome oxidase, protease, aspartate aminotransaminase, and alanine aminotransaminase were observed in the nervous, hepatopancreatic, and ovotestis tissues of the freshwater vector snail L. acuminata exposed to sublethal doses of E. tirucalli latex extract. The alterations in all biochemical parameters were significantly (P<0.05) time and dose dependent. After the 7th day of the withdrawal of treatment, there was significant (P<0.05) recovery in glycogen, pyruvate, lactate, total protein, and the free amino acid level and in the activity of the lactic dehydrogenase, succinic dehydrogenase, cytochrome oxidase, protease, aspartate aminotransaminase and alanine aminotransaminase enzymes in all three of the studied tissues of the snail, which supports the view that the plant product is safe for use as a molluscicide for the control of harmful freshwater vector snails in the aquatic environment.

  14. Caracterización de harina y almidón de frutos de banano Gros Michel (Musa acuminata AAA

    Directory of Open Access Journals (Sweden)

    Jairo Montoya-López

    2015-01-01

    Full Text Available En el estudio se determinaron las características fisicoquímicas, térmicas y reológicas de la harina y el almidón de frutos de banano Gros Michel (Musa acuminata cosechado en fincas del departamento del Quindío, Colombia. En el análisis proximal, la harina presentó un contenido de fibra de 18.82% y el almidón presentó contenidos de proteína de 1.92%, grasa de 5.3% y fibra de 2.76%. La harina presentó la temperatura más alta de absorción de calor (68.88 °C y su entalpía de gelatinización fue de 2.17 J/g; mientras que para el almidón estos valores fueron de 48.36 °C y 44.62 J/g, respectivamente. El análisis termogravimétrico (TGA de la harina o temperaturas en las cuales se registra la descomposición de carbohidratos (componentes de bajo peso molecular y polisacáridos (componentes de alto peso molecular fueron, respectivamente, de 284.51 °C y 470.42 °C; y para el almidón fueron de 307.51 °C y 500.46 °C. Los gránulos de almidón de banano tienen forma elipsoidal con un tamaño longitudinal promedio de 39.39 µm y tamaño transversal promedio de 29.47 µm. Los difractogramas de rayos X mostraron patrones de difracción tipo B. Los viscoamilogramas mostraron que para la harina la temperatura de inicio de gelatinización (Tg es de 76.3 °C, la viscosidad máxima de 1120 cP, y para el almidón la Tg fue de 70.75 °C y la viscosidad máxima de 2087 cP.

  15. Evasion of short interfering RNA-directed antiviral silencing in Musa acuminata persistently infected with six distinct banana streak pararetroviruses.

    Science.gov (United States)

    Rajeswaran, Rajendran; Seguin, Jonathan; Chabannes, Matthieu; Duroy, Pierre-Olivier; Laboureau, Nathalie; Farinelli, Laurent; Iskra-Caruana, Marie-Line; Pooggin, Mikhail M

    2014-10-01

    Vegetatively propagated crop plants often suffer from infections with persistent RNA and DNA viruses. Such viruses appear to evade the plant defenses that normally restrict viral replication and spread. The major antiviral defense mechanism is based on RNA silencing generating viral short interfering RNAs (siRNAs) that can potentially repress viral genes posttranscriptionally through RNA cleavage and transcriptionally through DNA cytosine methylation. Here we examined the RNA silencing machinery of banana plants persistently infected with six pararetroviruses after many years of vegetative propagation. Using deep sequencing, we reconstructed consensus master genomes of the viruses and characterized virus-derived and endogenous small RNAs. Consistent with the presence of endogenous siRNAs that can potentially establish and maintain DNA methylation, the banana genomic DNA was extensively methylated in both healthy and virus-infected plants. A novel class of abundant 20-nucleotide (nt) endogenous small RNAs with 5'-terminal guanosine was identified. In all virus-infected plants, 21- to 24-nt viral siRNAs accumulated at relatively high levels (up to 22% of the total small RNA population) and covered the entire circular viral DNA genomes in both orientations. The hotspots of 21-nt and 22-nt siRNAs occurred within open reading frame (ORF) I and II and the 5' portion of ORF III, while 24-nt siRNAs were more evenly distributed along the viral genome. Despite the presence of abundant viral siRNAs of different size classes, the viral DNA was largely free of cytosine methylation. Thus, the virus is able to evade siRNA-directed DNA methylation and thereby avoid transcriptional silencing. This evasion of silencing likely contributes to the persistence of pararetroviruses in banana plants. We report that DNA pararetroviruses in Musa acuminata banana plants are able to evade DNA cytosine methylation and transcriptional gene silencing, despite being targeted by the host silencing

  16. Cell-specific expression of tryptophan decarboxylase and 10-hydroxygeraniol oxidoreductase, key genes involved in camptothecin biosynthesis in Camptotheca acuminata Decne (Nyssaceae

    Directory of Open Access Journals (Sweden)

    Santamaria Anna

    2010-04-01

    Full Text Available Abstract Background Camptotheca acuminata is a major natural source of the terpenoid indole alkaloid camptothecin (CPT. At present, little is known about the cellular distribution of the biosynthesis of CPT, which would be useful knowledge for developing new strategies and technologies for improving alkaloid production. Results The pattern of CPT accumulation was compared with the expression pattern of some genes involved in CPT biosynthesis in C. acuminata [i.e., Ca-TDC1 and Ca-TDC2 (encoding for tryptophan decarboxylase and Ca-HGO (encoding for 10-hydroxygeraniol oxidoreductase]. Both CPT accumulation and gene expression were investigated in plants at different degrees of development and in plantlets subjected to drought-stress. In all organs, CPT accumulation was detected in epidermal idioblasts, in some glandular trichomes, and in groups of idioblast cells localized in parenchyma tissues. Drought-stress caused an increase in CPT accumulation and in the number of glandular trichomes containing CPT, whereas no increase in epidermal or parenchymatous idioblasts was observed. In the leaf, Ca-TDC1 expression was detected in some epidermal cells and in groups of mesophyll cells but not in glandular trichomes; in the stem, it was observed in parenchyma cells of the vascular tissue; in the root, no expression was detected. Ca-TDC2 expression was observed exclusively in leaves of plantlets subjected to drought-stress, in the same sites described for Ca-TDC1. In the leaf, Ca-HGO was detected in all chlorenchyma cells; in the stem, it was observed in the same sites described for Ca-TDC1; in the root, no expression was detected. Conclusions The finding that the sites of CPT accumulation are not consistently the same as those in which the studied genes are expressed demonstrates an organ-to-organ and cell-to-cell translocation of CPT or its precursors.

  17. Contribución al conocimiento de la biología y taxonomía de un hongo del género Phytium aislado del "aliso", Alnus acuminata HBK

    Directory of Open Access Journals (Sweden)

    Marina Correa de Restrepo

    1990-01-01

    Full Text Available Some biological aspects of an isolated fungus of Alnus acuminata roots were studied. It bas been found Tbat between OOC and 4°C tbe fungi grows fast. This condition can result in a important factor in the ecophysiology of 'Aliso' populations, that grows in secondary forests at sub-paramo, After a review of the taxonomic literature, we placed it in the Phytium genus, but not in a particular described species. We assume that it is a new species. We modificated the microculture technique that was simpler and safer and them we made direct observations about tbe fungus growtb and development. As for now it is nominated as Phytiun near Mammillatum Meurs. Palabras Claves: Phytium, bongos, A/nus acuminata HBK., "Aliso".

  18. Forestiera acuminata (Michx.)

    Science.gov (United States)

    K.F. Connor

    2004-01-01

    Swamp privet is a deciduous shrub or small, open-crowned tree, occasionally reaching 10 m in height but more often averaging 1.5 to 2.5 m. It is commonly multi-trunked. The bark ranges from gray to dark brown in color and is either smooth or ridged. Twigs are light brown, glabrous, and have conspicuous lenticels. Leaves are simple, opposite, and a dull, yellowish green...

  19. Don't camp beside the river: structure and dynamics of Andean alder (Alnus acuminata forests affected by river floods, northwestern Argentina No acampe junto al río: estructura y dinámica de bosques de aliso (Alnus acuminata del noroeste argentino afectados por crecientes de río

    Directory of Open Access Journals (Sweden)

    TOMÁS A EASDALE

    2005-12-01

    Full Text Available Alnus acuminata (Betulaceae is a pioneer tree that dominates mountain riparian forests throughout the eastern Andes. Early studies associated these forests with particular microclimatic conditions along river beds, but they were later linked to the periodical disturbance regime of mountain rivers. To understand the dynamics of these forests, we analysed tree age and spatial arrangement in two plots along Potrero river and another plot along La Horqueta river, Tucumán Province, north west Argentina. Through intensive tree coring and age reconstruction we identified similar-aged tree cohorts with maximum age ranges of eight years. Tree mapping and Moran's I spatial autocorrelation analysis showed that tree cohorts were spatially clumped, and provided further evidence that coetaneous patches of A. acuminata arise from massive regeneration following catastrophic flooding events. We tested the association between cohort initiation dates and regional maximum river discharge records by means of a randomization procedure and found weak evidence that establishment occurs after devastating floods, which eliminate previous vegetation and create bare sites suitable for A. acuminata regeneration. Dates of tree floodscars sampled along Potrero river precede by one year the most recent cohort initiation date and provide further support of this association. Although previous studies found a positive correlation between El Niño events and mean annual precipitation in northwestern Argentina, we did not detect an association between El Niño and annual maximum stream flow for rivers in Tucumán Province. Therefore, factors driving devastating floods and A. acuminata stand initiation require further studyEl aliso (Alnus acuminata, Betulaceae es un árbol pionero que domina bosques riparios de montaña en los Andes orientales. Estudios iniciales atribuyeron la presencia de estos bosques a las típicas condiciones microclimáticas de cauces de ríos, pero luego

  20. Construction and characterization of a plant transformation-competent BIBAC library of the black Sigatoka-resistant banana Musa acuminata cv. Tuu Gia (AA).

    Science.gov (United States)

    Ortiz-Vázquez, E; Kaemmer, D; Zhang, H-B; Muth, J; Rodríguez-Mendiola, M; Arias-Castro, C; James, Andrew

    2005-02-01

    A plant transformation-competent binary bacterial artificial chromosome (BIBAC) library was constructed from Musa acuminata cv. Tuu Gia (AA), a black Sigatoka-resistant diploid banana. After digestion of high-molecular-weight banana DNA by HindIII, several methods of DNA size selection were tested, followed by ligation, using a vector/insert molar ratio of 4:1. The library consists of 30,700 clones stored in 80 384-well microtiter plates. The mean insert size was estimated to be 100 kb, and the frequency of inserts with internal NotI sites was 61%. The majority of insert sizes fell into the range of 100+/-20 kb, making them suitable for Agrobacterium-mediated transformation. Only 1% and 0.9% of the clones contain chloroplast and mitochondrial DNA, respectively. This is the first BIBAC library for banana, estimated to represent five times its haploid genome (600 Mbp). It was demonstrated by hybridization that the library contains typical members of resistance gene and defense gene families that can be used for transformation of disease susceptible banana cultivars for banana genetic improvement.

  1. Dietary Administration of Banana (Musa acuminata) Peel Flour Affects the Growth, Antioxidant Status, Cytokine Responses, and Disease Susceptibility of Rohu, Labeo rohita.

    Science.gov (United States)

    Giri, Sib Sankar; Jun, Jin Woo; Sukumaran, Venkatachalam; Park, Se Chang

    2016-01-01

    To explore the feasibility of Musa acuminata (banana) peels as a feed additive, effects of banana peel flour (BPF) on the growth and immune functions of Labeo rohita were evaluated. Diets containing five different concentrations of BPF (0% [basal diet], 1% [B1], 3% [B3], 5% [B5], and 7% [B7]) were fed to the fish (average weight: 15.3 g) for 60 days. The final weight gain and specific growth rate were higher (P < 0.05) in the B5 group. The most significant improvements in immune parameters such as lysozyme, alternative complement pathway, leukocyte phagocytic, superoxide dismutase, and catalase activities were observed in the B5 group. However, the B5 group exhibited the lowest malondialdehyde activity. IgM and glutathione peroxidise activities were significantly elevated in the treatment groups, except in B1, after only 30 days of feeding. Of the examined cytokine-related genes, IL-1β, TNF-α, and HSP70 were upregulated in the head kidney and hepatopancreas, and expressions were generally higher in the B3 and B5 groups. Moreover, B5 group challenged with Aeromonas hydrophila 60 days after feeding exhibited the highest survival rate (70%; P < 0.05). These results suggest that dietary BPF at 5% could promote growth performance and strengthen immunity in L. rohita.

  2. Identification of pectenotoxins in plankton, filter feeders, and isolated cells of a Dinophysis acuminata with an atypical toxin profile, from Chile.

    Science.gov (United States)

    Blanco, Juan; Alvarez, Gonzalo; Uribe, Eduardo

    2007-04-01

    A bloom of Dinophysis acuminata produced, in autumn of 2005, a closure of the scallop harvesting in Bahía Inglesa, in the Chilean III region. Isolated cells of this Dinophysis species were shown to contain 180 pg cell(-1) of pectenotoxin 2 but neither okadaic acid nor any of its analogs or derivatives (at least at a detectable level). Examination of plankton and filter-feeder samples covering an area of ca. 350 km, from the location where the toxicity was recorded to Bahía Tongoy, showed that the unique toxin profile found in the first bloom was widespread over that part of Chile and persisted for months. The analysis were carried out by HPLC-ESI-MS using positive ionization mode, with a detection limit below 2 ng of OA mL(-1) of methanolic extract. This is the first report of the presence of pectenotoxins in the plankton of the Pacific coast of America and in the studied filter feeders. This is also the first report of a Dinophysis species containing pectenotoxins and not any toxin of the okadaic acid group.

  3. Chlorophyllin Bait Formulation and Exposure to Different Spectrum of Visible Light on the Reproduction of Infected/Uninfected Snail Lymnaea acuminata

    Directory of Open Access Journals (Sweden)

    Navneet Kumar

    2016-01-01

    Full Text Available Fasciolosis is a waterborne disease, caused by Fasciola species. Snail Lymnaea acuminata is an intermediate host of these flukes. Control of snail population is major tool in reducing the incidences. Variation in light intensity and wavelength caused significant changes in reproduction pattern of snails. Maximum fecundity was noted with bait containing carbohydrate (starch, 468 ± 0.10/20 snails or amino acid (serine, 319 ± 0.29/20 snails as attractant. Sublethal feeding of chlorophyllin bait with starch or serine attractant to infected and uninfected snails caused significant reduction in fecundity, hatchability, and survivability. These significant changes are observed in snails exposed to different spectral band of visible light and sunlight. Maximum fecundity of 536 ± 2.0 and minimum of 89.3 ± 0.4 were noted in snails not fed with bait and exposed to sunlight and red spectral band, respectively. There was complete arrest in the fecundity of infected and uninfected snails and no survivability of uninfected snails after 48 h feeding with bait containing chlorophyllin + attractant. Minimum hatchability (9.25 ± 0.5 was noted in red light exposed, chlorophyllin + starch fed infected snails and hatching period of bait fed snails was prolonged. Conclusively, chlorophyllin bait and red light reduce reproduction capacity in snails.

  4. Dietary Administration of Banana (Musa acuminata Peel Flour Affects the Growth, Antioxidant Status, Cytokine Responses, and Disease Susceptibility of Rohu, Labeo rohita

    Directory of Open Access Journals (Sweden)

    Sib Sankar Giri

    2016-01-01

    Full Text Available To explore the feasibility of Musa acuminata (banana peels as a feed additive, effects of banana peel flour (BPF on the growth and immune functions of Labeo rohita were evaluated. Diets containing five different concentrations of BPF (0% [basal diet], 1% [B1], 3% [B3], 5% [B5], and 7% [B7] were fed to the fish (average weight: 15.3 g for 60 days. The final weight gain and specific growth rate were higher (P<0.05 in the B5 group. The most significant improvements in immune parameters such as lysozyme, alternative complement pathway, leukocyte phagocytic, superoxide dismutase, and catalase activities were observed in the B5 group. However, the B5 group exhibited the lowest malondialdehyde activity. IgM and glutathione peroxidise activities were significantly elevated in the treatment groups, except in B1, after only 30 days of feeding. Of the examined cytokine-related genes, IL-1β, TNF-α, and HSP70 were upregulated in the head kidney and hepatopancreas, and expressions were generally higher in the B3 and B5 groups. Moreover, B5 group challenged with Aeromonas hydrophila 60 days after feeding exhibited the highest survival rate (70%; P<0.05. These results suggest that dietary BPF at 5% could promote growth performance and strengthen immunity in L. rohita.

  5. Expansion of banana (Musa acuminata) gene families involved in ethylene biosynthesis and signalling after lineage-specific whole-genome duplications.

    Science.gov (United States)

    Jourda, Cyril; Cardi, Céline; Mbéguié-A-Mbéguié, Didier; Bocs, Stéphanie; Garsmeur, Olivier; D'Hont, Angélique; Yahiaoui, Nabila

    2014-05-01

    Whole-genome duplications (WGDs) are widespread in plants, and three lineage-specific WGDs occurred in the banana (Musa acuminata) genome. Here, we analysed the impact of WGDs on the evolution of banana gene families involved in ethylene biosynthesis and signalling, a key pathway for banana fruit ripening. Banana ethylene pathway genes were identified using comparative genomics approaches and their duplication modes and expression profiles were analysed. Seven out of 10 banana ethylene gene families evolved through WGD and four of them (1-aminocyclopropane-1-carboxylate synthase (ACS), ethylene-insensitive 3-like (EIL), ethylene-insensitive 3-binding F-box (EBF) and ethylene response factor (ERF)) were preferentially retained. Banana orthologues of AtEIN3 and AtEIL1, two major genes for ethylene signalling in Arabidopsis, were particularly expanded. This expansion was paralleled by that of EBF genes which are responsible for control of EIL protein levels. Gene expression profiles in banana fruits suggested functional redundancy for several MaEBF and MaEIL genes derived from WGD and subfunctionalization for some of them. We propose that EIL and EBF genes were co-retained after WGD in banana to maintain balanced control of EIL protein levels and thus avoid detrimental effects of constitutive ethylene signalling. In the course of evolution, subfunctionalization was favoured to promote finer control of ethylene signalling. © 2014 CIRAD New Phytologist © 2014 New Phytologist Trust.

  6. Efecto del medio de soporte en la estabilidad biológica de dos cepas de Frankia aisladas de Alnus acuminata H. B. K.

    Directory of Open Access Journals (Sweden)

    Ana María Rey

    Full Text Available Alnus acuminata H. B. K. es una especie arbórea que puede ser incorporada en sistemas silvopastoriles, ya que tiene la capacidad de crecer en suelos marginados y contribuir a la conservación de la biodiversidad y al mejoramiento del suelo; lo cual se relaciona con la incorporación de hojarasca, el efecto de sombra, la retención de humedad, el reciclaje de nutrientes y la fijación de nitrógeno atmosférico, debido a su asociación simbiótica con el actinomiceto Frankia. La utilización de este como inoculante es una tecnología que requiere un profundo análisis de su comportamiento en condiciones controladas. Por otra parte, para la comercialización de los biofertilizantes es importante conservar su calidad el mayor tiempo posible, de lo cual depende la aceptación del producto en la cadena productiva. Por ello, se realizó una investigación con el objetivo de evaluar la estabilidad biológica de las cepas nativas de Frankia (Aan17 y Aac49 con diferentes proporciones sustrato:cepa, así como el efecto del alamacenamiento a 4 °C. Las cepas fueron tolerantes a los cambios del pH y al almacenamiento en condiciones de refrigeración. Se concluye que los inoculantes se deben almacenar a 4 °C durante 120 días, con una proporción de 80:20 (inoculante:sustrato en Aan17 y 60:40 en Aac49. En estos sustratos la proteína microbial se mantuvo por encima de 0,65 mg/mL en Aan17 y 0,7 mg/mL en Aac49.

  7. Ripening of fruits of 'Dwarf Prata' banana (Musa acuminata x Musa balbisiana, AAB group)irradiated and treated with calcium carbide

    Energy Technology Data Exchange (ETDEWEB)

    Martineli, Maristella [Instituto de Quimica. Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil); Coneglian, Regina C.C.; Vasconcellos, Marco A.S.; Silva, Eduardo, E-mail: rccconeg@ufrrj.br, E-mail: masv@ufrrj.br [Departamento de Fitotecnia. Instituto de Agronomia. Universidade Federal Rural do Rio de Janeiro (UFRRJ), Seropedica, RJ (Brazil); Vital, Helio C., E-mail: vital@ctex.eb.br [Secao de Defesa Nuclear. Divisao de Defesa Quimica, Biologica e Nuclear. Centro Tecnologico do Exercito (CTEx), Guaratiba, Rio de Janeiro, RJ (Brazil)

    2011-07-01

    The competing effects resulting from the exposure of fruits of 'warf prata' banana (Musa acuminata x Musa balbisiana, AAB group) to gamma radiation and to calcium carbide have been investigated in this work. The fruits were harvested in a pre-climateric stage (green colored though physiologically developed) in the city of Jaiba, state of Minas Gerais, and gamma irradiated with doses of 0.25 or 0.50 kGy in a research irradiating facility at the Brazilian Army Technology Center (CTEx) in the city of Rio de Janeiro. Some samples were also exposed to calcium carbide for 32 hours in order to accelerate ripening. Quantitative estimates of peel color, disease index and fresh mass loss were performed for 9 days while the fruits were kept at an average temperature of 23 deg C. The analyses were performed in the Federal Rural University of Rio de Janeiro, located in the city of Seropedica. The following treatments or combination of processes have been tested: untreated (control); treated only with irradiation with doses of 0.25 kGy or 0.50 kGy; treated with irradiation with doses of 0.25 kGy or 0.50 kGy and then exposed to calcium carbide. The fruits treated solely with irradiation with 0.25 kGy exhibited a better response during the first days of storage, although their initial green coloration vanished with time. In addition, the fungi Colletotrichum musae and Lasidioplodia theobroma were detected in samples submitted to the combination of both processes. In contrast, such fungi were not observed in fruits that had only been exposed to 0.25 kGy and exhibited low disease indices. Also, 1-2 cm lesions were detected on fruits.(author)

  8. Ripening of fruits of 'Dwarf Prata' banana (Musa acuminata x Musa balbisiana, AAB group)irradiated and treated with calcium carbide

    International Nuclear Information System (INIS)

    Martineli, Maristella; Coneglian, Regina C.C.; Vasconcellos, Marco A.S.; Silva, Eduardo; Vital, Helio C.

    2011-01-01

    The competing effects resulting from the exposure of fruits of 'warf prata' banana (Musa acuminata x Musa balbisiana, AAB group) to gamma radiation and to calcium carbide have been investigated in this work. The fruits were harvested in a pre-climateric stage (green colored though physiologically developed) in the city of Jaiba, state of Minas Gerais, and gamma irradiated with doses of 0.25 or 0.50 kGy in a research irradiating facility at the Brazilian Army Technology Center (CTEx) in the city of Rio de Janeiro. Some samples were also exposed to calcium carbide for 32 hours in order to accelerate ripening. Quantitative estimates of peel color, disease index and fresh mass loss were performed for 9 days while the fruits were kept at an average temperature of 23 deg C. The analyses were performed in the Federal Rural University of Rio de Janeiro, located in the city of Seropedica. The following treatments or combination of processes have been tested: untreated (control); treated only with irradiation with doses of 0.25 kGy or 0.50 kGy; treated with irradiation with doses of 0.25 kGy or 0.50 kGy and then exposed to calcium carbide. The fruits treated solely with irradiation with 0.25 kGy exhibited a better response during the first days of storage, although their initial green coloration vanished with time. In addition, the fungi Colletotrichum musae and Lasidioplodia theobroma were detected in samples submitted to the combination of both processes. In contrast, such fungi were not observed in fruits that had only been exposed to 0.25 kGy and exhibited low disease indices. Also, 1-2 cm lesions were detected on fruits.(author)

  9. Effects of gamma irradiation followed by climatization on the quality of 'Prata' banana (Musa acuminata x Musa balbisiana, AAB)

    Energy Technology Data Exchange (ETDEWEB)

    Martineli, Maristella; Coneglian, Regina C.C.; Vasconcellos, Marco A.S.; Silva, Eduardo; Rocha, Janielio G.; Melo, Maruzanete P. [Universidade Federal Rural do Rio de Janeiro (UFRRJ), Seropedica, RJ. Inst. de Agronomia (Brazil)], e-mail: maristellamartineli@yahoo.com.br; Vital, Helio C. [Centro Tecnologico do Exercito (CTEx), Rio de Janeiro, RJ (Brazil). Secao de Defesa Nuclear], e-mail: vital@ctex.eb.br

    2009-07-01

    Banana is a highly perishable climacteric fruit. In order to ensure fast and homogeneous ripening that will make its processing and commercialization easier, it is usually treated by climatization. On the other hand, irradiation is an interesting physical process capable of delaying ripening and extending the shelf life of fruits. This work investigated the competing effects of irradiation followed by climatization on the quality of 'Prata' banana (Musa acuminata x Musa balbisiana, AAB). All fruits were harvested in the preclimacteric stage, rinsed and stored at 27 deg C after being submitted to five different treatments. After hygienization, four out of five samples were exposed to gamma-ray at doses of 0.25 and 0.50 kGy. The unirradiated fruits were left for control and half of the irradiated samples were then climatized by exposure to CaC{sub 2}. Measurements of fresh mass loss, total soluble solids, peel coloration and disease index were performed on five different dates for up to nine days in order to monitor quality and the degree of ripening. It was found that high temperatures prevailing during climatization and storage accelerated maturation in all fruits in spite of the use of irradiation, with the control becoming ripe in 3 days only. In addition, based on the consistent results from the experiments performed, it can be concluded that irradiation at the doses tested was unable to overcome the maturation effects produced by climatization. However, the sole use of irradiation with 0.25 kGy yielded the lowest figures for fresh mass loss and disease index in the samples, thus becoming the most attractive among the treatments tested. (author)

  10. The transcriptional regulatory network mediated by banana (Musa acuminata) dehydration-responsive element binding (MaDREB) transcription factors in fruit ripening.

    Science.gov (United States)

    Kuang, Jian-Fei; Chen, Jian-Ye; Liu, Xun-Cheng; Han, Yan-Chao; Xiao, Yun-Yi; Shan, Wei; Tang, Yang; Wu, Ke-Qiang; He, Jun-Xian; Lu, Wang-Jin

    2017-04-01

    Fruit ripening is a complex, genetically programmed process involving the action of critical transcription factors (TFs). Despite the established significance of dehydration-responsive element binding (DREB) TFs in plant abiotic stress responses, the involvement of DREBs in fruit ripening is yet to be determined. Here, we identified four genes encoding ripening-regulated DREB TFs in banana (Musa acuminata), MaDREB1, MaDREB2, MaDREB3, and MaDREB4, and demonstrated that they play regulatory roles in fruit ripening. We showed that MaDREB1-MaDREB4 are nucleus-localized, induced by ethylene and encompass transcriptional activation activities. We performed a genome-wide chromatin immunoprecipitation and high-throughput sequencing (ChIP-Seq) experiment for MaDREB2 and identified 697 genomic regions as potential targets of MaDREB2. MaDREB2 binds to hundreds of loci with diverse functions and its binding sites are distributed in the promoter regions proximal to the transcriptional start site (TSS). Most of the MaDREB2-binding targets contain the conserved (A/G)CC(G/C)AC motif and MaDREB2 appears to directly regulate the expression of a number of genes involved in fruit ripening. In combination with transcriptome profiling (RNA sequencing) data, our results indicate that MaDREB2 may serve as both transcriptional activator and repressor during banana fruit ripening. In conclusion, our study suggests a hierarchical regulatory model of fruit ripening in banana and that the MaDREB TFs may act as transcriptional regulators in the regulatory network. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  11. A Ser/Thr protein kinase phosphorylates MA-ACS1 (Musa acuminata 1-aminocyclopropane-1-carboxylic acid synthase 1) during banana fruit ripening.

    Science.gov (United States)

    Choudhury, Swarup Roy; Roy, Sujit; Sengupta, Dibyendu N

    2012-08-01

    1-Aminocyclopropane-1-carboxylic acid synthase (ACS) catalyzes the rate-limiting step in ethylene biosynthesis during ripening. ACS isozymes are regulated both transcriptionally and post-translationally. However, in banana, an important climacteric fruit, little is known about post-translational regulation of ACS. Here, we report the post-translational modification of MA-ACS1 (Musa acuminata ACS1), a ripening inducible isozyme in the ACS family, which plays a key role in ethylene biosynthesis during banana fruit ripening. Immunoprecipitation analyses of phospholabeled protein extracts from banana fruit using affinity-purified anti-MA-ACS1 antibody have revealed phosphorylation of MA-ACS1, particularly in ripe fruit tissue. We have identified the induction of a 41-kDa protein kinase activity in pulp at the onset of ripening. The 41-kDa protein kinase has been identified as a putative protein kinase by MALDI-TOF/MS analysis. Biochemical analyses using partially purified protein kinase fraction from banana fruit have identified the protein kinase as a Ser/Thr family of protein kinase and its possible involvement in MA-ACS1 phosphorylation during ripening. In vitro phosphorylation analyses using synthetic peptides and site-directed mutagenized recombinant MA-ACS1 have revealed that serine 476 and 479 residues at the C-terminal region of MA-ACS1 are phosphorylated. Overall, this study provides important novel evidence for in vivo phosphorylation of MA-ACS1 at the molecular level as a possible mechanism of post-translational regulation of this key regulatory protein in ethylene signaling pathway in banana fruit during ripening.

  12. Identification and expression analysis of four 14-3-3 genes during fruit ripening in banana (Musa acuminata L. AAA group, cv. Brazilian).

    Science.gov (United States)

    Li, Mei-Ying; Xu, Bi-Yu; Liu, Ju-Hua; Yang, Xiao-Liang; Zhang, Jian-Bin; Jia, Cai-Hong; Ren, Li-Cheng; Jin, Zhi-Qiang

    2012-02-01

    To investigate the regulation of 14-3-3 proteins in banana (Musa acuminata L. AAA group, cv. Brazilian) fruit postharvest ripening, four cDNAs encoding 14-3-3 proteins were isolated from banana and designated as Ma-14-3-3a, Ma-14-3-3c, Ma-14-3-3e, and Ma-14-3-3i, respectively. Amino acid sequence alignment showed that the four 14-3-3 proteins shared a highly conserved core structure and variable C-terminal as well as N-terminal regions with 14-3-3 proteins from other plant species. Phylogenetic analysis revealed that the four 14-3-3 genes belong to the non-ε groups. They were differentially and specifically expressed in various tissues. Real-time RT-PCR analysis indicated that these four genes function differentially during banana fruit postharvest ripening. Three genes, Ma-14-3-3a, Ma-14-3-3c, and Ma-14-3-3e, were significantly induced by exogenous ethylene treatment. However, gene function differed in naturally ripened fruits. Ethylene could induce Ma-14-3-3c expression during postharvest ripening, but expression patterns of Ma-14-3-3a and Ma-14-3-3e suggest that these two genes appear to be involved in regulating ethylene biosynthesis during fruit ripening. No obvious relationship emerged between Ma-14-3-3i expression in naturally ripened and 1-MCP (1-methylcyclopropene)-treated fruit groups during fruit ripening. These results indicate that the 14-3-3 proteins might be involved in various regulatory processes of banana fruit ripening. Further studies will mainly focus on revealing the detailed biological mechanisms of these four 14-3-3 genes in regulating banana fruit postharvest ripening.

  13. Activation of salicylic acid metabolism and signal transduction can enhance resistance to Fusarium wilt in banana (Musa acuminata L. AAA group, cv. Cavendish).

    Science.gov (United States)

    Wang, Zhuo; Jia, Caihong; Li, Jingyang; Huang, Suzhen; Xu, Biyu; Jin, Zhiqiang

    2015-01-01

    Fusarium wilt caused by the fungus Fusarium oxysporum f. sp. cubens (Foc) is the most serious disease that attacks banana plants. Salicylic acid (SA) can play a key role in plant-microbe interactions. Our study is the first to examine the role of SA in conferring resistance to Foc TR4 in banana (Musa acuminata L. AAA group, cv. Cavendish), which is the greatest commercial importance cultivar in Musa. We used quantitative real-time reverse polymerase chain reaction (qRT-PCR) to analyze the expression profiles of 45 genes related to SA biosynthesis and downstream signaling pathways in a susceptible banana cultivar (cv. Cavendish) and a resistant banana cultivar (cv. Nongke No. 1) inoculated with Foc TR4. The expression of genes involved in SA biosynthesis and downstream signaling pathways was suppressed in a susceptible cultivar and activated in a resistant cultivar. The SA levels in each treatment arm were measured using high-performance liquid chromatography. SA levels were decreased in the susceptible cultivar and increased in the resistant cultivar. Finally, we examined the contribution of exogenous SA to Foc TR4 resistance in susceptible banana plants. The expression of genes involved in SA biosynthesis and signal transduction pathways as well as SA levels were significantly increased. The results suggest that one reason for banana susceptibility to Foc TR4 is that expression of genes involved in SA biosynthesis and SA levels are suppressed and that the induced resistance observed in banana against Foc TR4 might be a case of salicylic acid-dependent systemic acquired resistance.

  14. Development of an Ionic Liquid-Based Ultrasonic/Microwave-Assisted Simultaneous Distillation and Extraction Method for Separation of Camptothecin, 10-Hydroxycamptothecin, Vincoside-Lactam, and Essential Oils from the Fruits of Camptotheca acuminata Decne

    Directory of Open Access Journals (Sweden)

    Chunjian Zhao

    2016-10-01

    Full Text Available An ionic liquid-based ultrasonic/microwave-assisted simultaneous distillation and extraction (IL-UMASDE method for isolating camptothecin (CPT, 10-hydroxycamptothecin (HCPT, vincoside-lactam (VCS-LT, and essential oils (EOs from Camptotheca acuminata Decne fruits was developed. The important parameters were optimized using single-factor and central composite design experiments. The optimum conditions were 0.75 M 1-octyl-3-methylimidazolium ([C8mim]Br as the extraction solvent, a liquid–solid ratio of 13.7 mL/g, an extraction time of 33.2 min, a microwave power of 582 W, and a fixed ultrasonic power of 50 W. The yields of CPT, HCPT, and VCS-LT obtained under the optimum conditions were 2.463, 0.164, and 0.297 mg/g, respectively; these are 1.08-, 1.12-, and 1.04-fold higher, respectively, than those obtained by conventional 55% ethanol heat reflux extraction (HRE. The extraction time for the equilibrium yields of CPT, HCPT and VCS-LT using IL-UMASDE was 33.6%, 58.5%, 63.1%, and 66.8%, respectively, less than the corresponding times using IL-MASDE, IL-ultrasonic-assisted extraction (IL-UAE, 55% ethanol UAE and 55% ethanol HRE. The yield of EOs obtained using IL-UMASDE was 0.793 mg/g, i.e., 1.31-fold higher than that obtained by conventional hydrodistillation extraction (HDE. The components of the EOs obtained using IL-UMASDE and HDE were similar. The extraction time for the equilibrium yields of EOs using IL-UMASDE is 33.6%, 58.5%, 52.6%, and 72.3% lower than those for IL-MASDE, water-UMASDE, water-MASDE, and HDE, respectively. Compared with other extraction methods, IL-UMASDE gave the highest yields of CPT, HCPT, VCS-LT, and EOs and also had the shortest extraction time. IL-UMASDE is a potential green and highly efficient technique for the extraction of CPT, HCPT, VCS-LT, and EOs from Camptotheca acuminata Decne fruits.

  15. Biodiversity and community structure of zooplankton in the Sub-basin of Rio Poxim, Sergipe, Brazil

    Directory of Open Access Journals (Sweden)

    Eliane Maria de Souza Nogueira

    2011-08-01

    Full Text Available The zooplankton of aquatic environments is composed mostly of protozoans, rotifers, cladocerans and copepods, which play an important role in the food chain, transferring mass and energy from primary producers to higher trophic levels. This work was prepared with the objective of contributing to the knowledge of zooplankton biodiversity that occurs in the Sub-basin of Rio Poxim. Water samples were taken at monthly intervals at four sampling stations located along the sub-basin in the period August 2009 to July 2010. To obtain the zooplankton community, 100 L of water were filtered on nylon net with an aperture of 50 mm. Were identified 72 taxa distributed in the following taxonomic categories Rotifera, Protozoa, Porifera, Nematoda, Anellida, Cladocera, Copepoda, Ostracoda, Isopoda and Insecta. In terms of species richness, the phylum Rotifera followed by the Protoctista were the most relevant with forty and fifteen taxa, respectively. The most representative taxa in numerical terms were Arcella vulgaris, Notholca sp. Rotary sp. and nematodes. Regarding the community diversity index, the community was characterized as low diversity, but the taxa were distributed evenly in all monitoring points.

  16. High efficiency transformation of banana [Musa acuminata L. cv. Matti (AA)] for enhanced tolerance to salt and drought stress through overexpression of a peanut salinity-induced pathogenesis-related class 10 protein.

    Science.gov (United States)

    Rustagi, Anjana; Jain, Shalu; Kumar, Deepak; Shekhar, Shashi; Jain, Mukesh; Bhat, Vishnu; Sarin, Neera Bhalla

    2015-01-01

    Bananas and plantains (Musa spp. L.) are important subsistence crops and premium export commodity in several countries, and susceptible to a wide range of environmental and biotic stress conditions. Here, we report efficient, rapid, and reproducible Agrobacterium-mediated transformation and regeneration of an Indian niche cultivar of banana [M. acuminata cv. Matti (AA)]. Apical meristem-derived highly proliferative multiple shoot clump (MSC) explants were transformed with the Agrobacterium strain EHA105 harboring a binary vector pCAMBIA-1301 carrying hptII and uidA. Sequential agro-infiltration (10 min, 400 mmHg), infection (additional 35 min, Agrobacterium density A 600 = 0.8) and co-cultivation (18 h) regimen in 100 µM acetosyringone containing liquid medium were critical factors yielding high transformation efficiency (~81 %) corroborated by transient GUS expression assay. Stable transgenic events were recovered following two cycles of meristem initiation and selection on hygromycin containing medium. Histochemical GUS assay in several tissues of transgenic plants and molecular analyses confirmed stable integration and expression of transgene. The protocol described here allowed recovery of well-established putative transgenic plantlets in as little as 5 months. The transgenic banana plants could be readily acclimatized under greenhouse conditions, and were phenotypically similar to the wild-type untransformed control plants (WT). Transgenic plants overexpressing Salinity-Induced Pathogenesis-Related class 10 protein gene from Arachis hypogaea (AhSIPR10) in banana cv. Matti (AA) showed better photosynthetic efficiency and less membrane damage (P < 0.05) in the presence of NaCl and mannitol in comparison to WT plants suggesting the role of AhSIPR10 in better tolerance of salt stress and drought conditions.

  17. Identification, transcriptional and functional analysis of heat-shock protein 90s in banana (Musa acuminata L.) highlight their novel role in melatonin-mediated plant response to Fusarium wilt.

    Science.gov (United States)

    Wei, Yunxie; Hu, Wei; Wang, Qiannan; Zeng, Hongqiu; Li, Xiaolin; Yan, Yu; Reiter, Russel J; He, Chaozu; Shi, Haitao

    2017-01-01

    As one popular fresh fruit, banana (Musa acuminata) is cultivated in the world's subtropical and tropical areas. In recent years, pathogen Fusarium oxysporum f. sp. cubense (Foc) has been widely and rapidly spread to banana cultivated areas, causing substantial yield loss. However, the molecular mechanism of banana response to Foc remains unclear, and functional identification of disease-related genes is also very limited. In this study, nine 90 kDa heat-shock proteins (HSP90s) were genomewide identified. Moreover, the expression profile of them in different organs, developmental stages, and in response to abiotic and fungal pathogen Foc were systematically analyzed. Notably, we found that the transcripts of 9 MaHSP90s were commonly regulated by melatonin (N-acetyl-5-methoxytryptamine) and Foc infection. Further studies showed that exogenous application of melatonin improved banana resistance to Fusarium wilt, but the effect was lost when cotreated with HSP90 inhibitor (geldanamycin, GDA). Moreover, melatonin and GDA had opposite effect on auxin level in response to Foc4, while melatonin and GDA cotreated plants had no significant effect, suggesting the involvement of MaHSP90s in the cross talk of melatonin and auxin in response to fungal infection. Taken together, this study demonstrated that MaHSP90s are essential for melatonin-mediated plant response to Fusarium wilt, which extends our understanding the putative roles of MaHSP90s as well as melatonin in the biological control of banana Fusarium wilt. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  18. Effects of hot-water extract of banana (Musa acuminata) fruit's peel on the antibacterial activity, and anti-hypothermal stress, immune responses and disease resistance of the giant freshwater prawn, Macrobrachium rosenbegii.

    Science.gov (United States)

    Rattanavichai, Wutti; Cheng, Winton

    2014-08-01

    The hot-extracts isolated from fruit's peel of banana, Musa acuminata, was evaluated on the antibacterial activity to pathogens from aquatic animals, and immunostimulating potential, disease resistance and anti-hypothermal stress in giant freshwater prawn, Macrobrachium rosenbergii through injection administration. The banana peel extract (BPE) showed good activity against 1 Gram-positive and 3 Gram-negative pathogens, including Lactococcus garvieae, Photobacteria damsella, Vibrio alginolyticus and Vibrio parahemolyticus especially in prawn pathogen of L. garvieae strain, which were carried out by a disk diffusion method. Prawn received BPE via injection administration at 1-6 μg (g prawn)(-1) significantly increased total haemocyte count (THC), hyaline cell (HC), granular cell (GC), phenoloxidase (PO) activity and phagocytic activity against L. garvieae from 3 to 6 days, and significantly increased clearance efficiency against L. garvieae and a significantly decreased coagulation time of prawn from 1 to 6 days. Prawn injected with BPE at 6.0 μg (g prawn)(-1) for 6 days showed significantly increased superoxide dismutase (SOD) activity, but significantly decreased respiratory bursts (RBs) of per haemocyte. Survival rates of M. rosenbergii injected with BPE at concentrations of 1, 3 and 6 μg (g prawn)(-1) were significantly higher than those injected with saline control after challenge with L. garvieae for 4-6 days, and the respective relative survival percentages of prawn were 28.6%, 38.1%, and 47.8%, respectively at 6 days. The sublethal time of prawns that had received saline and BPE at 1, 3 and 6 μg (g prawn)(-1) for 6 days and then were transferred from 28 °C to 14 °C were 69.4, 79.8, 83.6, and 90.2 h, respectively. It was concluded that the BPE can be used as the bacteriostat, and immunostimulant and physiological regulator for prawn through injection administration to enhance immunity, physiological responses, and resistance against L. garvieae

  19. EFECTO DE LA ADICIÓN DE CAL A PLANTACIONES DE JAÚL (Alnus acuminata EN ANDISOLES DE LA CUENCA ALTA DEL RÍO VIRILLA, COSTA RICA

    Directory of Open Access Journals (Sweden)

    Marlon Salazar

    2011-01-01

    Full Text Available Con el propósito de evaluar el impacto de adicionar cal a plantaciones de jaúl (Alnus acuminata (H.B.K. O. Kuntze en Andisoles de la cuenca alta del río Virilla, Costa Rica, se realizó el presente trabajo en 2 localidades: 1 Finca Hospicio: Ubicada en la localidad de Vista de Mar, cantón de Goicoechea, a una altitud de 1542 msmn; el suelo se clasificó como Typic Udivitrands y la plantación se estableció en el 2002. 2 Finca Dorval: Ubicada en la localidad de Las Nubes, cantón de Vásquez de Coronado, a una altitud de 1925 msnm; el suelo se clasificó como Thaptic Udivitrands y la plantación se estableció en 1997. Los tratamientos aplicados fueron 0 (testigo, 750, 1500 y 2250 kg.ha-1 de carbonato de calcio y magnesio (Dolomita, 1500 kg.ha-1 de carbonato de calcio (Calcita y 1500 kg.ha-1 de sulfato de calcio (Yeso. Se midieron el diámetro a la altura del pecho (DAP a 1,3 m, la altura total de los árboles (m y se estimó el volumen (V mediante la formula: V(m3=2,71828¿10,0557+ln(d*2,0369+0,9277 18*ln(h propuesta por Segura et al. (2005, en la cual d es el DAP en cm y h es la altura total en m. Al comparar las mediciones del diámetro a la altura del pecho, incremento medio anual en diámetro (IMA-DAP, altura total, incremento medio anual en altura (IMA-ALT, volumen total e incremento en volumen total, por dosis y fuentes de cal aplicada, se observó que ningún tratamiento causó diferencias estadísticas, en estas variables en ninguna de las 2 fincas comparadas ni entre épocas de medición. La adición de fuentes y niveles de cal no afectó significativamente las variables diámetro, altura y volumen. La falta de respuesta a las diferentes enmiendas comparadas demuestra que el suelo proporcionó suficiente Ca, Mg y S para asegurar el crecimiento óptimo del jaúl. Tampoco se encontró que los suelos mostraran problemas de acidez de magnitud tal que afectaran negativamente el crecimiento del jaúl.

  20. A method for efficient extraction of rotifers (Rotifera) from soils

    Czech Academy of Sciences Publication Activity Database

    Devetter, Miloslav

    2010-01-01

    Roč. 53, č. 2 (2010), s. 115-118 ISSN 0031-4056 R&D Projects: GA ČR(CZ) GP206/06/P405 Institutional research plan: CEZ:AV0Z60660521 Keywords : soil rotifers * Bdelloids * quantitative extraction Subject RIV: EH - Ecology, Behaviour Impact factor: 1.474, year: 2010

  1. Genetic determinants of mate recognition in Brachionus manjavacas (Rotifera

    Directory of Open Access Journals (Sweden)

    Kubanek Julia

    2009-09-01

    Full Text Available Abstract Background Mate choice is of central importance to most animals, influencing population structure, speciation, and ultimately the survival of a species. Mating behavior of male brachionid rotifers is triggered by the product of a chemosensory gene, a glycoprotein on the body surface of females called the mate recognition pheromone. The mate recognition pheromone has been biochemically characterized, but little was known about the gene(s. We describe the isolation and characterization of the mate recognition pheromone gene through protein purification, N-terminal amino acid sequence determination, identification of the mate recognition pheromone gene from a cDNA library, sequencing, and RNAi knockdown to confirm the functional role of the mate recognition pheromone gene in rotifer mating. Results A 29 kD protein capable of eliciting rotifer male circling was isolated by high-performance liquid chromatography. Two transcript types containing the N-terminal sequence were identified in a cDNA library; further characterization by screening a genomic library and by polymerase chain reaction revealed two genes belonging to each type. Each gene begins with a signal peptide region followed by nearly perfect repeats of an 87 to 92 codon motif with no codons between repeats and the final motif prematurely terminated by the stop codon. The two Type A genes contain four and seven repeats and the two Type B genes contain three and five repeats, respectively. Only the Type B gene with three repeats encodes a peptide with a molecular weight of 29 kD. Each repeat of the Type B gene products contains three asparagines as potential sites for N-glycosylation; there are no asparagines in the Type A genes. RNAi with Type A double-stranded RNA did not result in less circling than in the phosphate-buffered saline control, but transfection with Type B double-stranded RNA significantly reduced male circling by 17%. The very low divergence between repeat units, even at synonymous positions, suggests that the repeats are kept nearly identical through a process of concerted evolution. Information-rich molecules like surface glycoproteins are well adapted for chemical communication and aquatic animals may have evolved signaling systems based on these compounds, whereas insects use cuticular hydrocarbons. Conclusion Owing to its critical role in mating, the mate recognition pheromone gene will be a useful molecular marker for exploring the mechanisms and rates of selection and the evolution of reproductive isolation and speciation using rotifers as a model system. The phylogenetic variation in the mate recognition pheromone gene can now be studied in conjunction with the large amount of ecological and population genetic data being gathered for the Brachionus plicatilis species complex to understand better the evolutionary drivers of cryptic speciation.

  2. [Rhodomonas salina (Cryptophyta) pastes as feed for Brachionus plicatilis (Rotifera)].

    Science.gov (United States)

    Guevara, Miguel; Bastardo, Leandro; Cortez, Roraysi; Arredondo-Vega, Bertha; Romero, Lolymar; Gómez, Patricia

    2011-12-01

    Rotifers are an important live feed for first feeding larvae of many fish species. The use of concentrated algae cells in the mass culture of the rotifer Brachionus plicatilis (Brachionidae) has opened new horizons for research on this organism. Pastes of Rhodomonas salina (Pyrenomonadaceae) obtained either by centrifugation or flocculation with chitosan were preserved, with or without vitamin C, at -20 degrees C for four weeks and were evaluated biochemically (proteins, lipids, pigments and fatty acids contents) and subsequently, were used to feed the rotifer Brachionus plicatilis at a ratio of 25 mg/L/day. Four different microalgae pastes were prepared: (1) centrifuged and preserved with vitamin C (CV), (2) centrifuged and preserved without vitamin C (C), (3) flocculated and with vitamin C (FV) and (4) flocculated without vitamin C (F). All treatments showed similar contents of proteins and total lipids with respect to control culture (a fresh culture of R. salina), with mean values of 40.0 +/- 2.32% and 12.0 +/- 1.45%, respectively. The pheophytin a/chlorophyll a ratio, a general indicator of the chemical status of microalgal concentrates, was similar (0.09-0.11) between centrifuged pastes and control culture, but was found to be higher in flocculated pastes (1.28-1.48). The fatty acid profile varied with respect to the control culture, mainly in the proportion of the essential polyunsaturated fatty acids (PUFAs): eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA). Total PUFAs, EPA and DHA contents were statistically similar between centrifuged pastes and control culture (PUFAs: 47%, EPA: 4% and DHA: 4.7%), whereas values obtained for flocculated pastes were significantly lower. The rotifers grew equally well when fed with centrifuged pastes or control culture (maximum density: 320 rotifers/mL; instantaneous growth rate: 0.23 rotifers/day, fecundity: 1.49 eggs/female and productivity: 43 x 10(3) rotifers/L/day. No significant effect of vitamin C was found when used as a paste preservative. We concluded that centrifugation is an effective harvesting method, and that freezing to -20 degrees C for four weeks (no vitamin added), may help maintain the nutritional quality of R. salina paste, similar to fresh microalgae and can be offered to Brachionus plicatilis.

  3. Genetic determinants of mate recognition in Brachionus manjavacas (Rotifera).

    Science.gov (United States)

    Snell, Terry W; Shearer, Tonya L; Smith, Hilary A; Kubanek, Julia; Gribble, Kristin E; Welch, David B Mark

    2009-09-09

    Mate choice is of central importance to most animals, influencing population structure, speciation, and ultimately the survival of a species. Mating behavior of male brachionid rotifers is triggered by the product of a chemosensory gene, a glycoprotein on the body surface of females called the mate recognition pheromone. The mate recognition pheromone has been biochemically characterized, but little was known about the gene(s). We describe the isolation and characterization of the mate recognition pheromone gene through protein purification, N-terminal amino acid sequence determination, identification of the mate recognition pheromone gene from a cDNA library, sequencing, and RNAi knockdown to confirm the functional role of the mate recognition pheromone gene in rotifer mating. A 29 kD protein capable of eliciting rotifer male circling was isolated by high-performance liquid chromatography. Two transcript types containing the N-terminal sequence were identified in a cDNA library; further characterization by screening a genomic library and by polymerase chain reaction revealed two genes belonging to each type. Each gene begins with a signal peptide region followed by nearly perfect repeats of an 87 to 92 codon motif with no codons between repeats and the final motif prematurely terminated by the stop codon. The two Type A genes contain four and seven repeats and the two Type B genes contain three and five repeats, respectively. Only the Type B gene with three repeats encodes a peptide with a molecular weight of 29 kD. Each repeat of the Type B gene products contains three asparagines as potential sites for N-glycosylation; there are no asparagines in the Type A genes. RNAi with Type A double-stranded RNA did not result in less circling than in the phosphate-buffered saline control, but transfection with Type B double-stranded RNA significantly reduced male circling by 17%. The very low divergence between repeat units, even at synonymous positions, suggests that the repeats are kept nearly identical through a process of concerted evolution. Information-rich molecules like surface glycoproteins are well adapted for chemical communication and aquatic animals may have evolved signaling systems based on these compounds, whereas insects use cuticular hydrocarbons. Owing to its critical role in mating, the mate recognition pheromone gene will be a useful molecular marker for exploring the mechanisms and rates of selection and the evolution of reproductive isolation and speciation using rotifers as a model system. The phylogenetic variation in the mate recognition pheromone gene can now be studied in conjunction with the large amount of ecological and population genetic data being gathered for the Brachionus plicatilis species complex to understand better the evolutionary drivers of cryptic speciation.

  4. Plant Guide: Tapertip hawksbeard (Crepis acuminata Nutt.)

    Science.gov (United States)

    Derek Tilley; Scott Jensen; Loren St. John

    2012-01-01

    Tapertip hawksbeard leaves are consumed by pre-laying sage grouse hens and make up a large portion of their diet (Barnett and Crawford, 1994). Sage grouse chicks also feed on tapertip hawksbeard leaves in addition to the insects attracted by the flowers (Drut and others, 1994; Klebenow and Gray, 1968).

  5. Genetic diversity among natural populations of Ottelia acuminata ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-11-16

    Nov 16, 2009 ... is essential for establishing effective and efficient conser- vation and breeding ... overlaid with 40 µl mineral oil. Amplifications were .... Diversity for Nineteen Populations of Pinus sibirica Du Tour with. Technique of ISSR.

  6. Protective role of Spondias mombin leaf and Cola acuminata seed ...

    African Journals Online (AJOL)

    Ismail O. Ishola

    2017-04-06

    Apr 6, 2017 ... the mashed leaves with lemon is effective for worms in children and believed to ..... 3.4. Y-maze test. The effects of SM and CA on short-term or working memory ..... cantly ameliorated the deficit in long-term memory induced.

  7. Novel method of wine production from banana ( Musa acuminata ...

    African Journals Online (AJOL)

    Pumpkin leaves (Telfaria occidentalis) macerate was added to group 1 and 2 to obtain substrate : leaves : water ratio of 1.5:0.02:3.0 (kg w/v). The mixture was boiled after 18 h at 100°C for 30 min and the filtrates obtained (1.8 ± 0.2 L) was inoculated with 1.0 ml of x 109 cfu/ml of Saccharomyces cerevisiae var. ellipsoides ...

  8. Genetic diversity among natural populations of Ottelia acuminata ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-11-16

    Nov 16, 2009 ... A total number of 120 O. acuminate accessions were analyzed, by amplification of their DNAs with 15 ... mortar and pestle. The powder was transferred to a 25 ml sterile. Falcon tube with 10 ml of CTAB buffer. The extraction buffer con- sisted of 2% (w/v) CTAB (cetyltrimethyl ammonium bromide,. Sigma), 1.5 ...

  9. Evaluation of the suspending properties of Cola acuminata gum on ...

    African Journals Online (AJOL)

    Calamine suspensions were formulated with CAG between the concentration range of 1 – 4 % w/v and compared with suspensions formulated with two standard suspending agents (tragacanth and acacia gums). Sedimentation volume, flow rate, rheology and redispersibility were used as evaluating parameters.

  10. Pastas de Rhodomonas salina (Cryptophyta como alimento para Brachionus plicatilis (Rotifera

    Directory of Open Access Journals (Sweden)

    Miguel Guevara

    2011-12-01

    Full Text Available Pastas de Rhodomonas salina, obtenidas mediante centrifugación y floculación con quitosano y preservadas con o sin vitamina C, a -20°C fueron evaluadas bioquímicamente y proporcionadas como alimento al rotífero Brachionus plicatilis. Las pastas microalgales: (1 centrifugada y con vitamina C (CV, (2 centrifugada y sin vitamina C (C, (3 floculada y con vitamina C (FV y (4 floculada y sin adición de vitamina C (F; mantuvieron sus contenidos de proteínas y lípidos totales similares al cultivo control, con valores de 40.0±2.32% y 12.0±1.45%, respectivamente. La relación feofitina a/clorofila a fue similar (0.09-0.11 entre las pastas centrifugadas y el cultivo control, pero mayor en las pastas floculadas (1.28-1.48. Las pastas centrifugadas presentaron porcentajes de PUFAs totales, EPA y DHA similares al cultivo control (PUFAs: 47%, EPA: 4% y DHA: 4.7% y superiores al de las pastas floculadas. Las pastas obtenidas por centrifugación indujeron un crecimiento del rotífero igual al obtenido con el alimento control (densidad máxima: 320rotíferos/mL; tasa instantánea de crecimiento: 0.23rotíferos/día, fecundidad: 1.49huevos/ hembra y productividad: 43x103rotíferos/L/día. Se concluye que la pasta de R. salina centrifugada y congelada a -20°C, durante cuatro semanas, sin adición de vitamina C, mantiene su calidad nutricional similar a la del alga fresca y puede ser usada como alimento de Brachionus plicatilis.

  11. Rates of Filtration and Ingestion of a Microalga by Philodina roseola (Rotifera: Bdelloidea

    Directory of Open Access Journals (Sweden)

    Raquel Aparecida Moreira

    2016-05-01

    Full Text Available Rotifers play an important role in biogeochemical cycles and organic productivity of freshwater ecosystems due to their high metabolic rates. Information on filter feeding, their main process of energy acquisition, are relevant and still scarce for tropical regions. The rotifers of the class Bdelloidea feed by filtration or scraping consuming small food items, such as bacteria, algae, yeasts or particulate organic matter. We know little of their role in the trophic dynamics in the habitats they occupy and so the aim of this study was to quantify laboratory filtration and ingestion rates of the rotifer Philodina roseola, fed with Raphidocelis subcapitata. The experiment consisted of 10 adult exposure treatment at five concentrations approximately in the range between 104 and 107 cells mL-1, at the temperature of 25 ± 1 °C. The experiments lasted one hour and initial and final concentrations of the algal suspensions were determined by counting the number of cells in a Neubauer chamber. There were no significant differences between the initial and final concentrations of cells in the control group indicating that algal growth did not occur. Philodina roseola filtration rates varied between 0.09 and 0.25 mL ind-1 h-1. Given that filtration is the main process of energy acquisition by Philodina roseola, as well as for most other rotifers, and that it comprises important issues related to trophic dynamics of aquatic ecosystems, additional experimental information is especially important and need to be extended to other types of food and combinations of experimental conditions.

  12. Diversity and distribution of Brachionidae (Rotifera in Thailand, with a key to the species

    Directory of Open Access Journals (Sweden)

    Sujeephon Athibai

    2013-08-01

    Full Text Available We investigated the diversity of brachionid rotifers in Thailand. Rotifers were collected from a wide range of habitat types (294 sites, 508 samples including canals, lakes, peat swamps, ponds, reservoirs, rice fields, rivers, swamps and temporary ponds from April 1998 to January 2004. Twenty-eight species including 11 infrasubspecific forms belonging to five genera were identified. The most frequently encountered species was Brachionus falcatus (50.7% of the sampling sites, followed by Keratella cochlearis (50%, B. angularis (49.7%, K. tropica (46.3% and B. forficula (45.9%. Less frequently encountered species were B. caudatus, B. durgae and B. urceolaris. These species were found in low abundances and only in a single site. Two sites in the Northeast – Nong Changpeuak and Bueng Srithat – recorded the greatest richness with 15 taxa, whereas no brachionid rotifers were found in 31 sites. On average, the species richness was five taxa per sampling site. A key to the genera and species of Thai brachionid rotifers is provided.

  13. Bioconcentration and localization of lead in the freshwater rotifer Brachionus calyciflorus Pallas 1677 (Rotifera: Monogononta)

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado-Flores, Jesus, E-mail: jalvaflo@hotmail.com [Universidad Autonoma de Aguascalientes, Centro de Ciencias Basicas, Departamento de Quimica, Avenida Universidad 940, Aguascalientes, Ags., CP 20131 (Mexico); Rico-Martinez, Roberto, E-mail: rrico@correo.uaa.mx [Universidad Autonoma de Aguascalientes, Centro de Ciencias Basicas, Departamento de Quimica, Avenida Universidad 940, Aguascalientes, Ags., CP 20131 (Mexico); Ventura-Juarez, Javier, E-mail: jventur@correo.uaa.mx [Universidad Autonoma de Aguascalientes, Centro de Ciencias Basicas, Departamento de Morfologia, Avenida Universidad 940, Aguascalientes, Ags., CP 20131 (Mexico); Silva-Briano, Marcelo, E-mail: msilva@correo.uaa.mx [Universidad Autonoma de Aguascalientes, Centro de Ciencias Basicas, Departamento de Biologia, Avenida Universidad 940, Aguascalientes, Ags., CP 20131 (Mexico); Rubio-Franchini, Isidoro, E-mail: rubio_reyes@hotmail.com [Instituto de Servicios de Salud del Estado de Aguascalientes, Laboratorio Estatal de Salud Publica, Av. Siglo XXI 105, Ciudad Satelite Morelos, C.P. 20270, Aguascalientes, Ags. (Mexico)

    2012-03-15

    We studied how lead is bioconcentrated and distributed in the rotifer Brachionus calyciflorus using metal histochemistry to locate lead granules, Leadmium Green{sup Registered-Sign} analysis to establish the route of uptake, atomic absorption to determined the bioconcentration factor (BCF), and detected the presence of microelements in the cuticle by X-ray microanalysis with scanning electron microscopy. Our results indicate: (a) the digestive system is the main route of lead uptake in the rotifer B. calyciflorus, (b) after 24-h lead is deposited in granules in the mastax and vitellarium, (c) our energy-dispersive X-ray microanalysis indicates decalcification taking place in the cuticle of the rotifer after a 24-h lead exposure, and (d) we determined a BCF = 115 for lead after a 24 h exposure. However, the route of mobilization and storage of intracellular lead are still not fully understood in B. calyciflorus.

  14. Genome size evolution at the speciation level: the cryptic species complex Brachionus plicatilis (Rotifera).

    Science.gov (United States)

    Stelzer, Claus-Peter; Riss, Simone; Stadler, Peter

    2011-04-07

    Studies on genome size variation in animals are rarely done at lower taxonomic levels, e.g., slightly above/below the species level. Yet, such variation might provide important clues on the tempo and mode of genome size evolution. In this study we used the flow-cytometry method to study the evolution of genome size in the rotifer Brachionus plicatilis, a cryptic species complex consisting of at least 14 closely related species. We found an unexpectedly high variation in this species complex, with genome sizes ranging approximately seven-fold (haploid '1C' genome sizes: 0.056-0.416 pg). Most of this variation (67%) could be ascribed to the major clades of the species complex, i.e. clades that are well separated according to most species definitions. However, we also found substantial variation (32%) at lower taxonomic levels--within and among genealogical species--and, interestingly, among species pairs that are not completely reproductively isolated. In one genealogical species, called B. 'Austria', we found greatly enlarged genome sizes that could roughly be approximated as multiples of the genomes of its closest relatives, which suggests that whole-genome duplications have occurred early during separation of this lineage. Overall, genome size was significantly correlated to egg size and body size, even though the latter became non-significant after controlling for phylogenetic non-independence. Our study suggests that substantial genome size variation can build up early during speciation, potentially even among isolated populations. An alternative, but not mutually exclusive interpretation might be that reproductive isolation tends to build up unusually slow in this species complex.

  15. Isolation and purification of glutathione S-transferases from Brachionus plicatilis and B. calyciflorus (Rotifera).

    Science.gov (United States)

    Bowman, B P; Snell, T W; Cochrane, B J

    1990-01-01

    1. The enzyme glutathione S-transferase (GST), a critical element in xenobiotic metabolism, was isolated from the marine rotifer Brachionus plicatilis and its freshwater congener B. calyciflorus. 2. In B. plicatilis, GST comprised 4.2% of cytosolic protein and was present as three separate isozymes with mol. wts 30,000, 31,400 and 33,700. Specific activity of crude homogenates was 56 nmol min-1 mg-1 protein, while that of affinity chromatography purified GST was 1850. 3. In B. calyciflorus, GST was present as two isozymes with mol. wts of 26,300 and 28,500, representing 1.0% of cytosolic protein. Crude GST specific activity was 1750 nmol min-1 mg-1 protein and purified was 72,400. 4. Rotifer GSTs are unusual because they are monomers whereas all other animals thus far investigated posses dimeric GSTs.

  16. Genome size evolution at the speciation level: The cryptic species complex Brachionus plicatilis (Rotifera

    Directory of Open Access Journals (Sweden)

    Riss Simone

    2011-04-01

    Full Text Available Abstract Background Studies on genome size variation in animals are rarely done at lower taxonomic levels, e.g., slightly above/below the species level. Yet, such variation might provide important clues on the tempo and mode of genome size evolution. In this study we used the flow-cytometry method to study the evolution of genome size in the rotifer Brachionus plicatilis, a cryptic species complex consisting of at least 14 closely related species. Results We found an unexpectedly high variation in this species complex, with genome sizes ranging approximately seven-fold (haploid '1C' genome sizes: 0.056-0.416 pg. Most of this variation (67% could be ascribed to the major clades of the species complex, i.e. clades that are well separated according to most species definitions. However, we also found substantial variation (32% at lower taxonomic levels - within and among genealogical species - and, interestingly, among species pairs that are not completely reproductively isolated. In one genealogical species, called B. 'Austria', we found greatly enlarged genome sizes that could roughly be approximated as multiples of the genomes of its closest relatives, which suggests that whole-genome duplications have occurred early during separation of this lineage. Overall, genome size was significantly correlated to egg size and body size, even though the latter became non-significant after controlling for phylogenetic non-independence. Conclusions Our study suggests that substantial genome size variation can build up early during speciation, potentially even among isolated populations. An alternative, but not mutually exclusive interpretation might be that reproductive isolation tends to build up unusually slow in this species complex.

  17. Complete mitochondrial genome of the monogonont rotifer, Brachionus koreanus (Rotifera, Brachionidae).

    Science.gov (United States)

    Hwang, Dae-Sik; Suga, Koushirou; Sakakura, Yoshitaka; Park, Heum Gi; Hagiwara, Atsushi; Rhee, Jae-Sung; Lee, Jae-Seong

    2014-02-01

    The complete mitochondrial genome was obtained from the assembled genome data sequenced by next generation sequencing (NGS) technology from the monogonont rotifer Brachionus koreanus. The mitochondrial genome of B. koreanus was composed of two circular chromosomes designated as mtDNA-I (10,421 bp) and mtDNA-II (11,923 bp). The gene contents of B. koreanus were identical with previously reported B. plicatilis mitochondrial genomes. However, gene orders of B. koreanus showed one rearrangement between the two species. Of 12 protein-coding genes (PCGs), 3 genes (ATP6, ND1, and ND3) had an incomplete stop codon. The A + T base composition of B. koreanus mitochondrial genome was high (68.81%). They also showed anti-G bias (12.03% and 10.97%) on the second and third position of PCGs as well as slight anti-C bias (15.96% and 14.31%) on the first and third position of PCGs.

  18. Rapid toxicity assessment using an in vivo enzyme test for Brachionus plicatilis (Rotifera).

    Science.gov (United States)

    Moffat, B D; Snell, T W

    1995-02-01

    A 1-hr in vivo enzyme inhibition assay based on esterase activity has good potential for marine toxicity assessment. A test was developed for the rotifer Brachionus plicatilis based on the nonfluorescent substrate fluorescein diacetate (FDA), which is metabolized by esterases to a fluorescent product. Enzyme inhibition, as determined by reduced fluorescence, can be scored visually or quantified using a fluorometer. Quantification of fluorescence permits the calculation of NOEC, LOEC, chronic value, and IC20. The 1-hr esterase inhibition test has sensitivity comparable to that of 24-hr rotifer acute tests for several compounds. The toxicity of six compounds was examined using the quantified assay. The resulting IC20s were within a factor of 3 of the 24-hour LC50s. IC20 values ranged from 0.017 mg/l for tributyltin to 3.1 mg/l for zinc, with an average coefficient of variation of 17.8%. Electrophoretic analysis of rotifer homogenates suggested that a single C esterase (acetylesterase) was responsible for FDA metabolism in B. plicatilis. Several other aquatic species are capable of metabolizing FDA, including Brachionus calyciflorus, Mysidopsis bahia, Menidia beryllina, Pimephales promelas, Ceriodaphnia dubia, Daphnia pulex, Artemia salina, and Ophryotrocha sp. The esterase inhibition test is an attractive tool for assessing aquatic toxicity because of its speed, simplicity, sensitivity, and applicability to a broad range of aquatic species.

  19. A novel adhering junction in the apical ciliary apparatus of the rotifer Brachionus plicatilis (Rotifera, Monogononta).

    Science.gov (United States)

    Dallai, R; Lupetti, P; Lane, N J

    1996-10-01

    Cultures of the rotifer Brachionus plicatilis were examined with regard to their interepithelial junctions after infiltration with the extracellular tracer lanthanum, freeze-fracturing or quick-freeze deep-etching. The lateral borders between ciliated cells have an unusual apical adhering junction. This apical part of their intercellular cleft looks desmosome-like, but it is characterized by unusual intramembranous E-face clusters of particles. Deep-etching reveals that these are packed together in short rows which lie parallel to one another in orderly arrays. The true membrane surface in these areas features filaments in the form of short ribbons; these are produced by projections, possibly part of the glycocalyx, emerging from the membranes, between which the electron-dense tracer lanthanum permeates. These projections appear to overlap with each other in the centre of the intercellular cleft; this would provide a particularly flexible adaptation to maintain cell-cell contact and coordination as a consequence. The filamentous ribbons may be held in position by the intramembranous particle arrays since both have a similar size and distribution. These contacts are quite different from desmosomes and appear to represent a distinct new category of adhesive cell-cell junction. Beneath these novel structures, conventional pleated septate junctions are found, exhibiting the undulating intercellular ribbons typical of this junctional type, as well as the usual parallel alignments of intramembranous rows of EF grooves and PF particles. Below these are found gap junctions as close-packed plaques of intramembranous particles on either the P-face or E-face. After freeze-fracturing, the complementary fracture face to the particles shows pits, usually on the P-face, arrayed with a very precise hexagonal pattern.

  20. Reduced expression of exocytotic proteins caused by anti-cholinesterase pesticides in Brachionus calyciflorus (Rotifera: Monogononta

    Directory of Open Access Journals (Sweden)

    IA Pérez-Legaspi

    Full Text Available AbstractThe organophosphate and carbamate pesticides methyl-parathion and carbaryl have a common action mechanism: they inhibit acetylcholinesterase enzyme by blocking the transmission of nerve impulses. However, they can alter the expression of exocytotic membrane proteins (SNARE, by modifying release of neurotransmitters and other substances. This study evaluated the adverse effects of the pesticides methyl-parathion and carbaryl on expression of SNARE proteins: Syntaxin-1, Syntaxin-4 and SNAP-23 in freshwater rotifer Brachionus calyciflorus. Protein expression of these three proteins was analyzed before and after exposure to these two pesticides by Western Blot. The expression of Syntaxin-1, Syntaxin-4 and SNAP-23 proteins in B. calyciflorussignificantly decreases with increasing concentration of either pesticides. This suggests that organophosphates and carbamates have adverse effects on expression of membrane proteins of exocytosis by altering the recognition, docking and fusion of presynaptic and vesicular membranes involved in exocytosis of neurotransmitters. Our results demonstrate that the neurotoxic effect of anticholinesterase pesticides influences the interaction of syntaxins and SNAP-25 and the proper assembly of the SNARE complex.

  1. Bioconcentration and localization of lead in the freshwater rotifer Brachionus calyciflorus Pallas 1677 (Rotifera: Monogononta)

    International Nuclear Information System (INIS)

    Alvarado-Flores, Jesús; Rico-Martínez, Roberto; Ventura-Juárez, Javier; Silva-Briano, Marcelo; Rubio-Franchini, Isidoro

    2012-01-01

    We studied how lead is bioconcentrated and distributed in the rotifer Brachionus calyciflorus using metal histochemistry to locate lead granules, Leadmium Green ® analysis to establish the route of uptake, atomic absorption to determined the bioconcentration factor (BCF), and detected the presence of microelements in the cuticle by X-ray microanalysis with scanning electron microscopy. Our results indicate: (a) the digestive system is the main route of lead uptake in the rotifer B. calyciflorus, (b) after 24-h lead is deposited in granules in the mastax and vitellarium, (c) our energy-dispersive X-ray microanalysis indicates decalcification taking place in the cuticle of the rotifer after a 24-h lead exposure, and (d) we determined a BCF = 115 for lead after a 24 h exposure. However, the route of mobilization and storage of intracellular lead are still not fully understood in B. calyciflorus.

  2. Joint inhibition of TOR and JNK pathways interacts to extend the lifespan of Brachionus manjavacas (Rotifera).

    Science.gov (United States)

    Snell, Terry W; Johnston, Rachel K; Rabeneck, Brett; Zipperer, Cody; Teat, Stephanie

    2014-04-01

    The TOR kinase pathway is central in modulating aging in a variety of animal models. The target of rapamycin (TOR) integrates a complex network of signals from growth conditions, nutrient availability, energy status, and physiological stresses and matches an organism's growth rate to the resource environment. Important remaining problems are the identification of the pathways that interact with TOR and their characterization as additive or synergistic. One of the most versatile stress sensors in metazoans is the Jun-N-terminal kinase (JNK) signaling pathway. JNK is an evolutionarily conserved stress-activated protein kinase that is induced by a range of stressors, including UV irradiation, reactive oxygen species, DNA damage, heat, and bacterial antigens. JNK is thought to interact with the TOR pathway, but its effects on TOR are poorly understood. We used the rotifer Brachionus manjavacas as a model animal to probe the regulation of TOR and JNK pathways and explore their interaction. The effect of various chemical inhibitors was examined in life table and stressor challenge experiments. A survey of 12 inhibitors revealed two, rapamycin and JNK inhibitor, that significantly extended lifespan of B. manjavacas. At 1 μM concentration, exposure to rapamycin or JNK inhibitor extended mean rotifer lifespan by 35% and maximum lifespan by 37%. Exposure to both rapamycin and JNK inhibitor simultaneously extended mean rotifer lifespan by 65% more than either alone. Exposure to a combination of rapamycin and JNK inhibitors conveyed greater protection to starvation, UV and osmotic stress than either inhibitor alone. RNAi knockdown of TOR and JNK gene expression was investigated for its ability to extend rotifer lifespan. RNAi knockdown of the TOR gene resulted in 29% extension of the mean lifespan compared to control and knockdown of the JNK gene resulted in 51% mean lifespan extension. In addition to the lifespan, we quantified mitochondria activity using the fluorescent marker MitoTracker and lysosome activity using LysoTracker. Treatment of rotifers with JNK inhibitor enhanced mitochondria activity nearly 3-fold, whereas rapamycin treatment had no significant effect. Treatment of rotifers with rapamycin or JNK inhibitor reduced lysosome activity in 1, 3 and 8 day old animals, but treatment with both inhibitors did not produce any additive effect. We conclude that inhibition of TOR and JNK pathways significantly extends the lifespan of B. manjavacas. These pathways interact so that inhibition of both simultaneously acts additively to extend rotifer lifespan more than the inhibition of either alone. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.

  3. Effect of three food types on the population growth of Brachionus calyciflorus and Brachionus patulus (Rotifera: Brachionidae

    Directory of Open Access Journals (Sweden)

    S.S.S. Sarma

    2001-03-01

    Full Text Available We compared the population growth of B. calyciflorus and B. patulus using the green alga Chlorella vulgaris, baker’s yeast Saccharomyces cerevisiae or their mixture in equal proportions as food. Food was offered once every 24 h in two concentrations (low: 1x10(6 and high: 3x10(6 ind. ml-1 separately for each species. The experiments were terminated after 15 days. In general, at any food type or concentration, B. patulus reached a higher population density. A diet of Chlorella alone supported a higher population growth of both rotifer species than yeast alone. B. calyciflorus and B. patulus achieved highest population densities (103+8 ind. ml-1 and 296+20 ind. ml-1, respectively on a diet of Chlorella at 3x10(6 ind. ml-1. When cultured using the mixture of Chlorella and yeast, the maximal population densities of B. calyciflorus were lower than those grown on Chlorella. Under similar conditions, the maximal abundance values of B. patulus were comparable in both food types. Regardless of food type and density the rate of population increase per day (r for B. calyciflorus varied from 0.13+0.03 to 0.63+0.04. These values for B. patulus ranged from 0.19+0.01 to 0.37+0.01. The results indicated that even though Chlorella was a superior foof for the tested rotifers, yeast can be effectively used at low concentrations to supplement algal requirements in rotifer culture systems.Se comparó el crecimiento poblacional de dos especies planctónicas (B. calyciflorus y B. patulus desarrolladas con el alga verde Chlorella vulgaris, la levadura de cerveza Saccharomyces cerevisiae y la mezcla de ambas dietas en proporciones iguales. B. patulus alcanzó las mayores densidades con cualquier tipo de alimento utilizado en comparación con B. calyciflorus. La dieta a base de Chlorella vulgaris sola promovió el mayor crecimiento poblacional en relación con la dieta de levadura sola. B. calyciflorus y B. patulus alcanzaron las mayores densidades de 103+8 ind. ml-1 y 296+20 ind. ml-1, respectivamente, con la dieta de Chlorella en 3x10(6 células ml-1. En condiciones similares, los valores máximos de abundancia de B. patulus fueron semejantes para ambos tipos de alimento. La tasa de incremento poblacional por día (r para B. calyciflorus vario de 0.13+0.03 a 0.63+0.04, sin importar el tipo y densidad de alimento. Los resultados indican que la dieta a base de Chlorella fue mejor para los rotíferos considerados, y que la levadura puede usarse de manera efectiva a concentraciones bajas para complementar los requerimientos algales del sistema de cultivo de rotíferos.

  4. Effect of crude extracts from cyanobacterial blooms in Lake Texcoco (Mexico) on the population growth of Brachionus calyciflorus (Rotifera).

    Science.gov (United States)

    Barrios, Cesar Alejandro Zamora; Nandini, S; Sarma, S S S

    2017-12-01

    Unlike temperate regions, tropical ecosystems are characterized by high temperatures (>18 °C) all year, promoting blooms of cyanobacteria which often produce secondary metabolites toxic to zooplankton. Nabor Carillo and the Recreational Lake are part of the saline, Lake Texcoco, in Central Mexico which is filled nowadays with treated waste water. Both water bodies are dominated by Planktothrix, Anabaenopsis, Spirulina and Microcystis. In this study we present the concentration of microcystins in these waterbodies over an annual cycle. We also evaluated the chronic effects of cyanobacterial crude extracts from both lakes on two clones of the rotifer Brachionus calyciflorus, one from Nabor Carrillo Lake and the other from a canal in the shallow, Lake Xochimilco. The experiments on population growth were performed, beginning with 10 individuals per container for each of the following treatments: control (no crude extract), concentrated crude extract, and diluted crude extract (50:50) with moderately hard water and Chlorella vulgaris in a concentration of 0.5 × 10 6  cells ml -1 . The cyanotoxin levels were measured using an ELISA test and ranged between 0.20 and 2.4 μg L -1 in the lake water. The results showed that the Recreational Lake extracts were more toxic, killing the rotifers in less than five days. The r values ranged from -1.74 to 0.48 in the presence of the crude extracts and 0.16 and 0.24 in the controls. The results have been discussed with emphasis on the importance of conducting regular studies to test ecotoxicological impacts of cyanobacterial blooms in tropical waters. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Synergistic toxicity of Macondo crude oil and dispersant Corexit 9500A(®) to the Brachionus plicatilis species complex (Rotifera).

    Science.gov (United States)

    Rico-Martínez, Roberto; Snell, Terry W; Shearer, Tonya L

    2013-02-01

    Using the marine rotifer Brachionus plicatilis acute toxicity tests, we estimated the toxicity of Corexit 9500A(®), propylene glycol, and Macondo oil. Ratios of 1:10, 1:50 and 1:130 for Corexit 9500A(®):Macondo oil mixture represent: maximum exposure concentrations, recommended ratios for deploying Corexit (1:10-1:50), 1:130 the actual dispersant:oil ratio used in the Deep Water Horizon spill. Corexit 9500A(®) and oil are similar in their toxicity. However, when Corexit 9500A(®) and oil are mixed, toxicity to B. manjavacas increases up to 52-fold. Extrapolating these results to the oil released by the Macondo well, suggests underestimation of increased toxicity from Corexit application. We found small differences in sensitivity among species of the B. plicatilis species complex, likely reflecting phylogenetic similarity. Just 2.6% of the water-accommodated fraction of oil inhibited rotifer cyst hatching by 50%, an ecologically significant result because rotifer cyst in sediments are critical resources for the recolonization of populations each Spring. Copyright © 2012 Elsevier Ltd. All rights reserved.

  6. Synergistic toxicity of Macondo crude oil and dispersant Corexit 9500A® to the Brachionus plicatilis species complex (Rotifera)

    International Nuclear Information System (INIS)

    Rico-Martínez, Roberto; Snell, Terry W.; Shearer, Tonya L.

    2013-01-01

    Using the marine rotifer Brachionus plicatilis acute toxicity tests, we estimated the toxicity of Corexit 9500A ® , propylene glycol, and Macondo oil. Ratios of 1:10, 1:50 and 1:130 for Corexit 9500A ® :Macondo oil mixture represent: maximum exposure concentrations, recommended ratios for deploying Corexit (1:10–1:50), 1:130 the actual dispersant:oil ratio used in the Deep Water Horizon spill. Corexit 9500A ® and oil are similar in their toxicity. However, when Corexit 9500A ® and oil are mixed, toxicity to B. manjavacas increases up to 52-fold. Extrapolating these results to the oil released by the Macondo well, suggests underestimation of increased toxicity from Corexit application. We found small differences in sensitivity among species of the B. plicatilis species complex, likely reflecting phylogenetic similarity. Just 2.6% of the water-accommodated fraction of oil inhibited rotifer cyst hatching by 50%, an ecologically significant result because rotifer cyst in sediments are critical resources for the recolonization of populations each Spring. - Highlights: ► We determined LC50's of Corexit 9500A ® , propylene glycol, and oil to B. plicatilis. ► Corexit 9500A ® and oil are equivalent in toxicity. ► When Corexit 9500A ® and oil are mixed, toxicity increases 52-fold to B. plicatilis. ► Results suggest underestimation of increased toxicity due to Corexit application. ► Sensitivity differences are small among species of the B. plicatilis species complex. - Using Brachionus plicatilis acute toxicity tests we estimated Corexit 9500A ® and oil toxicity. When these compounds are mixed a 52-fold increase in toxicity was observed.

  7. Population dynamics of Brachionus calyciflorus (Rotifera: Brachionidae in waste water from food-processing industry in Mexico

    Directory of Open Access Journals (Sweden)

    Raymundo Alfredo Arévalo Stevenson

    1998-09-01

    Full Text Available Waste water from Mexico's largest food processing industrial sector (based on maize, nejayote water was used for growing Brachionus calyciflorus isolated from Lake Chapultepec in the Federal District of Mexico (D.F.. Nejayote water was collected from Colonia Providencia, D.F. Experiments were conducted at 25°C in 25 ml capacity vials with 20 ml of medium into which we introduced B. calyciflorus at an initial density of 1 ind ml-1. The experimental design consisted a total of 33 test vessels (2 food combinations X 5 densities X 3 replicates = 30 plus 3 replicates as controls that contained only algae. Experiments were terminated after day 16. Waste water in original concentration did nt rotifes. However, when diluted to 5 oncentrations (ranging from 2% to 32% and pH adjusted to 7.0, rotifer density increased with increasing concentration of waste water. Green algae (at constant density of 2 X 10 6 cells-1 of Chlorella in combination with waste water resulted in a higher abundance of rotifers only at higher concentration (above 8 % of waste water. The maximum peak density of rotifers (238-50 ind ml -1 was obtained at 16% dilution of waste water nd with addition of Chlorella. The rate of population increase per day ® (mean-SD varied from 0.355-0.059 to 0.457-0.048 depending on food combination and concetration.Se usó aguas de desecho de la industria de la masa y la tortilla (aguas de nixtamal o nejayote para crecer rotíferos de agua dulce, Brachionus calyciflorus. El nejayote sin dilución no permitió el desarrollo del rotífero. Sin embargo, cuando se diluyó, B. calyciflorus aprovechó la materia orgánica. El agua de desecho por sí misma (sin alimento algal adicional fue comparable al agua con densidades del alga Chlorella de 2 X 10(6 células ml-1. Concentraciones de nejayote por encima del 8% no permitieron el crecimiento poblacional. Sin embargo, la presencia de alga permitió el desarrollo del rotífero a concentraciones de 8% y 16%. Nuestros hallazgos indican que el nejayote puedo ser utilizado de manera efectiva para la producción de rotíferos a gran escala para la acuacultura.

  8. Population dynamics of Brachionus calyciflorus (Rotifera: Brachionidae) in waste water from food-processing industry in Mexico

    OpenAIRE

    Arévalo Stevenson, Raymundo Alfredo; Sarma, S.S.S.; Nandini, S.

    1998-01-01

    Waste water from Mexico's largest food processing industrial sector (based on maize, nejayote water) was used for growing Brachionus calyciflorus isolated from Lake Chapultepec in the Federal District of Mexico (D.F.). Nejayote water was collected from Colonia Providencia, D.F. Experiments were conducted at 25°C in 25 ml capacity vials with 20 ml of medium into which we introduced B. calyciflorus at an initial density of 1 ind ml-1. The experimental design consisted a total of 33 test vessels...

  9. Morphological alterations in the freshwater rotifer Brachionus calyciflorus Pallas 1766 (Rotifera: Monogononta) caused by vinclozolin chronic exposure.

    Science.gov (United States)

    Alvarado-Flores, Jesús; Rico-Martínez, Roberto; Adabache-Ortíz, Araceli; Silva-Briano, Marcelo

    2015-05-01

    Vinclozolin (VZ) is a dicarboximide fungicide widely used on fruits, vegetables and wines, effective against fungi plagues. In this study we characterized the effects of VZ using a 4-day reproductive chronic assay with the freshwater rotifer Brachionus calyciflorus. The assay included observations of several features of asexual and sexual reproduction. Our results indicate that VZ: (a) increased asexual and sexual reproduction, (b) caused severe abnormality in females and (c) these abnormalities were inherited by sexual and asexual reproduction. At 1.2 mg/L three abnormal females were found out of 457 total females (0.66 %). This low percentage is consistent and reproducible according to further analysis, where we increased the number of replicates and total females exposed to 1.2 mg/L of VZ, and found 18 abnormal females out of 2868 total females (0.63 % abnormality). Interestingly, abnormal females found at 5.6 mg/L VZ exposure, were able to show mating behavior. Our results suggest that VZ behaves as a strong endocrine disruptor whose effects show the characteristic inverted-U-shape exposure concentration response curve regarding the intrinsic population increase and the percentage of abnormalities as endpoints.

  10. Effects of selected pharmaceuticals (ibuprofen and amoxicillin on the demography of Brachionus calyciflorus and Brachionus havanaensis (Rotifera

    Directory of Open Access Journals (Sweden)

    Brenda Karen González-Pérez

    2016-09-01

    Full Text Available The levels of emerging chemicals have increased dramatically during the last two decades posing problems for human and environmental health. Pain-killers such as ibuprofen and antibiotics such as amoxicillin are generally consumed together and hence are discharged into waterbodies as effluents. The lack of a rigorous control of pharmaceutical discharges into natural waterbodies is a concern for limnologists and ecotoxicologists because of their possible effects on non-target organisms. Rotifers, due to their sensitivity, short generation time and high reproductive rates, are widely used as bioassay organisms in testing the effects of different substances including pharmaceuticals. Here we quantified the demographic responses of Brachionus calyciflorus and Brachionus havanaensis exposed to three sublethal concentrations of ibuprofen (25, 12.5 and 6.25 mg L−1 and amoxicillin (200, 100 and 50 μg L−1. Our data showed that both survivorship- and reproduction-related variables were negatively affected with increasing concentrations of both pharmaceuticals. The rate of population increase of B. calyciflorus (0.63–0.72 d−1 was not affected by amoxicillin or by ibuprofen but for B. havanaensis, it was decreased significantly (from 0.89 to 0.38 d−1. Compared to ibuprofen, amoxicillin had more adverse effects on both the rotifer species.

  11. Long-term results of carbon dioxide laser treatment of meatal condylomata acuminata

    DEFF Research Database (Denmark)

    Krogh, J; Beuke, H P; Miskowiak, J

    1990-01-01

    A group of 74 men who underwent carbon dioxide laser treatment of meatal condylomata were observed for an average of 18 months. The cure rate after 1 treatment of isolated meatal lesions was 78%; the presence of external lesions lowered the rate to 32% and additional external and urethral warts...... to 25%. Following multiple treatments all but 6 patients were cured; 83% of the recurrences developed within 3 months. One urethral and 6 meatal strictures occurred more than 3 months after treatment; 9 patients had a spraying stream many years after treatment and 2 complained of frequency....

  12. The banana (Musa acuminata) genome and the evolution of monocotyledonous plants

    Czech Academy of Sciences Publication Activity Database

    D´Hont, A.; Denoeud, F.; Aury, J. M.; Baurens, F. Ch.; Carreel, F.; Garsmeur, O.; Noel, B.; Bocs, S.; Droc, G.; Rouard, M.; Da Silva, C.; Jabbari, K.; Cardi, C.; Poulain, J.; Souquet, M.; Labadie, K.; Jourda, C.; Lengellé, J.; Rodier-Goud, M.; Alberti, A.; Bernard, M.; Correa, M.; Ayyampalayam, S.; Mckain, M. R.; Leebens-Mack, J.; Burgess, D.; Freeling, M.; Mbéguié-A-Mbéguié, D.; Chabannes, M.; Wicker, T.; Panaud, O.; Barbosa, J.; Hřibová, Eva; Heslop-Harrison, P.; Habas, R.; Rivallan, R.; Francois, P.; Poiron, C.; Kilian, A.; Burthia, D.; Jenny, Ch.; Bakry, F.; Brown, S.; Guignon, V.; Kema, G.; Dita, M.; Waalwijk, C.; Joseph, S.; Dievart, A.; Jaillon, O.; Leclercq, J.; Argout, X.; Lyons, E.; Almeida, A.; Jeridi, M.; Doležel, Jaroslav; Roux, N.; Risterucci, A. M.; Weissenbach, J.; Ruiz, M.; Glaszmann, J. Ch.; Quétier, F.; Yahiaoui, N.; Wincker, P.

    2012-01-01

    Roč. 488, č. 7410 (2012), s. 213-219 ISSN 0028-0836 Institutional research plan: CEZ:AV0Z50380511 Keywords : IN-SITU HYBRIDIZATION * SEQUENCE COUNT DATA * DNA-SEQUENCES Subject RIV: ED - Physiology Impact factor: 38.597, year: 2012

  13. Transcriptome sequencing of Mycosphaerella fijiensis during association with Musa acuminata reveals candidate pathogenicity genes.

    Science.gov (United States)

    Noar, Roslyn D; Daub, Margaret E

    2016-08-30

    Mycosphaerella fijiensis, causative agent of the black Sigatoka disease of banana, is considered the most economically damaging banana disease. Despite its importance, the genetics of pathogenicity are poorly understood. Previous studies have characterized polyketide pathways with possible roles in pathogenicity. To identify additional candidate pathogenicity genes, we compared the transcriptome of this fungus during the necrotrophic phase of infection with that during saprophytic growth in medium. Transcriptome analysis was conducted, and the functions of differentially expressed genes were predicted by identifying conserved domains, Gene Ontology (GO) annotation and GO enrichment analysis, Carbohydrate-Active EnZymes (CAZy) annotation, and identification of genes encoding effector-like proteins. The analysis showed that genes commonly involved in secondary metabolism have higher expression in infected leaf tissue, including genes encoding cytochrome P450s, short-chain dehydrogenases, and oxidoreductases in the 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily. Other pathogenicity-related genes with higher expression in infected leaf tissue include genes encoding salicylate hydroxylase-like proteins, hydrophobic surface binding proteins, CFEM domain-containing proteins, and genes encoding secreted cysteine-rich proteins characteristic of effectors. More genes encoding amino acid transporters, oligopeptide transporters, peptidases, proteases, proteinases, sugar transporters, and proteins containing Domain of Unknown Function (DUF) 3328 had higher expression in infected leaf tissue, while more genes encoding inhibitors of peptidases and proteinases had higher expression in medium. Sixteen gene clusters with higher expression in leaf tissue were identified including clusters for the synthesis of a non-ribosomal peptide. A cluster encoding a novel fusicoccane was also identified. Two putative dispensable scaffolds were identified with a large proportion of genes with higher expression in infected leaf tissue, suggesting that they may play a role in pathogenicity. For two other scaffolds, no transcripts were detected in either condition, and PCR assays support the hypothesis that at least one of these scaffolds corresponds to a dispensable chromosome that is not required for survival or pathogenicity. Our study revealed major changes in the transcriptome of Mycosphaerella fijiensis, when associating with its host compared to during saprophytic growth in medium. This analysis identified putative pathogenicity genes and also provides support for the existence of dispensable chromosomes in this fungus.

  14. Repetitive part of the banana (Musa acuminata) genome investigated by low-depth 454 sequencing

    Czech Academy of Sciences Publication Activity Database

    Hřibová, Eva; Neumann, Pavel; Matsumoto, T.; Roux, N.; Macas, Jiří; Doležel, Jaroslav

    2010-01-01

    Roč. 10, č. 204 (2010), s. 1-10 ISSN 1471-2229 R&D Projects: GA AV ČR KJB500380901; GA AV ČR IAA600380703; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z50510513 Keywords : IN-SITU HYBRIDIZATION * RIBOSOMAL-RNA GENES * DNA-SEQUENCES Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.085, year: 2010

  15. Localization of BAC clones on mitotic chromosomes of Musa acuminata using fluorescence in situ hybridization

    Czech Academy of Sciences Publication Activity Database

    Hřibová, Eva; Doleželová, Marie; Doležel, Jaroslav

    2008-01-01

    Roč. 52, č. 3 (2008), s. 445-452 ISSN 0006-3134 R&D Projects: GA AV ČR IAA600380703 Institutional research plan: CEZ:AV0Z50380511 Keywords : cytogenetic mapping * chromosome structure * repetitive DNA Subject RIV: EF - Botanics Impact factor: 1.426, year: 2008

  16. Chemical composition and physicochemical properties of green banana (Musa acuminata x balbisiana Colla cv. Awak) flour.

    Science.gov (United States)

    Haslinda, W H; Cheng, L H; Chong, L C; Noor Aziah, A A

    2009-01-01

    Flour was prepared from peeled and unpeeled banana Awak ABB. Samples prepared were subjected to analysis for determination of chemical composition, mineral, dietary fibre, starch and total phenolics content, antioxidant activity and pasting properties. In general, flour prepared from unpeeled banana was found to show enhanced nutrition values with higher contents of mineral, dietary fibre and total phenolics. Hence, flour fortified with peel showed relatively higher antioxidant activity. On the other hand, better pasting properties were shown when banana flour was blended with peel. It was found that a relatively lower pasting temperature, peak viscosity, breakdown, final viscosity and setback were evident in a sample blended with peel.

  17. Antioxidant effcacy of unripe banana (Musa acuminata Colla) peel extracts in sunflower oil during accelerated storage.

    Science.gov (United States)

    Ling, Stella Sye Chee; Chang, Sui Kiat; Sia, Winne Chiaw Mei; Yim, Hip Seng

    2015-01-01

    Sunflower oil is prone to oxidation during storage time, leading to production of toxic compounds that might affect human health. Synthetic antioxidants are used to prevent lipid oxidation. Spreading interest in the replacement of synthetic food antioxidants by natural ones has fostered research on fruit and vegetables for new antioxidants. In this study, the efficacy of unripe banana peel extracts (100, 200 and 300 ppm)  in stabilizing sunflower oil was tested under accelerated storage (65°C) for a period of 24 days. BHA and α-tocopherol served as comparative standards besides the control. Established parameters such as peroxide value (PV), iodine value (IV), p-anisidine value (p-AnV), total oxidation value (TOTOX), thiobarbituric acid reactive substances (TBARS) and free fatty acid (FFA) content were used to assess the extent of oil deterioration. After 24 days storage at 65°C, sunflower oil containing 200 and 300 ppm extract of unripe banana peel showed significantly lower PV and TOTOX compared to BHA and α-tocopherol. TBARS, p-AnV and FFA values of sunflower oil containing 200 and 300 ppm of unripe banana peel extract exhibited comparable inhibitory effects with BHA. Unripe banana peel extract at 200 and 300 ppm demonstrated inhibitory effect against both primary and secondary oxidation up to 24 days under accelerated storage conditions. Unripe banana peel extract may be used as a potential source of natural antioxidants in the application of food industry to suppress lipid oxidation.

  18. Use of Banana (Musa acuminata Colla AAA) Peel Extract as an Antioxidant Source in Orange Juices.

    Science.gov (United States)

    Ortiz, Lucía; Dorta, Eva; Gloria Lobo, M; González-Mendoza, L Antonio; Díaz, Carlos; González, Mónica

    2017-03-01

    Using banana peel extract as an antioxidant in freshly squeezed orange juices and juices from concentrate was evaluated. Free radical scavenging capacity increased by adding banana peel extracts to both types of orange juice. In addition, remarkable increases in antioxidant capacity using 2,2'-azino-bis-(3-ethylbenzothiazoline)-6-sulfonic acid (ABTS) radical were observed when equal or greater than 5 mg of banana peel extract per ml of freshly squeezed juice was added. No clear effects were observed in the capacity to inhibit lipid peroxidation. Adding 5 mg banana peel extract per ml of orange juice did not substantially modify the physicochemical and sensory characteristics of either type of juice. However, undesirable changes in the sensory characteristics (in-mouth sensations and colour) were detected when equal or greater than 10 mg banana peel extract per ml of orange juice was added. These results confirm that banana peel is a promising natural additive that increases the capacity to scavenge free radicals of orange juice with acceptable sensory and physicochemical characteristics for the consumer.

  19. In vivo transformation of human skin with human papillomavirus type 11 from condylomatot acuminata

    International Nuclear Information System (INIS)

    Kreider, J.W.; Howett, M.K.; Lill, N.L.; Bartlett, G.L.; Zaino, R.J.; Sedlacek, T.V.; Mortel, R.

    1986-01-01

    Human papillomaviruses (HPVs) have been implicated in the development of a number of human malignancies, but direct tests of their involvement have not been possible. The authors describe a system in which human skin from various skin from various sites was infected with HPV type 11 (HPV-11) extracted from vulvar condylomata and was grafted beneath the renal capsule of athymic mice. Most of the skin grafts so treated underwent morphological transformation, resulting in the development of condylomata identical to those which occur spontaneously in patients. Foreskins responded with the most vigorous proliferative response to HPV-11. The lesions produced the characteristic intranuclear group-specific antigen of papillomaviruses. Both dot blot and Southern blot analysis of DNA from the lesions revealed the presence of HPV-11 DNA in the transformed grafts. These results demonstrate the first laboratory system for the study of the interaction of human skin with an HPV. The method may be useful in understanding the mechanisms of HPV transformation and replication and is free of the ethical restraints which have impeded study. This system will allow the direct study of factors which permit neoplastic progression of HPV-induced cutaneous lesions in human tissues

  20. Molecular characterization of Banana streak virus isolate from Musa Acuminata in China.

    Science.gov (United States)

    Zhuang, Jun; Wang, Jian-Hua; Zhang, Xin; Liu, Zhi-Xin

    2011-12-01

    Banana streak virus (BSV), a member of genus Badnavirus, is a causal agent of banana streak disease throughout the world. The genetic diversity of BSVs from different regions of banana plantations has previously been investigated, but there are relatively few reports of the genetic characteristic of episomal (non-integrated) BSV genomes isolated from China. Here, the complete genome, a total of 7722bp (GenBank accession number DQ092436), of an isolate of Banana streak virus (BSV) on cultivar Cavendish (BSAcYNV) in Yunnan, China was determined. The genome organises in the typical manner of badnaviruses. The intergenic region of genomic DNA contains a large stem-loop, which may contribute to the ribosome shift into the following open reading frames (ORFs). The coding region of BSAcYNV consists of three overlapping ORFs, ORF1 with a non-AUG start codon and ORF2 encoding two small proteins are individually involved in viral movement and ORF3 encodes a polyprotein. Besides the complete genome, a defective genome lacking the whole RNA leader region and a majority of ORF1 and which encompasses 6525bp was also isolated and sequenced from this BSV DNA reservoir in infected banana plants. Sequence analyses showed that BSAcYNV has closest similarity in terms of genome organization and the coding assignments with an BSV isolate from Vietnam (BSAcVNV). The corresponding coding regions shared identities of 88% and -95% at nucleotide and amino acid levels, respectively. Phylogenetic analysis also indicated BSAcYNV shared the closest geographical evolutionary relationship to BSAcVNV among sequenced banana streak badnaviruses.

  1. The banana (Musa acuminata) genome and the evolution of monocotyledonous plants

    NARCIS (Netherlands)

    Hont, D' A.; Denoeud, F.; Aury, J.M.; Kema, G.H.J.; Dita Rodriguez, M.A.; Waalwijk, C.

    2012-01-01

    Bananas (Musa spp.), including dessert and cooking types, are giant perennial monocotyledonous herbs of the order Zingiberales, a sister group to the well-studied Poales, which include cereals. Bananas are vital for food security in many tropical and subtropical countries and the most popular fruit

  2. Application of Cold Storage for Raja Sere Banana (Musa acuminata colla)

    Science.gov (United States)

    Crismas, S. R. S.; Purwanto, Y. A.; Sutrisno

    2018-05-01

    Raja Sere is one of the indigenous banana cultivars in Indonesia. This cultivar has a yellow color when ripen, small size and sweet taste. Traditionally, the growers market this banana cultivar to the market without any treatment to delay the ripening process. Banana fruits are commonly being harvested at the condition of hard green mature. At this condition of hard green mature, banana fruits can be stored for a long-term period. The objective of this study was to examine the effect of cold storage on the quality of raja sere banana that stored at 13°C. Banana fruits cultivar Raja Sere were harvested from local farmer field at the condition of hard green mature (about 14 weeks age after the flower bloom). Fifteen bunches of banana were stored in cold storage with a temperature of 13°C for 0, 3, 6, 9, and 12 days, respectively. For the control, room temperature storage (28°C) was used. At a storage period, samples of banana fruits ripened in the ripening chamber by injecting 100 ppm of ethylene gas at 25°C for 24 hours. The quality parameters namely respiration rate, hardness, total soluble solids (TSS), change in color, and weight loss were measured. For those banana fruits stored at room temperature, the shelf-life of banana was only reached up to 6 days. For those banana fruits stored in cold storage, the condition of banana fruits was reached up to 12 days. After cold storage and ripening, the third day measurement was the optimal time for bananas to be consumed which indicated by the yellow color (lightness value = 68.51, a* = 4.74 and value b* = 62.63), TSS 24.30 °Brix and hardness 0.48 kgf, weight loss about 7.53-16.45% and CO2 respiration rate of 100.37 mLCO2 / kg.hr.

  3. Fusarium ershadii sp. nov., a Pathogen on Asparagus officinalis and Musa acuminata

    NARCIS (Netherlands)

    Papizadeh, Moslem; Diepeningen, van Anne D.; Zamanizadeh, Hamid Reza; Saba, Farkhondeh; Ramezani, Hossein

    2018-01-01

    Two Fusarium strains, isolated from Asparagus in Italy and Musa in Vietnam respectively, proved to be members of an undescribed clade within the Fusarium solani species complex based on phylogenetic species recognition on ITS, partial RPB2 and EF-1α gene fragments. Macro- and micro-morphological

  4. Immunodetection of Luteinizing Hormone (LH, Follicle-Stimulating Hormone (FSH, Thyroid Stimulating Hormone (TSH and Prolactin (PRL in Brachionus calyciflorus (Rotifera: Monogononta

    Directory of Open Access Journals (Sweden)

    Jesús Alvarado-Flores

    2009-12-01

    Full Text Available The endocrine system controls and coordinates behavioral, biochemical, and physiological processes through signal mechanisms using neuropeptides or products of neurosecretory cells. Among invertebrates, this system is poorly studied in rotifers, in which estrogens and androgens significantly affect sexual reproduction. This is the first report of the presence of the Luteinizing Hormone (LH, Follicle-Stimulating Hormone (FSH, Thyroid Stimulating Hormone (TSH and Prolactin (PRL in rotifers. Analyses included the avidin-biotin-peroxidase complex method with primary antibodies LH (Anti-Rat LH serum for RIA, PRL (Anti-Rat PRL serum for RIA, FSH (Anti-Rat FSH serum for RIA and TSH (Anti-Rat TSH serum for RIA. These hormones were found in females, males and parthenogenetic and sexual eggs of the freshwater Brachionus calyciflorus. The immunoreactivity of FSH, LH, TSH and PRL in females was observed in: ovaries, cerebrum, mastax, stomach, lorica, and the stomach gland. However, in males LH was observed only at the trochal disk and cerebrum. The hormones FSH, TSH and PRL, were observed in testicles, contractil vesicles, and cementary gland of males. Regarding amictic or parthenogenetic eggs, the hormones LH, FSH, TSH, and PRL were located mainly in the micromeres, and the staining in the macromeres was weak. On the other hand, in the mictic or sexual eggs the inner shell is stained for the hormones PRL and LH, opposite to the staining of FSH and TSH, located mainly in the embryo. In general, immuno-reactivity was observed in areas important for the reproductive, excretory, digestive and developmental processes. Rev. Biol. Trop. 57 (4: 1049-1058. Epub 2009 December 01.Se logró detectar la presencia de las hormonas: Hormona Luteinizante (LH, Hormona Folículo Estimulante (FSH, Hormona Estimulante de la Tiroides (TSH y Prolactina (PRL en Brachionus calyciflorus siendo el primer reporte de la presencia de dichas hormonas en rotíferos. Estas hormonas fueron identificadas por un método inmunológico-histológico-químico usando el complejo avidina-biotina- peroxidasa con los siguientes anticuerpos primarios: LH (Anti-Rata LH suero para RIA, PRL (Anti-Rata PRL suero para RIA, FSH (Anti-Rata FSH suero para RIA y TSH (Anti-Rata TSH en suero para RIA. Estas hormonas se encontraron en las hembras, machos, huevos partenogenéticos y huevos sexuales del rotífero dulceacuícola B. calyciflorus. La reactividad inmunológica de FSH, LH, PRL y TSH en las hembras se observó en ovarios, cerebro, mástax, estómago, lorica, y la glándula del estómago. Sin embargo, en machos, la LH se observó sólo en el disco trocal y cerebro mientras que las hormonas FSH, PRL y TSH, se observaron en testículos, vesícula contráctil, y la glándula cementaria. En cuanto a los huevos partenogenéticos o amícticos, las hormonas LH, FSH, TSH, y PRL, se encontraron principalmente en los micrómeros, y en los macrómeros la tinción es débil. Por otra parte, el huevo sexual o míctico muestra reactividad inmunológica en la cubierta interior del huevo para las hormonas LH y PRL, lo contrario para FSH y TSH, las cuales se observaron principalmente en el embrión. La reactividad inmunológica fue observada, en general, en áreas importantes para los procesos reproductivos, excretorios, digestivos y del desarrollo.

  5. Effect of different densities of live and dead Chlorella vulgaris on the population growth of rotifers Brachionus calyciflorus and Brachionus patulus (Rotifera

    Directory of Open Access Journals (Sweden)

    E. Lucía-Pavón

    2001-12-01

    Full Text Available In order to maintain rotifer populations during periods of low algal production, it is necessary to offer alternate diets, some of which include forms of preserved algae. The present work is based on the effect of live and dead Chlorella vulgaris on the population growth of Brachionus calyciflorus and Brachionus patulus. The experimental design consisted of 3 algal levels (0.5x10(6, 1.5x10(6 and 4.5x10(6 cells ml-1 offered in 3 forms (living, frozen and heat-killed. The maximal population density values for B. calyciflorus ranged from 55±1 ind. ml-1 (at 0.5x10(6 cells ml-1 to 471±72 ind. ml-1 (at 4.5x10(6 cells ml-1 with live Chlorella, but was much lower (6±1 to 26±6 ind. ml-1 with frozen or heat-killed alga under comparable food levels. However, the maximum population density of B. patulus under live or or heat-killed Chlorella was similar at comparable algal levels but when offered frozen algae it was four times less. The highest mean peak population density was 1227±83 ind. ml-1 under 4.5x10(6 cells ml-1. The rate of population increase for B. calyciflorus varied from 0.50 to 0.79 using live Chlorella, but under comparable conditions, this range was lower (0.21 to 0.31 for B. patulus. Results have been discussed in light of possible application for aquaculturePara mantener poblaciones de rotíferos durante periodos con escasez de microalgas, es necesario ofrecer dietas alternativas, incluyendo algunas formas de microalgas preservadas. El presente trabajo analiza el efecto de Chlorella vulgaris viva y muerta sobre el crecimiento poblacional de Brachionus calyciflorus y Brachonus patulus. El diseño experimental consistió en tres niveles de algas (0.5x10(6, 1.5x10(6 y 4.5x10(6 células ml-1 ofrecidas en tres formas (viva, congelada y muerta con agua caliente. Las abundancias máximas de población de B. calyciflorus variaron desde 55±1 ind. ml-1 (en 0.5x10(6 células ml-1 a 471±72 ind. ml-1 (en 4.5x10(6 células ml-1 con Chlorella viva, mientras que, cuando se utilizó alga congelada o muerta con agua caliente, la abundancia fue mucho menor (6±1 a 26±6 ind. ml-1. Sin embargo, la máxima densidad de población de B. patulus con Chlorella viva o muerta con calor fue similar bajo niveles de algas comparables, mientras que cuando se ofreció alga congelada, la abundancia fue cuatro veces menor. La abundancia máxima de B. patulus fue 1 227±83 ind. ml-1 bajo 4.5x10(6 células ml-1. La tasa de crecimiento poblacional de B. calyciflorus varió desde 0.50 hasta 0.79 usando Chlorella viva, pero bajo las mismas condiciones, el rango es menor (0.21 a 0.31 para B. patulus. Los resultados se discuten para su posible aplicación en la acuacultura

  6. Tardigrada and Rotifera from moss microhabitats on a disappearing Ugandan glacier, with the description of a new species of water bear.

    Science.gov (United States)

    Zawierucha, Krzysztof; GĄsiorek, Piotr; Buda, Jakub; Uetake, Jun; Janko, Karel; Fontaneto, Diego

    2018-03-08

    Glaciers and ice sheets are a peculiar biome with characteristic abiotic and biotic components. Mountain glaciers are predicted to decrease their volume and even to melt away within a few decades. Despite the threat of a disappearing biome, the diversity and the role of microscopic animals as consumers at higher trophic levels in the glacial biome still remain largely unknown. In this study, we report data on tardigrades and rotifers found in glacial mosses on Mount Stanley, Uganda, and describe a new tardigrade species. Adropion afroglacialis sp. nov. differs from the most similar species by having granulation on the cuticle, absence of cuticular bars under the claws, and a different macroplacoid length sequence. We also provide a morphological diagnosis for another unknown tardigrade species of the genus Hypsibius. The rotifers belonged to the families Philodinidae and Habrotrochidae. In addition, we discuss the diversity of microinvertebrates and potential role of tardigrades and rotifers on mountain glaciers as top consumers. As for any organism living apparently exclusively in glacial habitats on tropical glaciers, their extinction in the near future is inevitable, possibly before we can even discover their existence.

  7. Evaluation of Bacterivory of Rotifera Based on Measurements of in-Situ Ingestion of Fluorescent Particles, Including Some Comparisons with Cladocera

    NARCIS (Netherlands)

    Ooms-Wilms, A.L.; Postema, G.; Gulati, R.D.

    1995-01-01

    Bacterivory of pelagic rotifers and cladocerans in eutrophic Lake Loosdrecht (The Netherlands) was determined by microscopic observation of in situ tracer particle uptake. Ingestion rates of rotifer species using 0.51 mu m microspheres or fluorescently labelled bacteria as tracers differed, with one

  8. Brachionidae (Rotifera: Monogononta de la albufera El Paraíso y el reporte de Brachionus ibericusen el Perú

    Directory of Open Access Journals (Sweden)

    Emily Toscano

    2013-12-01

    Full Text Available En este trabajo se reportan las especies de Brachionidae reconocidos en las muestras recogidas en octubre de 2010 en la albufera Laguna El Paraiso, Huacho (11°13' −11° 10'S, 77° 35' −77°40'W. Cinco especies fueron determinadas: Keratella tropica, Brachionus quadridentatus, B. urceolaris, B. angularis y B. ibericusCiros-Pérez 2001. Este último es un nuevo reporte para el Perú y amplía su distribución a nivel mundial.

  9. Combined effects of temperature and salinity on the demographic response of Proales similis (Beauchamp, 1907) and Brachionus plicatilis (Müller, 1786) (Rotifera) to mercury.

    Science.gov (United States)

    Rebolledo, Uriel Arreguin; Nandini, S; Sánchez, Ofelia Escobar; Sarma, S S S

    2018-07-01

    The demographic response of the brackish-water rotifers Proales similis and Brachionus plicatilis to mercury (0.5, 2, 8 and 32 μg L -1 of HgCl 2 ) at different salinity levels (10 and 20‰) and two temperature (25 °C and 32 °C) regimes were evaluated. Median lethal concentration (LC 50 ) for P. similis and B. plicatilis was 10 and 16 μg L -1 , respectively, showing that Proales similis was more sensitive to mercury than B. plicatilis. The rate of population increase (r) for both species was greater at 10‰ salinity and 32 °C (ranged from 0.6 to 0.95 d -1 ). The r-value decreased as the concentration of mercury in the medium increased. Regardless of the temperature, at lower salinity and higher mercury concentration (32 μg L -1 ), P. similis died within six days. The survivorship of P. similis and B. plicatilis was higher at 25 °C than at 32 °C (ranged from 5 to 8 and 7-13 d, respectively). Fecundity was higher at 32 °C than at 25 °C for both rotifers species. There was a significant effect of the interaction among salinity, temperature, and mercury in both species on the reproductive variables such as net and gross reproductive rates, generation time and the rate of population increase. Considering the sensitivity of P. similis, we suggest that this species be included in the list of marine bioassay organisms. Copyright © 2018 Elsevier Ltd. All rights reserved.

  10. Effect of periodical starvation on the life history of Brachionus plicatilis O.F. Müller (Rotifera): a possible strategy for population stability.

    Science.gov (United States)

    Yoshinaga; Hagiwara; Tsukamoto

    2000-10-25

    To estimate the changes in the life history of the rotifer Brachionus plicatilis O.F. Müller under starvation, we carried out an individual culture and determined the effects of periodical food deprivation on its asexual reproductive characteristics such as lifespan, reproductive period, age at first egg and offspring production, and lifetime fecundity (total number of offspring produced in her lifetime). Rotifers were fed for 1-3 h daily, and were then starved until the next day. Control animals were fed throughout their lifespan. Starved rotifers matured and produced their first offspring at an older age than the control animals. The periodical starvation resulted in a decrease in the lifetime fecundity to less than half that of the non-starved control. The reproductive period and lifespan were 2-3 times longer in the starved animals than in the control animals. The negative relationship between lifespan and lifetime fecundity is interpreted as a trade-off in an alternative life-history strategy of rotifers under starved conditions. The great decrease in fecundity and extension of lifespan enables rotifers to compensate to keep the population in equilibrium.

  11. Combined effect of concentrations of algal food (Chlorella vulgaris and salt (sodium chloride on the population growth of Brachionus calyciflorus and Brachionus patulus (Rotifera

    Directory of Open Access Journals (Sweden)

    Víctor M. Peredo-Álvarez

    2003-06-01

    Full Text Available Salinity is an important variable influencing the density and diversity of rotifers. Studies on salt tolerance of rotifers have so far concentrated on euryhaline species while very little information is available on noneuryhaline taxa. In the present work, we have evaluated the combined effects of Chlorella vulgaris and sodium chloride on the population growth of two freshwater rotifers B. calyciflorus and B. patulus. A 24 hr acute tolerance test using NaCl revealed that B. calyciflorus was more resistant (LC50 = 3.75 ± 0.04 g l-1 than B. patulus (2.14 ± 0.09 g l-1 . The maximal population density (mean±standard error for B. calyciflorus in the control at 4.5 X10 6 cells ml-1 (algal level was 80 ±5 ind. ml-1 , which was nearly a fifth of the one for B. patulus (397 ± 7 ind. ml-1 under comparable conditions. Data on population growth revealed that regardless of salt concentration, the density of B. calyciflorus increased with increasing food levels, while for B. patulus, this trend was evident only in the controls. Regardless of salt concentration and algal food level, the day of maximal population density was lower (4 ± 0.5 days for B. calyciflorus than for B. patulus (11 ±1 day. The highest rates of population increase (r values for B. calyciflorus and B. patulus were 0.429 ± 0.012 and 0.367 ± 0.004, respectively, recorded at 4.5 X10(6 cells ml-1 of Chlorella in the controls. The protective role of algae in reducing the effect of salt stress was more evident in B. calyciflorus than B. patulus.La salinidad es una variable importante que tiene influencia sobre la densidad y la diversidad de los rotíferos. Los estudios de rotíferos sobre tolerancia a la sal que se tienen hasta ahora se han concentrado en especies eurihalinas, sin embargo, hay muy poca información sobre taxas no eurihalinos. En el presente trabajo, se evaluaron los efectos combinados de las concentraciones de Chlorella vulgaris y cloruro de sodio sobre el crecimiento poblacional de dos rotíferos de agua dulce, B. calyciflorus y B. patulus. Una prueba de toxicidad aguda de 24 h utilizando cloruro de sodio reveló que B. calyciflorus fue más resistente (CL50 = 3.75 ± 0.04 g l -1 que B. patulus (2.14 ± 0.09 g l-1 . La máxima densidad de población (media ± error estándar de B. calyciflorus en el lote control, utilizando una concentración 4.5 X10(6 células ml-1 de alga fue de 80 ± 5 ind. ml-1 , casi una quinta parte de B. patulus (397 ±7 ind. ml-1 sobre condiciones comparables. Datos sobre el crecimiento poblacional revelaron que cualquier concentración de sal carece de efecto, la densidad de B. calyciflorus se incrementa cuando aumentan los niveles de alimento. Sin embargo para B. patulus esta tendencia fue evidente únicamente en los controles. Independientemente de las concentraciones de sal y los niveles de alimento, el día de abundancia máxima fue menor para B. calyciflorus (4 ± 0.5 días que para B. patulus (11 ±1 días. Los valores de la máxima tasa de crecimiento poblacional (r fueron para B. calyciflorus y B. patulus de 0.429 ± 0.012 y 0.367 ± 0.004, respectivamente en lotes control con 4.5 X10(6 células ml-1 de Chlorella. El papel de protección de alga para reducir el efecto del estrés de la sal fue más evidente en B. calyciflorus que en B. patulus.

  12. Informe preliminar sobre aspectos de la biología del Aliso (Alnus acuminata h.b.k.

    Directory of Open Access Journals (Sweden)

    Garcés de Granada Emira

    1986-12-01

    Full Text Available Las especies del género Alnus se consideran de gran Importancia porque la raíz se asocia simblóticamente con Actinomycetes, formando nódulos fijadores de nitrógeno atmosférico, siendo este el principal mecanismo para la Incorporación de nitrógeno reducido en suelos pobres (Burns y Hardy, 1975; Torrey, 1976; Normand y Lalonde, 1982. En colombia el Aliso (Alnus acumlnata H.B.K., se encuentra ampliamente distribuido y se ha Iniciado su utilizAción en proyectos de reforestación (Cáceres y Oyola, 1981. La madera es empleada como carbón vegetal y para la fabricación de cajas, cajones, palillos y postes (Slcco
    et al., 1965, también es Importante por el contenido de tanino (Torres, 1983. Sin embargo se hace necesario conocer aspectos básicos de la biologla de esta especie que
    incluyan germinación, fenologla, crecimiento, desarrollo y las interacciones entre la planta y otros organismos asociados, de los cuales se desconoce su relación biológica.

  13. Gene flow and geographic variation in natural populations of Alnus acuminata ssp. arguta (Fagales: Betulaceae in Costa Rica and Panama

    Directory of Open Access Journals (Sweden)

    Olman Murillo

    1999-12-01

    Full Text Available Seventeen natural populations in Costa Rica and Panama were used to asses gene flow and geographic patterns of genetic variation in this tree species. Gene flow analysis was based on the methods of rare alleles and FST (Index of genetic similarity M, using the only four polymorphic gene loci among 22 investigated (PGI-B, PGM-A, MNR-A and IDH-A. The geographic variation analysis was based on Pearson`s correlations between four geographic and 14 genetic variables. Some evidence of isolation by distance and a weak gene flow among geographic regions was found. Patterns of clinal variation in relation to altitude (r = -0.62 for genetic diversity and latitude (r= -0.77 for PGI-B3 were also observed, supporting the hypothesis of isolation by distance. No private alleles were found at the single population level.Diecisiete poblaciones naturales de esta especie forestal en Costa Rica y Panamá, fueron investigadas en relación con sus patrones de flujo genético y de variación geográfica. El análisis de flujo genético fue basado en los métodos de los alelos raros y de FST (Indice de similaridad genética M. Los análisis fueron a su vez basados en los únicos cuatro loci genéticos de un total de 22 investigados que mostraron polimorfismo (PGI-B, PGM-A, MNR-A and IDH-A. Los análisis de variación geográfica fueron basados en el desarrollo de correlaciones de Pearson entre 4 variables geográficas y 14 variables genéticas. Alguna evidencia de aislamiento por distancia así como un débil flujo genético entre regiones geográficas fue encontrado. Fueron también observados patrones de variación clinal en relación con la altitud (r = -0.62 para la diversidad genética y latitud (r= -0.77 en PGI-B3, que apoyan la hipotesis de aislamiento por distancia para esta especie. No se encontraron alelos privados en ninguna de las poblaciones investigadas.

  14. Utilization Of The Visceral Organsof Catfish (Pangasius Hypoptalmus) Added To Banana Peel (Musa Acuminata Balbisiana) To Produceliquid Organic Fertilizer

    OpenAIRE

    Fryathama, Ilham; Sukmiwati, Mery; ', Sumarto

    2017-01-01

    This study aimed to obtain liquid organic fertilizer produced from the visceral organs of catfish added to banana skin for enriching the macro elements N, P, and K.The method used in this study was the experimental. Parameters used were the value of pH, nitrogen, phosphorus and potassium. The experimentwas composed as completely randomized design (CRD), and the treatment was addition of banana peel which varied into 4 different amoun, namely: without the banana peel (K0), banana peel 100 g (K...

  15. Pengaruh Kombinasi Pemupukan Terhadap Pertumbuhan Pisang Kepok Kuning (Musa acuminata × M. balbisiana Pada Lahan Kering di Banyumas, Jawa Tengah

    Directory of Open Access Journals (Sweden)

    Saktiyono Sigit Tri Pamungkas

    2015-06-01

    Full Text Available Kepok Kuning banana (Musa acuminate × M.balbisiana is a banana which has a good adaptability tothe water shortage conditions. The banana has cultivatedin watershed of Tajum river, Banyumas. The place haspotential to be centre of Yellow Kepok banana productionbut the farmers occasionally applied fertilizer unbalancedwhich effect to productivity and quality of banana. It isnecessary to examine proportion of fertilizers to determinethe effective and effi cient fertilizer composition whichincreased productivity and quality of banana.The experiment was conducted on Gentawangi dryland farm, Jatilawang, Banyumas on January-June 2009. Theexperiment was laid out in randomized block design with12 replications and involving single factor. It consistedof 5 treatments The Banana was planted in pattern 3 m x3 m. Results showed that banana required both of organicfertilizers and inorganic in vegetative stage. The treatmentof Urea 150 g + 100 g + SP36 compost 10 kg/tree/applicationshowed the effi cient compared to other, followed bytreatment of ZA 150 g + SP36 KCl 150 g + 50 g/tree/application. Combination of Urea and ZA without organicfertilizer indicated uneffi cient compared to others

  16. PENGARUH PENAMBAHAN ASAM SITRAT TERHADAP KARAKTERISTIK FILM PLASTIK BIODEGRADABLE DARI PATI KULIT PISANG KEPOK (Musa acuminata balbisiana Colla

    Directory of Open Access Journals (Sweden)

    Hardjono Hardjono

    2016-06-01

    Full Text Available Banana peels can be used as raw material for biodegradable plastic film because the banana peels was consists of starch. Starch was derived from banana peels would be rapidly changing color or browning. Browning was prevented by the addition of citric acid during the process of starch extraction from banana peels. The aim of this study was to determine the effect of citric acid on mechanical properties and capabilities degradation of starch biodegradable film made from this starch (film plastik pati kulit pisang – FPKP. FPKP was made with banana peel starch (pati kulit pisang – PKP as raw materials, with the addition of glycerol as a plasticizer, and both CaCO3 and CMC as filler, whereas the PKP was obtained by simple extraction methods with or without the addition of citric acid. Glycerol concentration was varied from 20% w/w to 60% w/w, while CaCO3 and CMC were added in a fixed amount. The results was showed that the addition of citric acid affects the color of a PKP produced. The addition of citric acid can enhance the tensile strength of FPKP, up to 4,202 MPa for FPKP with CaCO3 filler and 4.032 MPa for FPKP with CMC filler. For biodegrability of FPKP, the affect of citric acid apply vice versa.

  17. Optimatization of transient transformation methods to study gene expression in Musa acuminata (AAA group) cultivar Ambon Lumut

    Science.gov (United States)

    Prayuni, Kinasih; Dwivany, Fenny M.

    2015-09-01

    Banana is classified as a climateric fruit, whose ripening is regulated by ethylene. Ethylene is synthesized from ACC (1-aminocyclopropane-1-carboxylic acid) by ACC oxidase enzyme which is encoded by ACO gene. Controling an important gene expression in ethylene biosynthesis pathway has became a target to delay the ripening process. Therefore in the previous study we have designed a MaACO-RNAi construct to control MaACO gene expression. In this research, we study the effectiveness of different transient transformation methods to deliver the construct. Direct injection, with or no vaccum infiltration methods were used to deliver MaACO-RNAi construct. All of the methods succesfully deliver the construct into banana fruits based on RT-PCR result.

  18. Transcripts and MicroRNAs Responding to Salt Stress in Musa acuminata Colla (AAA Group cv. Berangan Roots.

    Directory of Open Access Journals (Sweden)

    Wan Sin Lee

    Full Text Available Physiological responses to stress are controlled by expression of a large number of genes, many of which are regulated by microRNAs. Since most banana cultivars are salt-sensitive, improved understanding of genetic regulation of salt induced stress responses in banana can support future crop management and improvement in the face of increasing soil salinity related to irrigation and climate change. In this study we focused on determining miRNA and their targets that respond to NaCl exposure and used transcriptome sequencing of RNA and small RNA from control and NaCl-treated banana roots to assemble a cultivar-specific reference transcriptome and identify orthologous and Musa-specific miRNA responding to salinity. We observed that, banana roots responded to salinity stress with changes in expression for a large number of genes (9.5% of 31,390 expressed unigenes and reduction in levels of many miRNA, including several novel miRNA and banana-specific miRNA-target pairs. Banana roots expressed a unique set of orthologous and Musa-specific miRNAs of which 59 respond to salt stress in a dose-dependent manner. Gene expression patterns of miRNA compared with those of their predicted mRNA targets indicated that a majority of the differentially expressed miRNAs were down-regulated in response to increased salinity, allowing increased expression of targets involved in diverse biological processes including stress signaling, stress defence, transport, cellular homeostasis, metabolism and other stress-related functions. This study may contribute to the understanding of gene regulation and abiotic stress response of roots and the high-throughput sequencing data sets generated may serve as important resources related to salt tolerance traits for functional genomic studies and genetic improvement in banana.

  19. Protein (Cyanobacteria): 383945 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ckel incorporation protein HypA Oscillatoria acuminata PCC 6304 MHEVSLMENTLNIALDCASAQNASKIHRLKMRVGDLSGVVPDALEFAFDVVTRGTIAEGAKFEIERVPVVCHCSTCDRNFEPIDLFYECPHCHQLTYQIQSGQEIELTSLEVS ...

  20. The characteristic of a zooplankton in the contaminated bottom stream of the Pripyat' river and backwaters

    International Nuclear Information System (INIS)

    Zarubaw, A.I.; Malatkow, D.V.

    1994-01-01

    The researches of zooplankton are conducted on two stations on the Pripyat' river, but also on two backwaters which are in the Chernobyl NPP contamination zone. The rotifera is dominant group of zooplankton. Their quantity is more than 10 samples/litter. An absolute and relative fertility of rotifera is determined. It is established an structural and functional reorganization of the rotifera dominant complexes occurs. Any influence of contamination on a zooplankton condition is not found out. 5 refs., 2 tabs., 2 figs

  1. Untitled

    African Journals Online (AJOL)

    Biodiversity And Spatial Distribution of Rotifera in a Shallow Hypereutrophic. Tropical Lake (Cameroon) ... Key words : Rotifera, biodiversity, hypereutrophic lake, spatial distribution, tropical zone. RÉSUME. Une étude qualitative de la ...... Malaysia and Singapour with remark on some species. Hydrobiol, 78: 205-219. Gilbert ...

  2. Influencia de la pérdida foliar sobre la cosecha en el cv. Gruesa, Musa acuminata Colla (AAA, cultivado bajo invernadero en las Islas Canarias

    Directory of Open Access Journals (Sweden)

    Juan Cabrera Cabrera

    2010-12-01

    Full Text Available El cultivo de la variedad de platanera Gruesa, selección local de Dwarf Cavendish, ha experimentado un importante aumento en los últimos años en las Islas Canarias, tanto al aire libre como bajo invernadero. La eliminación de hojas, tras la floración, es una práctica habitual en los cultivos bajo invernadero. Asimismo es frecuente la pérdida de hojas por el efecto de los vientos en los cultivos al aire libre. El objetivo de este trabajo es evaluar, mediante simulación de pérdida foliar por daños mecánicos, la influencia que tiene la disminución de superficie foliar sobre el llenado y cosecha de la fruta en dicho cultivar. Para ello, cuatro meses antes de la cosecha se efectuaron cinco niveles de defoliación: 0%, 25%, 50%, 75% y 100%. Se valoran dos métodos diferentes de defoliación, eliminación de limbo foliar y tronchado de hojas con posterior corte de éstas. Se analizan y presentan datos morfológicos, fenológicos y productivos, así como valoración de la metodología empleada en este trabajo para la simulación de daños. A partir de un 25% de defoliado, equivalente a 7.5 hojas funcionales por planta, se detectaron diferencias significativas con las plantas testigos.

  3. Procesos morfológicos en la iniciación y desarrollo de nódulos en aliso (Alnus acuminata H.B.K

    Directory of Open Access Journals (Sweden)

    Niño Luz Marina

    1987-12-01

    Full Text Available La especie nativa Alnus ecuminata H.B.K. (Aliso establece una relación simbiótica en las raíces con un Actinomycete
    del género Frankia. De esta asociación resulta la formación de nódulos que tienen capacidad para fijar nitrógeno atmosférico y mejorar la disponibilidad de este elemento
    en los suelos. Para evaluar y analizar los cambios morfológicos originados por el establecimiento de la asociación, se inocularon con nódulos macerados plántulas de. Aliso sembradas en medio estéril. Periódicamente, a partir de los tratamientos, las raíces de Aliso fueron muestradas y procesadas empleando técnicas de microscopía óptica y electrónica. Las observaciones efectuadas mostraron
    al simbionte en cuatro formas: esporas, hifas, ves ículas y bacteroides y revelaron que el proceso de iniciación y desarrollo de los nódulos fue similar al de otras especies del
    género Alnus estudiadas en las Zonas templadas. Frankia penetró a los tejidos de la planta vía pelo radical, invadió luego el tejido cortical e indujo la formación del nódulo, el cual emergió a manera de una raíz lateral. Además se estableció que la hifas forma inefectiva de Frankia, penetró por células epidermales jóvenes. En estadios iniciales de infección, el Actinomycete se encontró en espacios intercelulares, aunque siempre terminó estableciéndose en células del tejido cortical.

  4. Procesos morfológicos en la iniciación y desarrollo de nódulos en aliso (alnus acuminata h.b.k)

    OpenAIRE

    Niño, Luz Marina; Pérez, Rosalia; Orozco de Amezquita, Martha; Garcés de Granada, Emira

    2011-01-01

    La especie nativa Alnus ecuminata H.B.K. (Aliso) establece una relación simbiótica en las raíces con un Actinomycete
    del género Frankia. De esta asociación resulta la formación de nódulos que tienen capacidad para fijar nitrógeno atmosférico y mejorar la disponibilidad de este elemento
    en los suelos. Para evaluar y analizar los cambios morfológicos originados por el establecimiento de la asociación, se inocularon con nódulos macerados plántulas de. Aliso sembradas en med...

  5. Enhanced yield of phenolic extracts from banana peels (Musa acuminata Colla AAA) and cinnamon barks (Cinnamomum varum) and their antioxidative potentials in fish oil.

    Science.gov (United States)

    Anal, Anil Kumar; Jaisanti, Sirorat; Noomhorm, Athapol

    2014-10-01

    The bioactive compounds of banana peels and cinnamon barks were extracted by vacuum microwave and ultrasonic-assisted extraction methods at pre-determined temperatures and times. These methods enhance the yield extracts in shorter time. The highest yields of both extracts were obtained from the conditions which employed the highest temperature and the longest time. The extracts' yield from cinnamon bark method was higher by ultrasonic than vacuum microwave method, while vacuum microwave method gave higher extraction yield from banana peel than ultrasonic method. The phenolic contents of cinnamon bark and banana peel extracts were 467 and 35 mg gallic acid equivalent/g extract, respectively. The flavonoid content found in banana peel and cinnamon bark extracts were 196 and 428 mg/g quercetin equivalent, respectively. In addition, it was found that cinnamon bark gave higher 2,2-Diphenyl-1-1 picryhydrazyl (DPPH) radical scavenging activity and total antioxidant activity (TAA). The antioxidant activity of the extracts was analyzed by measuring the peroxide and p-anisidine values after oxidation of fish oils, stored for a month (30 days) at 25 °C and showed lesser peroxide and p-anisidine values in the fish oils containing the sample extracts in comparison to the fish oil without containing any extract. The banana peel and cinnamon extracts had shown the ability as antioxidants to prevent the oxidation of fish oil and might be considered as rich sources of natural antioxidant.

  6. Análise transcritômica e proteômica da interação Musa acuminata x Mycosphaerella musicola

    OpenAIRE

    Passos, Marco Aurélio Ninômia

    2014-01-01

    A Sigatoka Amarela em banana (Musa spp.), causada pelo fungo Mycosphaerellamusicola, provoca desordem significativa de área foliar e amadurecimento prematuro do fruto. O desenvolvimento de genótipos resistentes a fungos patogênicos é de fundamental importância. A fim de desenvolver um recurso de genômica funcional para essa cultura oferencendo compreensão sobre os mecanismos moleculares das respostas de Musa a estresses bióticos, foi realizado um estudo de pirosequenciamento do transcritoma d...

  7. Analysis of MaACS2, a stress-inducible ACC Synthase Gene in Musa acuminata AAA Group Cultivar Pisang Ambon

    Directory of Open Access Journals (Sweden)

    Resnanti Utami Handayani

    2014-07-01

    Full Text Available Ethylene has an important function in plant growth and development. Ethylene production generally increases in response to pathogen attacks and other environmental stress conditions. The synthesis of this phytohormone is regulated by two enzymes, ACC synthase (ACS and ACC oxidase (ACO. ACC synthase is encoded by a multigene that regulates the production of ACC, after which this precursor is converted into ethylene by ACO. Pisang Ambon (Musa sp. AAA group, a banana cultivar originating from Indonesia, has nine ACS genes (MaACS 1-9 and one ACO gene (MaACO. One of the banana ACS genes, MaACS2, is stress-inducible. In this research, we have investigated the expression profile of MaACS2 in the roots and leaf tissues of infected tissue culture plants. Quantification of gene expression was analyzed using Real-Time PCR (qPCR using Ma18srRNA and MaGAPDH as reference genes. The results showed nine-to ten fold higher MaACS2 expression levels in the infected roots tissues compared to the uninfected roots tissues. However, MaACS2 expression in the leaves was only detected in infected tissue.

  8. Propagacio?n in vivo e in vitro de Prosopis sp. (algarrobo), Tabebuia billbergii (guayaca?n negro), Loxopterigium huasango (hualtaco) y Alnus acuminata (aliso)

    OpenAIRE

    Minchala Patin?o, Julia; Eras Guama?n, Vi?ctor; Poma Angamarca, Ruth; Gonza?lez Zaruma, Darlin; Yaguana Are?valo, Magaly; Mun?oz Chamba, Luis; Delgado Paredes, Guillermo E.

    2013-01-01

    El Laboratorio de Micropropagacio?n Vegetal del A?rea Agropecuaria y de Recursos Naturales Renovables, de la Universidad Nacional de Loja, inicio?, en el presente an?o, el proyecto de investigacio?n: Generacio?n de protocolos para la propagacio?n in vivo e in vitro de genotipos e?lites de especies forestales nativas y promisorias para la reforestacio?n en la Regio?n Sur del Ecuador; comprendiendo las especies Prosopis sp. (“algarrobo”), Tabebuia bill- bergii = Handroanthus billbergii (“guayac...

  9. Metabolomic Profiles of Dinophysis acuminata and Dinophysis acuta Using Non-Targeted High-Resolution Mass Spectrometry

    DEFF Research Database (Denmark)

    García-Portela, María; Reguera, Beatriz; Sibat, Manoella

    2018-01-01

    Photosynthetic species of the genus Dinophysis are obligate mixotrophs with temporary plastids (kleptoplastids) that are acquired from the ciliate Mesodinium rubrum, which feeds on cryptophytes of the Teleaulax-Plagioselmis-Geminigera clade. A metabolomic study of the three-species food chain Din...

  10. Molecular cloning and expression of five glutathione S-transferase (GST) genes from Banana (Musa acuminata L. AAA group, cv. Cavendish).

    Science.gov (United States)

    Wang, Zhuo; Huang, Suzhen; Jia, Caihong; Liu, Juhua; Zhang, Jianbin; Xu, Biyu; Jin, Zhiqiang

    2013-09-01

    Three tau class MaGSTs responded to abiotic stress, MaGSTF1 and MaGSTL1 responded to signaling molecules, they may play an important role in the growth of banana plantlet. Glutathione S-transferases (GST) are multifunctional detoxification enzymes that participate in a variety of cellular processes, including stress responses. In this study, we report the molecular characteristics of five GST genes (MaGSTU1, MaGSTU2, MaGSTU3, MaGSTF1 and MaGSTL1) cloned from banana (Musa acuminate L. AAA group, cv. Cavendish) using a RACE-PCR-based strategy. The predicted molecular masses of these GSTs range from 23.4 to 27.7 kDa and their pIs are acidic. At the amino acid level, they share high sequence similarity with GSTs in the banana DH-Pahang (AA group) genome. Phylogenetic analysis showed that the deduced amino acid sequences of MaGSTs also have high similarity to GSTs of other plant species. Expression analysis by semi-quantitative RT-PCR revealed that these genes are differentially expressed in various tissues. In addition, their expression is regulated by various stress conditions, including exposure to signaling molecules, cold, salinity, drought and Fusarium oxysporum f specialis(f. Sp) cubense Tropical Race 4 (Foc TR4) infection. The expression of the tau class MaGSTs (MaGSTU1, MaGSTU2 and MaGSTU3) mainly responded to cold, salinity and drought while MaGSTF1 and MaGSTL1 expressions were upregulated by signaling molecules. Our findings suggest that MaGSTs play a key role in both development and abiotic stress responses.

  11. Relation between the concentration of Dinophysis acuminata and diarrheic shellfish poisoning toxins in blue mussels (Mytilus edulis) during a toxic episode in the Limfjord (Denmark), 2006

    DEFF Research Database (Denmark)

    Jørgensen, Kevin; Andersen, Per

    2008-01-01

    (1). The OA content per cell measured when concentrating only 0.2 L per filter was a good measure of the theoretical content of toxins calculated in a "no handling" case. The influence of heat-treatment on the concentration of DSP toxins in mussels was investigated. Results of OA concentration...

  12. FGF-2 expression and the amount of fibroblast in the incised wounds of Rattus norvegicus rats induced with Mauli banana (Musa acuminata stem extract

    Directory of Open Access Journals (Sweden)

    Didit Aspriyanto

    2017-09-01

    Full Text Available Background: Traditional wound treatment using herbal medicine is thought to maintain the health of families and society in general economically, effectively, and efficiently without inducing side effects. One genus of plant that can be used as a traditional medicine is the Mauli banana, indigenous to South Borneo. Mauli banana stem contains bioactive compounds, most of which are tannins along with ascorbic acid, saponin, β-carotene, flavonoids, lycopene, alkaloids, and flavonoids. Tanin has antibacterial and antioxidant effects at low concentrations, as wells as antifungal ones at high concentrations. Purpose: This study aimed to analyze the effects of Mauli banana stem extract at concentrations of 25%, 37.5%, and 50% on the quality of incised wound healing in male Rattus norvegicus rats by assessing FGF-2 expression and fibroblast concentration on days 3 and 7. Methods: This research represented an experimental laboratory-based investigation involving 32 rats of the Rattus norvegicus strain aged 2-2.5 months old. Sampling was performed using a simple random sampling technique since the research population was considered homogeneous and divided into 8 treatment groups (C3, M3-25, M3-37.5, M3-50, C7, M7-25, M7-37.5, M7-50. The rats in each group were anesthetized before their back was incised with length and width of 15x15mm with a depth of 2mm. Gel hydroxy propyl cellulose medium (HPMC was applied to the incised wound of each rat in the control group, while stem Mauli banana extract was applied to that of each rat in the treatment groups three times a day at an interval of 6-8 hours. On day 3, four rats from each group were sacrificed, while, in the remaining groups, the same procedure was performed until day 7, at which point they (8 groups were sacrificed for HE examination in order to assess the amount of fibroblast and for IHC examination to examine FGF-2 expression. Data regarding FGF-2 expression and the amount of fibroblast were analysed by means of One-way Anova and HSD. Results: The results showed that the Mauli banana stem extract could significantly improve the expression of FGF-2 and the amount of fibroblast cells compared to C3 and C7 groups. The highest increase in FGF-2 expression and fibroblast amount were found in all groups on days 3 and 7 treated with the Mauli banana stem extract at a concentration of 50%. Conclusion: There was an increase of FGF-2 expression and the amount of fibroblast cells in the incision wound healing process that induced with Mauli banana stem extract.

  13. Caracterização morfológica da semente e da plântula de bacurizinho (Rheedia acuminata (Ruiz et Pav. Plachon et Triana - Clusiaceae

    Directory of Open Access Journals (Sweden)

    NASCIMENTO WALNICE MARIA OLIVEIRA DO

    2002-01-01

    Full Text Available O bacurizinho é uma espécie frutífera do gênero Rheedia, nativa da Amazônia, e raramente cultivada, pois seus frutos, embora comestíveis, apresentam polpa escassa. Os estudos com o bacurizinho visam a sua utilização como porta-enxerto, redutor de porte para outras espécies do gênero Rheedia e Garcinia que apresentam altura elevada, como o bacuripari (Rheedia macrophylla Planchon et Triana- Clusiaceae e o mangostão (Garcinia mangostana L.. Este trabalho teve como objetivo caracterizar, morfologicamente, a semente e a plântula dessa espécie. A semente é exalbuminosa, bitegumentada, com a testa de coloração marrom, apresentando vários feixes vasculares bem visíveis, distinguindo-se por sua coloração um pouco mais clara. O hilo é arredondado, de coloração escura, com pequena região mais clara ao centro, correspondendo no ponto de entrada de feixe vascular. A micrópila situa-se próxima ao hilo, sobre uma pequena protuberância triangular. O embrião é anômalo, hipocotilar e é representado unicamente por um longo eixo hipocótilo-radícula, sendo os cotilédones diminutos, aparecendo apenas na extremidade superior no lado oposto da micrópila. Durante a germinação, ocorre primeiramente a emergência de delgada raiz primária, no pólo oposto onde será originado o epicótilo. Essa raiz cresce aproximadamente 5-7cm e cessa, fenecendo posteriormente. Por ocasião da emergência do epicótilo, ocorre ao mesmo tempo a formação de uma raiz adventícia, na base do epicótilo, bem mais robusta que a anterior e que se constituirá no sistema radicular da planta. Precedendo a abertura do primeiro par de metáfilos, desenvolvem-se no epicótilo três pares de catafilos opostos e de coloração esverdeada. A germinação é hipógea e a plântula do tipo criptocotiledonar.

  14. Four year efficacy of prophylactic human papillomavirus quadrivalent vaccine against low grade cervical, vulvar, and vaginal intraepithelial neoplasia and anogenital warts: randomised controlled trial

    DEFF Research Database (Denmark)

    Dillner, Joakim; Kjaer, Susanne K; Wheeler, Cosette M

    2010-01-01

    To evaluate the prophylactic efficacy of the human papillomavirus (HPV) quadrivalent vaccine in preventing low grade cervical, vulvar, and vaginal intraepithelial neoplasias and anogenital warts (condyloma acuminata)....

  15. The effect of banana (Musa acuminata) peels hot-water extract on the immunity and resistance of giant freshwater prawn, Macrobrachium rosenbergii via dietary administration for a long term: Activity and gene transcription.

    Science.gov (United States)

    Rattanavichai, Wutti; Chen, Ying-Nan; Chang, Chin-Chyuan; Cheng, Winton

    2015-10-01

    The non-specific immune parameters, disease resistance and immune genes expressions in Macrobrachium rosenbergii were evaluated at 120 days of post feeding the diets containing the extracts of banana, Musa acuminate, fruit's peel (banana peels extract, BPE) at 0, 1.0, 3.0 and 6.0 g kg(-1). Results showed that prawns fed with a diet containing BPE at the level of 1.0, 3.0 and 6.0 g kg(-1) for 120 days had a significantly higher survival rate (30.0%, 40.0% and 56.7%, respectively) than those fed with the control diet after challenge with Lactococcus garvieae for 144 h, and the respective relative survival percentages were 22.2%, 33.3%, and 51.9%, respectively. Dietary BPE supplementation at 3.0 and/or 6.0 g kg(-1) for 120 days showed a significant increase total haemocyte count (THC), granular cell (GC), superoxide dismutase (SOD) activity, phenoloxidase (PO) activity, transglutaminase (TG) activity, and phagocytic activity and clearance efficiency to L. garvieae infection, and meanwhile, the significant decrease in haemolymph clotting times and respiratory bursts (RBs) per haemocyte of prawns were revealed. Furthermore, the mRNA expressions of prophenoloxidase (proPO), lipopolysaccharide and β-1,3-glucan binding protein (LGBP), peroxinectin (PE), transglutaminase (TG), and crustin (CT) were significantly increased. We therefore recommend that BPE can be used as an immunomodulator for prawns through dietary administration at 6.0 g kg(-1) for a long term (over 120 days) to modify immune responses and genes expression following the enhanced resistance against pathogens. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Dietary supplement of banana (Musa acuminata) peels hot-water extract to enhance the growth, anti-hypothermal stress, immunity and disease resistance of the giant freshwater prawn, Macrobrachium rosenbergii.

    Science.gov (United States)

    Rattanavichai, Wutti; Cheng, Winton

    2015-04-01

    In the present study, Macrobrachium rosenbergii were fed with diets containing extracts of banana, Musa acuminate, fruit's peel (banana peels extract, BPE) at 0, 1.0, 3.0 and 6.0 g kg(-1). The non-specific immune parameters, disease resistance and anti-hypothermal stress were evaluated at 2, 4, 8, 16 and 32 days of post feeding. Also, we demonstrated the percent weight gain (PWG), percent length gain (PLG), feeding efficiency (FE), and survival rate of giant freshwater prawn at 30, 60, 90, and 120 days of post feeding. The PWG, PLG, FE and survival rate of prawns fed at 0, 1.0, 3.0 and 6.0 g kg(-1) BPE-containing diets after 120 days were 69.5%, 75.4%, 77.8% and 83.3%; 21.8%, 23.6%, 27.8% and 33.9%; 0.60, 0.72, 0.75 and 0.90; and 55.4%, 62.2%, 62.3% and 75.3%, respectively. After 32 days of post feeding, a significant increase in total haemocyte count (THC), different haemocyte count (DHC), respiratory bursts (RBs), superoxide dismutase (SOD) activity, glutathione peroxidase (GPx) activity, phenoloxidase (PO) activity and transglutaminase (TG) activity, and meanwhile, a decreased haemolymph coagulation time was observed. Furthermore, phagocytic activity and clearance efficiency of prawns against Lactococcus garvieae infection were significantly increased. Prawns challenged with L. garvieae after 32 days of feeding at 1.0, 3.0 and 6.0 g kg(-1) had a significantly higher survival rate (33.3%, 40.0% and 56.7%) than those fed with the control diet. Subsequently, hypothermal (14 °C) stress was 43.4%, 50.0% and 50.0%, respectively. Altogether, we therefore recommend the dietary BPE administration at 6.0 g kg(-1) promotes growth, anti-hypothermal stress, and enhance immunity and resistance against L. garvieae in M. rosenbergii. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Zooplankton diversity of a protected and vulnerable wetland system in southern South America (Llancanelo area, Argentina

    Directory of Open Access Journals (Sweden)

    D. Sabina D’Ambrosio

    2016-02-01

    Full Text Available Abstract In arid regions, climatic conditions exert a great control on the aquatic systems present, but recent changes in climate have produced an enhanced salinization of the aquatic environments located there. Consequently, a major reduction in biodiversity would be expected in those wetlands that were originally fresh water. Salinity is a principal cause of reduced biodiversity particularly in zooplankton because few of those species can adapt to the salt pressure of saline environments. Therefore, the aim of this study was to gain essential information on the diversity of aquatic invertebrates in Llancanelo basin by focussing the analysis on the zooplankton community and exploring seasonal and spatial differences in the zooplankton assemblages of this vulnerable wetland system within an arid region of Argentina. Seasonal samples were taken at nine sites in the basin (a shallow lake, 4 springs, streams, and the Malargüe River. A total of 45 species were identified. The zooplankton abundance in the lake displayed a clear seasonal contrast and was higher than that recorded in the springs and lotic environments. Boeckella poopoensis, Fabrea salina, and Brachionus plicatilis predominated in the lake, indicating their halophilia. The presence of the crustaceans Alona sp., Macrocyclops albidus, and Paracyclops fimbriatus was restricted to the springs; whereas Notholca labis and Notholca squamula were found only in running water. The zooplankton species richness in the Llancanelo area is low because of both the salt content in the lake and the irregularity of freshwater entry in all locations during the annual cycle.

  18. 21 CFR 582.20 - Essential oils, oleoresins (solvent-free), and natural extractives (including distillates).

    Science.gov (United States)

    2010-04-01

    .... Clover Trifolium spp. Coca (decocainized) Erythroxylum coca Lam. and other spp. of Erythroxylum. Coffee Coffea spp. Cola nut Cola acuminata Schott and Endl., and other spp. of Cola. Coriander Coriandrum... Cola acuminata Schott and Endl., and other spp. of Cola. Laurel berries Laurus nobilis L. Laurel leaves...

  19. Four year efficacy of prophylactic human papillomavirus quadrivalent vaccine against low grade cervical, vulvar, and vaginal intraepithelial neoplasia and anogenital warts: randomised controlled trial

    DEFF Research Database (Denmark)

    Dillner, Joakim; Kjaer, Susanne K; Wheeler, Cosette M

    2010-01-01

    To evaluate the prophylactic efficacy of the human papillomavirus (HPV) quadrivalent vaccine in preventing low grade cervical, vulvar, and vaginal intraepithelial neoplasias and anogenital warts (condyloma acuminata).......To evaluate the prophylactic efficacy of the human papillomavirus (HPV) quadrivalent vaccine in preventing low grade cervical, vulvar, and vaginal intraepithelial neoplasias and anogenital warts (condyloma acuminata)....

  20. Morphological, molecular and ecological aspects of the South American hypogeous fungi Alpova austroalnicola sp. nov.

    Science.gov (United States)

    Eduardo R. Nouhra; Laura S. Domínguez; Alejandra G. Becerra; James M. Trappe

    2005-01-01

    Field studies in Argentina's Yunga District revealed Alpova austroalnicola sp. nov., a hypogeous fungus associated with Alnus acuminata ssp, acuminata. Morphological and molecular studies based on amplification and sequencing of the nuclear LSU rDNA gene showed its unique identity within ...

  1. ZOOPLANKTON FAUNA OF BİNGÖL FLOATING ISLANDS IN WINTER SEASON

    OpenAIRE

    Şen Özdemir, Nurgül; Caf, Fatma

    2015-01-01

    In this study was carried out winter season in 2011; zooplankton faunaof the Bingol Floating Islands. To­tally 18 zooplankton species were determinedas fol­lows; 14 Rotifera, 3 Cladocera and 1 Copepoda. It was determined thatthis zooplanktonic organisms consist­ed of 87.74 % Rotifera, 6.83 % Cladocera, and3.36 %  copepodit stages, 2.07 %  nauplii of copepoda. Rotif­era were thedominant group with regard to both spe­cies numbers, and individual numbers ofspecies. Cy­clops vicinus from Copepoda...

  2. Untitled

    Indian Academy of Sciences (India)

    Rice crop, nitrogen uptake, in the experiments with blue-green algae (Sahay), 223. Rice, spatial and temporal aspects of origin of (Nayar), 297. Rice, transplanted, photo-function of (Venkataraman), 145. Rotifera, responses of, to variations in some ecological factors (Arora), 57. Sphaerosyllis (Polychaeta), on a species of, ...

  3. Rotiferan Hox genes give new insights into the evolution of metazoan bodyplans

    DEFF Research Database (Denmark)

    Andreas, Fröbius C.; Funch, Peter

    2017-01-01

    The phylum Rotifera consists of minuscule, nonsegmented animals with a unique body plan and an unresolved phylogenetic position. The presence of pharyngeal articulated jaws supports an inclusion in Gnathifera nested in the Spiralia. Comparison of Hox genes, involved in animal body plan patterning...

  4. New insights on the musculature of filospermoid Gnathostomulida

    DEFF Research Database (Denmark)

    Gąsiorowski, Ludwik; Bekkouche, Nicolas Tarik; Sørensen, Martin Vinther

    2017-01-01

    . In addition to known pharyngeal muscles we found new apophyseal abductors not uncovered in bursovaginoid gnathostomulids, but which resemble certain muscles of the sister group (Micrognathozoa + Rotifera) and may present an autapomorphy of Gnathifera. The body wall musculature exhibits greater interspecific...

  5. The effect of some environmental factors on zooplankton community ...

    African Journals Online (AJOL)

    The zooplankton of Lake Qarun was studied January–December 2003. A total of 26 species was recorded, amongst which protozoa, primarily ciliophora, were most abundant (79% of the species total), followed by rotifera (13%) and copepoda (8%). The average density ranged from 965–1 452 l–1. The highest density (2 ...

  6. Taxa Composition, Abundance, Distribution And Diversity Of The ...

    African Journals Online (AJOL)

    Forty-eight genera of plankton were recorded; nine of Cyanophyceae, thirteen each of Chlorophyceae and Bacillariophyceae, seven of Protozoa and three each of Rotifera and Crustacea. Members of Cyanophyceae dominated the assemblage accounting for 91.77% of the total plankton abundance. All the major plankton ...

  7. Zooplankton composition and community structure in Lake Tiga ...

    African Journals Online (AJOL)

    Zooplankton in Lake Tiga was identified and its community structure assessed between March 2009 and March 2011. A total of 54 species of zooplankton was recorded, comprising two species of Protozoa, 26 species of Rotifera, eight species of Copepoda, 11 species of Cladocera, four species of Ostracoda and three ...

  8. Relationship between physicochemical parameters and ...

    African Journals Online (AJOL)

    Zooplankton samples were collected with silk plankton net of 25cm diameter of 70µm meshes attached with a bottle of 50ml capacity at the base and collection of samples of zooplanktons through vertical hauling.Five different groups of zooplankton were identified in this study where Rotifera group represented as the most ...

  9. Response of food organisms to inorganic nitrogen availability ...

    African Journals Online (AJOL)

    Influence of inorganic N2 forms on pond food organisms was investigated. Seven identified plankton taxa comprising four phytoplankton: Desmidiaceae (desmids), Bacillariophyceae (diatoms), Cyanophyceae (blue-green algae) and Chlorophyceae (green algae) and three zooplankton: Protozoa, Cladocera and Rotifera ...

  10. Avaliação dos métodos de amostragem para fauna perifítica em macrófitas na Reserva da Biosfera, Serra do Espinhaço, Estado de Minas Gerais, Brasil - DOI: 10.4025/actascibiolsci.v30i3.377 Evaluation of sampling methods for periphytic fauna in macrophytes at the Espinhaço Mountain Range Biosphere Reserve, Minas Gerais State, Brazil - DOI: 10.4025/actascibiolsci.v30i3.377

    Directory of Open Access Journals (Sweden)

    Cristiane Machado López

    2008-10-01

    Full Text Available Os métodos “Jarra”, “Remocao Manual” e “Draga de Eckman modificada” foram avaliados para amostrar a fauna perifitica associada a macrofitas aquaticas. Foram coletadas 63 amostras em cinco ambientes lenticos e tres loticos na reserva da biosfera da Serra do Espinhaco (Estado de Minas Gerais, Brasil. Os testes estatisticos Anova e Tukey foram feitos para riqueza de Protista, Rotifera e Crustacea, enquanto para a abundancia de Protista, Rotifera, Crustacea, Gastrotricha, Tardigrada e Nematoda foram avaliados os percentuais. Os protozoarios e rotiferos representaram 80% da abundancia e riqueza da comunidade. Nos ecossistemas avaliados todos os metodos foram relevantes para Protista, por outro lado, o metodo da Jarra foi o mais adequado para a analise de Crustacea. Entre os metodos, a Draga foi menos indicada para os grupos de microinvertebrados nos ecossistemas aquaticos. Os metodos Remocao Manual e Draga foram apropriados para analisar Rotifera. A abundancia de Gastrotricha e Tardigrada demonstrou melhores resultados pelo metodo da Jarra e Nematoda pelo metodo da Draga. Os tres metodos sao apropriados para amostragem da fauna perifitica em ambos os sistemas aquaticos. Entretanto, e importante estar ciente de que para cada tipo de ecossistema a amostragem da comunidade faunistica requer um metodo especifico para obter a melhor performance.The methods “Jar”, “Manual Removal” and “modified Ekman`s Dredge” were evaluated for sampling periphyton fauna associated to aquatic macrophytes. Sixty three samples were collected from five lentic and three lotic water bodies at Espinhaço Mountain Range Biosphere Reserve (Minas Gerais, Brazil. ANOVA and Tukey statistical tests were performed for Protista, Rotifera and Crustacea richness, whilst Protista, Rotifera, Crustacea, Gastrotricha, Tardigrada and Nematoda, abundance were evaluate by percentage. Amongst the three methods, Dregde is less indicated for different water bodies systems

  11. An introduction to loricifera, cycliophora, and micrognathozoa.

    Science.gov (United States)

    Kristensen, Reinhardt Møbjerg

    2002-07-01

    Loriciferans, cycliophorans and micrognathozoans are amongst the latest groups of animals to be discovered. Other than all being microscopic, they have very different body plans and are not closely related. Loriciferans were originally assigned to the Aschelminthes. However, both new molecular and ultrastructural researches have shown that Aschelminthes consist of two unrelated groups, Cycloneuralia and Gnathifera. Cycloneuralia may be included in the Ecdysozoa, including all molting invertebrates, and Gnathifera are more closely related to Platyhelminthes. The phylum Loricifera shares many apomorphic characters (e.g., scalids on the introvert) with both Priapulida and Kinorhyncha, and can be included in the taxon Scalidophora, a subgroup of Cycloneuralia. Cycliophora was originally allied to the Entoprocta and Ectoprocta (Bryozoa) based on ultrastructual research. Subsequent molecular data show they may be related to Rotifera and Acanthocephala, within the taxon Gnathifera. The phylogenetic position of Cycliophora is therefore not settled, and more ultrastructural and molecular data are needed. Micrognathozoa is the most recent major group of animals to be described. They show strong affinities with both Rotifera and Gnathostomulida (within the taxon Gnathifera), especially in the fine structure of the pharyngeal apparatus, where the jaw elements have cuticular rods with osmiophilic cores. Furthermore the micrognathozoans have two rows of multiciliated cells that form a locomotory organ, similar to that seen in some gastrotrichs and interstitial annelids. This character is never seen in Rotifera or in the monociliated Gnathostomulida. Rotifera and Acanthocephala always have a syncytial epidermis (Syndermata). Micrognathozoa lack this characteristic feature. Therefore, they are postulated to be placed basally in the Gnathifera, either as a sister-group to Gnathostomulida or as a sister-group to Rotifera + Acanthocephala.

  12. Protein (Cyanobacteria): 428211012 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007084156.1 NC_019694 1117:23174 ... 1150:9233 1301283:90386 ... 1158:1065 118323:857 56110:857 ... hydroxylam...ine reductase Oscillatoria acuminata PCC 6304 MYCSQCEQTAGGEACYQWGACGKSPEVDALQDLLTHL

  13. Hormones and growth factors in breast cancer

    African Journals Online (AJOL)

    Herman-Giddens M. Condylomata acuminata in children and sexual abuse. Genitourin ..... accommodated reasonably easily in the outline of hormone action referred to ... tumours may still respond to hormone manipulation with another type of ...

  14. Spatio-temporal variability of dinoflagellate assemblages in different salinity regimes in the west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Alkawri, A.A.S.; Ramaiah, N.

    2008 at the estuarine sampling location off Siridao. The toxic species, Alexandrium minutum (1171 cells l sup(-1)) followed by Dinophysis acuminata (838 cells l sup(-1)) were found to attain maximum cell numbers among the 10 different toxic species...

  15. Effect of benzylaminopurine (BAP) pulsing on in vitro shoot ...

    African Journals Online (AJOL)

    user

    2011-03-28

    Mar 28, 2011 ... Research Cluster, Faculty of Science, University Malaya, 50603 Kuala Lumpur, Malaysia. Accepted 12 ... number of bud formation in shoot cultures of Musa acuminata cv. ... In tissue culture, plant growth regulators (PGR) are.

  16. Four new species of the leafhopper genus Kapsa Dworakowska from China (Hemiptera, Cicadellidae, Typhlocybinae, with a key to Chinese species

    Directory of Open Access Journals (Sweden)

    Yuehua Song

    2012-07-01

    Full Text Available In the present paper, four new species, Kapsa acuminata, K. quadrispina, K. puerensis and K. yanheensis spp. n. from southwest China are described and illustrated, and a key to the species recorded from China is provided.

  17. Phenylphenalenones Accumulate in Plant Tissues of Two Banana Cultivars in Response to Herbivory by the Banana Weevil and Banana Stem Weevil

    OpenAIRE

    H?lscher, Dirk; Buerkert, Andreas; Schneider, Bernd

    2016-01-01

    Phenylphenalenone-type compounds accumulated in the tissues of two banana cultivars—Musa acuminata cv. “Grande Naine” (AAA) and Musa acuminata × balbisiana Colla cv. “Bluggoe” (ABB)—when these were fed on by the banana weevil (Cosmopolites sordidus (Germ.) (Coleoptera: Curculionidae)) and the banana stem weevil (Odoiporus longicollis (Oliver) (Coleoptera: Curculionidae)). The chemical constituents of the banana material were separated by means of chromatographic techniques and identified by N...

  18. Lipoidal Labellar Secretions in Maxillaria Ruiz & Pav. (Orchidaceae)

    OpenAIRE

    DAVIES, K. L.; TURNER, M. P.; GREGG, A.

    2003-01-01

    The labella of Maxillaria acuminata Lindl., M. cerifera Barb. Rodr. and M. notylioglossa Rchb.f., all members of the M. acuminata alliance, produce a viscid wax‐like secretion. Histochemical analysis revealed that the chemical composition of the secretion is similar in all three species, consisting largely of lipid and protein. Light microscopy and low‐vacuum scanning electron microscopy were used to investigate the secretory process. In a fourth taxon, M. cf. notylioglossa, transmission elec...

  19. Improvement of survival and development of Pacific white shrimp Litopenaeus vannamei larvae by feeding taurine enriched rotifers

    Directory of Open Access Journals (Sweden)

    Dedi Jusadi

    2015-03-01

    Full Text Available ABSTRACTThe objective of the present experiment was to study the most optimum taurine enrichment concentration of rotifers in improving Pacific white shrimp larva Litopenaeus vannamei survival and development. White shrimp larvae at sixth naupliar stage were reared in 12 units of 500 L fibre glass tanks with a stocking density of 125 ind/L. Starting from zoea two stage (Z-2, the larva was provided with rotifers with different taurine enrichment concentration according to the treatments, i.e. 0 mg/L enrichment medium (A, 25 mg/L (B, 50 mg/L(C, and 100 mg/L (D. The results show that different taurine concentration in the enrichment media increased taurine level in rotifers. Furthermore, the administration of taurine enriched rotifers up to 50 mg/L significantly improved larval survival and may accelerate larval development. The experimental results also concluded that a concentration of 50 mg/L is the most optimum taurine enrichment concentration of rotifers for the improvement of white shrimp larval survival and developmental stage.Keywords: taurine, rotifer, white shrimp, enrichmentABSTRAKPenelitian ini bertujuan untuk mengkaji konsentrasi optimum taurin melalui pengayaan pada rotifera terhadap tingkat kelangsungan hidup dan perkembangan stadia larva udang vaname Litopenaeus vannamei. Larva udang vaname stadia naupli-6 dipelihara dalam 12 tangki fiberglass volume 500 L dengan kepadatan 125 ind/L. Dimulai sejak stadia zoea 2 (Z-2 larva diberi rotifera yang diperkaya dengan taurin dengan konsentrasi yang berbeda sesuai dengan perlakuan, yaitu 0 mg/L media pengkaya (A, 25 mg/L (B, 50mg/L (C, dan 100mg/L (D. Hasil penelitian menunjukkan pengayaan taurin pada konsentrasi yang berbeda menyebabkan peningkatan kandungan taurin rotifera. Sementara pemberian rotifera yang diperkaya taurin hingga 50 mg/L meningkatkan kelangsungan hidup dan mempercepat perkembangan stadia larva udang. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa pemberian

  20. Zooplankton assemblage of Oyun Reservoir, Offa, Nigeria.

    Science.gov (United States)

    Mustapha, Moshood K

    2009-12-01

    The influence of physico-chemical properties of Oyun Reservoir, Offa, Nigeria (a shallow tropical African reservoir) on its zooplankton composition and abundance were investigated at three stations for two years between January 2002 and December 2003. Diversity is not high: only three groups of zooplankton were found: Rotifera with eight genera; and Cladocera and Copepoda with three genera each. Rotifera dominated numerically (71.02%), followed by Cladocera (16.45%) and Copepoda (12.53%). The zooplankton was more prevalent during the rainy season, and there were variations in the composition and abundance along the reservoir continuum. Factors such as temperature, nutrients, food availability, shape and hydrodynamics of the reservoir, as well as reproductive strategies of the organisms, strongly influence the generic composition and population density of zooplankton. Prevention of ecological deterioration of the water body would greatly should result in a more productive water body, rich in zooplankton and with better fisheries.

  1. Effect of Kind and Dosage of Enrichment Materials on the Nutritional Quality of Rotifers Especially n3-HUFA

    Directory of Open Access Journals (Sweden)

    Muhammad Agus Suprayudi

    2003-05-01

    Full Text Available This experiment was conducted to evaluate the quality of rotifer enriched with four  kinds of enrichement materials from the stand point of essensial fatty acids. Rotifer was enriched at 24 - 25oC for 18 hours at a density of 1000 ind/ml.  Rotifers were treated by four kinds of enrichment materials such as oleic acid (R-OA, two different density of Nannochloropsis oculata, (4x107 and 16x107 cell/ml; R-N18 and R-N42 two different levels of eicosapentaenoic acids (EPA triglyceride type (EPA-TAG (20 and 40 ml/ml; R-E20, R-E40 and two different level of EPA ethyl ester (EPA-EE (R-EE25 and R-EE50% respectively. Rotifers enriched with Nannochloropsis oculata and EPA-EE type have a similar profile of essensial fatty acid especially on n3-HUFA that dominated by EPA, while DHA was in a trace amount or not detected.  In addition Nannochloropsis oculata as an enrichment material showed the highest population density of rotifers during enrichment periods.  Rotifer enriched with EPA-TAG has a more complete of essential fatty acid profile compared to other enrichment materials due to their contained both of EPA and DHA. We conclude that rotifer enriched with EPA-TAG as enrichment material showed the best nutritional quality of rotifers from the stand point of essential fatty acid. Key words :  Rotifers, enrichment, eicosapentaenoic acid, docosaheksaenoic acid,  n3-HUFA   ABSTRAK Penelitian ini dilakukan untuk mengetahui profil asam lemak rotifera yang diperkaya dengan berbagai macam jenis dan dosis pengkaya. Rotifera dengan kepadatan 1000 ind./ml diperkaya dengan bebagai bahan pengkaya seperti asam oleat (R-OA; Nannochloropsis oculata dengan kepadatan 4x107 dan 16x107 sel/ml (R-N18 dan R-N42; eicosapentaenoic acid (EPA tipe triglicerida (EPA-TAG  dengan dosis 20 dan 40 μl (R-E20 dan R-E40 dan EPA tipe ethyl esther (EPA-EE  dengan dosis 25 dan 50 μl per liter (R-EE25 and R-EE50%. Rotifera diperkaya selama 18 jam pada suhu 24-25oC. Rotifera yang

  2. On the phylogeny of the metazoa in the light of Cycliophora and Micrognathozoa

    DEFF Research Database (Denmark)

    Sorensen, M. V.; Funch, P.; Willerslev, E.

    2000-01-01

    lamina. An earlier suggested close relationship between Cycliophora and Ectoprocta is rejected. The rotifer-like animal Micrognathozoa is placed in the clade Gnathifera, which also contains Gnathostomulida, Seisonida, Acanthocephala and Eurotatoria. Gnathifera is supported by the presence of jaws...... with a unique ultrastructure and cross-striated muscles attached to the jaw elements by epithelial cells. The jaws in Acanthocephala are considered secondarily reduced. In the analysis, Rotifera turns out to be paraphyletic with respect to Acanthocephala....

  3. Freshwater copepods and rotifers: predators and their prey

    Czech Academy of Sciences Publication Activity Database

    Brandl, Zdeněk

    2005-01-01

    Roč. 546, č. 1 (2005), s. 475-489 ISSN 0018-8158. [Rotifera /10./. Illmitz, 07.06.2003-13.06.2003] R&D Projects: GA AV ČR(CZ) KSK6005114 Institutional research plan: CEZ:AV0Z60170517 Keywords : rotifers * cyclopoid copepod s * calanoid copepod s * feeding * predation Subject RIV: EG - Zoology Impact factor: 0.978, year: 2005

  4. Photo Degradation in Dye-Sensitized Solar Cells

    Directory of Open Access Journals (Sweden)

    T. J. Abodunrin

    2015-05-01

    Full Text Available Mesoporous TiO2 of 20nm diameter is prepared in-tandem with organic dyes and based on Fluorine –doped SnO2 (FTO, conducting base is produced by hydrothermal process. The prepared mesoporous Cola Acuminata (C.acuminata, Lupinus Arboreus (L.arboreus and Bougainvillea Spectabilis (B.spectabilis films (0.16 cm2 are applied; individually and in combination as interfacial layer in-between nanocrystalline TiO2 (NC- TiO2 and the FTO anode in the dye-sensitized solar cell (DSSC. Absorbance index (A.I of all three dyes was studied within wavelength range 200-900 nm for a period of 11 months, equivalent to 352 sun exposure. C.acuminata had A.I value 4.00 that decreased to 2.32 under exposure to AM1.5 global conditions. B.spectabilis A.I was 1.19 but decreased to 0.520 within same period of study. Combination of C.acuminata and B.spectabilis gave A.I value 1.40, dye cocktails of C.acuminata, B.spectabilis and L.arboreus gave 2.00 A.I value for same wavelength range. A UV/Vis photo spectrometer was used to determine the prominent peaks and absorbance at such wavelengths. This exponential relationship is subject of our explorative study.

  5. Evaluation of sampling methods for periphytic fauna in macrophytes at the Espinhaço Mountain Range Biosphere Reserve, Minas Gerais State, Brazil = Avaliação dos métodos de amostragem para fauna perifítica em macrófitas na Reserva da Biosfera, Serra do Espinhaço, Estado de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Helena Lúcia Menezes Ferreira

    2008-07-01

    Full Text Available The methods “Jar”, “Manual Removal” and “modified Ekman Dredge” wereevaluated for sampling periphyton fauna associated with aquatic macrophytes. Sixty-three samples were collected from five lentic and three lotic water bodies at the Espinhaço Mountain Range Biosphere Reserve (Minas Gerais State, Brazil. Anova and Tukey statistical tests were performed for Protista, Rotifera and Crustacea richness, whereas the abundance of Protista, Rotifera, Crustacea, Gastrotricha, Tardigrada and Nematoda was evaluated by percentage. Of the three methods, the Dredge is less indicated for different water bodies systems in which there is interest in analyzing various microinvertebrate groups. The Protista and Rotifera represent 80% of the total abundance and richness in the invertebrate community. In the ecosystems evaluated, all methods are relevant for Protistaanalysis; on the other hand, Crustacea analysis required the Jar method. Manual Removal and Dredge methods are appropriate for Rotifera analysis. Gastrotricha and Tardigrada abundance presented better results with the Jar method; Nematoda with the Dredgemethod. The three methods are appropriate for periphyton fauna sampling in both water body systems; nevertheless, it is important to be aware that for each fauna community in a specified ecosystem, there is a specific method for best performance.Os métodos “Jarra”, “Remoção Manual” e “Draga de Eckman modificada” foram avaliados para amostrar a fauna perifítica associada à macrófitas aquáticas. Foram coletadas 63 amostras em cinco ambienteslênticos e três lóticos na reserva da biosfera da Serra do Espinhaço (Estado de Minas Gerais, Brasil. Os testes estatísticos Anova e Tukey foram feitos para riqueza de Protista, Rotifera eCrustacea, enquanto para a abundância de Protista, Rotifera, Crustacea, Gastrotricha, Tardigrada e Nematoda foram avaliados os percentuais. Os protozoários e rotíferos representaram 80% daabund

  6. Acantholytic dermatosis of the crural folds with ATP2C1 mutation is a possible variant of Hailey-Hailey Disease.

    Science.gov (United States)

    Lipoff, Jules B; Mudgil, Adarsh V; Young, Saryna; Chu, Paul; Cohen, Steven R

    2009-01-01

    We describe a patient with acantholytic dermatosis of the crural folds (ADCF) that was misdiagnosed and treated as condyloma acuminata for 13 years. After many skin biopsies consistently showed epidermal acantholysis and negative human papillomavirus serotyping excluded condyloma acuminata, a diagnosis of ADCF was considered most likely. Acitretin effectively suppressed the symptomatic hyperkeratosis. Subsequent genetic testing revealed a deletion in the ATP2C1 gene that led us to conclude that this case of ADCF is probably a variant of familial benign chronic pemphigus (Hailey-Hailey disease).

  7. Morphological, molecular and ecological aspects of the South American hypogeous fungus Alpova austroalnicola sp. nov.

    Science.gov (United States)

    Nouhra, Eduardo R; Dominguez, Laura S; Becerra, Alejandra G; Trappe, James M

    2005-01-01

    Field studies in Argentina's Yunga District revealed Alpova austroalnicola sp. nov., a hypogeous fungus associated with Alnus acuminata ssp. acuminata. Morphological and molecular studies based on amplification and sequencing of the nuclear LSU rDNA gene showed its unique identity within Alpova. Related genera included in the analyses were Boletus edulis, Rhizopogon spp., Suillus luteus and Truncocolumella citrina. Additional observations of animal diggings around the sites and microscopic examination of fecal pellets of the nine-banded armadillo (Dasypus novemcinctus novemcinctus) indicate A. austroalnicola is consumed and its spores dispersed by animals.

  8. Headspace Analysis of Volatile Compounds Coupled to Chemometrics in Leaves from the Magnoliaceae Family

    Directory of Open Access Journals (Sweden)

    Mohamed A. Farag

    2015-01-01

    Full Text Available Headspace volatile analysis has been used for volatiles profiling in leaves of 4 Magnolia species with a total of 75 compounds were identified. Monterpene hydrocarbons dominated the volatile blend of M. calophylla (86%, M. acuminata (78%, M. virginiana (70% and M. grandiflora (47% with b -pinene and b -ocimene occurring in the largest amounts, whereas sesquiterpenes were the most abundant compounds in M. grandiflora (39%. High levels of oxygenated compounds were only found in M. virginiana volatile blend (11.4% with 2-phenylethyl alcohol as major component. Hierarchical cluster analysis performed on volatiles content revealed the close relationship between M. acuminata and M. calophylla.

  9. Phenylphenalenones Accumulate in Plant Tissues of Two Banana Cultivars in Response to Herbivory by the Banana Weevil and Banana Stem Weevil.

    Science.gov (United States)

    Hölscher, Dirk; Buerkert, Andreas; Schneider, Bernd

    2016-08-25

    Phenylphenalenone-type compounds accumulated in the tissues of two banana cultivars-Musa acuminata cv. "Grande Naine" (AAA) and Musa acuminata × balbisiana Colla cv. "Bluggoe" (ABB)-when these were fed on by the banana weevil (Cosmopolites sordidus (Germ.) (Coleoptera: Curculionidae)) and the banana stem weevil (Odoiporus longicollis (Oliver) (Coleoptera: Curculionidae)). The chemical constituents of the banana material were separated by means of chromatographic techniques and identified by NMR spectroscopy. One new compound, 2-methoxy-4-phenylphenalen-1-one, was found exclusively in the corm material of "Bluggoe" that had been fed on by the weevils.

  10. Phenylphenalenones Accumulate in Plant Tissues of Two Banana Cultivars in Response to Herbivory by the Banana Weevil and Banana Stem Weevil

    Directory of Open Access Journals (Sweden)

    Dirk Hölscher

    2016-08-01

    Full Text Available Phenylphenalenone-type compounds accumulated in the tissues of two banana cultivars—Musa acuminata cv. “Grande Naine” (AAA and Musa acuminata × balbisiana Colla cv. “Bluggoe” (ABB—when these were fed on by the banana weevil (Cosmopolites sordidus (Germ. (Coleoptera: Curculionidae and the banana stem weevil (Odoiporus longicollis (Oliver (Coleoptera: Curculionidae. The chemical constituents of the banana material were separated by means of chromatographic techniques and identified by NMR spectroscopy. One new compound, 2-methoxy-4-phenylphenalen-1-one, was found exclusively in the corm material of “Bluggoe” that had been fed on by the weevils.

  11. DArT whole genome profiling provides insights on the evolution and taxonomy of edible Banana (Musa spp.)

    Czech Academy of Sciences Publication Activity Database

    Sardos, J.; Perrier, X.; Doležel, Jaroslav; Hřibová, Eva; Christelová, Pavla; Van den Houwe, I.; Kilian, A.; Roux, N.

    2016-01-01

    Roč. 118, č. 7 (2016), s. 1269-1278 ISSN 0305-7364 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LG15017 Institutional support: RVO:61389030 Keywords : multilocus genotype data * arrays technology dart * genetic diversity * population-structure * balbisiana colla * acuminata colla * markers * identification * aflp * domestication * Musa acuminata * Musa balbisiana * Musa spp. * banana * DArT * domestication * taxonomy * classification * domestication Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 4.041, year: 2016

  12. Réflexions sur les rotifères en tant qu'indicateurs biologiques

    Directory of Open Access Journals (Sweden)

    POURRIOT R.

    1976-01-01

    Full Text Available Quelques espèces de Rotifères fournissent un bon exemple d'indicateurs écologiques pour un facteur limitant : Synchaeta lakowitziana, Conochitoides natans, Notholca spp (température, Brachionus plicatilis (salinité. Le système d'indexation des espèces à la qualité des eaux est discuté. Les espèces strictement édaphiques (non aquatiques, les espèces rares appartenant à des genres où la variabilité est grande et les espèces euryoecques, peu caractéristiques, devraient être exclues des listes d'indicateurs établies par SLADECEK (1973, car elles ne facilitent pas l'application de ce système. Il s'avère nécessaire d'améliorer le poids indicatif et la valeur de saprobité des espèces, de ne conserver que les plus caractéristiques par leur constance et leur fidélité. Il serait, de plus, intéressant de se référer à des index plus dynamiques que statiques.

  13. Seed oil content and fatty acid composition of annual halophyte ...

    African Journals Online (AJOL)

    ajl yemi

    2011-12-19

    Dec 19, 2011 ... 1State Key Laboratory of Desert and Oasis Ecology, Xinjiang Institute of Ecology and Geography, Chinese Academy of. Sciences, Urumqi 830011, China. 2Graduate University of ... of S. acuminata: brown with soft coarse seed coat and black with rigid smooth seed coat (Ding et al., 2010). Brown and black ...

  14. Regeneración de palmas en plantaciones y bosques nativos en el santuario de fauna y flora Otún, Quimbaya (Risaralda, Colombia

    Directory of Open Access Journals (Sweden)

    Diego Felipe Correa Gómez

    2006-01-01

    undata, Ch. pinnatifron y P. acuminata. En general, las clases plántulas y juveniles 1 contuvieron la mayor cantidad de individuos, con un máximo del 92% de total de individuos de G. undata encontrados en las urapaneras.

  15. Temperature effects on peel spotting in "Sucrier banana" fruit

    NARCIS (Netherlands)

    Trakulnaleumsai, C.; Ketsa, S.; Doorn, van W.G.

    2006-01-01

    Banana fruit of the cultivar `Sucrier¿ (Musa acuminata, AA Group) develops peel spotting at a relatively early stage of development (when the peel is about as slightly more yellow than green). Holding ripening bananas at 15 and 18 °C instead of room temperature (26¿27 °C) only temporarily reduced

  16. 21 CFR 182.20 - Essential oils, oleoresins (solvent-free), and natural extractives (including distillates).

    Science.gov (United States)

    2010-04-01

    ... (clary sage) Salvia sclarea L. Clover Trifolium spp. Coca (decocainized) Erythroxylum coca Lam. and other spp. of Erythroxylum. Coffee Coffea spp. Cola nut Cola acuminata Schott and Endl., and other spp. of Cola. Coriander Coriandrum sativum L. Cumin (cummin) Cuminum cyminum L. Curacao orange peel (orange...

  17. Seed oil content and fatty acid composition of annual halophyte ...

    African Journals Online (AJOL)

    Suaeda acuminata produces two morphologically distinct types of seeds on the same plant. This study was conducted to compare oil content and fatty acid composition of the two seed morphs. Though oil characteristics between dimorphic seeds showed statistically significant difference, these differences were relatively ...

  18. In vitro multiplication of banana (Musa sp.) cv. Grand Naine

    African Journals Online (AJOL)

    SAM

    2014-07-02

    Jul 2, 2014 ... with IAA 2.00 mg/l resulted in maximum establishment of cultures in lesser time. MS medium + BAP. 4.00 mg/l + ... is, Musa acuminata (Malaysia) and Musa balbsiana. (India) (Georget et al., 2000). Banana plantlets produced.

  19. 2018-02-16T09:03:05Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    Key Words: Banana, interspecific hybridisation, ploidy level, RAPD Résumé Les bananes cultivées obtenues par hybridation interspécifique de deux diploides sauvages (2n=2x=22), Musa acuminata and M. balbisiana étaient les donneurs des génomes A et B, respectivement. La plupart des bananes cultivées sont ...

  20. Irinotecan: from clinical pharmacokinetics to pharmacogenetics

    NARCIS (Netherlands)

    A.H.J. Mathijssen (Ron)

    2002-01-01

    textabstractFour decades ago, a plant alkaloid was isolated from the Chinese tree Camptotheca acuminata (Nyssaceae family), which showed promising antitumor activity in vitro (1 ). At that moment, a relatively new class of anticancer agents was born. Unfortunately, during clinical trials, this

  1. A Review of the Bio-Activity Relationship of Mistletoes and the ...

    African Journals Online (AJOL)

    The following six host trees and their mistletoes were investigated: Azadirachta indica (neem), Psidium guajava (guava), Pentaclethra macrophylla (oil-bean), Kola acuminata (cola nut), Persea americana (avocado), and Baphia nitida (cam wood). The work showed that of the six host trees and their mistletoes studied, four ...

  2. Colchicine and amiprophos-methyl (APM) in polyploidy induction in ...

    African Journals Online (AJOL)

    Jane

    2011-10-12

    Oct 12, 2011 ... The objective was to assess the colchicine and amiprophos-methyl (APM) concentration and exposure period in the chromosome duplication of breed banana plants diploids. Banana stem tips were used from the following genotypes: breed diploids (1304-04 [Malaccensis x Madang (Musa acuminata spp.

  3. Effects of relative humidity on banana fruit drop

    NARCIS (Netherlands)

    Saengpook, C.; Ketsa, S.; Doorn, van W.G.

    2007-01-01

    Commercial ripening of banana fruit occurs at high relative humidity (RH), which prevents browning of damaged skin areas. In experiments with ripening at high RH (94 ± 1%) the individual fruit (fingers) of `Sucrier¿ (Musa acuminata, AA Group) banana exhibited a high rate of drop. The falling off of

  4. Senescent spotting of banana peel is inhibited by modified atmosphere packaging

    NARCIS (Netherlands)

    Choehom, R.; Ketsa, S.; Doorn, van W.G.

    2004-01-01

    Banana fruit (Musa cavendishii [Musa acuminata] AA Group cv. Sucrier) were placed in trays and held at 29-30 degreesC. Covering the trays with 'Sun wrap' polyvinyl chloride film prevented the early senescent peel spotting, typical for this cultivar. Carbon dioxide and ethylene concentrations within

  5. A new species of Combretum from East Borneo

    NARCIS (Netherlands)

    Exell, A.W.

    1954-01-01

    Combretum kostermansii Exell, sp. nov. Frutex scandens, ramulis primo fulvo-pilosis et tomentellis demum sparse pilosis, atro-rubris. Folia opposita breviter petiolata, petiolo 1—3 mm longo, piloso, lamina chartacea, ovata vel oblongo-ovata, basi cordata, apice acuminata, 2—7 X 1.8—3.6 cm, supra

  6. Florae Malesianae Precursores II. The Convolvulaceae of Malaysia IX

    NARCIS (Netherlands)

    Hoogland, R.D.

    1953-01-01

    Erycibe beccariana Hoogl. sp. nov. — Frutex scandens, ramulis junioribus sparsim stellato-hirsutis, adultioribus glabrescentibus cortice rimis longitudinalibus fisso. Folia elliptica ad elliptico-oblonga, 9—13 X 4— 71/2 cm, apice breviter acuminata, basi rotundata vel minute cordata, supra glabra,

  7. A Study to Determine the Best Method of Caring for Certain Short-Stay Surgical Patients at Reynolds Army Community Hospital

    Science.gov (United States)

    1988-09-01

    herniorrhaphy Umbilical sinus, excision Venectomy Ventral hernia GYNECOLOGIC Adhesions of clitoris, release Cervical polypectomy Condylomata acuminata...window Arch bars, removal and placement Branchial arch appendages, excision Bronchoscopy (Rigid) Caldwell-Luc operation Cervical node biopsy Closed...Breast mass, excision Bronchoscopy with operative procedure Cervical node biopsy Debridement of wound, infection, or burn Debridement of chest wall

  8. Physiological and biochemical changes during banana ripening and finger drop

    NARCIS (Netherlands)

    Imsabai, W.; Ketsa, S.; Doorn, van W.G.

    2006-01-01

    Fruit drop of banana is due to breaking at the junction of the pedicel and pulp, and we found no true abscission zone. The breakage seems therefore due to weakening of the peel. We investigated pectin hydrolysis and some properties at the rupture zone, using `Hom Thong` (Musa acuminata, AAA Group)

  9. Hot water treatments delay cold-induced banana peel blackening

    NARCIS (Netherlands)

    Promyou, S.; Ketsa, S.; Doorn, van W.G.

    2008-01-01

    Banana fruit of cv. Gros Michel (Musa acuminata, AAA Group, locally called cv. Hom Thong) and cv. Namwa (Musa x paradisiaca, ABB Group) were immersed for 5, 10 and 15 min in water at 42 degrees C, or in water at 25 degrees C (control), and were then stored at 4 degrees C. Hot water treatment for 15

  10. Colchicine and amiprophos-methyl (APM) in polyploidy induction in ...

    African Journals Online (AJOL)

    The objective was to assess the colchicine and amiprophos-methyl (APM) concentration and exposure period in the chromosome duplication of breed banana plants diploids. Banana stem tips were used from the following genotypes: breed diploids (1304-04 [Malaccensis x Madang (Musa acuminata spp. banksii)] and ...

  11. Current status of the banana and plantain collection at the USDA-ARS Tropical Agriculture Research Station, Mayaguez, Puerto Rico

    Science.gov (United States)

    Banana (Musa acuminata Colla. [AA, AAA]; Musa x paradisiaca Colla [ABB, AAAB, AABB]), are large monocotyledonous plants in the Musaceae family and is one of the world’s furthermost important crops in the world. High genetic variability can be found in centers of origin, but the lack of diversity in...

  12. Evaluation of genetic diversity between 27 banana cultivars (Musa ...

    African Journals Online (AJOL)

    Cultivated bananas (Musa spp.) are mostly diploid or triploid cultivars with various combinations of the A and B genomes inherited from their diploid ancestors Musa acuminata Colla. and Musa balbisiana. Colla. respectively. Random amplified polymorphic DNA (RAPD) markers were used to establish the relatedness of 27 ...

  13. Changes in antioxidant and fruit quality in hot water-treated ‘Hom Thong’ banana fruit during storage

    Science.gov (United States)

    The effects of hot water treatment on antioxidant phytochemicals and fruit quality were investigated in banana fruit of cv. Gros Michel (Musa acuminata, AAA Group, locally called cv. Hom Thong) by immersing fruits in hot water (50 'C) for 10 min, before storage at 25 'C for 10 days or 14 'C for 8 da...

  14. Analysis of genetic variation in different banana ( Musa species ...

    African Journals Online (AJOL)

    The banana (Musa acuminata Colla) is considered as an important crop plant due to its high economic value as good dietary source. Here, we analyze the genetic relationship of four different banana varieties that are cultivated in south India. Random amplified polymorphic DNAs (RAPDs) fingerprinting of these banana ...

  15. Banana MaMADS transcription factors are necessary for fruit ripening and molecular tools to promote shelf-life and food security

    Science.gov (United States)

    Genetic solutions to postharvest crop loss can reduce cost and energy inputs while increasing food security, especially for banana (Musa acuminata), which is a significant component of worldwide food commerce. We have functionally characterized two banana E class (SEPALLATA3 [SEP3]) MADS box genes, ...

  16. Lack of Ecotypic Differentiation: Plant Response to Elevation, Population Origin, and Wind in the Luquillo Mountains, Puerto Rico

    Science.gov (United States)

    Ned Fetcher; Roberto A. Cordero; Janice Voltzow

    2000-01-01

    How important is ecotypic differentiation along elevational gradients in the tropics? Reciprocal transplants of two shrubs, Clibadium erosum (Asteraceae) and Psychotria berteriana (Rubiaceae), and a palm, Prestoea acuminata var. montana (Palmaceae), were used to test for the effect of environment and population origin on growth and physiology in the Luquillo...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 88 ... Vol 6, No 1 (2008), Fournier\\'s Gangrene: Irrua Teaching Hospital, Nigeria, Experience. Abstract. E Irekpita, TAT Salami, AE Dongo, KC Eze, MO Momoh, SA Okogbenin. Vol 3, No 3 (2005), Giant condylomata acuminata of buschke and löwenstein - single case report & review, Abstract. Adil HH Bashir.

  18. PREDICTION DE LA CROISSANCE DU BANANIER PLANTAIN ...

    African Journals Online (AJOL)

    Hornik K., Stinchcombe M., White H., Auer P. 1994. Degree of approximation results of feedforward networks approximating unknown mapping et their derivatives. Neur. Net. Comp., 6 : 1262 - 1275. Jannoyer M. 1995. Déterminisme du nombre d'or- ganes reproducteurs d'une inflorescence de bananier (Musa acuminata, ...

  19. Combination with Tadalafil reduces the aphrodisiac activity of Cola ...

    African Journals Online (AJOL)

    Sexual behavioural parameters of mount latency, mount frequency, genital grooming, anogenital sniffing, and chasing of female animals were recorded in male rats (one hour after administration of extract) by their interaction with a receptive female (1:1) for an observatory period of 1 hour. Cola acuminata and Garcinia kola ...

  20. Toxin- and cadmium-induced cell death events in tomato suspension cells resemble features of hypersensitive response

    NARCIS (Netherlands)

    Iakimova, E.T.; Woltering, E.J.; Yordanova, Z.P.

    2007-01-01

    Elicitors of different origin (fumonisin B1, fungal toxin), camptothecin (alkaloid from Camptotheca acuminata), mastoparan (wasp venom) and the heavy metal (cadmium) were tested for their ability to induce programmed cell death (PCD) in a model system of tomato cell culture, line MsK8. By employing

  1. Recovery of active pathogenesis-related enzymes from the apoplast ...

    African Journals Online (AJOL)

    Overall protease activity intensity was higher in the symplast. Maximum symplast contamination of the apoplast was 2% as estimated by glucose 6-phosphate dehydrogenase activity, a biochemical marker for symplast. Accumulation of pathogenesis-related enzymatic activities in the apoplast of M. acuminata leaf tissue was ...

  2. Florae Malesianae Precursores III. Dialium L. (Caesalpiniaceae)

    NARCIS (Netherlands)

    Wit, de H.C.D.

    1953-01-01

    Dialium hydnocarpoides, sp. nov. — Foliola (15)17—19, elliptice oblonga, 4.5—6.5(8.5) cm longa, 2—2.5(3) cm lata, apice abrupte breviter acuminata. Sepala extus pubescentia, intus puberula. Stamina 2, raro 3. Ovarium in receptaculo plano, lato, strigoso excentrice insertum. Stylus glaber. Legumen

  3. EFFECTS OF INSECT PEST INFESTATION ON THE CAFFEINE ...

    African Journals Online (AJOL)

    The caffeine content of nuts of Cola nitida and C. acuminata infested by insect pests in four major geographical zones of Nigeria have been determined and compared with the uninfested ones using high-performance liquid chromatography (HPLC). The findings showed that the infestation has no significant effect on the ...

  4. Zooplankton assemblage of Oyun Reservoir, Offa, Nigeria

    Directory of Open Access Journals (Sweden)

    Moshood K Mustapha

    2009-12-01

    Full Text Available The influence of physico-chemical properties of Oyun Reservoir, Offa, Nigeria (a shallow tropical African reservoir on its zooplankton composition and abundance were investigated at three stations for two years between January 2002 and December 2003. Diversity is not high: only three groups of zooplankton were found: Rotifera with eight genera; and Cladocera and Copepoda with three genera each. Rotifera dominated numerically (71.02%, followed by Cladocera (16.45% and Copepoda (12.53%. The zooplankton was more prevalent during the rainy season, and there were variations in the composition and abundance along the reservoir continuum. Factors such as temperature, nutrients, food availability, shape and hydrodynamics of the reservoir, as well as reproductive strategies of the organisms, strongly influence the generic composition and population density of zooplankton. Prevention of ecological deterioration of the water body would greatly should result in a more productive water body, rich in zooplankton and with better fisheries. Rev. Biol. Trop. 57 (4: 1027-1047. Epub 2009 December 01.La influencia de las propiedades fisicoquímicas del Reservorio Oyun, Offa, Nigeria (un embalse tropical somero sobre la composición y abundancia del zooplancton fue investigada en tres estaciones entre enero de 2002 y diciembre de 2003. La diversidad no resultó muy alta con tres grupos de zooplancton: Rotifera con ocho géneros, y Cladocera y Copepoda con tres géneros cada uno. Rotifera dominó (71.02%, seguido de Cladocera (16.45% y Copepoda (12.53%. El zooplancton fue más común durante la temporada de lluvias, y hubo variaciones en su composición y abundancia a lo largo del embalse. Factores tales como la temperatura, los nutrientes, la disponibilidad de alimentos, la forma y la hidrodinámica del embalse, así como las estrategias reproductivas de los organismos, influyen fuertemente en la composición genérica y la densidad poblacional del zooplancton. La

  5. 18S rRNA data indicate that Aschelminthes are polyphyletic in origin and consist of at least three distinct clades.

    Science.gov (United States)

    Winnepenninckx, B; Backeljau, T; Mackey, L Y; Brooks, J M; De Wachter, R; Kumar, S; Garey, J R

    1995-11-01

    The Aschelminthes is a collection of at least eight animal phyla, historically grouped together because the absence of a true body cavity was perceived as a pseudocoelom. Analyses of 18S rRNA sequences from six Aschelminth phyla (including four previously unpublished sequences) support polyphyly for the Aschelminthes. At least three distinct groups of Aschelminthes were detected: the Priapulida among the protostomes, the Rotifera-Acanthocephala as a sister group to the protostomes, and the Nematoda as a basal group to the triploblastic Eumetazoa.

  6. Zooplankton community of Parnaíba River, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Ludmilla Cavalcanti Antunes Lucena

    2015-03-01

    Full Text Available Aim:The objective of the present work is to present a list of species of zooplankton (Rotifera, Cladocera and Copepoda from the Parnaíba River. Additionally, we provide comments on their distribution along the river, and between dry and wet seasons.MethodsZooplankton was collected with a plankton net (60 µm mesh and concentrated into a volume of 80 mL for further analysis, during the dry (October 2010 and wet (April 2011 seasons. Sampling was restricted to the marginal areas at depths between 80 and 150 cm.ResultsA total of 132 species was recorded among the three zooplankton groups studied. During the dry season a total of 82 species was registered and 102 species was registered for the wet season. Rotifera contributed with 66.7% of the species, followed by Cladocera (26.5% and Copepoda (6.8%.ConclusionsThe richness of species observed was high compared to other large rivers in Brazil. In the context of current policies for water management and river diversions in northeastern Brazil, the present study highlights the importance of this river system for biodiversity conservation.

  7. A mitogenomic re-evaluation of the bdelloid phylogeny and relationships among the Syndermata.

    Directory of Open Access Journals (Sweden)

    Erica Lasek-Nesselquist

    Full Text Available Molecular and morphological data regarding the relationships among the three classes of Rotifera (Bdelloidea, Seisonidea, and Monogononta and the phylum Acanthocephala are inconclusive. In particular, Bdelloidea lacks molecular-based phylogenetic appraisal. I obtained coding sequences from the mitochondrial genomes of twelve bdelloids and two monogononts to explore the molecular phylogeny of Bdelloidea and provide insight into the relationships among lineages of Syndermata (Rotifera + Acanthocephala. With additional sequences taken from previously published mitochondrial genomes, the total dataset included nine species of bdelloids, three species of monogononts, and two species of acanthocephalans. A supermatrix of these 10-12 mitochondrial proteins consistently recovered a bdelloid phylogeny that questions the validity of a generally accepted classification scheme despite different methods of inference and various parameter adjustments. Specifically, results showed that neither the family Philodinidae nor the order Philodinida are monophyletic as currently defined. The application of a similar analytical strategy to assess syndermate relationships recovered either a tree with Bdelloidea and Monogononta as sister taxa (Eurotatoria or Bdelloidea and Acanthocephala as sister taxa (Lemniscea. Both outgroup choice and method of inference affected the topological outcome emphasizing the need for sequences from more closely related outgroups and more sophisticated methods of analysis that can account for the complexity of the data.

  8. Review of dermatology use of 5-aminolevulinic acid photodynamic therapy in China from 1997 to 2013

    Science.gov (United States)

    Wang, Peiru; Zhang, Guolong; Wang, Xiuli

    2015-07-01

    The prodrug 5-aminolevulinic acid (ALA) and its ester derivatives have been used in photodynamic therapy (PDT) in dermatology worldwide. In China, ALA-PDT was first used to treat urethral condylomata acuminata and non-melanoma skin cancers in 1997. A powder formulation of ALA hydrochloride was approved by the Chinese Food and Drug Administration for the treatment of condylomata acuminata in 2007. Large successful experience of treating condylomatas was accumulated compared with Western countries. Meanwhile, numerous clinical studies as well as off-label use of ALAPDT have been carried out in China. To reflect the progress of ALA-PDT in China, several major Chinese and English databases were searched and published data were reviewed in this article.

  9. Kamptotesin

    OpenAIRE

    Kurtan, Merve; Kurtoğlu, Sezin; Melikoğlu, Gülay

    2014-01-01

    Monoterpen indol alkaloit olan kamptotesin ilk olarak 1957’deÇin’de bulunan Camptotheca acuminata Decaisne türünden eldeedilmiştir. Kamptotesin sadece C. acuminata (Nyssaceae)bitkisinde değil Icacinaceae, Rubiaceae, Loganiaceae veApocynaceae gibi çeşitli familyalara ait başka bitkilerde debulunmuştur. Bu çalışma, kamptotesin ve kamptotesin türevlerininbitkiler alemindeki dağılımı ile ilgili ayrıntılı bir değerlendirmesağlamaktadır. Antitümör alkaloit olarak bilinen kamptotesin DNAtopoizomeraz...

  10. Effect of banana pulp and peel flour on physicochemical properties and in vitro starch digestibility of yellow alkaline noodles.

    Science.gov (United States)

    Ramli, Saifullah; Alkarkhi, Abbas F M; Shin Yong, Yeoh; Min-Tze, Liong; Easa, Azhar Mat

    2009-01-01

    The present study describes the utilization of banana--Cavendish (Musa acuminata L., cv cavendshii) and Dream (Musa acuminata colla. AAA, cv 'Berangan')--pulp and peel flours as functional ingredients in yellow alkaline noodles. Noodles were prepared by partial substitution of wheat flour with ripe banana pulp or peel flours. In most cases, the starch hydrolysis index, predicted glycaemic index (pGI) and physicochemical properties of cooked noodles were affected by banana flour addition. In general, the pGI values of cooked noodles were in the order; banana peel noodles banana pulp noodles peel flour was higher in total dietary fibre but lower in resistant starch contents than the pulp flour, the low pGI of banana peel noodles was mainly due to its high dietary fibre content. In conclusion, banana pulp and peel flour could be useful for controlling starch hydrolysis of yellow noodles, even though some physicochemical properties of the noodles were altered.

  11. Effect of physiological harvest stages on the composition of bioactive compounds in Cavendish bananas*

    Science.gov (United States)

    Bruno Bonnet, Christelle; Hubert, Olivier; Mbeguie-A-Mbeguie, Didier; Pallet, Dominique; Hiol, Abel; Reynes, Max; Poucheret, Patrick

    2013-01-01

    The combined influence of maturation, ripening, and climate on the profile of bioactive compounds was studied in banana (Musa acuminata, AAA, Cavendish, cv. Grande Naine). Their bioactive compounds were determined by the Folin-Ciocalteu assay and high-performance thin layer chromatographic (HPTLC) method. The polyphenol content of bananas harvested after 400 degree days remained unchanged during ripening, while bananas harvested after 600 and 900 degree days exhibited a significant polyphenol increase. Although dopamine was the polyphenol with the highest concentration in banana peels during the green developmental stage and ripening, its kinetics differed from the total polyphenol profile. Our results showed that this matrix of choice (maturation, ripening, and climate) may allow selection of the banana (M. acuminata, AAA, Cavendish, cv. Grande Naine) status that will produce optimal concentrations of identified compounds with human health relevance. PMID:23549844

  12. Wild species of interest for tourism in Manabí and Guayas, Ecuador

    Directory of Open Access Journals (Sweden)

    Sonia Rosete Blandariz

    2018-01-01

    Full Text Available Ethnobotany is the discipline that studies the relationships between man and plants. The purpose of the study was to identify the uses of wild species of interest for tourism in Manabí and Guayas. Interviews, walks and field observations were carried out in areas with little disturbed vegetation. Seventeen species were reported with at least one recognized use, some used for the manufacture of artisanal, ornamental objects, and the majority in danger of extinction due to the degradation of their habitat. The species of greatest interest for tourism due to their beauty and degree of scarcity are Attalea colenda (O.F.Cook Balslev & A.J.Hend. (Arecaceae, Brassia jipijapensis Dodson & N.H.Williams (Orchidaceae, Ceiba trischistandra (A. Gray Bakhuisen (Malvaceae, Erythrina megistophylla Diels (Fabaceae, Erythrina smithiana Krukoff Fabaceae, Macroclinium manabinum (Dodson Dodson (Orchidaceae, Passiflora sprucei Mast. (Passifloraceae, Phytelephas aequatorialis Spruce (Arecaceae and Prestoea acuminata (Willd. H.E.Moore var. acuminata (Arecaceae.

  13. Charcoal anatomy of forest species

    Directory of Open Access Journals (Sweden)

    Graciela Inés Bolzon de Muñiz1

    2012-09-01

    Full Text Available Vegetal charcoal retains the anatomical structure of the wood and may permit its botanical identification, which depends on species characteristics, the charcoal fragments size and preservation state. Anatomical characterization of ten forest species charcoal was done envisaging the identification and control of illegal charcoal. Differences between gymnosperms and angiosperms are evident in carbonized wood. Vessel diameter was statistically different between wood and charcoal in Vatairea guianensis, Mezilaurus itauba, Calophyllum brasiliense e Qualea cf. acuminata, and vessel frequency in Vatairea guianensis, Manilkara huberi, Qualea cf. acuminata e Simarouba amara. The anatomical structure from wood, in general aspects, is constant during carbonization process using temperature of 450°C, being possible to identify the material by using its cellular components.

  14. Alkaloids as taxonomic markers in some species of Magnolia L. and Liriodendron L.

    Directory of Open Access Journals (Sweden)

    Mirosław Furmanowa

    2014-01-01

    Full Text Available Some Magnoliaceae cultivated in Poland were investigated: Liriodendron tulipifera L. and 6 species of magnolia: Magnolia acuminata L., M. denudata Desr., M. kobus DC., M. obovata Thunb., M. salicifolia Maxim. and M. tripetala L. For alkaloid detection in the leaves thin-,layer chromatography was used. In Liriodendron tulipifera L. and in all the Magnolia species liriodenine which exhibits cytostatic activity was detected. The extract of Liriodendron tulipifera L. leaves showed, beside liriodenine other spots on the chromatogram than did the magnolias. Alkaloids can be utilized in the chemotaxonomy of Magnoliaceae as a diagnostic trait. The results of the investigations indicate a certain distinctiveness of M. acuminata L., in agreement with those obtained by way of numerical taxonomy. Most similar as regards alkaloid content in leaves are M. obovata Thunb. and M. tripetala L.

  15. Cola pierlotii R.Germ. : étude de la composition chimique de la graine

    Directory of Open Access Journals (Sweden)

    Lognay, G.

    2013-01-01

    Full Text Available Cola pierlotii R.Germ.: study of the chemical composition of the seed. This note reports the first analysis of the chemical composition of Cola pierlotii seed. It compares the recorded values with various literature data on Cola nitida and Cola acuminata that are the two most used species or as agent flavor or as a precursor drugs. Cola pierlotii is characterized in particular by a high caffeine content up to 1.27%.

  16. Chemical Composition and Biological Activities of the Essential Oils from Three Melaleuca Species Grown in Tunisia

    Directory of Open Access Journals (Sweden)

    Ismail Amri

    2012-12-01

    Full Text Available The chemical composition of the essential oils of Melaleuca armillaris Sm., Melaleuca styphelioides Sm. and Melaleuca acuminata F. Muell., collected in Tunisia, was studied by means of GC and GC-MS analysis. In all, 46 compounds were identified, 38 for M. armillaris, 20 for M. acuminata and eight for M. styphelioides, respectively. The presence of a sesquiterpenic fraction (52.2% characterized the oil from M. armillaris; M. sthypheliodes oil was rich in methyl eugenol, a phenolic compound (91.1%, while M. acuminata oil is mainly constituted by oxygenated monoterpenoids (95.6%. The essential oils were evaluated for their in vitro potentially phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The radicle elongation of five seeds was inhibited at the highest doses tested, while germination of all seeds was not affected. Moreover, the essential oils showed low antimicrobial activity against eight selected microorganisms.

  17. Chemical composition and biological activities of the essential oils from three Melaleuca species grown in Tunisia.

    Science.gov (United States)

    Amri, Ismail; Mancini, Emilia; De Martino, Laura; Marandino, Aurelio; Lamia, Hamrouni; Mohsen, Hanana; Bassem, Jamoussi; Scognamiglio, Mariarosa; Reverchon, Ernesto; De Feo, Vincenzo

    2012-12-05

    The chemical composition of the essential oils of Melaleuca armillaris Sm., Melaleuca styphelioides Sm. and Melaleuca acuminata F. Muell., collected in Tunisia, was studied by means of GC and GC-MS analysis. In all, 46 compounds were identified, 38 for M. armillaris, 20 for M. acuminata and eight for M. styphelioides, respectively. The presence of a sesquiterpenic fraction (52.2%) characterized the oil from M. armillaris; M. sthypheliodes oil was rich in methyl eugenol, a phenolic compound (91.1%), while M. acuminata oil is mainly constituted by oxygenated monoterpenoids (95.6%). The essential oils were evaluated for their in vitro potentially phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The radicle elongation of five seeds was inhibited at the highest doses tested, while germination of all seeds was not affected. Moreover, the essential oils showed low antimicrobial activity against eight selected microorganisms.

  18. Seasonal variability of Dinophysis spp. and Protoceratium reticulatum associated to lipophilic shellfish toxins in a strongly stratified Chilean fjord

    Science.gov (United States)

    Alves-de-Souza, Catharina; Varela, Daniel; Contreras, Cristóbal; de La Iglesia, Pablo; Fernández, Pamela; Hipp, Byron; Hernández, Cristina; Riobó, Pilar; Reguera, Beatriz; Franco, José M.; Diogène, Jorge; García, Carlos; Lagos, Néstor

    2014-03-01

    The fine scale vertical distribution of Dinophysis spp. and Protoceratium reticulatum (potential producers of lipophilic shellfish toxins, LSTs) and its relation with LSTs in shellfish was studied in Reloncaví fjord, a strongly stratified system in Southern Chile. Samples were taken over two years from late spring to early autumn (2007-2008 period) and from early spring to late summer (2008-2009 period). Dinophysis spp., in particular Dinophysis acuminata, were always detected, often forming thin layers in the region of the salinity driven pycnocline, with cell maxima for D. acuminata of 28.5×103 cells L-1 in March 2008 and 17.1×103 cells L-1 in November 2008. During the 2008-2009 sampling period, blooms of D. acuminata co-occurred with high densities of cryptophyceans and the ciliate Mesodinium spp. The highest levels of pectenotoxin-2 (PTX-2; 2.2 ng L-1) were found in the plankton in February 2009, associated with moderate densities of D. acuminata, Dinophysis tripos and Dinophysis subcircularis (0.1-0.6×103 cells L-1). However, only trace levels of PTX-2 were observed in bivalves at that time. Dinophysistoxin (DTX-1 and DTX-3) levels in bivalves and densities of Dinophysis spp. were not well correlated. Low DTX levels in bivalves observed during a major bloom of D. acuminata in March 2008 suggested that there is a large seasonal intraspecific variability in toxin content of Dinophysis spp. driven by changes in population structure associated with distinct LST toxin profiles in Reloncaví fjord during the study period. A heterogeneous vertical distribution was also observed for P. reticulatum, whose presence was restricted to summer months. A bloom of this species of 2.2×103 cells L-1 at 14 m depth in February 2009 was positively correlated with high concentrations of yessotoxins in bivalves (51-496 ng g-1) and plankton samples (3.2 ng L-1). Our results suggest that a review of monitoring strategies for Dinophysis spp. in strongly stratified fjord systems

  19. Sublittoral meiobenthic assemblages from disturbed and non-disturbed sediments in the Balearics

    Directory of Open Access Journals (Sweden)

    S. Deudero

    2000-09-01

    Full Text Available Qualitative and quantitative differences in species composition of meiobenthic communities illustrate the differences among various taxonomic assemblages in the Balearic Islands (Western Mediterranean analysed by means of multivariate analysis. Average densities ranged between 1000 and 4000 ind?10cm-2, and are in the same range as previously reported from other shallow Mediterranean areas. The dominant meiofaunal taxa were Nematoda (range 40 to 75%, Turbellaria (5-47% and Copepoda (2-14%, while other meiofaunal groups (Tardigrada and Rotifera were only represented by approximately 5% of the total abundance. The dominant nematode families were Desmodoridae, Chromadoridae and Xyalidae. The meiofaunal communities showed little variation among locations. Moreover, small-scale heterogeneity does not seem to affect nematode distribution as shown by the high similarity between replicates in the multivariate analysis.

  20. The effects of environmental parameters on zooplankton assemblages in tropical coastal estuary, South-west, Nigeria

    Directory of Open Access Journals (Sweden)

    Waidi O. Abdul

    2016-09-01

    Full Text Available The present study was carried out to examine the distribution and assemblage structure of zooplankton in relation to environmental parameters of tropical coastal estuarine ecosystem impounding Bight of Benin, Nigeria. The estuarine water samples were collected between January and December, 2014 from three sampling zones (Brushpark, Open water and Wetland then were fixed in 4% formalin. A total of twenty-eight (28 species belonging to four (4 groups were recorded in this study. These groups were rotifera, copepoda, cladocerans and ostracodas, and were all widely distributed in the three investigated zones. Higher richness, dominance and abundance indices were recorded in Zone I when compared to both Zones II and III. Cluster analysis showed five distinct species communities. The canonical correspondence analysis (CCA showed a distinct smattering positive and negative correlation on the distribution of zooplankton indicating that the relative abundance of any species was dependent on specific environmental variables.

  1. Whole-mount in situ hybridization in the rotifer Brachionus plicatilis representing a basal branch of lophotrochozoans.

    Science.gov (United States)

    Boell, Louis A; Bucher, Gregor

    2008-08-01

    In order to broaden the comparative scope of evolutionary developmental biology and to refine our picture of animal macroevolution, it is necessary to establish new model organisms, especially from previously underrepresented groups, like the Lophotrochozoa. We have established the culture and protocols for molecular developmental biology in the rotifer species Brachionus plicatilis Müller (Rotifera, Monogononta). Rotifers are nonsegmented animals with enigmatic basal position within the lophotrochozoans and marked by several evolutionary novelties like the wheel organ (corona), the median eye, and the nonpaired posterior foot. The expression of Bp-Pax-6 is shown using whole-mount in situ hybridization. The inexpensive easy culture and experimental tractability of Brachionus as well as the range of interesting questions to which it holds the key make it a promising addition to the "zoo" of evo-devo model organisms.

  2. Documenting the fauna of a small temporary pond from Pune, Maharashtra, India

    Directory of Open Access Journals (Sweden)

    Mihir R. Kulkarni

    2015-05-01

    Full Text Available Most of the limnological studies in India have focussed on a few taxa of large, permanent water bodies, and pond ecosystems, and related temporary water bodies are neglected.  We present here a faunal inventory, with representative photographs, for a single, small temporary pond, reporting over 125 species of strictly aquatic fauna and 25 species of associated fauna, even though we did not identify some groups such as Protozoa, Diptera and nymphs of Odonata, etc.  The identified species belong to seven taxa of vertebrates and invertebrates together. Arthropoda and Rotifera were the most species rich groups, observed with 83 and 45 representatives, respectively. Coleoptera were the most numerous in terms of species number.  Such a small water body holds some endemics as well as otherwise very rare animals and so deserves better attention.  We also highlight the potential and importance of such habitats for research and conservation.   

  3. Efectos de plantaciones abandonadas de especies exóticas y nativas sobre la regeneración natural de un bosque montano en Colombia

    Directory of Open Access Journals (Sweden)

    Jaime Cavelier

    1999-12-01

    Full Text Available Se realizaron censos de vegetación durante 1994 en una parcela de 0.1 ha. en cada una de las plantaciones abandonadas de Pinus radiata, Cupressus lusitanica, Eucalyptus globulus, Alnus acuminata y en un bosque secundario montano alto en los Andes centrales de Colombia. También fueron recolectados datos de las propiedades físicas y químicas de suelos superficiales. El bosque de regeneración natural tiene el mayor número de especies (33 seguido por las plantaciones de E. globulus (26 y A. acuminata (16. Las plantaciones abandonadas de P. radiata y C. lusitanica, tuvieron sólo tres especies. Entre el bosque de regeneración natural y la plantación de E. globulus hubo solamente once especies en común y solamente siete con la plantación de A. acuminata. Todas estas especies, con excepción de tres, son arbustos del sotobosque dispersados por viento o aves. En el sotobosque de la plantación de P. radiata había una regeneración abundante del árbol nacional de Colombia, Ceroxylum quindiuensis. La altura de los árboles y el área basal fueron significativamente mayores en las plantaciones de P. radiata y C. lusitanica que en el bosque de regeneración natural. De las variables ambientales y biológicas medidas en este estudio, la acumulación de acículas bajo las plantaciones de P. radiata y C. lusitanica y la alta biomasa de raíces finas bajo la plantación de C. lusitanica, podrían ser los principales factores limitantes para el establecimiento de un número mayor de especies del bosque nativo. Las propiedades químicas de los suelos varían ampliamente y no hubo diferencias coherentes entre los suelos bajo especies exóticas y nativas.Vegetation surveys were carried out during 1994 in 0.1. ha plots in abandoned plantations of Pinus radiata, Cupressus lusitanica, Eucalyptus globulus, Alnus acuminata and in a secondary upper montane rain forest in the Central Andes of Colombia. The regeneration forest had the higher number of plant

  4. Molecular analysis and genomic organization of major DNA satellites in banana (Musa spp.).

    Science.gov (United States)

    Čížková, Jana; Hřibová, Eva; Humplíková, Lenka; Christelová, Pavla; Suchánková, Pavla; Doležel, Jaroslav

    2013-01-01

    Satellite DNA sequences consist of tandemly arranged repetitive units up to thousands nucleotides long in head-to-tail orientation. The evolutionary processes by which satellites arise and evolve include unequal crossing over, gene conversion, transposition and extra chromosomal circular DNA formation. Large blocks of satellite DNA are often observed in heterochromatic regions of chromosomes and are a typical component of centromeric and telomeric regions. Satellite-rich loci may show specific banding patterns and facilitate chromosome identification and analysis of structural chromosome changes. Unlike many other genomes, nuclear genomes of banana (Musa spp.) are poor in satellite DNA and the information on this class of DNA remains limited. The banana cultivars are seed sterile clones originating mostly from natural intra-specific crosses within M. acuminata (A genome) and inter-specific crosses between M. acuminata and M. balbisiana (B genome). Previous studies revealed the closely related nature of the A and B genomes, including similarities in repetitive DNA. In this study we focused on two main banana DNA satellites, which were previously identified in silico. Their genomic organization and molecular diversity was analyzed in a set of nineteen Musa accessions, including representatives of A, B and S (M. schizocarpa) genomes and their inter-specific hybrids. The two DNA satellites showed a high level of sequence conservation within, and a high homology between Musa species. FISH with probes for the satellite DNA sequences, rRNA genes and a single-copy BAC clone 2G17 resulted in characteristic chromosome banding patterns in M. acuminata and M. balbisiana which may aid in determining genomic constitution in interspecific hybrids. In addition to improving the knowledge on Musa satellite DNA, our study increases the number of cytogenetic markers and the number of individual chromosomes, which can be identified in Musa.

  5. Effects of insect and decapod exclusion and leaf litter species identity on breakdown rates in a tropical headwater stream

    Directory of Open Access Journals (Sweden)

    José Rincón

    2014-04-01

    Full Text Available La gran variedad de especies vegetales junto a los ríos tropicales afecta la diversidad de detritos orgánicos que llegan a los arroyos, creando variaciones temporales en cantidad y calidad de hojarasca. Examinamos la influencia de las especies vegetales y de la exclusión de macroinvertebrados sobre la descomposición de hojarasca en la parte alta de un arroyo en las montañas Luquillo de Puerto Rico. Incubamos hojarasca de Dacryodes excelsa (Burseraceae, Guarea guidonia (Meliaceae, Cecropia scheberiana (Moraceae, Manilkara bidentata (Sapotaceae y Prestoea acuminata (Palmae en bolsas descomposición que colocamos en una poza de Quebrada Prieta. Usamos bolsas de malla fina para excluir los macroinvertebrados y de malla gruesa para permitir la entrada a crustáceos decápodos (camarones y cangrejos jóvenes e insectos acuáticos (principalmente efemerópteros, quironómidos y tricópteros. D. excelsa y G. guidonia (en ambos tipos de malla tuvieron tasas de descomposición más altas que C. scheberiana, M. bidentata y P. acuminata. La descomposición fue más rápida para todas las especies de hoja con la malla gruesa, resaltando el papel de los descomponedores en este hábitat. Tras 42 días de esta incubación, las densidades totales de invertebrados, efemerópteros y tricópteros fueron mayores en las bolsas con hojas de D. excelsa y G. guidonia, e inferiores en P. acuminata, C. scheberiana y M. bidentata. A mayor densidad de insectos hubo mayor tasa de descomposición. Nuestros resultados indican la importancia de la especie de las hojas y de la presencia de macroinvertebrados en el proceso de descomposición de hojarasca en partes altas de arroyos tropicales.

  6. Efeito da composição quimica, origem e grau de maturação sobre cor e acrocanica da banana nanica obtida por secagem HTST.

    OpenAIRE

    Michelle Oliveira

    2007-01-01

    Resumo: A banana crocante, para ser consumida na forma de snacks, pode ser obtida através de secagem com ar a altas temperaturas por um curto período de tempo (HTST - High Temperature Short Time) na fase inicial de secagem, seguida da secagem à temperatura média (50-70°C). O objetivo deste trabalho foi avaliar a influência da composição química da banana nanica (Musa acuminata Colla subgrupo Cavendish), proveniente de duas origens e três graus de maturação sobre as características de crocânci...

  7. Dos especies nuevas de calathea (Marantaceae de la Amozonia Colombiana

    Directory of Open Access Journals (Sweden)

    Suárez Stella

    2000-07-01

    Full Text Available Two new species of Marantaceae from Amazonian Colombia are described and illustrated: Calathea caquetensis and C. compacta. C. caquetensis is apparently related to C. attenuata and C. silvosa. C. compacta seems to be related to C. ecuminata, C. pearcei and C. schunkei.Se describen e ilustran dos especies nuevas de Marantaceae de la Amazonia colombiana: Calathea caquetensís y C. compacta. C. caquetensis está aparentemente relacionada con C. attenuata y C. silvosa. C compacta parece estar relacionada con C. acuminata, C. pearcei y C. schunkei.

  8. Note on Cladonia species (lichenized Ascomycota from Ardahan province (Turkey

    Directory of Open Access Journals (Sweden)

    Piotr Osyczka

    2011-05-01

    Full Text Available This paper is the first report on Cladonia species from Ardahan, a north-eastern province of Turkey. A circumpolar boreal-low arctic species, Cladonia acuminata, rarely reported from Asia, and the recently described Cladonia monomorpha are reported as new for Turkey. Their detailed descriptions and taxonomical remarks are provided. Localities of other ascertained Cladonia species in the province supplement the knowledge of their distribution patterns in the country. In addition, the typically corticolous/lignicolous species Vulpicida pinastri is mentioned as also growing on primary squamules and podetia of C. pyxidata.

  9. A new species of Otatea (Poaceae: Bambusoideae: Bambuseae) from Querétaro, Mexico

    OpenAIRE

    Ruiz-Sánchez, Eduardo

    2012-01-01

    Based on recent systematic studies of the genus Otatea, that included an extensive taxonomic investigation of herbaria specimens, and recent fieldwork in the Mexican state of Querétaro, a new Otatea species, O. ramirezii, is here described and illustrated. The new species is endemic to the Sierra Gorda in Querétaro, Mexico. It is compared with Otatea acuminata, O. carrilloi and O. glauca, from which it can be separated by the presence of only one (rarely two) branches per node, erect culm lea...

  10. Toxin profiles of five geographical isolates of Dinophysis spp. from North and South America.

    Science.gov (United States)

    Fux, Elie; Smith, Juliette L; Tong, Mengmeng; Guzmán, Leonardo; Anderson, Donald M

    2011-02-01

    Marine dinoflagellates of the genus Dinophysis can produce toxins of the okadaic acid (OA) and pectenotoxin (PTX) groups. These lipophilic toxins accumulate in filter-feeding shellfish and cause an illness in consumers called diarrhetic shellfish poisoning (DSP). In 2008, a bloom of Dinophysis led to the closure of shellfish harvesting areas along the Texas coast, one of the first DSP-related closures in the U.S. This event resulted in a broad study of toxin production in isolates of Dinophysis spp. from U.S. waters. In the present study, we compared toxin profiles in geographical isolates of Dinophysis collected in the U.S. (Eel Pond, Woods Hole MA; Martha's Vineyard, MA; and Port Aransas Bay, Texas), and in those from Canada (Blacks Harbour, Bay of Fundy) and Chile (Reloncavi Estuary), when cultured in the laboratory under the same conditions. For each isolate, the mitochondrial cox1 gene was sequenced to assist in species identification. Strains from the northeastern U.S. and Canada were all assigned to Dinophysis acuminata, while those from Chile and Texas were most likely within the D. acuminata complex whereas precise species designation could not be made with this marker. Toxins were detected in all Dinophysis isolates and each isolate had a different profile. Toxin profiles of isolates from Eel Pond, Martha's Vineyard, and Bay of Fundy were most similar, in that they all contained OA, DTX1, and PTX2. The Eel Pond isolate also contained OA-D8 and DTX1-D7, and low levels (unconfirmed structurally) of DTX1-D8 and DTX1-D9. D. acuminata from Martha's Vineyard produced DTX1-D7, along with OA, DTX1, and PTX2, as identified in both the cells and the culture medium. D. acuminata from the Bay of Fundy produced DTX1 and PTX2, as found in both cells and culture medium, while only trace amounts of OA were detected in the medium. The Dinophysis strain from Texas only produced OA, and the one from Chile only PTX2, as confirmed in both cells and culture medium. Published

  11. Novelties in the genus Persicaria (Polygonaceae) in Brazil

    DEFF Research Database (Denmark)

    Funez, Luís A.; Hassemer, Gustavo

    2018-01-01

    This work presents novelties in the genus Persicaria in Brazil. More specifically, we describe P. sylvestris, a new species from the Atlantic rainforest in subtropical Brazil, propose the new combination P. diospyrifolium and designate a lectotype for its basionym, Polygonum diospyrifolium. The new...... species has until now been identified as P. acuminata, from which it differs by morphological characters as well as ecological aspects. We also provide photographs of the new species and of similar species along with a distribution map and a key to the species of Persicaria in Brazil....

  12. Molecular and cytological characterization of the global Musa germplasm collection provides insights into the treasure of banana diversity

    Czech Academy of Sciences Publication Activity Database

    Christelová, Pavla; De Langhe, E.; Hřibová, Eva; Čížková, Jana; Sardos, J.; Hušáková, Markéta; Van den Houwe, I.; Sutanto, A.; Kepler, A.K.; Swennen, R.; Roux, N.; Doležel, Jaroslav

    2017-01-01

    Roč. 26, č. 4 (2017), s. 801-824 ISSN 0960-3115 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk(CZ) LG12021; GA MŠk LG15017 Institutional support: RVO:61389030 Keywords : genetic-linkage map * aab group * balbisiana colla * acuminata colla * black sigatoka * population-structure * marker analysis * flow-cytometry * plantain musa * aflp markers * Classification * Gene bank * Genetic diversity * ITC collection * Microsatellites * Musa Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 2.265, year: 2016

  13. Giant Condyloma Acuminatum in the Genital, Perineal and Perianal Region in a Pediatric Patient. Literature Review and Case Report

    Directory of Open Access Journals (Sweden)

    Rodrigo Suárez-Ibarrola

    2016-07-01

    Full Text Available Condyloma acuminata is caused by the proliferation of squamous epithelial cells in the presence of human papilloma virus (HPV infection. There are several treatment options available for anogenital warts, however, none have proven to be more efficacious. We present the case of a 3 year-8 months-old male, diagnosed with human immunodeficiency virus (HIV infection, who presented with multiple warts in the anogenital region. Lesions were treated with imiquimod 5%, electrosurgical resection and interferon α-2b. Combination of electrofulguration and interferon α-2b is an effective treatment option for children with giant condyloma accuminatum although recurrence is expected within a short follow-up period.

  14. Study of genital lesions

    Directory of Open Access Journals (Sweden)

    Anand Kumar B

    2003-03-01

    Full Text Available A total of one hundred patients (75 males and 25 females age ranged from 17-65 years with genital lesions attending the STD clinic of Bowring and LC Hospitals Bangalore constituted the study group. Based on clinical features, the study groups were classified as syphilis (39, chancroid (30, herpes genitolis (13, condylomato lato (9, LGV (7t condylomata acuminata (5, genital scabies (3, granuloma inguinole (2 and genital candidiasis (1. In 68% microbiological findings confirmed the clinical diagnosis. Of the 100 cases 13% and 2% were positive for HIV antibodies and HbsAg respectively.

  15. In vitro antibacterial activity of crude extracts of 9 selected medicinal plants against UTI causing MDR bacteria

    Directory of Open Access Journals (Sweden)

    Monali P. Mishra

    2017-01-01

    Full Text Available Urinary tract infection (UTI has become a more grievous problem today, due to multidrug resistance of infecting Gram-positive (GP and Gram-negative (GN bacteria, sometimes even with multiple infections. This study examines effectivity of 9 tropical flowering plants (Anogeissus acuminata, Azadirachta indica, Bauhinia variegata, Boerhaavia diffusa, Punica granatum, Soymida febrifuga, Terminalia chebula, Tinospora cordifolia and Tribulus terrestris for possible use as source of antimicrobials for multidrug resistant (MDR bacteria, along with main-stream antibiotics. Pathogenic bacteria were isolated from urine samples of patients attending and admitted in the hospital. Antibiograms of 11 isolated bacteria (GPs, Enterococcus faecalis and Staphylococcus aureus; and GNs, Acinetobacter baumannii, Citrobacter freundii, Enterobacter aerogenes, Escherichia coli, Klebsiella oxytoca, Klebsiella pneumoniae, Proteus mirabilis, Proteus vulgaris and Pseudomonas aeruginosa were ascertained by the disc-diffusion method, and antibacterial effectivity of plant extracts was monitored by the agar-well diffusion method. Isolated bacteria were floridly MDR to most antibiotics of the day. Methanol extracts of 9 plants were used, and extracts of 3 plants, A. acuminata, P. granatum and S. febrifuga at least caused 25–29 mm as the maximum size of zone of inhibition on bacterial lawns. Minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC values of methanol extracts of 9 plants were recorded. The methanol extract of A. acuminata had 0.29 mg/ml as the lowest MIC value and 0.67 mg/ml as the lowest MBC value, against MDR S. aureus, signifying effectivity; but, it had the highest MIC value of 3.41 mg/ml. and the highest MBC value of 4.27 mg/ml for most other MDR bacteria including E. coli. Qualitative phytochemical analysis was done for these 9 plants and information on leading phytochemicals was presented retrieved from PubChem database. Thus

  16. Operational Draft Regional Guidebook for the Functional Assessment of High-gradient Ephemeral and Intermittent Headwater Streams in Western West Virginia and Eastern Kentucky

    Science.gov (United States)

    2010-07-01

    Liriodendron tulipifera tuliptree Ulmus rubra slippery elm Magnolia acuminata cucumber-tree Ulmus thomasii rock elm ERDC/EL TR-10-11 103 Watershed...americana American elm ERDC/EL TR-10-11 41 0 0.5 1 1.5 2 2.5 SRV per 100 feet of stream reach 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1 Va ria bl e S...canadensis eastern hemlock Juglans nigra black walnut Ulmus americana American elm Liquidambar styraciflua sweetgum Ulmus parvifolia Chinese elm

  17. As espécies de Coccoloba P. Browne (Polygonaceae) da Amazônia brasileira

    OpenAIRE

    Melo,Efigênia de

    2004-01-01

    O gênero Coccoloba está representado na Amazônia brasileira por 23 espécies: Coccoloba acuminata Kunth, C. arborescens (Vell.) R. A. Howard, C. ascendens Duss ex Lindau, C. brasiliensis Nees & Mart., C. charitostachya Standl., C. conduplicata Maguire, C. coronata Jacq., C. declinata (Vell.) Mart., C. densifrons Mart. ex Meisn., C. excelsa Benth., C. gentryi R. A. Howard, C. latifolia Lam., C. lehmannii Lindau, C. lucidula Benth., C. marginata Benth., C. mollis Casar., C. ovata Benth., C. ...

  18. The Species of Cocoloba P. Browne (Polygonaceae) from brasilian Amazonia

    OpenAIRE

    Melo, Efigênia de

    2004-01-01

    O gênero Coccoloba está representado na Amazônia brasileira por 23 espécies: Coccoloba acuminata Kunth, C. arborescens (Vell.) R. A. Howard, C. ascendens Duss ex Lindau, C. brasiliensis Nees & Mart., C. charitostachya Standl., C. conduplicata Maguire, C. coronata Jacq., C. declinata (Vell.) Mart., C. densifrons Mart. ex Meisn., C. excelsa Benth., C. gentryi R. A. Howard, C. latifolia Lam., C. lehmannii Lindau, C. lucidula Benth., C. marginata Benth., C. mollis Casar., C. ovata Benth., C. para...

  19. Genome-Wide Analysis of the Musa WRKY Gene Family: Evolution and Differential Expression during Development and Stress.

    Science.gov (United States)

    Goel, Ridhi; Pandey, Ashutosh; Trivedi, Prabodh K; Asif, Mehar H

    2016-01-01

    The WRKY gene family plays an important role in the development and stress responses in plants. As information is not available on the WRKY gene family in Musa species, genome-wide analysis has been carried out in this study using available genomic information from two species, Musa acuminata and Musa balbisiana. Analysis identified 147 and 132 members of the WRKY gene family in M. acuminata and M. balbisiana, respectively. Evolutionary analysis suggests that the WRKY gene family expanded much before the speciation in both the species. Most of the orthologs retained in two species were from the γ duplication event which occurred prior to α and β genome-wide duplication (GWD) events. Analysis also suggests that subtle changes in nucleotide sequences during the course of evolution have led to the development of new motifs which might be involved in neo-functionalization of different WRKY members in two species. Expression and cis-regulatory motif analysis suggest possible involvement of Group II and Group III WRKY members during various stresses and growth/development including fruit ripening process respectively.

  20. Role of Mediterranean diet, tropical vegetables rich in antioxidants, and sunlight exposure in blindness, cataract and glaucoma among African type 2 diabetics

    Science.gov (United States)

    Moïse, Mvitu Muaka; Benjamin, Longo-Mbenza; Doris, Tulomba Mona; Dalida, Kibokela Ndembe; Augustin, Nge Okwe

    2012-01-01

    AIM To assess whether regular Mediterranean diet and regular intake of vegetables may reduce the risk of blindness, cataract, and glaucoma in these type 2 diabetics. METHODS A cross-sectional design was carried out among known black diabetics admitted at the diabetic clinics of Kinshasa, between October 2008 and March 2009. The Mediterranean-style dietary score (MSDPS) was used to characterize a Mediterranean-style dietary pattern in the study population using the Harvard semi quantitative FFQ adapted for Africa. RESULTS Five hundred Type 2 diabetic patients were included in this study (48% of males; 40% aged ≥60 years). There was a significant association between blindness, cataract and aging; between blindness (P<0.05), cataract (P<0.05), glaucoma (P<0.05), and physical inactivity; between blindness (P<0.05), cataract (P<0.0001), glaucoma (P<0.01) and high SES, and a very significant association between blindness (P<0.0001), cataract (P<0.0001), glaucoma (P<0.0001) and exposure to sunlight. There was also a significant association between blindness, glaucoma, and male sex. Regular intake of Mediterranean diet, Brassica Rapa, beans, Abelmoschus, Musa acuminata reduced significantly the risk of blindness, cataract and glaucoma. CONCLUSION Regular intake of Mediterranean diet, Brassica Rapa, beans, Abelmoschus, and Musa acuminata may significantly reduce the risk of blindness or its major causes among type 2 diabetes mellitus in Africa. PMID:22762057

  1. Desenvolvimento in vitro de plântulas de diplóides de bananeira obtidas a partir de cultura de embriões

    Directory of Open Access Journals (Sweden)

    NEVES TÁRCIA DOS SANTOS

    2002-01-01

    Full Text Available Este trabalho teve por objetivo avaliar o desenvolvimento in vitro de plântulas de progênies de oito genótipos de bananeira obtidos a partir de cultura de embriões. Os genótipos foram as espécies selvagens Calcutta e Malaccensis (Musa acuminata-AA, Butuhan e França (M. balbisiana-BB e os híbridos 0304-02, 1304-06, 4252-04 e 9379-09 (M. acuminata-AA. Os embriões foram extraídos de forma asséptica, sendo introduzidos em meio de cultura MS com 30 g L-1 agar, inicialmente em placas de Petri (40 dias e depois em tubos de ensaio (45 dias. Verificou-se efeito do genótipo no desenvolvimento in vitro dos embriões. As progênies dos genótipos selvagens do grupo BB, seguidos das progênies dos híbridos AA apresentaram maior desenvolvimento para as variáveis estudadas. O protocolo utilizado foi adequado para a cultura de embriões das progênies dos oito genótipos, devendo, no entanto, o período de desenvolvimento in vitro ser reduzido para 30 dias a fim de que o enraizamento não seja muito acentuado.

  2. Genome-wide analysis of the AP2/ERF family in Musa species reveals divergence and neofunctionalisation during evolution.

    Science.gov (United States)

    Lakhwani, Deepika; Pandey, Ashutosh; Dhar, Yogeshwar Vikram; Bag, Sumit Kumar; Trivedi, Prabodh Kumar; Asif, Mehar Hasan

    2016-01-06

    AP2/ERF domain containing transcription factor super family is one of the important regulators in the plant kingdom. The involvement of AP2/ERF family members has been elucidated in various processes associated with plant growth, development as well as in response to hormones, biotic and abiotic stresses. In this study, we carried out genome-wide analysis to identify members of AP2/ERF family in Musa acuminata (A genome) and Musa balbisiana (B genome) and changes leading to neofunctionalisation of genes. Analysis identified 265 and 318 AP2/ERF encoding genes in M. acuminata and M. balbisiana respectively which were further classified into ERF, DREB, AP2, RAV and Soloist groups. Comparative analysis indicated that AP2/ERF family has undergone duplication, loss and divergence during evolution and speciation of the Musa A and B genomes. We identified nine genes which are up-regulated during fruit ripening and might be components of the regulatory machinery operating during ethylene-dependent ripening in banana. Tissue-specific expression analysis of the genes suggests that different regulatory mechanisms might be involved in peel and pulp ripening process through recruiting specific ERFs in these tissues. Analysis also suggests that MaRAV-6 and MaERF026 have structurally diverged from their M. balbisiana counterparts and have attained new functions during ripening.

  3. Aquatic hyphomycetes as environmental quality bioindicators in the Chirgua River (Bejuma, Venezuela

    Directory of Open Access Journals (Sweden)

    Rafael Fernández

    2017-01-01

    Full Text Available At present, the evaluation of water resources uses bioindicators, such as additional diagnostic systems, because they indicate anthropogenic disturbances. Aquatic hyphomycetes,  part of the trophic chain of aquatic ecosystems, are indicators of water quality through their varying  presence and concentration of conidia based on environmental disturbance; therefore, this research assessed their bioindicator role for environmental quality in the Chirgua River in Venezuela. In 2011 in two areas: 1 Headwaters (unaffected and 2 downstream area (affected, physico-chemical parameters (O2, conductivity, pH, temperature and total solids and nutrients were determined weekly (SO4-2, PO4-3, NO2-2 and NO3-3, along with coliforms (total and fecal and water hyphomycetes (number of species and conidia/mL. We identified a total of 44 species, 42 (20 exclusive in zone 1 and 24 (2 exclusive in zone 2. In the affected sector, the number of species and conidia/mL of the coliforms (total and fecal decreased, as compared to the unaffected zone. Sensitive species to environmental disturbance for coliforms included Brachiosphaera tropicalis, Camposporium antenatum, Campylospora filicladia, Campylospora parvula, Clavatospora tentacula, Clavatospora stellata, Culicidospora gravida, Diplocladiella scalaroides, Flabellospora acuminata, Helicomyces colligatus, Helicomyces sp., Helicomyces torquatus, Phalangispora constricta, Tetracladium marchalianum and Triscelophorus monosporus, while tolerant species included Alatospora acuminata, Campylospora chaetocladia, Flabellospora crassa, Isthmotricladia gombakiensis, Tetraploa cf. Aristata and Triscelophorus acuminatus.

  4. Results of a Musa mapping project

    International Nuclear Information System (INIS)

    Lagoda, P.J.L.; Noyer, J.L.; Baurens, F.C.

    1998-01-01

    A completed map, based on two selfed progenies from two banana cultivars (M53 and SFB5) is presented (roughly 1200 cM). More than three hundred markers are linked in 11 linkage groups representing the genome (2n=22) of Musa acuminata. Roughly one third of the markers are co-dominant restriction fragment polymorphisms (RFLPs; one hundred) or micro satellites (thirty). Two thirds of the markers are dominant amplified fragment length polymorphisms (AFLPs; 10% could be considered to be co-dominant). The mean linkage distance is 3 cM, but marker density still should be increased on a couple of linkage groups. Particularities for a mapping job in banana are discussed. Due to Musa acuminata sub-species specific translocations, up to 36% of all the markers tested show important segregation distortions. The need for a cooperative mapping initiative based on a proposed ''frame-map'' harbouring evenly spaced co-dominant ''anchor'' markers is proposed. CIRAD has published 45 sequence tagged micro satellite sites (STMS) in the EMBL database which are accessible at: ''http://www.ebi.ac.uk/'' using the keywords LAGODA and MICROSATELLITE (EMBL accessions X87258 to X87265, X90740 to X90750 and Z85950 to Z85977). (author)

  5. Lipoidal labellar secretions in Maxillaria ruiz & pav. (Orchidaceae).

    Science.gov (United States)

    Davies, K L; Turner, M P; Gregg, A

    2003-03-01

    The labella of Maxillaria acuminata Lindl., M. cerifera Barb. Rodr. and M. notylioglossa Rchb.f., all members of the M. acuminata alliance, produce a viscid wax-like secretion. Histochemical analysis revealed that the chemical composition of the secretion is similar in all three species, consisting largely of lipid and protein. Light microscopy and low-vacuum scanning electron microscopy were used to investigate the secretory process. In a fourth taxon, M. cf. notylioglossa, transmission electron microscopy showed that lipid bodies are associated with smooth endoplasmic reticulum or occur as plastoglobuli within plastids. Lipid bodies vary in appearance and this may reflect differences in chemical composition. They become associated with the plasmalemma and eventually accumulate between the latter and the cell wall. The wall contains no pits or ectodesmata, and it is speculated that lipid passes through the wall as small lipid moieties before eventually reassembling to form lipid globules on the external surface of the cuticle. These globules are able to coalesce forming extensive viscid areas on the labellum. The possible significance of this process to pollination is discussed.

  6. Genetic resources in Musa bananas and improvement of their disease resistance

    International Nuclear Information System (INIS)

    Borges Fuentes, O.L.

    1977-01-01

    The cultivated bananas belong to the genus Musa and it is the wild species Musa acuminata and Musa balbisiana which contributed to the origin of the sorts used as food. Most of these are triploids and possess a high degree of sterility. The sources of variation that are of importance for genetic improvement of the bananas are (1) hereditary differences between the cultivated clones; (2) difference between species and sub-species; (3) differences between the primitive cultivars derived from Musa acuminata, and (4) mutations that can be artiificially induced. The bananas are attacked by many diseases. Their vulnerability to certain diseases is highly significant in view of the extreme genetic uniformity of the commercial crops and the absence of resistant genes. In the past the wild species and the diploids used as food served as sources of resistance. However, efforts to induce resistance in the cultivated triploid bananas have not been successful. The use of mutagenic agents is proposed as a possible way of improving genetic variability in banana cultivation. (author)

  7. Antiviral activity of some South American medicinal plants.

    Science.gov (United States)

    Abad, M J; Bermejo, P; Sanchez Palomino, S; Chiriboga, X; Carrasco, L

    1999-03-01

    Folk medicinal plants are potential sources of useful therapeutic compounds including some with antiviral activities. Extracts prepared from 10 South American medicinal plants (Baccharis trinervis, Baccharis teindalensis, Eupatorium articulatum, Eupatorium glutinosum, Tagetes pusilla, Neurolaena lobata, Conyza floribunda, Phytolacca bogotensis, Phytolacca rivinoides and Heisteria acuminata) were screened for in vitro antiviral activity against herpes simplex type I (HSV-1), vesicular stomatitis virus (VSV) and poliovirus type 1. The most potent inhibition was observed with an aqueous extract of B. trinervis, which inhibited HSV-1 replication by 100% at 50-200 micrograms/mL, without showing cytotoxic effects. Good activities were also found with the ethanol extract of H. acuminata and the aqueous extract of E. articulatum, which exhibited antiviral effects against both DNA and RNA viruses (HSV-1 and VSV, respectively) at 125-250 micrograms/mL. The aqueous extracts of T. pusilla (100-250 micrograms/mL), B. teindalensis (50-125 micrograms/mL) and E. glutinosum (50-125 micrograms/mL) also inhibited the replication of VSV, but none of the extracts tested had any effect on poliovirus replication.

  8. Community stand structure of rehabilitated forest at Kenaboi Forest Reserve, Negeri Sembilan, Malaysia

    Science.gov (United States)

    Fatma, N. A. H.; Wan Juliana, W. A.; Shaharuddin, M. I.; Wickneswari, R.

    2016-11-01

    A descriptive study of species composition, community structure and biomass was conducted in compartment 107, which is a rehabilitated area at Kenaboi Forest Reserve, Jelebu, Negeri Sembilan. The objective is to determine the forest structure and species composition in a rehabilitated area of Kenaboi FR since enrichment planting had done. A sample plot of 1 hectare was censused and a total of 395 trees with diameter ≥ 5 cm DBH were recorded. A total of 285 individual trees were identified belonging to 20 families and the commonest family was Dipterocarpaceae with 193 individuals. The highest tree density per ha was Shorea acuminata at 33% followed by S. parvifolia, 10% and S. leprosula, 6%. The biggest tree was Artocarpus elasticus Reinw. ex Blume with a diameter of 101 cm. The total basal area was 34.48 m2/ha, whereby the highest basal area was between 45 - 54.9 cm DBH class that contributed 10.21 m2/ha (30%). The total biomass estimation (above ground and below ground) was 792.57 t/ha. Dipterocarpaceae contributed the highest total biomass at 545.14 t/ha with S. acuminata contributed the highest total biomass of 330.45 t/ha. This study will contribute to the knowledge of regeneration forest especially on how the ecological process restoring the biodiversity and ecosystem functioning in rehabilitated forest by practicing the enrichment planting of native species.

  9. Development and application of sequence-tagged microsatellite site (STMS) markers in chickpea (Cicer arietinum), banana (Musa spp.) and their major pathogens, Ascochyta rabiei and Mycosphaerella fijiensis

    International Nuclear Information System (INIS)

    Winter, P.; Kaemmer, D.; Paff, T.; Geistlinger, J.; Neu, C.; Kahl, G.

    2001-01-01

    DNA markers of various kinds have found widespread application in many facets of plant breeding and plant pathogen control. Yet another marker type, sequence-tagged microsatellite (STMS) markers, provides the markers of choice for nearly every crop because of their co-dominant nature, reliability, ease of application and high polymorphic information content. We report here on the development of a whole set of STMS markers and the respective, selected primer sequences for two important crops, chickpea (Cicer arietinum L.) and banana (Musa acuminata), and for their most devastating fungal pathogens, Ascochyta rabiei and Mycosphaerella fijiensis, respectively. These markers were generated either by direct screening of size-selected genomic libraries with microsatellite-complementary oligonucleotides, or by enrichment of DNA fragments containing microsatellite sequences. A total of 69 markers for chickpea, 15 markers for M. acuminata, 19 markers for A rabiei and 11 markers for M. fijiensis, selected on the basis of their high information content and ease of use are presented here. These can be applied for mapping of the respective genomes, for various population studies, and cultivar and isolate identification. We further demonstrate that several of these markers can potentially be applied across species boundaries and thus could increase the marker repertoire also for other species of the genus Cicer, Musa and for Ascochyta-type pathogens of bean, and potentially also of lentil and pea. (author)

  10. Genome-wide analysis of the Musa WRKY gene family: evolution and differential expression during development and stress

    Directory of Open Access Journals (Sweden)

    Ridhi eGoel

    2016-03-01

    Full Text Available The WRKY gene family plays an important role in the development and stress responses in plants. As information is not available on the WRKY gene family in Musa species, genome-wide analysis has been carried out in this study using available genomic information from two species, Musa acuminata and Musa balbisiana. Analysis identified 147 and 132 members of the WRKY gene family in M. acuminata and M. balbisiana respectively. Evolutionary analysis suggests that the WRKY gene family expanded much before the speciation in both the species. Most of the orthologs retained in two species were from the γ duplication event which occurred prior to α and β genome-wide duplication (GWD events. Analysis also suggests that subtle changes in nucleotide sequences during the course of evolution have led to the development of new motifs which might be involved in neo-functionalization of different WRKY members in two species. Expression and cis-regulatory motif analysis suggest possible involvement of Group II and Group III WRKY members during various stresses and growth/ development including fruit ripening process respectively.

  11. Phylogeny of the Acanthocephala based on morphological characters.

    Science.gov (United States)

    Monks, S

    2001-02-01

    Only four previous studies of relationships among acanthocephalans have included cladistic analyses, and knowledge of the phylogeny of the group has not kept pace with that of other taxa. The purpose of this study is to provide a more comprehensive analysis of the phylogenetic relationships among members of the phylum Acanthocephala using morphological characters. The most appropriate outgroups are those that share a common early cell-cleavage pattern (polar placement of centrioles), such as the Rotifera, rather than the Priapulida (meridional placement of centrioles) to provide character polarity based on common ancestry rather than a general similarity likely due to convergence of body shapes. The phylogeny of 22 species of the Acanthocephala was evaluated based on 138 binary and multistate characters derived from comparative morphological and ontogenetic studies. Three assumptions of cement gland structure were tested: (i) the plesiomorphic type of cement glands in the Rotifera, as the sister group, is undetermined; (ii) non-syncytial cement glands are plesiomorphic; and (iii) syncytial cement glands are plesiomorphic. The results were used to test an early move of Tegorhynchus pectinarius to Koronacantha and to evaluate the relationship between Tegorhynchus and Illiosentis. Analysis of the data-set for each of these assumptions of cement gland structure produced the same single most parsimonious tree topology. Using Assumptions i and ii for the cement glands, the trees were the same length (length = 404 steps, CI = 0.545, CIX = 0.517, HI = 0.455, HIX = 0.483, RI = 0.670, RC = 0.365). Using Assumption iii, the tree was three steps longer (length = 408 steps, CI = 0.539, CIX = 0.512, HI = 0.461, HIX = 0.488, RI = 0.665, RC = 0.359). The tree indicates that the Palaeacanthocephala and Eoacanthocephala both are monophyletic and are sister taxa. The members of the Archiacanthocephala are basal to the other two clades, but do not themselves form a clade. The results

  12. Abundance, food habits, and breeding season of exotic T ilapia zillii and native O reochromis niloticus L. fish species in Lake Zwai , Ethiopia

    Directory of Open Access Journals (Sweden)

    Padanillay C. Prabu

    2008-05-01

    Full Text Available Relative abundance, diet and breeding season overlap in the reproduction of exotic Tilapia zillii and native Oreochromis niloticus in Lake Zwai were studied from samples collected over 12 months. Younger fish of both species collected were also evaluated for food composition.Food items from stomachs of both species were collected and analysed using the frequency of occurrence method. In terms of number, T. zillii dominated O. niloticus at the sampling sites. In both species, macrophytes, detritus, blue green algae, diatoms, green algae, Ceratium, Euglena,and Phacus constituted foods of plant origin, whereas chironomid larvae, Copepoda, Cladocera,Rotifera, Nematoda, fish eggs, and fish scales constituted foods of animal origin. Foods of the latter type such as Ephemeroptera and mollusks were also noted in the diet of adult T. zillii.Despite the extensive overlap in food habits of the two species, however, the food items were found in the diet of the species with different average percentage frequencies of occurrence. The level of gonad maturation and gonadosomatic index (GSI values showed that in Lake Zwai breeding was year-round for both T. zillii and O. niloticus, with a peak during April-September and February-August respectively, indicating extended breeding season overlap in reproduction. The two species were always found together in the catches from the sampling sites, which indicated some niche overlap between them.

  13. Influence of inlet water on the biotic and abiotic variables in a fish pond

    Directory of Open Access Journals (Sweden)

    L. H. Sipaúba-Tavares

    Full Text Available Abstract The effects of treated and untreated water inlets with macrophytes on the improvement of water quality and zooplankton community were evaluated in a fish pond with continuous water flow. Water and zooplankton samples were retrieved at four sites during nine months. There were differences (p<0.01 between inlet water from fish pond and inlet water from canal with macrophytes, featuring higher concentrations of nutrient load, mainly TAN and TP in the former. The inlet water from fish pond contained a higher number of abundant species (9 species, whilst the water supply from the canal with macrophytes had a greater richness (31 species of zooplankton species. Results showed that inlet water without macrophytes directly affected the characteristics of the water column and the dominance of zooplankton species such as Thermocyclops decipiens, and greater abundance of Rotifera species. Since aquatic plants in the inlet water of fish pond analyzed showed lower allochthonous material loads from the previous fish pond, the management adopted with macrophytes may be applied to avoid eutrophication risks, common in farm ponds.

  14. Abundance of plankton population densities in relation to bottom soil textural types in aquaculture ponds

    Directory of Open Access Journals (Sweden)

    F. Siddika

    2012-06-01

    Full Text Available Plankton is an important food item of fishes and indicator for the productivity of a water body. The present study was conducted to evaluate the effects of bottom soil textural conditions on abundance of plankton in aquaculture pond. The experiment was carried out using three treatments, i.e., ponds bottom with sandy loam (T1, with loam (T2 and with clay loam (T3. The ranges of water quality parameters analyzed were suitable for the growth of plankton during the experimental period. Similarly, chemical properties of soil were also within suitable ranges and every parameter showed higher ranges in T2. A total 20 genera of phytoplankton were recorded belonged to Chlorophyceae (7, Cyanophyceae (5, Bacillariophyceae (5, Euglenophyceae (2 and Dinophyceae (1. On the other hand, total 13 genera of zooplankton were recorded belonged to Crustacea (7 and Rotifera (6. The highest ranges of phytoplankton and zooplankton densities were found in T2 where low to medium-type bloom was observed during the study period. Consequently, the mean abundance of plankton (phytoplankton and zooplankton density was significantly highest in T2. The highest abundance of plankton in the T2 indicated that pond bottom with loamy soil is suitable for the growth and production of plankton in aquaculture ponds.

  15. Tardigrades in Space Research - Past and Future

    Science.gov (United States)

    Weronika, Erdmann; Łukasz, Kaczmarek

    2017-12-01

    To survive exposure to space conditions, organisms should have certain characteristics including a high tolerance for freezing, radiation and desiccation. The organisms with the best chance for survival under such conditions are extremophiles, like some species of Bacteria and Archea, Rotifera, several species of Nematoda, some of the arthropods and Tardigrada (water bears). There is no denying that tardigrades are one of the toughest animals on our planet and are the most unique in the extremophiles group. Tardigrada are very small animals (50 to 2,100 μm in length), and they inhabit great number of Earth environments. Ever since it was proven that tardigrades have high resistance to the different kinds of stress factors associated with cosmic journeys, combined with their relatively complex structure and their relative ease of observation, they have become a perfect model organism for space research. This taxon is now the focus of astrobiologists from around the world. Therefore, this paper presents a short review of the space research performed on tardigrades as well as some considerations for further studies.

  16. Potential pest transfer mediated by international ornamental plant trade.

    Science.gov (United States)

    Patoka, Jiří; Bláha, Martin; Kalous, Lukáš; Vrabec, Vladimír; Buřič, Miloš; Kouba, Antonín

    2016-05-25

    In recent years, the keeping of ornamental freshwater animals and plants in garden ponds has been growing in popularity. Water hyacinth (Eichhornia crassipes) is one of the preferred macrophytes seasonally imported mainly from South-eastern Asia throughout the world. This constitutes a secondary introduction inasmuch as the species is native to South America. Although many assemblages of aquatic invertebrates have been described as associated with this plant in the wild, there has been no research focused on their potential introduction via the international plant trade. We examined 216 specimens of water hyacinths imported for ornamental purposes from Indonesia into the Czech Republic. Numerous meio- and macroinvertebrates belonging to at least 39 species were captured. On the total number of individuals, the highest prevalence was of Tubulinea and Rotifera. Most of these were still alive and vital, including a caterpillar of the Indo-Australian invasive moth Spodoptera litura. Water hyacinths are usually placed into outdoor ponds immediately after import, which facilitates the release of non-target alien species. The present paper aims to draw attention to "hitchhikers" associated with the ornamental trade.

  17. A comparison of the fate and effects of two pyrethroid insecticides (lambda-cyhalothrin and cypermethrin) in pond mesocosms.

    Science.gov (United States)

    Farmer, D; Hill, I R; Maund, S J

    1995-08-01

    : The fate and effects of two pyrethroid insecticides (lambda-cyhalothrin and cypermethrin) were investigated in replicated 25 m(3) pond mesocosms. Three pesticide treatments which simulated spray drift deposition were examined: 0.7 g a.i. ha(-1) cypermethrin and 0.17 and 1.7 g a.i. ha(-1) lambda-cyhalothrin. Based on the use rate and pesticidal activity of the chemicals, the cypermethrin and lower lambda-cyhalothrin rates were approximately equivalent. After applications, pyrethroid residues in the water column declined rapidly. Treatment-related effects were observed on some macroinvertebrate taxa, most notably the Asellidae and Gammaridae. Surfacedwelling insects also suffered initial knock-down, particularly in the 1.7 g a.i. ha(-1) lambda-cyhalothrin treatment, but there was recovery after the spray period. No adverse effects occurred on algae, macrophytes or zooplankton, but there were occasional enhancements (e.g. algal biomass and abundances of copepod nauplii and Rotifera) which may have been indirect effects. An overall comparison of the treatments indicated that the higher lambda-cyhalothrin rate had the greatest effects, whilst the cypermethrin application had a somewhat greater impact than the lower lambda-cyhalothrin treatment rate (due to effects on peracarid crustaceans). The study indicated that should spray drift occur at the levels expected for either pyrethroid's normal use patterns, potential impacts on natural aquatic ecosystems would be minor and transient.

  18. Plankton community and the relationship with the environment in saline lakes of Onon-Torey plain, Northeastern Mongolia.

    Science.gov (United States)

    Afonina, Ekaterina Yu; Tashlykova, Natalya A

    2018-02-01

    The plankton community of sixteen saline lakes located on Onon-Torey plain (Northeastern Mongolia) during the filling phase and the raising of the water level was investigated in July 2011. Thirty-five taxa of phytoplankton and thirty-one species of zooplankton were found. For phytoplankton, blue-green algae ( Merismopedia elegans , Anabaenopsis elenkinii , Arthrospora fusiformis , Spirulina major , Lyngbya sp., Oscillatoria sp.) and green algae ( Monoraphidium minutum , Tetrastrum komarekii , Ankyra ocellata , Oocystis sp.) were dominant. For zooplankton, Filinia longiseta, Brachionus plicatilis , B. variabilis , Hexarthra mira (Rotifera), Daphnia magna , Moina brachiata , M. mongolica (Cladocera), Arctodiaptomus bacillifer , Mixodiaptomus incrassatus , Metadiaptomus asiaticus (Copepoda) dominated. Mineralization, active hydrogen ratio, dissolved oxygen and water temperature were the main factors influencing the diversity, structure and distribution of plankton organisms in the steppe lakes during low water level. The RDA analysis for phytoplankton and zooplankton from different lakes was carried out for selected two groups which included lakes and a subset related species. The first group is of oligohaline and mesohaline lakes in which mostly green algae, rotifers and copepods inhabit. The second group is of mesohaline and polyhaline lakes with mainly blue-green algae , some crustaceans and rotifers inhabiting. High abundance and biomass of Spirulina major , Oscillatoria sp. and Brachionus variabilis were observed in lakes with high mineralization, pH and temperature.

  19. Use of rotifers for the maintenance of monoalgal mass cultures of Spirulina

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, S.A.; Richmond, A.

    1987-01-01

    Zooplankton was successfully used for the biological control of unicellular algal contaminants in Spirulina mass cultures even under conditions adverse to the growth of Spirulina (maximal winter daily temperature of approximately 10 degrees C and very low bicarbonate concentration). Brachionus plicatilis (Rotifera) was the most successful species of zooplankton used. The interrelationships between Spirulina, green unicellular contaminant, and B. plicatilis were studied under various conditions. Two species of unicellular contaminant were used; Monoraphidium minutum was isolated from local cultures and Chlorella vulgaris, obtained from contaminated Spirulina cultures in Israel. The rotifer B. plicatilis successfully controlled the population size of both contaminants whether they were introduced in a single addition or as a daily dose. The biological control of the unicellular contaminants allows Spirulina to be cultured in a medium low in bicarbonate, thereby reducing the cost of the medium and increasing the quantity of CO2 that may be freely absorbed from the atmosphere at the optimal pH for Spirulina cultivation. (Refs. 9).

  20. Plankton community and the relationship with the environment in saline lakes of Onon-Torey plain, Northeastern Mongolia

    Directory of Open Access Journals (Sweden)

    Ekaterina Yu. Afonina

    2018-02-01

    Full Text Available The plankton community of sixteen saline lakes located on Onon-Torey plain (Northeastern Mongolia during the filling phase and the raising of the water level was investigated in July 2011. Thirty-five taxa of phytoplankton and thirty-one species of zooplankton were found. For phytoplankton, blue-green algae (Merismopedia elegans, Anabaenopsis elenkinii, Arthrospora fusiformis, Spirulina major, Lyngbya sp., Oscillatoria sp. and green algae (Monoraphidium minutum, Tetrastrum komarekii, Ankyra ocellata, Oocystis sp. were dominant. For zooplankton, Filinia longiseta, Brachionus plicatilis, B. variabilis, Hexarthra mira (Rotifera, Daphnia magna, Moina brachiata, M. mongolica (Cladocera, Arctodiaptomus bacillifer, Mixodiaptomus incrassatus, Metadiaptomus asiaticus (Copepoda dominated. Mineralization, active hydrogen ratio, dissolved oxygen and water temperature were the main factors influencing the diversity, structure and distribution of plankton organisms in the steppe lakes during low water level. The RDA analysis for phytoplankton and zooplankton from different lakes was carried out for selected two groups which included lakes and a subset related species. The first group is of oligohaline and mesohaline lakes in which mostly green algae, rotifers and copepods inhabit. The second group is of mesohaline and polyhaline lakes with mainly blue-green algae, some crustaceans and rotifers inhabiting. High abundance and biomass of Spirulina major, Oscillatoria sp. and Brachionus variabilis were observed in lakes with high mineralization, pH and temperature.

  1. Comparative ecotoxicity of interstitial waters in littoral ecosystems using Microtox{reg_sign} and the rotifer Brachionus plicatilis

    Energy Technology Data Exchange (ETDEWEB)

    Valls, T.A. Del; Forja, J.M. [Univ. de Cadiz (Spain). Dpto. de Quimica Fisica; Lubian, L.M.; Gomez-Parra, A. [C.S.I.C., Cadiz (Spain). Inst. de Ciencias Marinas de Andalucia

    1997-11-01

    The toxic effects of sediment interstitial waters collected from seven littoral sites in the Gulf of Cadiz were tested with the Microtox assay and a 7-d Brachionus plicatilis (Rotifera) decline test. Dissolved organic carbon (DOC), nutrients (ammonia, phosphate, nitrate, nitrite, and silicate), the heavy metals (Fe, Mn, Zn, Cu, Pb, Cr, and Cd), and the linear alkylbenzensulfonate (LAS) concentrations in the interstitial water were measured. The results of assays were compared in a dose-response relationship between sites. This comparison has demonstrated a general agreement between toxicity values determined by Brachionus plicatilis and Photobacterium phosphoreum, except in the case of interstitial water toxicity from mixtures of heavy metals. Data derived from interstitial water chemistry and bioassays were assembled by multivariate statistical techniques (principal components analysis). Positive prevalence of these components in cases studied was used to establish those ranges in chemical concentrations associated with adverse effects. The interstitial water guidelines, in terms of concentrations at or below which biological effects have been shown to be minimal (mg/L), are: DOC, 12.8; phosphate, 0.28; LAS, 80.4; ammonia, 12.1: chromium, 0.0045.

  2. The influence of physical and chemical parameters on the extinction of the god fish (Tor duoronensis) species: case study in Balong Dalem Kuningan district

    Science.gov (United States)

    Abidin, Z.; Marwoto, P.; Iswari, R. S.

    2018-03-01

    Tor douronensis (God Fish) species are endemic freshwater fish that only live in Kuningan District. Originally these fish scattered in the pool Cigugur, Cibulan, Balong Kambang, Darma Loka and Balong Dalem. However, since 2006 the god fish that existed in Balong Dalem extinct. This study aims to analyze the possible factors causing extinction of the god fish in situ Balong Dalem. The study was conducted during May 2017. The results showed that there were 11 phytoplankton and 13 genera of Gomphonema, Stigeoclonium, Desmidium, Closterium, Navicula, Spirulina, Phormidium, Melosira, Gloeotrichia, Oedogonium, Hyalodiscus, Moscocrocis and Cladophora. While zooplankton found 3 genus of Cyclops, Rotifera and Tanypus. The results showed that the abundance, diversity and uniformity of zooplankton correlated positively with pH, temperature, DO and water flow but not with others. Condition of water quality (physical-chemical parameter) Balong Dalem in bad condition, low productivity and labile. Condition of substrate base there Balong Dalem in the form of sand and fine mud. All of these conditions caused the extinction of Tor douronensis in situ Balong Dalem.

  3. Age-related environmental gradients influence invertebrate distribution in the Prince Charles Mountains, East Antarctica.

    Science.gov (United States)

    Czechowski, Paul; White, Duanne; Clarke, Laurence; McKay, Alan; Cooper, Alan; Stevens, Mark I

    2016-12-01

    The potential impact of environmental change on terrestrial Antarctic ecosystems can be explored by inspecting biodiversity patterns across large-scale gradients. Unfortunately, morphology-based surveys of Antarctic invertebrates are time-consuming and limited by the cryptic nature of many taxa. We used biodiversity information derived from high-throughput sequencing (HTS) to elucidate the relationship between soil properties and invertebrate biodiversity in the Prince Charles Mountains, East Antarctica. Across 136 analysed soil samples collected from Mount Menzies, Mawson Escarpment and Lake Terrasovoje, we found invertebrate distribution in the Prince Charles Mountains significantly influenced by soil salinity and/or sulfur content. Phyla Tardigrada and Arachnida occurred predominantly in low-salinity substrates with abundant nutrients, whereas Bdelloidea (Rotifera) and Chromadorea (Nematoda) were more common in highly saline substrates. A significant correlation between invertebrate occurrence, soil salinity and time since deglaciation indicates that terrain age indirectly influences Antarctic terrestrial biodiversity, with more recently deglaciated areas supporting greater diversity. Our study demonstrates the value of HTS metabarcoding to investigate environmental constraints on inconspicuous soil biodiversity across large spatial scales.

  4. Assessment of The Pajarales Complex Rotiferofauna during The Rainy Season, Departamento de Magdalena, Colombia

    International Nuclear Information System (INIS)

    Celis, Sebastian; Mancera, Ernesto; Jenny A Leon

    2008-01-01

    In order to assess the potential effects of the Magdalena River recommunication with its former delta, we studied the abundance and composition of the rotiferofauna of the Pajarales Complex (PC) during its highest annual zooplankton abundance. We selected the Rotifera phylum, due to its high reproductive rates and the efficiency in energetic transformation process. We sampled the rotifers with a van Dorn bottle, during the second rainy season in 2006. During each sampling we registered salinity, temperature, pH, and dissolved oxygen. We calculated the rotifer diversity using the Shannon-Wiener H (log10) index comparing among sampling sites and sampling dates to establish variations along the study period. The physico-chemical variables were graphically related with the diversity values calculated using 0.05 for ??and 95% for the confidence interval. We found a total of 20 morpho types belonged to Brachionidae, Lecanidae, Filiniidae, Synchaetidae, exarthriidae and Testudinellidae families, been Brachionidae and Lecanidae the most abundant. The relationships between diversity and physico-chemical variables, show salinity as the main responsible of the rotifer diversity; in conclusion, the current rotiferofauna in the PC is most abundant and diverse than 16 years ago, before the recommunication with the Magdalena River. Likewise, dissolved oxygen concentration, pH and salinity of the CP waters were different. Taking into account that salinity was the most influent factor in the rotiferofauna diversity; the river recomommunication probably favored the increment of rotiferofauna diversity in the PC

  5. Distribution and diet of larval and juvenile Arctic cod ( Boreogadus saida) in the shallow Canadian Beaufort Sea

    Science.gov (United States)

    Walkusz, Wojciech; Paulic, Joclyn E.; Williams, William J.; Kwasniewski, Slawomir; Papst, Michael H.

    2011-02-01

    The distribution and diet of larval and juvenile Arctic cod ( Boreogadus saida) were studied during summer 2005 in the coastal Canadian Beaufort Sea. A total of 275 individuals were captured and the highest abundance was observed at station depths of 20-30 m. This corresponds well with the location of the frontal zone where the Mackenzie River plume water and open sea water meet. Diet examinations were performed on 220 Arctic cod, which were found undamaged from sampling. We observed a gradual decrease in prey number per fish and increase in prey size as larvae grew which corresponded to a shift from Rotifera and nauplii towards larger copepodid stages. However, at all sizes, the larvae remain generalists and feed on a broad range of organisms. Environmental changes due to climate warming could have a two-fold impact on fish larvae feeding in the studied region. First, the potential for increased primary production may lead to increased zooplankton production that may impact the feeding and nutrition positively. On the other hand, greater discharge of turbid water from the Mackenzie River may reduce light penetration in the water column that may negatively influence the ability of visual predators to successively forage.

  6. Variaciones de abundancia y biomasa del zooplancton en un embalse tropical oligo-mesotrófico del norte de Venezuela

    Directory of Open Access Journals (Sweden)

    Sandra Merayo

    2010-06-01

    Full Text Available La abundancia del zooplancton en los embalses está determinada principalmente por la velocidad y el contenido del agua, pero se sabe relativamente poco sobre los embalses tropicales. Se estudió la distribución temporal y espacial de la abundancia y la biomasa del zooplancton en el eje longitudinal del embalse de Clavellinos, en el norte de Venezuela, entre octubre 2006 y septiembre 2007. El zooplancton fue recolectado en el estrato oxigenado con una red de plancton. Un total de 16 taxones fueron identificados: Copepoda, Cladocera, Rotifera, Ostracoda y Diptera. Thermocyclops decipiens (Copepoda, Cyclopoida dominó la comunidad, mientras que los rotíferos fueron los más diversos, con 10 especies. La abundancia del zooplancton varió de 31 a 101ind/l en E1, 36 a 84ind/l en E2, y, de 30 a 250ind/L en el E3. La biomasa varió de 97,4 a 1406.3μg/l en E1, 108,5 a 397.2μg/l en E2, y de 25,9 a 763.9μg/l en el E3. Esta comunidad de zooplancton pareciσ responder a las variaciones ambientales en el embalse, mαs que a las variaciones en la disponibilidad de recursos.

  7. Spatial Distribution of Zooplankton Diversity across Temporary Pools in a Semiarid Intermittent River

    Directory of Open Access Journals (Sweden)

    Thaís X. Melo

    2013-01-01

    Full Text Available This study describes the richness and density of zooplankton across temporary pools in an intermittent river of semiarid Brazil and evaluates the partitioning of diversity across different spatial scales during the wet and dry periods. Given the highly patchy nature of these pools it is hypothesized that the diversity is not homogeneously distributed across different spatial scales but concentrated at lower levels. The plankton fauna was composed of 37 species. Of these 28 were Rotifera, 5 were Cladocera, and 4 were Copepoda (nauplii of Copepoda were also recorded. We showed that the zooplankton presents a spatially segregated pattern of species composition across river reaches and that at low spatial scales (among pools or different habitats within pools the diversity of species is likely to be affected by temporal changes in physical and chemical characteristics. As a consequence of the drying of pool habitats, the spatial heterogeneity within the study river reaches has the potential to increase β diversity during the dry season by creating patchier assemblages. This spatial segregation in community composition and the patterns of partition of the diversity across the spatial scales leads to a higher total diversity in intermittent streams, compared to less variable environments.

  8. Comparison of biofilm ecology supporting growth of individual Naegleria species in a drinking water distribution system.

    Science.gov (United States)

    Puzon, Geoffrey J; Wylie, Jason T; Walsh, Tom; Braun, Kalan; Morgan, Matthew J

    2017-04-01

    Free-living amoebae (FLA) are common components of microbial communities in drinking water distribution systems (DWDS). FLA are of clinical importance both as pathogens and as reservoirs for bacterial pathogens, so identifying the conditions promoting amoebae colonisation of DWDSs is an important public health concern for water utilities. We used high-throughput amplicon sequencing to compare eukaryotic and bacterial communities associated with DWDS biofilms supporting distinct FLA species (Naegleria fowleri, N. lovaniensis or Vermamoeba sp.) at sites with similar physical/chemical conditions. Eukaryote and bacterial communities were characteristics of different FLA species presence, and biofilms supporting Naegleria growth had higher bacterial richness and higher abundance of Proteobacteria, Bacteroidetes (bacteria), Nematoda and Rotifera (eukaryota). The eukaryotic community in the biofilms had the greatest difference in relation to the presence of N. fowleri, while the bacterial community identified individual bacterial families associated with the presence of different Naegleria species. Our results demonstrate that ecogenomics data provide a powerful tool for studying the microbial and meiobiotal content of biofilms, and, in these samples can effectively discriminate biofilm communities supporting pathogenic N. fowleri. The identification of microbial species associated with N. fowleri could further be used in the management and control of N. fowleri in DWDS. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  9. Food of forage fishes in western Lake Erie, 1975-76

    Science.gov (United States)

    Muth, Kenneth M.; Busch, Wolf-Dieter N.

    1989-01-01

    In western Lake Erie in the summer and fall of 1975–1976, food eaten by seven forage fishes—emerald shiner (Notropis atherinoides), spottail shiner (Notropis hudsonius), trout-perch (Percopsis omiscomaycus), andyoung-of-the-year (YOY) of alewife (Alosa pseudoharengus), gizzard shad (Dorosoma cepedianum), white bass (Morone chrysops), and freshwater drum (Aplodi-notus grunniens)—was divided among six major taxa: Cladocera, Copepoda, Diptera, Ostracoda, Amphipoda, and Algae. In addition, fish were eaten by YOY white bass, and Rotifera were consumed by YOY gizzard shad. Interspecies diet overlap indices, calculated to compare the food of the different species and to evaluate diet similarities, were usually highest for YOY white bass and YOY freshwater drum when compared with the other species and usually lowest between emerald shiners and all other forage fishes. Understanding the feeding interactions among fishes that could influence production at the forage-food level of the food web could provide insight into how cascading trophic interactions influence the production of piscivorous predators.

  10. An overview of a uranium acidic mining lake (Caldas, Brazil): composition of the zooplankton community and limno-chemical aspects

    Energy Technology Data Exchange (ETDEWEB)

    Nascimento, H.; Ferrari, C.; Roque, C.V.; Nascimento, M.R. [Brazilian Nuclear Energy Commission/Pocos de Caldas Laboratory (Brazil); Wisniewski, M.J. [Alfenas Federal University/Limnology Laboratory (Brazil); Rodgher, S. [Universidade Estadual Paulista Julio de Mesquita Filho/Science and Technology Laboratory (Brazil)

    2014-07-01

    This research represents an attempt to fill a gap in the information on the zooplankton composition and limno-chemical aspects of the uranium pit lake (Osamu Utsumi Pit, Brazil), affected by acid mine drainage. In the present study water samples were collected three-monthly, for a period of one year (2008-2009). The water samples from the uranium pit lake showed moderately acidic pH values (3.6 to 4.1), high values of the electrical conductivity, sulfate, uranium, fluoride, zinc, manganese and aluminum concentrations. The Rotifera cephalodella sp., Keratella americana, K. cochlearis, Bdelloidea order and the Cladocera Bosminopsis deitersi, Bosmina sp., were registered in the samples from the uranium pit lake with ADM. Of the species registered the Bdelloidea order was the most important in terms of density (17,500 - 77,778 ind m{sup -3}), since it occurred throughout the whole sampling period. In this study, probably the combined effect of moderately acid pH values and other potentially co-stressors factors, for example the high concentrations of stable and radioactive chemical species, could have influenced this richness and also the composition of the zooplankton species in the water samples from the uranium pit lake. Document available in abstract form only. (authors)

  11. Tardigrades in Space Research - Past and Future.

    Science.gov (United States)

    Weronika, Erdmann; Łukasz, Kaczmarek

    2017-12-01

    To survive exposure to space conditions, organisms should have certain characteristics including a high tolerance for freezing, radiation and desiccation. The organisms with the best chance for survival under such conditions are extremophiles, like some species of Bacteria and Archea, Rotifera, several species of Nematoda, some of the arthropods and Tardigrada (water bears). There is no denying that tardigrades are one of the toughest animals on our planet and are the most unique in the extremophiles group. Tardigrada are very small animals (50 to 2,100 μm in length), and they inhabit great number of Earth environments. Ever since it was proven that tardigrades have high resistance to the different kinds of stress factors associated with cosmic journeys, combined with their relatively complex structure and their relative ease of observation, they have become a perfect model organism for space research. This taxon is now the focus of astrobiologists from around the world. Therefore, this paper presents a short review of the space research performed on tardigrades as well as some considerations for further studies.

  12. Diel vertical migration and distribution of zooplankton in a tropical Brazilian reservoirlian

    Directory of Open Access Journals (Sweden)

    Ana M. A. da Silva

    2009-08-01

    amostradas em quatro profundidades (Sub-superfície, 50% Io, 1% Io e Fundo em uma estação de amostragem com cinco metros de profundidade, em intervalos de quatro horas, ao longo de 24 horas. Duas espécies de Cladocera (Moina minuta e Diaphanosoma spinulosum e uma espécie de Copepoda (Notodiaptomus cearensis apresentaram padrões relativamente semelhantes de migração noturna, permanecendo no fundo durante o dia e se deslocando próximo à superfície no fim da tarde e ao longo da noite. Brachionus falcatus e Hexarthra mira (Rotifera não apresentaram padrões migratórios e as suas distribuições verticais foram relativamente homogêneas. As variáveis ambientais e as distribuições das espécies correlacionaram-se fracamente, sugerindo que outros mecanismos podem ser responsáveis por induzir a migração vertical.

  13. Applicability of cryoconite consortia of microorganisms and glacier-dwelling animals in astrobiological studies

    Directory of Open Access Journals (Sweden)

    Zawierucha Krzysztof

    2017-06-01

    Full Text Available For several years it has been of interest to astrobiologists to focus on Earth’s glaciers as a habitat that can be similar to glaciers on other moons and planets. Microorganisms on glaciers form consortia – cryoconite granules (cryoconites. They are granular/spherical mineral particles connected with archaea, cyanobacteria, heterotrophic bacteria, algae, fungi, and micro animals (mainly Tardigrada and Rotifera. Cryophilic organisms inhabiting glaciers have been studied in different aspects: from taxonomy, ecology and biogeography, to searching of biotechnological potentials and physiological strategies to survive in extreme glacial habitats. However, they have never been used in astrobiological experiments. The main aim of this paper is brief review of literature and supporting assumptions that cryoconite granules and microinvertebrates on glaciers, are promising models in astrobiology for looking for analogies and survival strategies in terms of icy planets and moons. So far, astrobiological research have been conducted on single strains of prokaryotes or microinvertebrates but never on a consortium of them. Due to the hypothetical similarity of glaciers on the Earth to those on other planets these cryoconites consortia of microorganisms and glacier microinvertebrates may be applied in astrobiological experiments instead of the limno-terrestrial ones used currently. Those consortia and animals have qualities to use them in such studies and they may be the key to understanding how organisms are able to survive, reproduce and remain active at low temperatures.

  14. The identification of plankton, water quality, blood cell, and histology in culture pond of tilapia Oreochromis niloticus which infected by viral nervous necrosis (VNN)

    Science.gov (United States)

    Yanuhar, U.; Rahayu, D. T.; Musa, M.; Arfiati, D.

    2018-04-01

    Currently, Viral Nervous Necrotic (VNN) is not only attacking the marine fish but also the freshwater fish like tilapia (Oreochromis niloticus). The aims of study to identify the type of plankton, water quality status, blood cell status, also histology of VNN infected tilapia obtained in culture ponds. The methods included plankton identification and water quality analysis from the infected fish pond in the Krakal, Blitar. The quality of blood cells and the histology of tilapia infected by VNN observed using a microscope with Hematoxylin-Eosin staining. The result show plankton in a fish pond of infected tilapia includes 3 divisions: Chlorophyta, Cyanophyta, and Bacillariophyta and 2 phyla: Arthropoda, and Rotifera. The values of erythrocyte, hematocrit, and hemoglobin were smaller than normal tilapia, however, the leukocyte and macronucleus values of VNN-infected fish were higher than normal fish. The fish histology shows the vacuolation in the brain and eyes tissue. The water quality of the culture pond have the temperature, pH, turbidity, DO, CO2, NO3, PO4, TOM in the range of 30-32°C 7.0-9.0; 25cm; 6.082–7.44mg/L 3.98–9.08mg/L 1.039–1.139 mg/L; 0.051-0.054mg/L; and 11.377-13.905mg/L, respectively. VNN causing high leukocyte and macronuclei and the damaging in brain and eyes tissue in infected tilapia.

  15. Oxidative stress and production of bioactive monoterpene indole alkaloids: biotechnological implications.

    Science.gov (United States)

    Matsuura, Hélio Nitta; Rau, Mariana Ritter; Fett-Neto, Arthur Germano

    2014-02-01

    Monoterpene indole alkaloids (MIAs) encompass plant natural products with important pharmacological relevance. They include the anti-tumoral MIAs found in Catharanthus roseus and Camptotheca acuminata. The often low yields of bioactive alkaloids in plants has prompted research to identify the factors regulating MIA production. Oxidative stress is a general response associated with biotic and abiotic stresses leading to several secondary responses, including elicitation of MIA production. These changes in secondary metabolism may take place directly or via second messengers, such as Ca(2+) and reactive oxygen species (ROS). H2O2 is the main ROS that participates in MIA biosynthesis. This review analyzes the links between oxidative stress, elicitation of bioactive MIA production and their potential roles in antioxidant defense, as well as exploring the implications to developing biotechnological strategies relevant for alkaloid supply.

  16. Lectins with Anti-HIV Activity: A Review

    Directory of Open Access Journals (Sweden)

    Ouafae Akkouh

    2015-01-01

    Full Text Available Lectins including flowering plant lectins, algal lectins, cyanobacterial lectins, actinomycete lectin, worm lectins, and the nonpeptidic lectin mimics pradimicins and benanomicins, exhibit anti-HIV activity. The anti-HIV plant lectins include Artocarpus heterophyllus (jacalin lectin, concanavalin A, Galanthus nivalis (snowdrop agglutinin-related lectins, Musa acuminata (banana lectin, Myrianthus holstii lectin, Narcissus pseudonarcissus lectin, and Urtica diocia agglutinin. The anti-HIV algal lectins comprise Boodlea coacta lectin, Griffithsin, Oscillatoria agardhii agglutinin. The anti-HIV cyanobacterial lectins are cyanovirin-N, scytovirin, Microcystis viridis lectin, and microvirin. Actinohivin is an anti-HIV actinomycete lectin. The anti-HIV worm lectins include Chaetopterus variopedatus polychaete marine worm lectin, Serpula vermicularis sea worm lectin, and C-type lectin Mermaid from nematode (Laxus oneistus. The anti-HIV nonpeptidic lectin mimics comprise pradimicins and benanomicins. Their anti-HIV mechanisms are discussed.

  17. Concentration of Organochlorine and Organophosphorus Pesticides in Different Molluscs from Tighra Reservoir, Gwalior, India.

    Science.gov (United States)

    Mamta; Rao, R J; Wani, Khursheed Ahmad

    2015-09-01

    Concentration of organochlorine and organophosphorus pesticides and their metabolites were determined in whole body homogenate of L. acuminata, I. exustus, V. dissimilis, V. bengalensis, from Tighra Reservoir during summer and post monsoon season using GC-MS technique. The different types of pesticides viz., HCB, heptachlor, aldrin, endosulfan, dieldrin, p,p-DDT, choloropyrifos, methyl parathion, dicholorovos, ethion, malathion, parathion were found in resident molluscs studied. Concentration of these pesticides varied independently during the summer and the post monsoon season at monitored sites. The study concluded that presence of pesticides in Tighra Reservoir is a major concern on public and ecosystem health and use of biopesticides in the adjacent area of Reservoir is highly recommended.

  18. Harmful algae and toxis in paranaguá bay , Brazil: bases for monitoring

    Directory of Open Access Journals (Sweden)

    Luiz Laureno Mafra Junior

    2006-09-01

    Full Text Available The estuarine complex of Paranaguá - ECP (South Brazil, 25º30'S, 48º30'W is a large subtropical system, where pristine mangrove forests are still present, and fishery and aquaculture are important economic activities. This work investigated the occurrence of harmful algae in Paranaguá Bay, as well as the presence of toxins in the filter feeding mussel Mytella guyanensis, a local fishery resource. Samples along the Paranaguá sub-system were collected almost monthly from August 2002 to October 2003. Besides physical and chemical variables, cell densities of harmful species and presence of toxins in the mussel by mouse bioassay (DSP, PSP and HPLC (ASP were performed. HAB species included Pseudo-nitzschia spp., Dinophysis acuminata,Prorocentrum minimum,Gymnodinium catenatum,Phaeocystis spp., Chattonella spp. and Heterosigma akashiwo.Trichodesmium erythraeum and Coscinodiscus wailesii were also included in this study due to their potential for harmful bloom formation. Toxin results showed the occurrence of DSP (December 2002 in shellfish related to the presence of D. acuminata (max. 4,566 cells.l-1. Additionally, cultivated strains produced paralytic and amnesic toxins in laboratory. Spring (October to December, Southern Hemisphere and late summer (February to April were the periods of higher abundance of harmful algae, mainly in euhaline and inner polyhaline sectors of the ECP.O complexo estuarino de Paranaguá (CEP; 25º30'S, 48º30'W, localizado no litoral sul do Brasil, abriga extensas áreas preservadas de manguezais e tem a pesca e aqüicultura como importantes atividades econômicas. Este trabalho investigou a ocorrência de microalgas nocivas no CEP e a presença de ficotoxinas no molusco bivalve Mytella guyanensis. Para tanto, foram coletadas amostras com periodicidade aproximadamente mensal, entre agosto de 2002 e outubro de 2003. Foram avaliadas variáveis físico-químicas, densidade de espécies nocivas e a presença de toxinas nos

  19. The effect of gamma radiation on the ultrastruture of the peel of banana fruits

    International Nuclear Information System (INIS)

    Strydom, G.; Staden, J. van; Smith, M.T.

    1991-01-01

    Ultrastructural studies of the banana (Musa acuminata Collar cv. Dwarf Cavendish) revealed that γ-irradiation at exposures above 0.2 kGy induced collapse of the peel structure, dilations between thylakoids and a loss of granal stacking; at 1 kGy granal stacking persisted although dilation of the chloroplast envelope was noted. Fruit softening and yellowing were retarded by an exposure of 0.2 kGy; the higher γ-ray exposure values accelerated these changes but none was greater than the control. A marked decrease in sensitivity to exogenously applied ethylene was evident following irradiation exposures between 0.6 and 1.0 kGy

  20. Citric acid production by Koji fermentation using banana peel as a novel substrate.

    Science.gov (United States)

    Karthikeyan, Alagarsamy; Sivakumar, Nallusamy

    2010-07-01

    The growing demand for citric acid and the current need for alternative sources have encouraged biotechnologists to search for novel and economical substrates. Koji fermentation was conducted using the peels of banana (Musa acuminata) as an inexpensive substrate for the production of citric acid using Aspergillus niger. Various crucial parameters that affect citric acid production such as moisture content, temperature, pH, inoculum level and incubation time were quantified. Moisture (70%), 28 degrees C temperature, an initial pH 3, 10(8) spores/ml as inoculum and 72h incubation was found to be suitable for maximum citric acid production by A. niger using banana peel as a substrate. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

  1. La Sabana de Bogotá y su lago en el Pleniglacial Medio

    Directory of Open Access Journals (Sweden)

    Hamenn Thomas Van Der

    1986-12-01

    Full Text Available Durante buena parte del Pleistoceno (últimos  2.5 millones de años, la Sabana de Bogotá fue un lago. En su extensa historia presenta cambios frecuentes de nivel, especialmente durante las épocas interglaciales en las cuales el lago se contraía y dejaba una amplia zona pantanosa y boscosa entre su orilla y el pie de los cerros (VAN DER HAMMEN & GONZÁLEZ 1960-1963; HOOGHIEMSTRA,1984. Durante el último interglacial y en los interestadiales y estadiales de la parte temprana del último glacial existía un lago relativamente grande; en los bordes y especialmente en la parte baja de los valles que desembocan a la Sabana (como el de Tenjo se encontraba vegetación pantanosa, especialmente con Alnus acuminata (Aliso acompañado en ocasiones de Weinmannia sp. y Vallea stipularis.

  2. Yield of tannin willows on ravine areas in the Central Forest Steppe

    Energy Technology Data Exchange (ETDEWEB)

    Sidorov, A I

    1981-01-01

    A note on the performance of 12 species of willow grown in a plantation on leached chernozem soils, to provide bark rich in tannins. The plantation was established by cuttings (25 cm long) at a spacing of 2.5 x 0.5 metres for the tree willows and 2.5 x 0.75 metres for the bush willows. Bark yields were determined at 7-8 years. The greatest yields were obtained from Salix smithiana, S. stipularis and S. acuminata: 12.0, 10.8 and 10.2 t/hectare respectively. Data on tannin yields are tabulated. Fellings for bark harvesting can be made every 5 years in plantations of bush willows and every 7 years in plantations of tree willows. The plantations can be used for 30 year with bush willows and for 50 years with tree willows.

  3. Dicty_cDB: Contig-U16068-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Primary rat hepatocyte toxicity modeling. 46 1e-13 5 ( EL485357 ) CHUM7113.b1_A04.ab1 CHU(LMS) puzzle...T(LMS) Jerusalem artichoke ... 54 8e-08 3 ( EL484942 ) CHUM6734.b1_K04.ab1 CHU(LMS) puzzle sunflower Hel... ... MUSR Musa acuminata cDNA 5', mRNA seque... 44 3e-07 4 ( EL513970 ) CHUY742.b1_L18.ab1 CHU(XYZ) puzzle sunfl...Y525.b1_J11.ab1 CHU(XYZ) puzzle sunflower Heli... 54 5e-06 2 ( DY934089 ) CHPX124...ld sunflowe... 54 5e-06 2 ( EL476432 ) CHUL4354.b1_D09.ab1 CHU(LMS) puzzle sunflower Hel... 54 5e-06 2 ( DY9

  4. Characterization and chemical composition of epicuticular wax from banana leaves grown in Northern Thailand

    Directory of Open Access Journals (Sweden)

    Suporn Charumanee

    2017-08-01

    Full Text Available This study aimed to investigate the physicochemical properties and chemical composition of epicuticular wax extracted from leaves of Kluai Namwa, a banana cultivar which is widely grown in Northern Thailand. Its genotype was identified by a botanist. The wax was extracted using solvent extraction. The fatty acid profiles and physicochemical properties of the wax namely melting point, congealing point, crystal structures and polymorphism, hardness, color, and solubility were examined and compared to those of beeswax, carnauba wax and paraffin wax. The results showed that the genotype of Kluai Namwa was Musa acuminata X M. balbisiana (ABB group cv. Pisang Awak. The highest amount of wax extracted was 274 μg/cm2 surface area. The fatty acid composition and the physicochemical properties of the wax were similar to those of carnauba wax. It could be suggested that the banana wax could be used as a replacement for carnauba wax in various utilizing areas.

  5. Viabilidade in vitro de grãos de pólen de bananeira sob diferentes concentrações de ácido bórico e sacarose

    OpenAIRE

    Reis,Ronaldo Viana dos; Morais-Lino,Lucymeire de Souza; Silva,Sebastião de Oliveira e; Amorim,Edson Perito; Ledo,Carlos Alberto da Silva; Viana,Alexandre Pio

    2011-01-01

    Neste trabalho, objetivou-se avaliar a germinação do grão de pólen e o comprimento do tubo polínico das bananeiras diplóides M53, 8987-01 e 9197-03, Calcutá, Lidi e 86B79-12. O delineamento utilizado foi inteiramente casualizado com cinco doses de sacarose (0, 5, 10, 15, 20%) e seis concentrações de ácido bórico (0, 100, 200, 300, 400 e 500 Mg L-1) com quatro repetições. Foram utilizados grãos de pólen retirados da inflorescência masculina dos diplóides Musa acuminata (AA). O pólen foi distri...

  6. Mass entrapment and lysis of Mesodinium rubrum cells in mucus threads observed in cultures with Dinophysis

    DEFF Research Database (Denmark)

    Ojamäe, Karin; Hansen, Per Juel; Lips, Inga

    2016-01-01

    The entrapment and death of the ciliate Mesodinium rubrum in the mucus threads in cultures with Dinophysis is described and quantified. Feeding experiments with different concentrations and predator–prey ratios of Dinophysis acuta, Dinophysis acuminata and M. rubrum to study the motility loss...... and aggregate formation of the ciliates and the feeding behaviour of Dinophysis were carried out. In cultures of either Dinophysis species, the ciliates became entrapped in the mucus, which led to the formation of immobile aggregates of M. rubrum and subsequent cell lysis. The proportion of entrapped ciliates...... was influenced by the concentration of Dinophysis and the ratio of predator and prey in the cultures. At high cell concentrations of prey (136 cells mL−1) and predator (100 cells mL−1), a maximum of 17% of M. rubrum cells became immobile and went through cell lysis. Ciliates were observed trapped in the mucus...

  7. Pattern of Sexually Transmitted Diseases in Chandigarh

    Directory of Open Access Journals (Sweden)

    Bhushan Kumar

    1987-01-01

    Full Text Available A retrospective,data analysis of sexually transmitted diseases was carried out to study the pattern of these diseases prevalent in the region. One thousand′five hundred and seventy,one patients′were seen from January 1977 to October 1985. Maks constituted 95.5% of this group and females the remaining 4.5%. Commonest age group affected was 20-29 years in both sexes. Condytoma acuminata was the commonest STD (21.40/o, followed by gonorrhoea (16.9%, chancroid (12.2% genital herpes (11.4%, syphilis (10.4%, not′specific ulcers (7.1%, donovanosis (6.3%,mixed infections (5.3% and NSU (4.1% Secondary syphilis was the most common (48.6% presentation of syphik and in women it od 75.8% of all the cases of syphilis. In′more than a quarter of patients, psycho- problems were the reason for attendance.

  8. Pattern of childhood STDs in a major hospital of East Delhi

    Directory of Open Access Journals (Sweden)

    Bhogal C

    2002-01-01

    Full Text Available Of the 1418 patients with STDs, who attended the STD clinic between January 1996 to December 2000, 50 (3.4% were children below 14 years of age. Boys (29 were more than girls (21. Syphilis was the most common STD found in these children (46.8%, followed by vulvo-vaginal candidiasis (19.2%, condylomata acuminata (10.6%, gonorrhoea (8.5%, herpes progenitalis (6.4%, chancroid (4.3%, perianal candidosis and perianal molluscum contagiosum (2.1 % each. Three children had more than one STD. A history of sexual abuse could be elicited in 30 children (60%, none of the children were positive of HIV. All children with symptoms pertaining to their genitourinary system should be evaluated thoroughtly for sexual abuse.

  9. Calidad de las accesiones colectadas en la región centro-oriental de Cuba (Nota técnica Quality of accessions collected in the central-eastern region of Cuba (Technical note

    Directory of Open Access Journals (Sweden)

    J Reino

    2010-06-01

    Full Text Available Se efectuó una prospección en el 2005, en la región centro-oriental de Cuba, y se colectaron semillas de 43 accesiones (36 de leguminosas arbóreas y siete de herbáceas. Posteriormente se realizó una prueba de germinación para conocer la calidad de las semillas (con corte de cubierta, en placas de petri sobre arena de río. El número de semillas utilizadas en cada accesión fue diferente (según las colectadas y solo se empleó una réplica (sin diseño estadístico. Las semillas de mejor calidad correspondieron a las accesiones Bauhinia acuminata, Bauhinia purpurea (de Nuevitas y Vertientes, Cassia fistula, Albizia kalkora, Centrosema sp. y Centrosema brasilianum (100% de germinación, así como Calopogonium caeruleum (90% y Albizia lucida (91,6%. Siete accesiones no germinaron. La mayoría logró una alta sobrevivencia (en bolsas, aunque en especies como Bauhinia hookeli, B. acuminata, Albizia lebbeck, C. caeruleum, C. brasilianum, Desmodium sp. y Teramnus sp. fue baja y dos accesiones no sobrevivieron. El germoplasma de la EEPF «Indio Hatuey» se incrementó en 34 accesiones. Se demostró la importancia de conocer la calidad de las semillas y la relación entre este indicador y su deterioro, debido a la gran variabilidad que mostró el porcentaje de germinación en semillas colectadas en un mismo período de tiempo.A prospection was made in 2005, in the central-eastern region of Cuba and seeds from 43 accessions (36 tree legumes and seven herbaceous ones were collected. Afterwards, a germination test was conducted in order to learn the quality of the seeds (with seed coat cut, in Petri dishes on river sand. The number of seeds used in each accession was different (according to the collected ones and only one replication was used (without statistical design. The best-quality seeds corresponded to the accessions Bauhinia acuminata, Bauhinia purpurea (from Nuevitas and Vertientes, Cassia fistula, Albizia kalkora, Centrosema sp. and

  10. Biodiversity Status, Distribution and Use Pattern of Some Ethno-Medicinal Plants

    Directory of Open Access Journals (Sweden)

    Priti KUMARI

    2012-12-01

    Full Text Available The erosion of plant biodiversity is a matter of global concern. Due to unawareness the building blocks of entire ecosystems are disappearing. Some medicinal plants like Taxus baccata Linn., Thymus serpyllum Linn., Coleus forskohli Will., Oroxylum indicum Linn., Valeriana hardwickii Wall., Malaxis acuminata D.Don, Habenaria edgeworthii Hook. f.ex.Collett., Costus speciosus (Koen. Sm., Dioscorea deltodea Wall., Gloriosa superba Linn., Polygonatum cirrhifolium Wall. and Polygonatum verticillatum Linn., Thalictrum foliolosum DC., Berberis aristata DC., Baliospermum montanum Will., Bergenia ciliata (Haworth Sternb., Clerodendrum serratum Linn., Valeriana jatamansii Jones, Celastrus paniculatus Will., Habenaria intermedeia D. Don, and Curculigo orchioides Gaerth are reached on the border of extinction. The 2008 IUCN Red List shows that the number of threatened plant species is increasing gradually (IUCN 2008. Therefore, there is an immediate need for conservation steps to be taken up along with promotion of conservation of medicinal plants.

  11. Ecotoxicology evaluation of watery extracts of plants on seeds of radish, lettuce and tomato

    Directory of Open Access Journals (Sweden)

    Edisleidy Águila Jiménez

    2016-02-01

    Full Text Available The effect of watery extracts of Nicotiana acuminata, Piper aduncum L. and Crotalaria juncea was evaluated on the germination and the elongación of the roots of seeds of Raphanus sativus (radish, Lactuca sativa L (lettuce and Lycopersicon esculentum (tomato. The extracts were produced at medium scale in the laboratory of formulation of the Faculty of Química- Pharmacy of the “Universidad Central Marta Abreu de las Villas” . It was demonstrated upon concluding the work that the lettuce was the most sensitive species for this type of study. It was concluded that the extracts could be poured to the means to minor concentrations that 0.01% with a margin of security that they are not going to affect the processes of germination and elongacion of the roots. It was determined that one could use the alone rehearsal using the seeds of lettuce like species of rehearsal.

  12. Changing trends in sexually transmitted diseases in North Eastern India

    Directory of Open Access Journals (Sweden)

    Jaiswal A

    2002-01-01

    Full Text Available A retrospective data analysis was carried out to find the trends in frequency and distribution of different STDs in North Eastern (NE India during 1995 - 1999. The commonest STD was chancroid (25.7% followed by condylomata acuminata (CA, nongonococcal urethritis (NGU, lymphogranuloma venereum (LGV, syphilis, gonorrhoea (GONO, herpes genitalis (HG, mixed infection (MI and balanoposthitis (BP. Interestingly no case of donovanosis (Dono was seen. HIV infection accounted for 9.62% of the total STD patients. A comparison of the present data with that reported a decade back (1986 - 1990 revealed a sharp decline in the incidence of syphilis, chancroid, GONO, whereas a conspicuous upward trend in CA and NGU. Factors responsible for these variations are analysed briefly.

  13. Dermatological manifestations in patients with HIV/AIDS

    Directory of Open Access Journals (Sweden)

    Sahily De la Paz Peña

    2015-11-01

    Full Text Available In view of the frequency of the dermatological manifestations in patients who suffer from AIDS/HIV, and with the objective of describing their behaviour, a descriptive,observational, and cross sectional investigation was carried out in the cases of the AIDS provincial consultation at Ernesto Guevara General Teaching Hospital of Las Tunas from January, 2007 to June, 2008. The information was obtained from the survey, the dermatological examination, and the clinical charts. The sample was made up of 43 patients, in which males and 31 to 40 age groups prevailed. There were no important quantity differences between the seropositive number and AIDS cases. The 27, 9% had dermatosis that made suspect the presence of the chronic retrovirus. The viral and the mycotic diseases were the most frequent ones, being the neoplastic type and drugreactions the least frequent ones. Other sexually transmitted diseases (STD appeared associated to the primary disease, mainly herpes simplex type II, and verruca acuminata.

  14. Infestation of Raoiella indica Hirst (Trombidiformes: Tenuipalpidae) on Host Plants of High Socio-Economic Importance for Tropical America.

    Science.gov (United States)

    Otero-Colina, G; González-Gómez, R; Martínez-Bolaños, L; Otero-Prevost, L G; López-Buenfil, J A; Escobedo-Graciamedrano, R M

    2016-06-01

    The mite Raoiella indica Hirst was recently introduced into America, where it has shown amazing ability to disseminate and broaden its range of hosts. An experiment was conducted in Cancún, Mexico, to determine infestation levels of this mite on plants recorded as hosts: coconut palm (Cocos nucifera) of cultivars Pacific Tall and Malayan Dwarf, oil palm (Elaeis guineensis) hybrids Deli x Ghana and Deli x Nigeria, Dwarf Giant banana (Musa acuminata, AAA subgroup Cavendish), Horn plantain (M. acuminata x Musa balbisiana, AAB subgroup Plantain), lobster claw (Heliconia bihai), and red ginger (Alpinia purpurata). Nursery plants of these host species or cultivars were artificially infested with R. indica in February 2011. In the four replications of 10 plants, each plant was infested with 200 R. indica specimens, and the numbers of infesting mites were recorded for 6 months. A maximum of 18,000 specimens per plant were observed on coconut Pacific Tall and Malayan Dwarf, followed by lobster claw, with a maximum of 1000 specimens per plant. Infestations were minimal for the remaining plants. Mite numbers on all plants declined naturally during the rainy season. All plant materials sustained overlapping mite generations, indicating that they are true hosts. Complementarily, infestation level was determined in backyard bananas and plantains. Correlations of infestation with plant height, distance from coconuts, and exposure to direct sunlight were estimated. Both bananas and plantains were infested by R. indica even when situated far from infested coconut palms. A Spearman correlation was found between infestation and plant height, although it was significant only for Silk plantain.

  15. Insights into the Musa genome: Syntenic relationships to rice and between Musa species

    Directory of Open Access Journals (Sweden)

    Althoff Ryan

    2008-01-01

    Full Text Available Abstract Background Musa species (Zingiberaceae, Zingiberales including bananas and plantains are collectively the fourth most important crop in developing countries. Knowledge concerning Musa genome structure and the origin of distinct cultivars has greatly increased over the last few years. Until now, however, no large-scale analyses of Musa genomic sequence have been conducted. This study compares genomic sequence in two Musa species with orthologous regions in the rice genome. Results We produced 1.4 Mb of Musa sequence from 13 BAC clones, annotated and analyzed them along with 4 previously sequenced BACs. The 443 predicted genes revealed that Zingiberales genes share GC content and distribution characteristics with eudicot and Poaceae genomes. Comparison with rice revealed microsynteny regions that have persisted since the divergence of the Commelinid orders Poales and Zingiberales at least 117 Mya. The previously hypothesized large-scale duplication event in the common ancestor of major cereal lineages within the Poaceae was verified. The divergence time distributions for Musa-Zingiber (Zingiberaceae, Zingiberales orthologs and paralogs provide strong evidence for a large-scale duplication event in the Musa lineage after its divergence from the Zingiberaceae approximately 61 Mya. Comparisons of genomic regions from M. acuminata and M. balbisiana revealed highly conserved genome structure, and indicated that these genomes diverged circa 4.6 Mya. Conclusion These results point to the utility of comparative analyses between distantly-related monocot species such as rice and Musa for improving our understanding of monocot genome evolution. Sequencing the genome of M. acuminata would provide a strong foundation for comparative genomics in the monocots. In addition a genome sequence would aid genomic and genetic analyses of cultivated Musa polyploid genotypes in research aimed at localizing and cloning genes controlling important agronomic

  16. Para - And Intraurethral Penile Tumor - Like Condylomatosis

    Directory of Open Access Journals (Sweden)

    Anastasiya Atanasova Chokoeva

    2018-01-01

    Full Text Available Condyloma acuminata represents an epidermal manifestation, associated with the epidermotropic human papillomavirus (HPV. They have been reported as the most common sexually transmitted disease, with prevalence exceeding 50%, increased up to 4 times, within the last two decades, as the most common side of affection are the penis, vulva, vagina, cervix, perineum, and perianal area, with increased prevalence in young, sexually active individuals.  Increased attention should be focused on lesions, caused by types, with moderate (33, 35, 39, 40, 43, 45, 51-56, 58 or high risk potential (types 16, 18 for malignant transformation, leading to further development of cancers of anus, vagina, vulva and penis, as well as cancers of the head and neck . A provident of coexistence of many of these types in the same patient could be seen in approximately 10-15% of patients, as the lack of adequate information on the oncogenic potential of many other types complicated the treatment and the further outcome. Although the variety of treatment options, genital condylomata acuminata still show high recurrent rate to destructive topical regiments, because of the activation of the viruses at some point, which emphasise the importance of virus- eradication, instead only of the topical destruction of the lesions.  Despite decreasing the recurrent rate, the most important goal of immunisation is the reduction of the incidence of HPV-associated squamous cell carcinomas using either the quadrivalent (Silgard/Gardasil or the bivalent (Cervarix HPV (human papillomavirus vaccine. We present a patient with periurethral condylomata acuminate, who refused performing of a biopsy for determining the virus type, as we want to emphasize the importance of the virus - treatment in all cases of genital warts, instead only of topical destruction of the lesions, not only because of the recurrence incidence rate, but also because of the well - known oncogenic potential of some HPV

  17. Tipos do Herbário Prisco Bezerra - EAC

    Directory of Open Access Journals (Sweden)

    Maria Stela Bezerra da Silva

    1990-01-01

    Full Text Available Com o presente trabalho pretende-se contribuir para a divulgação dos tipos do Herbário Prisco Bezerra - EAC. Um levantamento realizado no acervo do Herbário revelou o registro de dez tipos. Sete deles pertencentes à família Leguminosae distribuídas entre as subfamilias Caesalpinioideae: Peltogyne crenulata, Sentia dardanoi, Moldenhawera acuminata, Chamaecrista duckeana, Papilionoideae: Aeschynomene monteiroi, Cranocarpus gracilis e Mimosoideae: Mimosa niomarlei; dois, pertencentes à família Erythroxylaceae. As espécies Erythroxylum tianguanum e Erythroxylum bezerrae e um à família Euphorbiaceae: Dalechampia fernandesii recentemente descrita por G. Webster. Os tipos são apresentados na seqüência das indicações: nome das famílias, seguido do epíteto específico, habitat, com a transferência de todas as informações mencionadas na ficha de exsicata do material, bem como, a fotografia correspondente. Citam-se também alguns aspectos característicos das espécies, para melhor visualização dos detalhes fotográficos.The present paper repasts the type specimens in the Herbário Prisco Bezerra (University of Ceará. The Herbário has ten type, of which seven are Leguminosae: Peltoqyne crenulata, Senna dardanoi, Moldenhawera acuminata Chamaecrista duckeana, Aeschynomene monteiroi, Cranocarpus gracilis, Mimosa niomarlei, two the Erythroxylaceae: Erythroxylum tianquanum and Erythroxylum bezerrae and one Euphorbiaceae: Dalechampia fernandesii. Additional informations for these exsicata is presented.

  18. In vitro antioxidant, hypoglycemic and oral glucose tolerance test of banana peels

    Directory of Open Access Journals (Sweden)

    V.V. Navghare

    2017-08-01

    Full Text Available Banana fruit is claimed to have antidiabetic effects despite its high calorie content, and its peels also contain vital phytoconstituents including gallocatechin. Previously banana pulp has been studied for antihyperglycemic effects, and in the present investigation antihyperglycemic effect of ethanolic extract of inner peels of Musa sapientum (EMS, Musa paradisiaca (EMP, Musa cavendish (EMC and Musa acuminata (EMA fruit was evaluated using oral glucose tolerance test in normoglycemic rats. In vitro antioxidant study was conducted using DPPH, H2O2 radical scavenging assay and ferric reducing power assay. Wistar rats were divided into fourteen groups and twelve groups received different doses of aforementioned extracts, while control group received gum acacia solution and remaining group received standard drug, glimepiride. All the rats received glucose load at a dose of 2 g/kg body weight. Groups treated with EMC and EMA showed significant decrease in glucose level (p < 0.01 at 150 min as compared to control group. In hypoglycemic study, only EMP 500 mg/kg, p.o. treated group revealed a significant decrease (p < 0.05 in glucose level at 120 min, while other groups did not show any sign of hypoglycemia. In glucose tolerance test, animals treated with EMC and EMA depicted dose dependent antihyperglycemic effect at 150 min while EMS and EMP showed significant reduction in plasma glucose at higher doses. In a similar fashion, EMA i.e. M. acuminata demonstrated highest antioxidant activity followed by EMC against DPPH radical. In ferric reducing power and H2O2 scavenging assay, EMA demonstrated maximal antioxidant activity when compared with other extracts.

  19. Pathologic audit of 164 consecutive cases of vulvar intraepithelial neoplasia.

    Science.gov (United States)

    Scurry, James; Campion, Michael; Scurry, Bonnie; Kim, Soo Nyung; Hacker, Neville

    2006-04-01

    There are 2 types of vulvar intraepithelial neoplasia (VIN): warty-basaloid and differentiated. Differentiated VIN is uncommon and seldom diagnosed prior to carcinoma and, traditionally, is not graded. There are currently 3 grading systems for warty-basaloid VIN: the World Health Organization (WHO) 3 grade system of VIN 1-3, a 2 grade system of low and high grade vulvar intraepithelial lesions, and the revised International Society for the Study of Vulvovaginal Disease (ISSVD) classification which has no grading of VIN. According to the ISSVD, VIN 1 should be abolished and VIN 2 and 3 combined into a single category, simply termed warty-basaloid VIN. To determine the best system for grading warty-basaloid VIN and learn more about differentiated VIN, we reviewed the pathology of 164 consecutive women with VIN. Of these, 134 (82.3%) had warty-basaloid VIN, 29 (18.2%) had differentiated VIN, and 1 had both. Of warty-basaloid VIN cases, 4 had VIN 1, 13 VIN 2, and 118 VIN 3 when graded according to the WHO. All VIN 1 occurred in condylomata acuminata. VIN 2 and 3 were distinguished only by degree of abnormality. Differentiated VIN was diagnosed before SCC in only 7 cases (26.7%). Because the only VIN 1 cases seen were in condylomata acuminata and because VIN 2 and 3 were difficult to distinguish and there appears little clinical reason to do so, our study supports the ISSVD proposal that VIN 1 be abolished and VIN 2 and 3 be combined. There needs to be more clinical awareness of vulvar conditions, so that differentiated VIN is biopsied before cancer has supervened.

  20. Monitoring of Dinophysis species and diarrhetic shellfish toxins in Flødevigen Bay, Norway: inter-annual variability over a 25-year time-series.

    Science.gov (United States)

    Naustvoll, L-J; Gustad, E; Dahl, E

    2012-01-01

    The accumulation of phycotoxins in bivalve mussels associated with mussels feeding on toxic phytoplankton is a well-known phenomenon in Norway. Regular monitoring for 25 years has revealed that accumulation of Diarrhetic Shellfish poisoning (DSP) toxins in mussels is the main phycotoxin problem along the Norwegian coast. The aim of this study was to evaluate possible trends over time of Dinophysis spp. and DSP as well as possible correlation between abundance of Dinophysis spp. and toxin accumulation in mussels, as based on intensive and regular monitoring at the southern coast of Norway at Flødevigen Bay. The main source organism causing a risk of DSP in Norway is Dinophysis acuta. However, it cannot be excluded that other Dinophysis spp., e.g. D. acuminata and D. norvegica, may contribute to the total accumulation of toxins. The variability in the occurrence of these species is high at both short- and long-term; between days and between years. There are, however, some important overall patterns in the occurrence of the species during the last decades. Dinophysis acuminata and D. norvegica have mainly been abundant from March to December, whereas D. acuta has typically occurred in late summer and autumn (August-December). For all three species we have observed a narrowing of the peak season since 2002 at the same time as they have become less abundant. Coincident with these changes, the problem of the accumulation of DSP toxins in mussels along the southern coast of Norway has declined significantly, but it is still mainly restricted to the autumn. Why the cell concentration of Dinophysis spp. has declined after 2002 is not obvious, but this has occurred in a period with relatively high summer temperatures. The relatively simultaneous changes in physical, chemical and biological factors of the pelagic ecosystem along the southern coast of Norway indicate that complicated ecological interactions may be involved.

  1. Variaciones de abundancia y biomasa del zooplancton en un embalse tropical oligo-mesotrófico del norte de Venezuela

    Directory of Open Access Journals (Sweden)

    Sandra Merayo

    2010-06-01

    Full Text Available La abundancia del zooplancton en los embalses está determinada principalmente por la velocidad y el contenido del agua, pero se sabe relativamente poco sobre los embalses tropicales. Se estudió la distribución temporal y espacial de la abundancia y la biomasa del zooplancton en el eje longitudinal del embalse de Clavellinos, en el norte de Venezuela, entre octubre 2006 y septiembre 2007. El zooplancton fue recolectado en el estrato oxigenado con una red de plancton. Un total de 16 taxones fueron identificados: Copepoda, Cladocera, Rotifera, Ostracoda y Diptera. Thermocyclops decipiens (Copepoda, Cyclopoida dominó la comunidad, mientras que los rotíferos fueron los más diversos, con 10 especies. La abundancia del zooplancton varió de 31 a 101ind/l en E1, 36 a 84ind/l en E2, y, de 30 a 250ind/L en el E3. La biomasa varió de 97,4 a 1406.3μg/l en E1, 108,5 a 397.2μg/l en E2, y de 25,9 a 763.9μg/l en el E3. Esta comunidad de zooplancton pareciσ responder a las variaciones ambientales en el embalse, mαs que a las variaciones en la disponibilidad de recursos.Variations of zooplankton abundance and biomass in a tropical oligo-mesotrophic reservoir in Northern Venezuela. Zooplankton abundance in reservoirs is mainly determined by the speed and content of the water, but relatively little is known regarding tropical reservoirs. We studied the seasonal and spatial distribution of zooplankton abundance and biomass along the longitudinal axis of Clavellinos reservoir, northern Venezuela, from October 2006 to September 2007. Zooplankton was collected from the oxygenated layer using a plankton net. A total of 16 taxa were identified: Copepoda, Cladocera, Rotifera, Ostracoda and Diptera. Thermocyclops decipiens (Copepoda, Cyclopoida dominated the community, while rotifers were the most diverse, with 10 species. Zooplankton abundance varied from 31 to 101ind/L in E1, 36 to 84ind/L in E2, and, from 30 to 250ind/L in E3. Biomass varied from 97.4 to

  2. Vertical distribution of zooplankton in the water column of Lago Amapá, Rio Branco, Acre, Brazil

    Directory of Open Access Journals (Sweden)

    Erlei Cassiano Keppeler

    2004-06-01

    Full Text Available The aim of investigation was to study the model of vertical distribution in Lago Amapá, taking into consideration the seasonality of its zooplanktonic composition. Lago Amapá (10º2'36"S and 67º50'24"W is located in the floodplain of the Rio Acre. Samplings were conducted at three different depths of the water column, to study the vertical distribution of zooplankton populations and determine some physico-chemical and biological parameters of Lago Amapá. Weekly samples were taken with a Van Dorn sampler. The species showed greater concentrations at the by means of water column. Thirty-eight zooplankton species were found in the samples represented by Rotifera (30, Cladocera (5 and Cyclopoida (3. The temperature of the water column showed a tendency toward relatively high values (about 30ºC with little variation, consequently resulting in low viscosity. Based of Jaccard's index, it was seen that during the low-water phase, S1 and S3 of the three sampling stations studied, had greater similarity (Cj = 0.7058 in the middle of the water column. Lago Amapá showed characteristics in line with the intermediate disturbance hypothesis model, favoring colonization by opportunistic species such as rotifers.O objetivo desta investigação foi observar a distribuição vertical da comunidade do zooplâncton no Lago Amapá (10º2'36"S e 67º50'24"W, localizado na planície de inundação do Rio Acre. Amostragens foram conduzidas em três diferentes profundidades da coluna da água, considerando aspectos sazonais do zooplâncton, parâmetros físicos, químicos e biológicos. Coletas foram realizadas semanalmente com Garrafa de Van Dorn. As espécies apresentaram maiores concentrações no meio da coluna da água. Foram encontradas 38 espécies, assim distribuídas: Rotifera (30, Cladocera (5 e Cyclopoida (3. A temperatura da coluna da água em geral apresentou-se alta, em torno de 30ºC, com pequena variação, resultando em baixa viscosidade. O

  3. Trophic ecology of the freshwater prawn, Pseudopalaemon bouvieri (Decapoda: Palaemonidae in Northeastern Argentina: with remarks on population structure

    Directory of Open Access Journals (Sweden)

    Romina Patricia Carnevali

    2012-03-01

    Full Text Available Freshwater decapod crustaceans are important components of food webs in these environments, but little is known about the diet of species that live in tropical waters. We studied the feeding ecology of the prawn Pseudopalaemon bouvieri and its population structure in two different areas with six lagoons, with a different composition and abundance of aquatic macrophytes. At each site of macrophytes banks, 18 prawns sample was collected with a hand net (1mm mesh size from 1m². In the laboratory, prawns cephalothorax length was measured, sex determined, and a total of 208 stomachs were examined for food items. Our results showed that the population abundance varied between 10 ind/m² and 1 411 ind/m². The cephalothorax length ranged between 6mm and 21mm, and the male:female ratio varied between 0.3 and 1.0, with a higher proportion of ovigerous females (21% in area one than area two. P. bouvieri is omnivorous, and its diet was principally based on algae, plant remains, Protozoa, Rotifera, Oligochaeta, Crustacea, Insecta, detritus and other items. The analysis of the stomach content did not reveal any significant difference in the diet between juveniles and adults, and males and females of both areas consumed a similar diet (Kruskal-Wallis test p=0.8273. We concluded that the dietary items consumed by prawns and the niche breadth were similar between the two areas, although the proportion of items consumed varied between lagoons of both areas. The density of P. bouvieri was different between areas, but the size of cephalothorax (CL was similar.

  4. Spatial variations in zooplankton diversity in waters contaminated with composite effluents

    Directory of Open Access Journals (Sweden)

    Asitava CHATTERJEE

    2007-08-01

    Full Text Available Zooplankton species are cosmopolitan in their clean freshwater habitat and are also found in industrial and municipal wastewaters. The present study records for the first time the aspects of zooplankton diversity in relation to physico-chemical environment of five selected sites of the East Calcutta wetlands, a Ramsar site of Kolkata city, India, heavily contaminated by industrial and municipal wastewaters. The study revealed the occurrence of 22 species of zooplankton, among these 3 species of Cladocera, 2 species of Copepoda, 15 species of Rotifera, and 2 species of Ostracoda were recorded. The copepod Mesocyclops leuckarti was found in all the five sites, rotifers Asplanchna brightwelli, Brachionus angularis, B. calyciflorus and Cladocera Ceriodaphnia cornuta were found in four sites; Moina micrura and Diaphanosoma sarsi were found at three sites. Site wise variation in dominance, diversity, evenness and richness were calculated. Site 1, a fish-pond that stabilized composite wastewater, showed the maximum species richness having 17 species, while Site 2, SWF wastewater carrying canal, showed only 4 species. The calculated Jack 1 values of Sites 1 to 5 were 21.78, 3.77, 18.63, 12.5 and 16.95 respectively. Shannon-Wiener species diversity index (H/ values were almost similar for all the three relatively less polluted sites viz, Site 1 (1.959, Site 4 (2.010, Site 5 (2.047. However, at highly polluted sites viz., 2 and 3, H/ value of 1.336 and 0.984 respectively, were calculated. Simpson’s Dominance index (Dsimp value was highest at Site 3 (0.618 indicating maximum dominance, whereas at Site 5 dominance was lowest (0.1680 and diversity was highest. We discuss the role of zooplankton in the amelioration of wastewater.

  5. Estudio de la composición y abundancia del zooplancton durante la fase de llenado del embalse Amaní, Norcasia (Caldas

    Directory of Open Access Journals (Sweden)

    Juan Pablo Álvarez Silva

    2003-01-01

    Full Text Available La variación de la composición, abundancia y diversidad del zooplancton fue analizada durante la fase de llenado del embalse Amaní en un gradiente horizontal y vertical, a partir de trece muestreos semanales realizados entre junio y agosto de 2002. La composición del zooplancton es similar a otros ecosistemas lénticos tropicales de baja altitud y fue registrado un total 32 taxa, de los cuales se destaca el rotífero Keratella por su elevada abundancia durante junio y julio. Rotifera fue el grupo que presentó la mayor riqueza de especies (16 así como una sobresaliente dominancia numérica sobre copépodos y cladóceros, con una abundancia relativa superior al 60%. La densidades promedio del zooplancton fluctuaron de manera significativa (6 a 1525 org l-1, y de forma diferencial entre los brazos del embalse y los sectores de confluencia y presa, que presentaron los menores intervalos (14-208 org l-1 y 6-108 org l-1, respectivamente. En el presente trabajo se incluyen los patrones de comportamiento de la abundancia de los géneros más frecuentes de zooplancton así como de aspectos relacionados con la dinámica poblacional de los copépodos Thermocyclops decipiens y Mesocyclops aspericornis. Se discuten los cambios en la estructura de la comunidad del zooplancton y se mencionan las posibles interacciones y fenómenos de regulación entre los diferentes taxa zooplanctónicos y de estos con el fitoplancton. Finalmente se presenta un catalogo de microfotografías de los organismos registrados. Este trabajo constituye un aporte importante de ecología descriptiva del zooplancton limnético y da pautas para posteriores monitoreos en este embalse.

  6. Epiphytic invertebrate patterns in coastal lakes along a gradient of salinity and water exchange with the sea

    Science.gov (United States)

    Obolewski, Krystian; Bąkowska, Martyna

    2017-10-01

    The species composition and abundance of epiphytic fauna inhabiting common reed (Phragmites australis (Cav.) Trin. ex Steud.) was performed in five coastal lakes in Słowiński National Park (southern Baltic coast in northern Poland). The lakes represent a salinity gradient (from freshwater to β-oligohaline waters) and four types of coastal lakes: (1) lagoon, L (Lake Łebsko, seawater enters it permanently); (2) coastal lake with periodically brackish water, CLB (Lake Gardno); (3) freshwater costal lake, CLF (Lake Smołdzińskie); and (4) coastal dune lakes, CLD (Dołgie Wielkie and Dołgie Małe). Using statistical ordination techniques, we found that the structure of epiphytic fauna (microinvertebrates and macroinvertebrates) is determined primarily by hydrological connectivity (water exchange) with the sea. Canonical Correspondence Analysis, coupled with variance partitioning, showed that hydrological connectivity accounted for 24% of the variation in the invertebrate community, followed by physico-chemical (19%) and trophic (8%) factors. Our results indicate that the assemblages of Ciliata-libera and Cnidaria are characteristic for L (β-oligohaline), Rotifera, Suctoria, Chaetogaster sp., Gastropoda and Trichoptera are characteristic for CLB (limnetic/β-oligohaline), but no taxonomic groups are characteristic for CLF and CLD (both limnetic). The index of multivariate dispersion showed a decreasing trend with the increasing lake isolation from the open sea, except for CLD. However, in terms of the structure of epiphytic fauna, Multi-Response Permutation Procedures showed that CLD significantly differed only from CLB. Our results suggest that the identified characteristic taxonomic groups of plant-associated macroinvertebrates have a high potential to be used as bioindicators of salinity and water exchange with the sea, due to their sensitivity to environmental stress.

  7. Effects of the fungicide metiram in outdoor freshwater microcosms: responses of invertebrates, primary producers and microbes.

    Science.gov (United States)

    Lin, Ronghua; Buijse, Laura; Dimitrov, Mauricio R; Dohmen, Peter; Kosol, Sujitra; Maltby, Lorraine; Roessink, Ivo; Sinkeldam, Jos A; Smidt, Hauke; Van Wijngaarden, René P A; Brock, Theo C M

    2012-07-01

    The ecological impact of the dithiocarbamate fungicide metiram was studied in outdoor freshwater microcosms, consisting of 14 enclosures placed in an experimental ditch. The microcosms were treated three times (interval 7 days) with the formulated product BAS 222 28F (Polyram®). Intended metiram concentrations in the overlying water were 0, 4, 12, 36, 108 and 324 μg a.i./L. Responses of zooplankton, macroinvertebrates, phytoplankton, macrophytes, microbes and community metabolism endpoints were investigated. Dissipation half-life (DT₅₀) of metiram was approximately 1-6 h in the water column of the microcosm test system and the metabolites formed were not persistent. Multivariate analysis indicated treatment-related effects on the zooplankton (NOEC(community) = 36 μg a.i./L). Consistent treatment-related effects on the phytoplankton and macroinvertebrate communities and on the sediment microbial community could not be demonstrated or were minor. There was no evidence that metiram affected the biomass, abundance or functioning of aquatic hyphomycetes on decomposing alder leaves. The most sensitive populations in the microcosms comprised representatives of Rotifera with a NOEC of 12 μg a.i./L on isolated sampling days and a NOEC of 36 μg a.i./L on consecutive samplings. At the highest treatment-level populations of Copepoda (zooplankton) and the blue-green alga Anabaena (phytoplankton) also showed a short-term decline on consecutive sampling days (NOEC = 108 μg a.i./L). Indirect effects in the form of short-term increases in the abundance of a few macroinvertebrate and several phytoplankton taxa were also observed. The overall community and population level no-observed-effect concentration (NOEC(microcosm)) was 12-36 μg a.i./L. At higher treatment levels, including the test systems that received the highest dose, ecological recovery of affected measurement endpoints was fast (effect period < 8 weeks).

  8. Global isolation by distance despite strong regional phylogeography in a small metazoan

    Science.gov (United States)

    Mills, Scott; Lunt, David H; Gómez, Africa

    2007-01-01

    Background Small vagile eukaryotic organisms, which comprise a large proportion of the Earth's biodiversity, have traditionally been thought to lack the extent of population structuring and geographic speciation observed in larger taxa. Here we investigate the patterns of genetic diversity, amongst populations of the salt lake microscopic metazoan Brachionus plicatilis s. s. (sensu stricto) (Rotifera: Monogononta) on a global scale. We examine the phylogenetic relationships of geographic isolates from four continents using a 603 bp fragment of the mitochondrial COI gene to investigate patterns of phylogeographic subdivision in this species. In addition we investigate the relationship between genetic and geographic distances on a global scale to try and reconcile the paradox between the high vagility of this species and the previously reported patterns of restricted gene flow, even over local spatial scales. Results Analysis of global sequence diversity of B. plicatilis s. s. reveals the presence of four allopatric genetic lineages: North American-Far East Asian, Western Mediterranean, Australian, and an Eastern Mediterranean lineage represented by a single isolate. Geographically orientated substructure is also apparent within the three best sampled lineages. Surprisingly, given this strong phylogeographic structure, B. plicatilis s. s. shows a significant correlation between geographic and genetic distance on a global scale ('isolation by distance' – IBD). Conclusion Despite its cosmopolitan distribution and potential for high gene flow, B. plicatilis s. s. is strongly structured at a global scale. IBD patterns have traditionally been interpreted to indicate migration-drift equilibrium, although in this system equilibrium conditions are incompatible with the observed genetic structure. Instead, we suggest the pattern may have arisen through persistent founder effects, acting in a similar fashion to geographic barriers for larger organisms. Our data indicates

  9. EST based phylogenomics of Syndermata questions monophyly of Eurotatoria

    Directory of Open Access Journals (Sweden)

    Bucher Gregor

    2008-12-01

    Full Text Available Abstract Background The metazoan taxon Syndermata comprising Rotifera (in the classical sense of Monogononta+Bdelloidea+Seisonidea and Acanthocephala has raised several hypotheses connected to the phylogeny of these animal groups and the included subtaxa. While the monophyletic origin of Syndermata and Acanthocephala is well established based on morphological and molecular data, the phylogenetic position of Syndermata within Spiralia, the monophyletic origin of Monogononta, Bdelloidea, and Seisonidea and the acanthocephalan sister group are still a matter of debate. The comparison of the alternative hypotheses suggests that testing the phylogenetic validity of Eurotatoria (Monogononta+Bdelloidea is the key to unravel the phylogenetic relations within Syndermata. The syndermatan phylogeny in turn is a prerequisite for reconstructing the evolution of the acanthocephalan endoparasitism. Results Here we present our results from a phylogenomic approach studying i the phylogenetic position of Syndermata within Spiralia, ii the monophyletic origin of monogononts and bdelloids and iii the phylogenetic relations of the latter two taxa to acanthocephalans. For this analysis we have generated EST libraries of Pomphorhynchus laevis, Echinorhynchus truttae (Acanthocephala and Brachionus plicatilis (Monogononta. By extending these data with database entries of B. plicatilis, Philodina roseola (Bdelloidea and 25 additional metazoan species, we conducted phylogenetic reconstructions based on 79 ribosomal proteins using maximum likelihood and bayesian approaches. Our findings suggest that the phylogenetic position of Syndermata within Spiralia is close to Platyhelminthes, that Eurotatoria are not monophyletic and that bdelloids are more closely related to acanthocephalans than monogononts. Conclusion Mapping morphological character evolution onto molecular phylogeny suggests the (partial or complete reduction of the corona and the emergence of a retractable

  10. Preliminary assessment of the zooplankton community composition in a region under the influence of a uranium mine (Caldas, Southeastern Brazil)

    International Nuclear Information System (INIS)

    Ferrari, Carla Rolim; Roque, Claudio Vitor; Ronqui, Leilane B.; Campos, Michelle B.; Rodgher, Suzelei; Nascimento, Marcos Roberto Lopes; Azevedo, Heliana de; Wisniewski, Maria Jose dos Santos

    2009-01-01

    The Ore Treatment Unit consists of an open cast mine (CM), its mining waste areas, facilities for the physical treatment of the ore, and a chemical treatment plant for uranium extraction. At CM, the processes of acid drainage create effluents, which are treated by chemical processes and, thereafter, disposed of in Antas dam. The objective of the present study was to make an inventory of zooplanktonic and describe the physicochemical characteristics of site CM and at the site of treated effluents disposal (site 41), located at Antas dam. Water samples were collected in October/08 and January/09, in order to describe the abiotic variables and the zooplankton community. The average values of conductivity at sites CM and 41 were 2415 and 422 μ/cm 2 , respectively. Values of pH at site CM remained acid, whereas, at site 41 we recorded values near neutrality. The concentrations of total nutrients at both sampling sites were higher in the rainy season. Zooplankton species richness present at site CM was lower than at site 41, and there were only two identified species Bosmina sp and Keratella americana. At site 41 we recorded more species, mainly of the Rotifera. Among Cladocera, we identified two species, regarding Copepoda, the orders Cyclopoida and Calanoida were present. At site CM the density values were lower compared to site 41. The preliminary assessment of the zooplankton community showed lower values of species richness and density at site CM, what may be probably explained by the adverse environmental conditions for zooplankton community. (author)

  11. Evaluation of some water characteristics of the blue nile in Khartoum state as indicators of river nile pollution

    International Nuclear Information System (INIS)

    Khilla, E. E. A.

    2004-05-01

    This study investigated some physical, chemical and biological characteristics of the Blue nile river in Khartoum state. Four sites were chosen and studied namely. River transport corporation. Burri and Bahri power stations and Manshiya bridge (under construction) between may and july 2003. Four classes of phytoplankton were encountered: chlorophyceae, chrysophyceae, bacillariophyceae; with the last two classes being the most dominant.The zooplankton was represented by the genera copepoda- the dominant one- cladocera and rotifera. River transport corporation site showed higher total coliform counts during may and june, while all four stations showed the highest count (>100 MPN per 100 ml) in july. Values for total coliform and fecal bacteria were higher than previous studies which could be an indication that the blue nile river is polluted with both total coliform and fecal coliform bacteria. Pollution indicators were also manifested in relatively higher values of BOD, COD, and NO 3N , NO 2N .This could be attributed to anthropogenic activities such as bickerers, agricultural runoff, human and animal waste. Some of the changes were attributed to the natural hydrological regime of the Blue nile river such as increase of temperature, transparency and pH, at low flood period and the increase in TDS and conductivity; decline in transparency besides the disappearance of plankton with the onset of floodwater. The site of Manshiya bridge exhibited lowest transparency value due to dredging activities.The investigation within the Manshiya bridge site (under construction ), albeit done in a preliminary way. is the first of its kind in Sudan. The data indicate that the Blue nile river within Khartoum state has undergone physical, chemical and biological changes.The magnitude, causes and trends are yet to be elucidated.The study calls for an urgent, proper and long-term investigation of the Blue nile as well as the major rivers in Sudan.(Author)

  12. Composición y abundancia del zooplancton en la laguna El Morro, Isla de Margarita, Venezuela

    Directory of Open Access Journals (Sweden)

    William Villalba

    2017-12-01

    Full Text Available Se analizó la composición y abundancia del zooplancton de la laguna El Morro en la isla de Margarita, Venezuela, durante el periodo de surgencia (marzo-mayo 2011 y de relajación (junio-agosto 2011. Las muestras fueron recolectadas en 6 estaciones de las diferentes zonas de la laguna. Se realizaron calados con una red de plancton de 333 µm durante 10 minutos. Se midió in situ la temperatura, salinidad y oxígeno disuelto, además de nutrientes. Se registraron valores medios de temperatura de 29.7 ºC, salinidad de 36 ups, oxígeno disuelto de 5.9 mg.L-1. La concentración de nutrientes fue baja (medias de 0.12; 0.04; 0.03 mg.L-1 para nitrato, nitrito y fosfato, respectivamente. Se detectaron diferencias significativas temporales con mayores registros en la temporada de relajación, mientras que espacialmente no mostró diferencias, a pesar que en las estaciones internas (Est. 4,5,6 se obtuvo mayor abundancia. Se identificaron quince grupos zooplanctónicos, determinándose nueve especies del grupo Copepoda, dos de Cladocera, una de Decapoda, Tunicada y Rotifera y diferentes formas larvarias de distintos taxa. Las larvas de crustáceos presentaron la abundancia media y relativa más alta (47738 ind.m-3 y 46.83%, respectivamente, seguido del copépodo Oithona nana (31740 ind.m-3 y 25.94%, respectivamente y Paracalanus quasimodo (12958 ind.m-3 y 8.47%, respectivamente. Esta laguna involucra la estacionalidad surgencia-relajación como un efecto importante en la distribución y abundancia del zooplancton.

  13. Mechanisms underlying recovery of zooplankton in Lake Orta after liming

    Directory of Open Access Journals (Sweden)

    Roberta Piscia

    2016-04-01

    Full Text Available The goal of this study was to improve the understanding of the large-scale mechanisms underlying the recovery of the zooplankton of Lake Orta from historical contamination, following reduced input of ammonia and metals and the subsequent 1989/90 liming intervention. The industrial pollution had been severe and long-lasting (1929-1990. Zooplankton biodiversity has improved, but most of the new taxa appearing in our counts are rotifers, while many calanoids and the large cladoceran predators (Bythotrephes and Leptodora that are common in the nearby Lake Maggiore, were still absent from Lake Orta 17 years after liming. To aid understanding of the large-scale mechanisms controlling changes in annual richness, we assessed the annual persistence (P of Crustacea and Rotifera taxa as an estimator of whether propagules that survived introduction, as result of the natural recolonization process, also thrived. We found that the rate of introduction of zooplankton colonists and their persistence in the water column of Lake Orta changed from 1971 to 2007. New rotifer taxa appeared in the lake after the mid-1980s, when discharge of toxic substances decreased, but their annual persistence was low (P<0.5 until the turn of the century. The numerical values of rotifer and crustacean persistence in Lake Orta were unexpectedly high in 2001 and 2007 (0.55 and 0.72 for rotifers, 0.85 and 0.86 for crustacean, respectively, much higher than in limed lakes in Sudbury, Canada, and in adjacent Lake Maggiore. We hypothesize this could be related to the lack of Cladoceran predators and zooplanktivorous fish in the pelagic waters of Lake Orta.

  14. Correspondence of zooplankton assemblage and water quality in wetlands of Cachar, Assam, India: Implications for environmental management

    Directory of Open Access Journals (Sweden)

    Kar Sulata

    2018-03-01

    Full Text Available The zooplankton assemblage of selected wetlands of Assam, India was assessed to deduce the structural variation in the context of water quality parameters. A two year study between 2012 and 2014 comprising of 530 samples from the five wetlands revealed the presence of 46 taxa, 26 Rotifera, 15 Cladocera, 4 Copepoda and 1 Ostracoda, in varying density. The rotifers dominated in terms of abundance (48 ind. cm−3 followed by the cladocerans (28 ind. cm−3 and the copepods (19 ind. cm−3 and showed significant (p <0.05 correlations with turbidity, alkalinity, hardness and phosphate contents of the water samples. The diversity and the richness of the zooplankton showed an increasing trend with the water temperature. Among the different taxa, Brachionus sp. was most abundant followed by Mesocyclops sp. while Beauchampiella sp. was represented in the least numbers. Application of the cluster analysis allowed the segregation of the different zooplankton based on the similarities of abundance in the samples. The water quality parameters like temperature, alkalinity, turbidity, magnesium and calcium were observed to be significant contributors in shaping the zooplankton community composition of the wetlands, revealed through the correlations and canonical correspondence analysis. As an extension, the information can be used in monitoring the quality of the freshwater habitats of the concerned and similar geographical regions, using the zooplankton as the major constituents. The variations in the abundance of cladoceran, copepod and rotifer zooplanktons can be used to understand the mechanisms that sustain the food webs of the aquatic community of the freshwater bodies.

  15. Food web effects of titanium dioxide nanoparticles in an outdoor freshwater mesocosm experiment.

    Science.gov (United States)

    Jovanović, Boris; Bezirci, Gizem; Çağan, Ali Serhan; Coppens, Jan; Levi, Eti E; Oluz, Zehra; Tuncel, Eylül; Duran, Hatice; Beklioğlu, Meryem

    2016-09-01

    Over the course of 78 days, nine outdoor mesocosms, each with 1350 L capacity, were situated on a pontoon platform in the middle of a lake and exposed to 0 μg L(-1) TiO2, 25 μg L(-1) TiO2 or 250 μg L(-1) TiO2 nanoparticles in the form of E171 TiO2 human food additive five times a week. Mesocosms were inoculated with sediment, phytoplankton, zooplankton, macroinvertebrates, macrophytes and fish before exposure, ensuring a complete food web. Physicochemical parameters of the water, nutrient concentrations, and biomass of the taxa were monitored. Concentrations of 25 μg L(-1) TiO2 and 250 μg L(-1) TiO2 caused a reduction in available soluble reactive phosphorus in the mesocosms by 15 and 23%, respectively, but not in the amount of total phosphorus. The biomass of Rotifera was significantly reduced by 32 and 57% in the TiO2 25 μg L(-1) and TiO2 250 μg L(-1) treatments, respectively, when compared to the control; however, the biomass of the other monitored groups-Cladocera, Copepoda, phytoplankton, macrophytes, chironomids and fish-remained unaffected. In conclusion, environmentally relevant concentrations of TiO2 nanoparticles may negatively affect certain parameters and taxa of the freshwater lentic aquatic ecosystem. However, these negative effects are not significant enough to affect the overall function of the ecosystem, as there were no cascade effects leading to a major change in its trophic state or primary production.

  16. Temporal and spatial distribution of the meiobenthic community in Daya Bay, South China Sea

    Science.gov (United States)

    Tang, L.; Li, H. X.; Yan, Y.

    2012-04-01

    Spatial and temporal biodiversity patterns of the meiobenthos were studied for the first time in Daya Bay, which is a tropical semi-enclosed basin located in the South China Sea. The abundance, biomass, and composition of the meiobenthos and the basic environmental factors in the bay were investigated. The following 19 taxonomic groups were represented in the meiofauna: Nematoda, Copepoda, Polychaeta, Oligochaeta, Kinorhyncha, Gastrotricha, Ostracoda, Bivalvia, Turbellaria, Nemertinea, Sipuncula, Hydroida, Amphipoda, Cumacea, Halacaroidea, Priapulida, Echinodermata, Tanaidacea, and Rotifera. Total abundance and biomass of the meiobenthos showed great spatial and temporal variation, with mean values of 993.57 ± 455.36 ind cm-2 and 690.51 ± 210.64 μg 10 cm-2, respectively. Nematodes constituted 95.60 % of the total abundance and thus had the greatest effect on meiofauna quantity and distribution, followed by copepods (1.55 %) and polychaetes (1.39 %). Meiobenthos abundance was significantly negatively correlated with water depth at stations (r=-0.747, P<0.05) and significantly negatively correlated with silt-clay content (r=-0.516, P<0.01) and medium diameter (r=-0.499, P<0.01) of the sediment. Similar results were found for correlations of biomass and abundance of nematodes with environmental parameters. Polychaete abundance was positively correlated with the bottom water temperature (r=0.456, P<0.01). Meiobenthos abundance differed significantly among seasons (P<0.05), although no significant difference among stations and the interaction of station × season was detected by two-way ANOVA. In terms of vertical distribution, most of the meiobenthos was found in the surface layer of sediment. This pattern was apparent for nematodes and copepods, but a vertical distribution pattern for polychaetes was not as obvious. Based on the biotic indices and analyses of their correlations and variance, the diversity of this community was likely to be influenced by

  17. Spiralian phylogeny informs the evolution of microscopic lineages.

    Science.gov (United States)

    Laumer, Christopher E; Bekkouche, Nicolas; Kerbl, Alexandra; Goetz, Freya; Neves, Ricardo C; Sørensen, Martin V; Kristensen, Reinhardt M; Hejnol, Andreas; Dunn, Casey W; Giribet, Gonzalo; Worsaae, Katrine

    2015-08-03

    Despite rapid advances in the study of metazoan evolutionary history [1], phylogenomic analyses have so far neglected a number of microscopic lineages that possess a unique combination of characters and are thus informative for our understanding of morphological evolution. Chief among these lineages are the recently described animal groups Micrognathozoa and Loricifera, as well as the two interstitial "Problematica" Diurodrilus and Lobatocerebrum [2]. These genera show a certain resemblance to Annelida in their cuticle and gut [3, 4]; however, both lack primary annelid characters such as segmentation and chaetae [5]. Moreover, they show unique features such as an inverted body-wall musculature or a novel pharyngeal organ. This and their ciliated epidermis have led some to propose relationships with other microscopic spiralians, namely Platyhelminthes, Gastrotricha, and in the case of Diurodrilus, with Micrognathozoa [6, 7]-lineages that are grouped by some analyses into "Platyzoa," a clade whose status remains uncertain [1, 8-11]. Here, we assess the interrelationships among the meiofaunal and macrofaunal members of Spiralia using 402 orthologs mined from genome and transcriptome assemblies of 90 taxa. Lobatocerebrum and Diurodrilus are found to be deeply nested members of Annelida, and unequivocal support is found for Micrognathozoa as the sister group of Rotifera. Analyses using site-heterogeneous substitution models further recover a lophophorate clade and position Loricifera + Priapulida as sister group to the remaining Ecdysozoa. Finally, with several meiofaunal lineages branching off early in the diversification of Spiralia, the emerging concept of a microscopic, acoelomate, direct-developing ancestor of Spiralia is reviewed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Global isolation by distance despite strong regional phylogeography in a small metazoan

    Directory of Open Access Journals (Sweden)

    Mills Scott

    2007-11-01

    Full Text Available Abstract Background Small vagile eukaryotic organisms, which comprise a large proportion of the Earth's biodiversity, have traditionally been thought to lack the extent of population structuring and geographic speciation observed in larger taxa. Here we investigate the patterns of genetic diversity, amongst populations of the salt lake microscopic metazoan Brachionus plicatilis s. s. (sensu stricto (Rotifera: Monogononta on a global scale. We examine the phylogenetic relationships of geographic isolates from four continents using a 603 bp fragment of the mitochondrial COI gene to investigate patterns of phylogeographic subdivision in this species. In addition we investigate the relationship between genetic and geographic distances on a global scale to try and reconcile the paradox between the high vagility of this species and the previously reported patterns of restricted gene flow, even over local spatial scales. Results Analysis of global sequence diversity of B. plicatilis s. s. reveals the presence of four allopatric genetic lineages: North American-Far East Asian, Western Mediterranean, Australian, and an Eastern Mediterranean lineage represented by a single isolate. Geographically orientated substructure is also apparent within the three best sampled lineages. Surprisingly, given this strong phylogeographic structure, B. plicatilis s. s. shows a significant correlation between geographic and genetic distance on a global scale ('isolation by distance' – IBD. Conclusion Despite its cosmopolitan distribution and potential for high gene flow, B. plicatilis s. s. is strongly structured at a global scale. IBD patterns have traditionally been interpreted to indicate migration-drift equilibrium, although in this system equilibrium conditions are incompatible with the observed genetic structure. Instead, we suggest the pattern may have arisen through persistent founder effects, acting in a similar fashion to geographic barriers for larger

  19. Patterns of diversity in soft-bodied meiofauna: dispersal ability and body size matter.

    Science.gov (United States)

    Curini-Galletti, Marco; Artois, Tom; Delogu, Valentina; De Smet, Willem H; Fontaneto, Diego; Jondelius, Ulf; Leasi, Francesca; Martínez, Alejandro; Meyer-Wachsmuth, Inga; Nilsson, Karin Sara; Tongiorgi, Paolo; Worsaae, Katrine; Todaro, M Antonio

    2012-01-01

    Biogeographical and macroecological principles are derived from patterns of distribution in large organisms, whereas microscopic ones have often been considered uninteresting, because of their supposed wide distribution. Here, after reporting the results of an intensive faunistic survey of marine microscopic animals (meiofauna) in Northern Sardinia, we test for the effect of body size, dispersal ability, and habitat features on the patterns of distribution of several groups. As a dataset we use the results of a workshop held at La Maddalena (Sardinia, Italy) in September 2010, aimed at studying selected taxa of soft-bodied meiofauna (Acoela, Annelida, Gastrotricha, Nemertodermatida, Platyhelminthes and Rotifera), in conjunction with data on the same taxa obtained during a previous workshop hosted at Tjärnö (Western Sweden) in September 2007. Using linear mixed effects models and model averaging while accounting for sampling bias and potential pseudoreplication, we found evidence that: (1) meiofaunal groups with more restricted distribution are the ones with low dispersal potential; (2) meiofaunal groups with higher probability of finding new species for science are the ones with low dispersal potential; (3) the proportion of the global species pool of each meiofaunal group present in each area at the regional scale is negatively related to body size, and positively related to their occurrence in the endobenthic habitat. Our macroecological analysis of meiofauna, in the framework of the ubiquity hypothesis for microscopic organisms, indicates that not only body size but mostly dispersal ability and also occurrence in the endobenthic habitat are important correlates of diversity for these understudied animals, with different importance at different spatial scales. Furthermore, since the Western Mediterranean is one of the best-studied areas in the world, the large number of undescribed species (37%) highlights that the census of marine meiofauna is still very far

  20. Estudios ecológicos en la Cordillera Oriental colombiana III. - La vegetación de la cuenca del lago de Tota (Boyacá Estudios ecológicos en la Cordillera Oriental colombiana III. - La vegetación de la cuenca del lago de Tota (Boyacá

    Directory of Open Access Journals (Sweden)

    Rangel Ch. Orlando

    1986-12-01

    Full Text Available In the river basin of the Tota lake (Boyacá there are two differents zones related to the geomorphology, soil and climate. In the noreast zone the ecological conditions allow that the vegetation shows a greater cover; in the norwest zone on the other hand these conditions are very drastic, the floristic composition of vegetation is poor and generally speaking the landscape is of "arid type".  The distribution of vegetation in the river basin is caused by topographic variations (altitude, reIief and by differences of climate (temperature and solar radiation. Around the lake, the soil-content of water and nutrients, the physiography and the wind-action in some cases determine of the arrangement of plants-associations. These units of vegetation (associations are described following the Zurich-Montpellier school and the rules and recomendations of the Code of Phytosociological Nomenclature (BARKMAN et at.. 1976.  Among these units are the: forest of Alnus acuminata subsp.  acuminata which grow on moist and marsh places around the lake and the sparse scrub with Hypericum ruscoides and Plantago monticola ond dry places.  In the "Páramo-región", the dense scrub with Brachyotum striqosum and Celamaqrostis effusa and the stemrosette communities with Espeletia lopezii were studied.  The "life-form" spectrum (RAUNKIAER, en BRAUN-BLANQUET, 1979 and the leaf characters (size, consistency, indumentation for each association also are provided. En la geomorfología y en el clima de la cuenca del lago de Tota, se diferencian dos regiones: nor-oriental y nor-occidental. En la primera las condiciones ecológicas son favorables y permiten una mayor cobertura y diversidad de la vegetación; la región nor-occidental por el contrario, esta sujeta a condiciones ecológicas drásticas, muestra una vegetación muy pobre y en general el paisaje es de tipo "árido".  La preliminar caracterización de los suelos, indica que en su mayoría, estos son bastante

  1. Occurrence of marine algal toxins in oyster and phytoplankton samples in Daya Bay, South China Sea.

    Science.gov (United States)

    Jiang, Tao; Liu, Lei; Li, Yang; Zhang, Jing; Tan, Zhijun; Wu, Haiyan; Jiang, Tianjiu; Lu, Songhui

    2017-09-01

    The occurrence and seasonal variations of marine algal toxins in phytoplankton and oyster samples in Daya Bay (DYB), South China Sea were investigated. Two Dinophysis species, namely, D. caudata and D. acuminata complex, were identified as Okadaic acid (OA)/pectenotoxin (PTX) related species. Liquid chromatography with tandem mass spectrometry (LC-MS/MS) analysis demonstrated that 2.04-14.47 pg PTX2 per cell was the predominant toxin in single-cell isolates of D. caudata. D. acuminata was not subjected to toxin analysis. The occurrence of OAs in phytoplankton concentrates of net-haul sample coincided with the presence of D. accuminata complex, suggesting that this species is most likely an OA producer in this sea area. OA, dinophysistoxins-1 (DTX1), PTX2, PTX2sa, gymnodimine (GYM), homoyessotoxin (homoYTX), and domoic acid (DA) demonstrated positive results in net haul samples. To our best knowledge, this paper is the first to report the detection of GYM, DA, and homoYTX in phytoplankton samples in Chinese coastal waters. Among the algal toxins, GYM demonstrated the highest frequency of positive detections in phytoplankton concentrates (13/17). Five compounds of algal toxins, including OA, DTX1, PTX2, PTX2sa, and GYM, were detected in oyster samples. DA and homoYTX were not detected in oysters despite of positive detections for both in the phytoplankton concentrates. However, neither the presence nor absence of DA in oysters can be determined because extraction conditions with 100% methanol used to isolate toxins from oysters (recommended by the EU-Harmonised Standard Operating Procedure, 2015) would likely be unsuitable for this water-soluble toxin. In addition, transformation of DA during the digestion process of oysters may also be involved in the negative detections of this toxin. GYM exhibited the highest frequency of positive results in oysters (14/17). OAs were only detected in the hydrolyzed oyster samples. The detection rates of PTX and PTX2sa in

  2. First report of diarrheic shellfish toxins in mollusks from Buenos Aires province (Argentina associated with dinophysis spp.: evidence of okadaic acid, dinophysistoxin-1 and their acylderivatives

    Directory of Open Access Journals (Sweden)

    Eugenia A Sar

    2012-06-01

    Full Text Available In January 2010, the toxin-producing dinoflagellates Dinophysis acuminata and D. caudata (10³ cells·l-1 were detected in Mar Azul during routine plankton monitoring in Buenos Aires Province coastal waters, Argentina. Wild clams Mesodesma mactroides and Donax hanleyanus from Mar Azul intertidal beach, which are part of the diet for local inhabitants and tourists, tested positive with the offcial lipophilic mouse bioassay. This paper focuses on the detection of Diarrhetic Shellfsh Poison (DSP toxins in these samples using a HPLC-FLD pre column derivatization procedure. The data showed that shellfish were contaminated with complex DSP toxin profiles composed of Okadaic Acid (OA, Dinophysistoxin-1 (DTX-1, Acyl-Dinophysistoxin-1 (Acyl-DTX-1 and Acyl-Okadaic Acid (Acyl-OA. The DSP toxins found in this study produce diarrhea symptoms consistent with those experienced by patients who had ingested cooked shellfish in January. This is the first report of Acyl-derivatives in South American Atlantic shellfish samples and of OA in Argentinean shellfish samples.Primer reporte de toxinas diarreicas de moluscos en bivalvos de la Provincia de Buenos Aires (Argentina asociado con Dinophysis spp.: evidencia de Ácido Okadaico, Dinophysistoxina-1 y sus acyl-derivados. En enero de 2010, los dinoflagelados productores de toxinas Dinophysis acuminata y D. caudata (10³ cells·l-1 fueron detectados en Mar Azul durante un monitoreo rutinario de fitoplancton realizado en aguas costeras de la Provincia de Buenos Aires, Argentina. Mesodesma mactroides (almeja amarilla y Donax hanleyanus (berberecho del intermareal de Mar Azul, que son parte de la dieta de los habitantes del lugar y de turistas, dieron resultado positivo para toxinas lipofílicas mediante bioensayo ratón. Este trabajo está focalizado en la detección de Toxinas Diarreicas de Moluscos (DSP en muestras colectadas durante el evento de toxicidad usando un HPLC-FLD con procedimiento de derivatizaci

  3. Anatomy and morphology character of five Indonesian banana cultivars (Musa spp. of different ploidy level

    Directory of Open Access Journals (Sweden)

    ISSIREP SUMARDI

    2010-04-01

    Full Text Available Sumardi I, Wulandari M (2011 Anatomy and morphology character of five Indonesian banana cultivars (Musa spp. of different ploidy level. Biodiversitas 12: 167-175. In Indonesia there are many cultivars of banana, and some of them produce edible fruits. Beside their morphology, the character which necessary as a tool for classification is anatomical character. The aim of this research were to describe the anatomical character and morphology of fives Indonesian banana cultivars based on their level of ploidy. The cultivars were collected from Banana Germplasm Plantation, Yogyakarta District, Indonesia. The samples of roots, rhizome, and leaf were collected from five banana cultivars i.e.: Musa acuminata cv Penjalin, M.balbisiana cv Kluthuk warangan, M.acuminata cv Ambon warangan, M.paradisiaca cv Raja nangka , and M. paradisiaca cv Kluthuk susu. For anatomy observation samples were prepared using paraffin method, stained with 1% safranin in 70% ethanol. To observe the structure of stomata and epidermis surface, slide were prepared using modification of whole mount method. Slides were observed using Olympus BHB microscope completed with Olympus camera BM-10A. Stem and leaf morphology character of diploid level (AA and BB genome is different with triploid level (AAA, AAB, and ABB genome. Anatomy and morphology character of root and rhizome of banana in diploid level (AA and BB genome and triploid level (AAA, AAB, and ABB genome is quite similar. Distribution of stomata is found in leaf and pseudostem. Stomata is found in adaxial and abaxial epidermis layer. The size of guard cells in triploid cultivars was longer than that diploid cultivars. The root composse of epidermis layer, cortex and cylinder vascular of five cultivar’s root show anomalous structure. Rhizome consist of peripheric and centre zone. Anatomically, this was no differences in the rizome structur among five banana cultivars. The row of vascular bundles act as demarcation area

  4. Origins and Domestication of Cultivated Banana Inferred from Chloroplast and Nuclear Genes

    Science.gov (United States)

    Zhang, Cui; Wang, Xin-Feng; Shi, Feng-Xue; Chen, Wen-Na; Ge, Xue-Jun

    2013-01-01

    Background Cultivated bananas are large, vegetatively-propagated members of the genus Musa. More than 1,000 cultivars are grown worldwide and they are major economic and food resources in numerous developing countries. It has been suggested that cultivated bananas originated from the islands of Southeast Asia (ISEA) and have been developed through complex geodomestication pathways. However, the maternal and parental donors of most cultivars are unknown, and the pattern of nucleotide diversity in domesticated banana has not been fully resolved. Methodology/Principal Findings We studied the genetics of 16 cultivated and 18 wild Musa accessions using two single-copy nuclear (granule-bound starch synthase I, GBSS I, also known as Waxy, and alcohol dehydrogenase 1, Adh1) and two chloroplast (maturase K, matK, and the trnL-F gene cluster) genes. The results of phylogenetic analyses showed that all A-genome haplotypes of cultivated bananas were grouped together with those of ISEA subspecies of M. acuminata (A-genome). Similarly, the B- and S-genome haplotypes of cultivated bananas clustered with the wild species M. balbisiana (B-genome) and M. schizocarpa (S-genome), respectively. Notably, it has been shown that distinct haplotypes of each cultivar (A-genome group) were nested together to different ISEA subspecies M. acuminata. Analyses of nucleotide polymorphism in the Waxy and Adh1 genes revealed that, in comparison to the wild relatives, cultivated banana exhibited slightly lower nucleotide diversity both across all sites and specifically at silent sites. However, dramatically reduced nucleotide diversity was found at nonsynonymous sites for cultivated bananas. Conclusions/Significance Our study not only confirmed the origin of cultivated banana as arising from multiple intra- and inter-specific hybridization events, but also showed that cultivated banana may have not suffered a severe genetic bottleneck during the domestication process. Importantly, our findings

  5. Nonmelanoma Skin Cancer in Nonwhite Organ Transplant Recipients.

    Science.gov (United States)

    Pritchett, Ellen N; Doyle, Alden; Shaver, Christine M; Miller, Brett; Abdelmalek, Mark; Cusack, Carrie Ann; Malat, Gregory E; Chung, Christina Lee

    2016-12-01

    Organ transplant recipients have a higher incidence of skin cancer. This risk is magnified over time and with continued exposure to immunosuppression. Skin cancer in nonwhite patients is associated with greater morbidity and mortality owing to diagnosis at a more advanced stage, which suggests that nonwhite organ transplant recipients are at even higher risk. To describe demographic and clinical factors and the incidence of skin cancer in nonwhite organ transplant recipients. We performed a retrospective medical record review of patients who were organ transplant recipients (154 were white and 259 nonwhite [black, Asian, Hispanic, Pacific Islander]) seen from November 1, 2011, to April 18, 2016 at an academic referral center. Variables were analyzed and compared between racial groups, including sex, age, race/ethnicity, Fitzpatrick type, type and location of skin cancer, type of organ transplanted, time to diagnosis of skin cancer after transplantation, and history of condyloma acuminata and/or verruca vulgaris. Most of the 413 patients (62.7%) evaluated were nonwhite organ transplant recipients; 264 were men, and 149 were women. Their mean (SD) age was 60.09 (13.59) years. Nineteen skin cancers were identified in 15 patients (5.8%) representing 3 racial/ethnic groups: black (6 patients), Asian (5), and Hispanic (4). All squamous cell carcinomas in blacks were diagnosed in the in situ stage, located on sun-protected sites, and occurred in patients whose lesions tested positive for human papilloma virus (HPV) and/or who endorsed a history of condyloma acuminata or verruca vulgaris. Most skin cancers in Asians were located on sun-exposed areas and occurred in individuals who emigrated from equatorial locations. Nonwhite organ transplant recipients are at risk for developing skin cancer posttransplantation. Follow-up in a specialized transplant dermatology center and baseline total-body skin examination should be part of posttransplantation care in all organ

  6. Las macrófitas de algunos lagos alto-andinos del Ecuador y su bajo potencial como bioindicadores de eutrofización

    Directory of Open Access Journals (Sweden)

    Benjamin Kiersch

    2004-12-01

    Full Text Available Se estudió la presencia de macrófitas en tres lagos de altoandinos en Ecuador,Lago San Pablo,Laguna La Mica y Lago Cuicocha.Los primeros dos son eutróficos, mientras que el último es un lago de caldera extremadamente oligotrófico.Las especies dominantes en los lagos eutróficos son:Ceratophyllum demersum , Myriophyllum quitense ,Potamogeton illinoensis ,P. striatus y Elodea matthewsii .En el lago oligotrófico están presentes P.pectinatus,P.illinoensi s,y las Characeae Chara rusbyabana ,Ch.globularis y Nitella acuminata .La máxima profundidad para la presencia de macrófitas puede ser usada como un indicador del estado de eutroficación,la cual va desde 5 m en la Laguna Mica a 35 m en el Lago Cuicocha.El valor de la bioindicación de las especies de macrófitas en estos lagos altoandinos es bajo,debido a que solo unas pocas especies están presentes,y algunas de ellas no son específicas para las condiciones ambientales.Macrophytes from some high Andean lakes of Ecuador and their low potential as bioindicators of eutrophication .The occurrence of macrophyte in three high Andean lakes of Ecuador,Lago San Pablo, Laguna La Mica and Lago Cuicocha was recorded in 5-9 transects per lake.The first two lakes are eutrophic, the third is an extremely oligotrophic caldera lake.The dominant species in eutrophic lakes are Ceratophyllum demersum ,Myriophyllum quitense ,Potamogeton illinoensis ,P.striatus and Elodea matthewsii .In the oligotrophic lake P.pectinatus,P.illinoensi s,and the Characeae Chara rusbyana ,Ch.globularis and Nitella acuminata occur.The maximum depth of the macrophyte ’s presence can be used as an indicator of the trophic state,ranging from about 5 m in Mica to 35 m in Cuicocha.The bioindication value of the macrophyte species in these high Andean lakes is low,because few species occur and because some of them are not specific to environmental conditions.Rev.Biol.Trop.52(4:829-837.Epub 2005 Jun 24.

  7. The Early Devonian eurypterid Grossopterus overathi (Gross, 1933 from Overath, Germany

    Directory of Open Access Journals (Sweden)

    J. A. Dunlop

    2002-01-01

    Full Text Available The holotype and only known specimen of the eurypterid (Chelicerata: Eurypterida Grossopterus overathi (Gross, 1933 from the Early Devonian (Siegennian of Overath, north-west Germany is redescribed. Based on comparisons with other eurypterid taxa we interpret G. overathi as having a well-preserved type B genital appendage, which exhibits two apomorphic character states: (1 a furca fused into a single, spatulate plate and (2 marginal serrations near the distal end of the appendage. Grossopterus is assigned to the family Hughmilleriidae, but its carapace resembles that of the larger Slimonia acuminata (Salter, 1856 (Slimoniidae. A provisional phylogenetic analysis resolves Grossopterus as the sister group of (Slimonia + Pterygotoidea. The large pterygotids, in particular, have been suggested as significant predators on early vertebrates and hypotheses about eurypterid-fish co-evolution are reviewed, in particular Romer's proposal that dermal armour in fish evolved in response to eurypterid predation. Der Holotyp – das einzig bekannte Exemplar – des Eurypteriden (Chelicerata: Eurypterida Grossopterus overathi (Gross, 1933 aus dem frühen Devon (Siegennian von Overath im nordwestlichen Deutschland wird wieder beschrieben. Basierend auf Vergleichen mit anderen Eurypteriden-Taxa interpretieren wir G. overathi als Träger eines Typ B-Anhanges, wobei zwei apomorphe Merkmalszustände vorliegen: (1 die Furca ist zu einer einzigen, spatelförmigen Platte verschmolzen, und (2 der Seitenrand nahe des distalen Endes des Genitalanhanges ist gezähnt. Grossopterus wird zur Familie der Hughmilleriidae gestellt, aber der prosomale Dorsalschild ähnelt der größeren Slimonia acuminata (Salter, 1856 (Slimoniidae. Eine vorläufige phylogenetische Analyse zeigt Grossopterus als Schwesteruppe von (Slimonia + Pterygotoidea auf. Besonders die großen Pterygotiden wurden als signifikante Prädatoren von frühen Vertebraten gehandelt, und Hypothesen zur Eurypteriden

  8. Biomonitoring of Heavy metals using the bivalve molluscs in sunderban mangrove wetland, Northeast Coast of Bay of bengal (india): possible risks to Human health

    Energy Technology Data Exchange (ETDEWEB)

    Cabral, Henrique; Cardoso, Ines [Departamento de Biologia Animal/Instituto de Oceanografia, Campo Grande, Lisboa (Portugal); Chatterjee, Mousumi; Kumar Bhattacharya, Asok; Aftab Alam, Mohammad [Department of Marine Science, University of Calcutta, Calcutta (India); Kanta Satpathy, Kamala [Indira Gandhi Centre for Atomic Research, Environmental and Industrial Safety Section, Safety Group, Kalpakkam, Tamil Nadu (India); Kumar Sarkar, Santosh

    2008-02-15

    The suitability of using four bivalve molluscs (Sanguinolaria acuminata, Anadara granosa, Meretrix meretrix, and Pelecyora trigona) in biomonitoring of heavy metals (Cu, Pb, Cd, Zn, and Hg) collected from intertidal regions of the Sunderban mangrove wetland, northeastern part of the Bay of Bengal, were evaluated. Both speciesdependent variability and temporal variations were pronounced. A high degree of organ specificity was evident in the bivalves where gill and mantle exhibited higher metal accumulation due to ion exchange property of the mucous layer covering these organs while shells represent very poor accumulation. Elevated values of Zn and Cu reflect high potential for biomagnification through marine food chain. Metal concentrations in different body size groups of the bivalves do not follow uniform trend. Correlation coefficient between different metal couplings as tested statistically revealed significant coupling for Pb-Zn, Pb-Cu, Zn-Cu, and Hg-Cu. Concentrations of all the metals in specific organs (visceral mass, mantle and gill) of the bivalves exceeded the safe levels according to the international standards for metals compiled by Food and Agricultural Organization of the United Nations and would be of great risk for human consumption. It is concluded that the mussel and clam are suitable biomonitors to employ in programs designed to assess changes in metal pollution in the Sunderban mangrove wetland. (Abstract Copyright [2008], Wiley Periodicals, Inc.)

  9. Translating the “Banana Genome” to Delineate Stress Resistance, Dwarfing, Parthenocarpy and Mechanisms of Fruit Ripening

    Directory of Open Access Journals (Sweden)

    Prasanta K Dash

    2016-10-01

    Full Text Available Evolutionary frozen, genetically sterile and globally iconic fruit Banana entered the genomics era with decoding of structural genome of double haploid Pahang (AA genome constitution genotype of M. acuminata. This wonder crop, as of today, remains untouched by the green revolution and researchers face intrinsic impediments for varietal improvement to enhance its yield. The complex genome of banana was decoded by hybrid sequencing strategies revealed panoply of genes and transcription factors involved in the process of sucrose conversion that imparts sweetness to its fruit. Banana has historically faced the wrath of pandemic bacterial, fungal and viral diseases and multitude of abiotic stresses that has ruined the livelihood of small and marginal farmers’ and destroyed commercial plantations. Decoding of its structural genome has given impetus to a deeper understanding of the repertoire of genes involved in disease resistance, understanding the mechanism of dwarfing to develop an ideal plant type, unravelling the process of parthenocarpy for better fruit quality, and fruit ripening in this climacteric fruit. Injunction of comparative genomics research will usher in to integrate information from its decoded genome and other monocots into field applications in banana related but not limited to yield enhancement, food security, livelihood assurance, and energy sustainability. In this mini review, we discuss pre- and post-genomic discoveries and highlight accomplishments in structural genomics, genetic engineering and forward genetic accomplishments with an aim to target genes and transcription factors for translational research in banana.

  10. Total phenolics and antioxidant activity of five medicinal plant

    International Nuclear Information System (INIS)

    Sousa, Cleyton Marcos de M.; Silva, Hilris Rocha e; Vieira-Junior, Gerardo Magela; Ayres, Mariane Cruz C.; Costa, Charllyton Luis S. da; Araajo, Delton Servulo; Cavalcante, Luis Carlos D.; Barros, Elcio Daniel S.; Araujo, Paulo Breitner de M.; Brandao, Marcela S.; Chaves, Mariana H.

    2007-01-01

    This paper describes total phenolics content and antioxidant activity in the ethanolic extract of leaves, bark and roots of five medicinal plants: Terminalia brasiliensis Camb., Terminalia fagifolia Mart. and Zucc., Copernicia cerifera (Miller) H.E. Moore, Cenostigma macrophyllum Tul. var. acuminata Teles Freire and Qualea grandiflora Mart. The total phenolics content of the plant extracts, determined by the Folin-Ciocalteu method, varied from 250.0 ±8,2 to 763,63 ±13.03 mg of gallic acid equivalent/g dry EtOH extract. The antioxidant activity of extracts was evaluated using the 2,2-diphenyl-1-picrylhydrazyl (DPPH) assay system. Extract of bark from T. brasiliensis, the most active, with an EC 50 value of 27.59 ± 0.82 μg/mL, was comparable to rutin (EC 50 = 27.80 ± 1.38) and gallic acid (EC 50 = 24.27 ± 0.31), used as positive controls. The relationship between total phenolic content and antioxidant activity was positive and significant for T. brasiliensis, C. macrophyllum and C. cerifera. (author)

  11. Impact of windstorm on a community of centipedes (Chilopoda) in a beech forest in Western Poland.

    Science.gov (United States)

    Leśniewska, Małgorzata; Skwierczyński, Filip

    2018-01-01

    The study was carried out in the years 2016-2017, five years after a windstorm which destroyed 1/3 of the protected beech forest area in the west of Poland. The community of centipedes in the area affected by the windstorm was depleted in terms of the species richness, diversity, and population density. The dominance structures were shortened and the species composition was rebuilt. The areas that proved to be the richest in terms of species richness and diversity among the sites affected by the windstorm were the one where windfallen trees were left and the other where beech trees had been planted by humans. In total, the quantitative and qualitative samples collected four times throughout a year featured 608 specimens from 11 species of two centipede orders - Lithobiomorpha and Geophilomorpha. Lithobius curtipes and L. forficatus were found in all of the investigated areas. L. pelidnus and L. piceus were captured at control sites exclusively. Only one species - L. erythrocephalus was found solely at the damaged site. The most numerous and most frequently found species in the community were L. curtipes , L. mutabilis , and Strigamia acuminata respectively. Although windstorms are natural phenomena their consequences may lead to significant changes in the community of the investigated soil animals. The importance of coarse woody debris, significantly contributing to the improvement and maintenance of species richness and diversity of Chilopoda, has once again been confirmed.

  12. Gross and microscopic morphology of lesions in Cnidaria from Palmyra Atoll, Central Pacific

    Science.gov (United States)

    Williams, Gareth J.; Work, Thierry M.; Aeby, Greta S.; Knapp, Ingrid S.; Davy, Simon K.

    2011-01-01

    We conducted gross and microscopic characterizations of lesions in Cnidaria from Palmyra Atoll, Central Pacific. We found growth anomalies (GA) to be the most commonly encountered lesion. Cases of discoloration and tissue loss were rare. GAs had a focal or multi-focal distribution and were predominantly nodular, exophytic, and umbonate. In scleractinians, the majority of GAs manifested as hyperplasia of the basal body wall (52% of cases), with an associated absence or reduction of polyp structure (mesenteries and filaments, actinopharynx and tentacles), and depletion of zooxanthellae in the gastrodermis of the upper body wall. In the soft corals Sinularia sp. and Lobophytum sp., GAs exclusively manifested as prominent hyperplasia of the coenenchyme with an increased density of solenia. In contrast to scleractinians, soft coral GAs displayed an inflammatory and necrotizing component with marked edema of the mesoglea, accompanied by infiltrates of variably-sized granular amoebocytes. Fungi, algae, sponges, and Crustacea were present in some scleractinian GAs, but absent in soft coral GAs. Fragmentation of tissues was a common finding in Acropora acuminata and Montipora cf. dilatata colonies with tissue loss, although no obvious causative agents were seen. Discoloration in the zoanthid, Palythoa tuberculosa, was found to be the result of necrosis, while in Lobophytum sp. discoloration was the result of zooxanthellar depletion (bleaching). Soft corals with discoloration or tissue loss showed a marked inflammatory response, however no obvious causative organisms were seen. Lesions that appeared similar at the gross level were revealed to be distinct by microscopy, emphasizing the importance of histopathology.

  13. Synthesis and characterization of poly (lactic acid)/chitosan nanocomposites based on renewable resources as biobased-material

    Science.gov (United States)

    Suryani; Agusnar, H.; Wirjosentono, B.; Rihayat, T.; Salisah, Z.

    2018-01-01

    Biobased becomes one of the new breakthrough in the smart engineering, especially in biomedical applications, such as tissue engineering that serves as a supporting physical structure to trigger the growth of skin tissue. From various studies which had been done, it was known that the optimal Biobased healed wounds or injuries in a relatively short time. In this study, a Biobased natural polymer based e.g Poly(Lactic Acid) (PLA)/Chitosan Nanocomposites was made. PLA was synthesized from saba banana (Musa acuminata) as raw material using Ring-Opening Polymerization (ROP) method. PLA was mixed with Chitosan with Chitosan concentration variations of 1%, 3%, and 5% to form a nanocomposites. The analysis result showed that Chitosan concentration in PLA/Chitosan Nanocomposites sample affected the value of tensile strength. The highest value of tensile strength was obtained on a sample of 100 ml volume with a concentration of 3%, which was 120.396 MPa. The highest percentage of elongation was obtained in 100 ml volume sample with 5% concentration, which was 26.3686%. In the hydrophilicity test, the highest percentage of water absorption was obtained in a 200 ml volume sample with 5% concentration, which was 44.615%. The addition of Chitosan to the sample affected the functional group bonding, where there was a functional group of NH2 at the wave number of 2923.92 cm-1. The sample characteristics based on water absorption indicated that the sample was potentially to be used as Biobased construction material.

  14. Efficient transformation of Mycosphaerella fijiensis by underwater shock waves.

    Science.gov (United States)

    Escobar-Tovar, Lina; Magaña-Ortíz, Denis; Fernández, Francisco; Guzmán-Quesada, Mauricio; Sandoval-Fernández, Jorge A; Ortíz-Vázquez, Elizabeth; Loske, Achim M; Gómez-Lim, Miguel A

    2015-12-01

    Black leaf streak disease, also known as black Sigatoka, causes dramatic losses in production of banana and plantains fruits. The disease is caused by the pathogenic fungus Mycosphaerella fijiensis (anamorph Pseudocercospora fijiensis; Mycosphaerellaceae). Genetic transformation of M. fijiensis would allow a better understanding of molecular basis of pathogenicity and design novel approaches to control the infection caused by this pathogen. However, transformation of this fungus has not been easy. We report here a protocol for genetic transformation of M. fijiensis employing underwater shock waves and intact conidia. The recombinant strains recovered showed genetic stability over >10 generations. The frequency of transformation obtained was between 75 and 150 times higher than the efficiency reported in the only article published on transformation of M. fijiensis using spheroplasts. This improvement allowed the use of a thousand times less cells than the amount employed before, avoiding the need for cumbersome successive batch cultures. Our protocol is simple, highly efficient, fast and reproducible and together with the available genomes of M. fijiensis and Musa acuminata, it offers new possibilities to study the diverse mechanisms of pathogenesis of the fungus. Copyright © 2015. Published by Elsevier B.V.

  15. Hormonal and Hydroxycinnamic Acids Profiles in Banana Leaves in Response to Various Periods of Water Stress

    Directory of Open Access Journals (Sweden)

    Jalel Mahouachi

    2014-01-01

    Full Text Available The pattern of change in the endogenous levels of several plant hormones and hydroxycinnamic acids in addition to growth and photosynthetic performance was investigated in banana plants (Musa acuminata cv. “Grand Nain” subjected to various cycles of drought. Water stress was imposed by withholding irrigation for six periods with subsequent rehydration. Data showed an increase in abscisic acid (ABA and indole-3-acetic acid (IAA levels, a transient increase in salicylic acid (SA concentration, and no changes in jasmonic acid (JA after each period of drought. Moreover, the levels of ferulic (FA and cinnamic acids (CA were increased, and plant growth and leaf gas exchange parameters were decreased by drought conditions. Overall, data suggest an involvement of hormones and hydroxycinnamic acids in plant avoidance of tissue dehydration. The increase in IAA concentration might alleviate the senescence of survival leaves and maintained cell elongation, and the accumulation of FA and CA could play a key role as a mechanism of photoprotection through leaf folding, contributing to the effect of ABA on inducing stomatal closure. Data also suggest that the role of SA similarly to JA might be limited to a transient and rapid increase at the onset of the first period of stress.

  16. Hormonal and hydroxycinnamic acids profiles in banana leaves in response to various periods of water stress.

    Science.gov (United States)

    Mahouachi, Jalel; López-Climent, María F; Gómez-Cadenas, Aurelio

    2014-01-01

    The pattern of change in the endogenous levels of several plant hormones and hydroxycinnamic acids in addition to growth and photosynthetic performance was investigated in banana plants (Musa acuminata cv. "Grand Nain") subjected to various cycles of drought. Water stress was imposed by withholding irrigation for six periods with subsequent rehydration. Data showed an increase in abscisic acid (ABA) and indole-3-acetic acid (IAA) levels, a transient increase in salicylic acid (SA) concentration, and no changes in jasmonic acid (JA) after each period of drought. Moreover, the levels of ferulic (FA) and cinnamic acids (CA) were increased, and plant growth and leaf gas exchange parameters were decreased by drought conditions. Overall, data suggest an involvement of hormones and hydroxycinnamic acids in plant avoidance of tissue dehydration. The increase in IAA concentration might alleviate the senescence of survival leaves and maintained cell elongation, and the accumulation of FA and CA could play a key role as a mechanism of photoprotection through leaf folding, contributing to the effect of ABA on inducing stomatal closure. Data also suggest that the role of SA similarly to JA might be limited to a transient and rapid increase at the onset of the first period of stress.

  17. Wild Musa Species Collection of Purwodadi Botanic Garden: Inventory and Its Morpho - taxonomic Review

    Directory of Open Access Journals (Sweden)

    Lia Hapsari

    2014-01-01

    Full Text Available Indonesia, being part of the center of origin of bananas (Musaceae, has a large number diversity of bananas both wild seeded species and edible seedless cultivated varieties. Inventory of wild Musa species in Purwodadi Botanic Garden has been conducted through compiling data records from PBG’s Registration section, field inspection and observation to living collections in the garden, herbarium specimens and literature studies. The results show that total 17 wild Musa accessions has been recorded planted in Purwodadi Botanic Garden since 1990 until 2012; comprises of 8 Musa acuminata sub species, 2 Musa balbisiana forms, 1 Musa ornata, 1 Musa troglodytarum, 1 Musa borneensis and 4 unidentified species Musa spp.; but only 8 living accessions remained in 2012. Morphotaxonomic review of those 8 wild Musa accessions remained will be discussed in this paper including their geographical distributions. According to its differentiated morphological characteristics observations, it is known that there are three accessions were resembled cultivars and one unidentified species have been determined its species level, so that their registration identity needs to be revised. It is important next to prioritize ex-situ conservation of wild Musa species not yet collected in Purwodadi Botanic Garden especially from Eastern Indonesia.

  18. Identification of genes differentially expressed during ripening of banana.

    Science.gov (United States)

    Manrique-Trujillo, Sandra Mabel; Ramírez-López, Ana Cecilia; Ibarra-Laclette, Enrique; Gómez-Lim, Miguel Angel

    2007-08-01

    The banana (Musa acuminata, subgroup Cavendish 'Grand Nain') is a climacteric fruit of economic importance. A better understanding of the banana ripening process is needed to improve fruit quality and to extend shelf life. Eighty-four up-regulated unigenes were identified by differential screening of a banana fruit cDNA subtraction library at a late ripening stage. The ripening stages in this study were defined according to the peel color index (PCI). Unigene sequences were analyzed with different databases to assign a putative identification. The expression patterns of 36 transcripts confirmed as positive by differential screening were analyzed comparing the PCI 1, PCI 5 and PCI 7 ripening stages. Expression profiles were obtained for unigenes annotated as orcinol O-methyltransferase, putative alcohol dehydrogenase, ubiquitin-protein ligase, chorismate mutase and two unigenes with non-significant matches with any reported sequence. Similar expression profiles were observed in banana pulp and peel. Our results show differential expression of a group of genes involved in processes associated with fruit ripening, such as stress, detoxification, cytoskeleton and biosynthesis of volatile compounds. Some of the identified genes had not been characterized in banana fruit. Besides providing an overview of gene expression programs and metabolic pathways at late stages of banana fruit ripening, this study contributes to increasing the information available on banana fruit ESTs.

  19. Genome-wide Expression Analysis and Metabolite Profiling Elucidate Transcriptional Regulation of Flavonoid Biosynthesis and Modulation under Abiotic Stresses in Banana.

    Science.gov (United States)

    Pandey, Ashutosh; Alok, Anshu; Lakhwani, Deepika; Singh, Jagdeep; Asif, Mehar H; Trivedi, Prabodh K

    2016-08-19

    Flavonoid biosynthesis is largely regulated at the transcriptional level due to the modulated expression of genes related to the phenylpropanoid pathway in plants. Although accumulation of different flavonoids has been reported in banana, a staple fruit crop, no detailed information is available on regulation of the biosynthesis in this important plant. We carried out genome-wide analysis of banana (Musa acuminata, AAA genome) and identified 28 genes belonging to 9 gene families associated with flavonoid biosynthesis. Expression analysis suggested spatial and temporal regulation of the identified genes in different tissues of banana. Analysis revealed enhanced expression of genes related to flavonol and proanthocyanidin (PA) biosynthesis in peel and pulp at the early developmental stages of fruit. Genes involved in anthocyanin biosynthesis were highly expressed during banana fruit ripening. In general, higher accumulation of metabolites was observed in the peel as compared to pulp tissue. A correlation between expression of genes and metabolite content was observed at the early stage of fruit development. Furthermore, this study also suggests regulation of flavonoid biosynthesis, at transcriptional level, under light and dark exposures as well as methyl jasmonate (MJ) treatment in banana.

  20. Genetic variability among 18 cultivars of cooking bananas and plantains by RAPD and ISSR markers

    Directory of Open Access Journals (Sweden)

    YUYU SURYASARI POERBA

    2010-07-01

    Full Text Available Poerba YS, Ahmad F (2010 Genetic variability among 18 cultivars of cooking bananas and plantains by RAPD and ISSR markers. Biodiversitas 11: 118-123. This study was done to assess the molecular diversity of 36 accessions (18 cultivars of the plantain and cooking bananas (Musa acuminata x M. balbisiana, AAB, ABB subgroups based on Random amplified polymorphic DNA (RAPD and and Inter Simple Sequence Repeats (ISSR markers and to determine genetic relationships in the bananas. RAPD and ISSR fingerprinting of these banana varieties was carried out by five primers of RAPDs and two primers of ISSRs. RAPD primers produced 63 amplified fragments varying from 250 to 2500 bp in size. 96.82% of the amplification bands were polymorphic. ISSR primers produced 26 amplified fragments varying from 350 bp to 2000 bp in size. The results showed that 92.86% of the amplification bands were polymorphic. The range of genetic distance of 18 cultivars was from 0.06-0.67.

  1. Evolutionary transition towards permanent chloroplasts? - Division of kleptochloroplasts in starved cells of two species of Dinophysis (Dinophyceae.

    Directory of Open Access Journals (Sweden)

    Pernille Møller Rusterholz

    Full Text Available Species within the marine toxic dinoflagellate genus Dinophysis are phagotrophic organisms that exploit chloroplasts (kleptochloroplasts from other protists to perform photosynthesis. Dinophysis spp. acquire the kleptochloroplasts from the ciliate Mesodinium rubrum, which in turn acquires the chloroplasts from a unique clade of cryptophytes. Dinophysis spp. digest the prey nuclei and all other cell organelles upon ingestion (except the kleptochloroplasts and they are therefore believed to constantly acquire new chloroplasts as the populations grow. Previous studies have, however, indicated that Dinophysis can keep the kleptochloroplasts active during long term starvation and are able to produce photosynthetic pigments when exposed to prey starvation. This indicates a considerable control over the kleptochloroplasts and the ability of Dinophysis to replicate its kleptochloroplasts was therefore re-investigated in detail in this study. The kleptochloroplasts of Dinophysis acuta and Dinophysis acuminata were analyzed using confocal microscopy and 3D bioimaging software during long term starvation experiments. The cell concentrations were monitored to confirm cell divisions and samples were withdrawn each time a doubling had occurred. The results show direct evidence of kleptochloroplastidic division and that the decreases in total kleptochloroplast volume, number of kleptochloroplasts and number of kleptochloroplast centers were not caused by dilution due to cell divisions. This is the first report of division of kleptochloroplasts in any protist without the associated prey nuclei. This indicates that Dinophysis spp. may be in a transitional phase towards possessing permanent chloroplasts, which thereby potentially makes it a key organism to understand the evolution of phototrophic protists.

  2. Ploidy Variation in Hybrids from Interploid 3x X 2x Crosses in Musa

    Directory of Open Access Journals (Sweden)

    Osuji, JO.

    1997-01-01

    Full Text Available Hybrids were obtained after in vitro germination of embryos from interploid crosses between triploid 'French' plantain cultivars (Musa spp. AAB group 'Ntanga 2' and 'Bobby Tannap' with diploid banana (Ivlusa acuminata subsp. burmannicoidesj 'Calcutta 4'. Cross-pollinated bunches were harvested at full maturity and ripened with acetylene in a room for 4 days. Seeds were extracted from peeled ripe fruits by squashing. Embryos from the seeds were excised aseptically after 2 days and germinated in vitro. Seedlings were subsequently planted in early evaluation trials after acclimatising in the greenhouse. Chromosome counts were carried out on root tips of mature and maiden suckers to determine ploidy levels using a modified squashing technique. Counts showed that two of the hybrids were aneuploids (trisomies with somatic chromosome number of 2n = 2x + 1 = 23, one hybrid was diploid while the other two were tetraploids. Tetraploids are the most promising hybrids for the genetic improvement of plantains. Diploids are valuable material for further improvement of the plantain genome at this ploidy level. Trisomies provide means for further characterisation of the Musa genome and physical gene mapping in plantain and banana.

  3. La banane : de son origine à sa commercialisation

    Directory of Open Access Journals (Sweden)

    Lassois L.

    2009-01-01

    Full Text Available Banana: from origin to market. Cultivated bananas are giant herbaceous plants within the genus Musa. They are both sterile and parthenocarpic. There are well over a thousand domesticated Musa cultivars, they are mostly triploid (a few are diploid or tetraploid and are derived from crosses between two wild species, Musa acuminata and Musa balbisiana. In terms of production, bananas are the fourth agricultural product after rice, wheat, and maize. They constitute the basis of food security for many people. Cropping systems vary widely around the world and contrasting objectives are encountered: consumption by the producer, sale on local or national markets, export, etc. Cooking bananas, including plantains, must be distinguished from dessert bananas, which constitute a major international trade. This international trade started only in the early 1900s but it has since grown continuously. Banana is currently the most exported fruit, in terms of both value and quantity. Despite the high genetic diversity found within the genus Musa, the export market is mainly based on single Cavendish. There are major challenges to banana production from biotic or abiotic stresses to continue to meet the criteria of sustainability, quality and yield that are imposed.

  4. Giant condyloma acuminate due human papilloma virus type 16 in an infant successfully treated with topical imiquimod therapy

    Directory of Open Access Journals (Sweden)

    Meltem Dinleyici

    2015-12-01

    Full Text Available Anogenital warts related to human papillomavirus (HPV have been observed in children. Definition of the transmission mode, therapy, and follow-up for long term potential complications is important. A 27-month old girl was admitted with multiple pedunculated red-purple colored cauliflower-like lesions of 1.5 years duration. Clinical/histopathological and microbiological diagnosis was condyloma acuminate due to HPV type 16. After 12 weeks of imiquimod 5% cream application (pea-sized overnight three times per week, the perianal warts had completely disappeared. The mode of transmission of HPV 16 in our case was probably horizontal, related to the sharing of common personal hygiene items in the women’s shelter. We report herein the case of an infant living in a women’s shelter with giant condyloma acuminata due to HPV 16, which was successfully treated with topical imiquimod therapy. This patient should be followed up for recurrence and potential malignant lesions related to HPV type 16.

  5. Label-free potentiometric biosensor based on solid-contact for determination of total phenols in honey and propolis.

    Science.gov (United States)

    Draghi, Patrícia Ferrante; Fernandes, Julio Cesar Bastos

    2017-03-01

    We developed a label-free potentiometric biosensor using tyrosinase extracted from Musa acuminata and immobilized by covalent bond on a surface of a solid-contact transducer. The transducer was manufactured containing two layers. The first layer contained a blend of poly(vinyl) chloride carboxylated (PVC-COOH), graphite and potassium permanganate. On this layer, we deposited a second layer containing just a mixture of poly(vinyl chloride) carboxylated and graphite. On the last layer of the transducer, we immobilized the tyrosinase enzyme by reaction with N-(3-dimethylaminopropyl)-N'-ethylcarbodiimide hydrochloride. The solid-contact potentiometric biosensor presented at low detection limit of 7.3×10 -7 M and a linear range to catechol concentration between 9.3×10 -7 M and 8.3×10 -2 M. This biosensor was applied to determine the amount of total phenols in different samples of honey and propolis. The results agreed with the Folin-Ciocalteu method. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. INDINOL FORTO AND EGALLOHIT IN THE TREATMENT OF CONDYLOMA ACUMINATE AND GIANT CONDYLOMA

    Directory of Open Access Journals (Sweden)

    V. A. Molochkov

    2014-01-01

    Full Text Available Genital papilloma virus is one of the commonest sexually transmitted disease. Its treatment is still under development and relapses are frequent. The article presents the results of the study of indolecarbinol (Indinol Forto for the prevention of recurrent genital warts in 75  patients with genital or anal condyloma acuminata, BuschkeLowenstein tumor and bowenoid papulosis, after photodynamic therapy (PDT, cryodestruction, electrocoagulation or Mardil Selen application. Seven patients with Buschke-Lowenstein tumor underwent PDT with subsequent application of Egallohit gel on the lesions. Indolecarbinol 400 mg daily was prescribed for 3 months in combination with alpha2b-interferon (Viferon 1 million IU daily during 1–3 months. No recurrences were observed during follow-up (mean follow-up duration was 3.9±2.7 years, from 5  months to 9  years. In patients with BuschkeLowenstein tumor, PDT with subsequent Egallohit application resulted in the formation of thin and cosmetically acceptable zones of atrophic scars. The article includes three case reports of patients with Buschke-Lowenstein tumor.

  7. Inhibition of acetylcholinesterase and cytochrome oxidase activity in Fasciola gigantica cercaria by phytoconstituents.

    Science.gov (United States)

    Sunita, Kumari; Habib, Maria; Kumar, P; Singh, Vinay Kumar; Husain, Syed Akhtar; Singh, D K

    2016-02-01

    Fasciolosis is an important cattle and human disease caused by Fasciola hepatica and Fasciola gigantica. One of the possible methods to control this problem is to interrupt the life cycle of Fasciola by killing its larva (redia and cercaria) in host snail. Molecular identification of cercaria larva of F. gigantica was done by comparing the nucleotide sequencing with adult F. gigantica. It was noted that nucleotide sequencing of cercaria larva and adult F. gigantica were 99% same. Every month during the year 2011-2012, in vivo treatment with 60% of 4 h LC50 of phyto cercaricides citral, ferulic acid, umbelliferone, azadirachtin and allicin caused significant inhibition of acetylcholinesterase (AChE) and cytochrome oxidase activity in the treated cercaria larva of F. gigantica. Whereas, activity of both enzymes were not significantly altered in the nervous tissues of vector snail Lymnaea acuminata exposed to same treatments. Maximum reduction in AChE (1.35% of control in month of June) and cytochrome oxidase (3.71% of control in the month of July) activity were noted in the cercaria exposed to 60% of 4 h LC50 of azadirachtin and allicin, respectively. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Ship traffic and the introduction of diatoms and dinoflagellates via ballast water in the port of Annaba, Algeria

    Science.gov (United States)

    Cheniti, Radhia; Rochon, André; Frihi, Hocine

    2018-03-01

    We present here the first study on the role of ship traffic in the introduction of potentially harmful and/or non-indigenous species in the port of Annaba (Algeria). A total of 25 ships of two different types (general cargo and bulk carriers) were sampled and separated into two categories: oceanic and Mediterranean ships. We estimated propagule pressure of high-risk coastal phytoplankton delivered in ballast water to the port of Annaba. We identified 40 diatom and 38 dinoflagellate taxa, among which, 11 harmful/toxic taxa: Pseudo-nitzschia spp., Alexandrium tamarense, Alexandrium sp., Dinophysis acuminata, Dinophysis rotundata, Dinophysis sp., Gonyaulax spinifera, Gymnodinium catenatum, Lingulodinium polyedrum, Protoceratium reticulatum and cyst of Alexandrium sp. In addition, 8 taxa (5 diatoms, 1 dinoflagellate and 2 dinoflagellate cysts) never observed in the Annaba region were considered as potentially non-indigenous: Actinoptychus splendens, Coscinodiscus asteromphalus, Coscinodiscus lineatus, Odentella granulata, Thalassiosira cf. decipiens, Prorocentrum scutellum, cyst of Polykrikos kofoidii and Islandinium minutum. Several factors were examined, including ship routes, ballast water age and the volume of ballast water discharged. Our analyses revealed that diatom and dinoflagellate abundances decreased with ballast water age, possibly as a result of mortality of species due to voyage length and lack of light in ballast tanks. Estimates of actual propagule pressure, diatoms and dinoflagellates abundances varied from 1 to 4 × 108 cells/ship. The results of this study could serve as the baseline for the development and implementation of monitoring and ballast water management programs in ports of Algeria.

  9. Simultaneous determination of camptothecin and 10-hydroxycamptothecine in the Camptotheca acuminate, its medicinal preparation and in rat plasma by liquid chromatography with fluorescence detection.

    Science.gov (United States)

    Li, Peng; Chen, Qinhua; Yu, Fei; Xie, Xiaoyu; Wang, Sicen

    2015-10-01

    Camptotheca acuminata Decne is an important medicinal plant that contains various cytotoxic alkaloids, such as camptothecine (CPT) and 10-hydroxycamptothecine (HCPT). A rapid and sensitive liquid chromatography with fluorescence detection (LC-FLD) method for the quantification of CPT and HCPT is described. The separation was carried out on a DL-Cl8 column (4.6 × 150 mm, 5 µm), with the mobile phase of acetonitrile-sodium dihydrogen phosphate buffer (10 mm) using an gradient elution at the flow rate of 0.6 mL/min. The LC-FLD method was validated for linearity, sensitivity, accuracy and precision, and then used to determine the content of the above components. The lower detection limits of CPT and HCPT were 0.4 and 0.1 ng/mL, respectively. The precision was <1.58% and the mean recovery of the analytes was 96.0-98.6%. The LC-FLD method was successfully applied to determine CPT and HCPT in real samples including C. acuminate, HCPT injection and rat plasma. Copyright © 2015 John Wiley & Sons, Ltd.

  10. Antibacterial and antioxidant activities of Musa sp. leaf extracts against multidrug resistant clinical pathogens causing nosocomial infection.

    Science.gov (United States)

    Karuppiah, Ponmurugan; Mustaffa, Muhammed

    2013-09-01

    To investigate different Musa sp. leave extracts of hexane, ethyl acetate and methanol were evaluated for antibacterial activity against multi-drug resistant pathogens causing nosocomial infection by agar well diffusion method and also antioxidant activities. The four different Musa species leaves were extracted with hexane, ethyl acetate and methanol. Antibacterial susceptibility test, minimum inhibitory concentration and minimum inhibitory bacterial concentration were determined by agar well diffusion method. Total phenolic content and in vitro antioxidant activity was determined. All the Musa sp. extracts showed moderate antibacterial activities expect Musa paradisiaca with the inhibition zone ranging from 8.0 to 18.6 mm. Among four species ethyl acetate extracts of Musa paradisiaca showed highest activity against tested pathogens particularly E. coli, P. aeruginosa and Citrobacter sp. The minimum inhibitory concentrations were within the value of 15.63- 250 µg/mL and minimum bactericidal concentrations were ranging from 31.25- 250 µg/mL. Antioxidant activity of Musa acuminate exhibited maximum activity among other three Musa species. The present study concluded that among the different Musa species, Musa paradisiaca displayed efficient antibacterial activity followed by Musa acuminata against multi-drug resistant nosocomial infection causing pathogens. Further, an extensive study is needed to identify the bioactive compounds, mode of action and toxic effect in vivo of Musa sp.

  11. In vitro colonic fermentation and glycemic response of different kinds of unripe banana flour.

    Science.gov (United States)

    Menezes, Elizabete Wenzel; Dan, Milana C T; Cardenette, Giselli H L; Goñi, Isabel; Bello-Pérez, Luis Arturo; Lajolo, Franco M

    2010-12-01

    This work aimed to study the in vitro colonic fermentation profile of unavailable carbohydrates of two different kinds of unripe banana flour and to evaluate their postprandial glycemic responses. The unripe banana mass (UBM), obtained from the cooked pulp of unripe bananas (Musa acuminata, Nanicão variety), and the unripe banana starch (UBS), obtained from isolated starch of unripe banana, plantain type (Musa paradisiaca) in natura, were studied. The fermentability of the flours was evaluated by different parameters, using rat inoculum, as well as the glycemic response produced after the ingestion by healthy volunteers. The flours presented high concentration of unavailable carbohydrates, which varied in the content of resistant starch, dietary fiber and indigestible fraction (IF). The in vitro colonic fermentation of the flours was high, 98% for the UBS and 75% for the UBM when expressed by the total amount of SCFA such as acetate, butyrate and propionate in relation to lactulose. The increase in the area under the glycemic curve after ingestion of the flours was 90% lower for the UBS and 40% lower for the UBM than the increase produced after bread intake. These characteristics highlight the potential of UBM and UBS as functional ingredients. However, in vivo studies are necessary in order to evaluate the possible benefit effects of the fermentation on intestinal health.

  12. Antioxidant potential in regenerated tissues of medicinally important atropa accuminata

    International Nuclear Information System (INIS)

    Khan, F. A.; Abbasi, B. H.; Shinwari, Z. K.; Shah, S. H.

    2017-01-01

    Due to random exploitation from natural resources, an efficient regeneration system of medicinally important but rare plant species, Atropa acuminata for conservation was inevitable. Leaf explants were incubated on MS medium with different level of various plant growth regulators (PGRs) alone and in combination for callus induction and induced organogenesis. After 4 weeks of culture, callus induction was recorded with the highest frequency with 1.0 mg/l thidiazuron (TDZ) supplement. After 5 weeks of subsequent sub-culturing, optimum shoot induction frequency of 89% was achieved with 1.0 mg/l TDZ and 1.0 mg/l a-naphthaleneacetic acid (NAA) supplement. Highest number of shoots/explant (8.2) were recorded on MS medium with 2.0 mg/l 6-benzyladenine (BA)+1.0 mg/l NAA supplement. Shoots in elongation medium was recorded 5.8 cm long in two medium i.e., 1.0 mg/l TDZ supplement and 1.0 mg/l TDZ+1.0 mg/l NAA supplement. Successful In vitro rooting was induced on MS medium with all applied level of indole butyric acid (IBA). The regenerated shoots with well developed roots were successfully acclimatized in sterilized soil and transferred to greenhouse conditions. Furthermore higher activity for detoxifying DPPH free radical was shown by regenerated shoots in this medicinally important plant species. (author)

  13. The significance of γ-and λ-dislocations in transient states of phyllotaxis: how to get more from less – sometimes!

    Directory of Open Access Journals (Sweden)

    Beata Zagórska-Marek

    2016-12-01

    Full Text Available In some plants, developmental changes of phyllotaxis are so frequent that the whole spectrum of phyllotactic patterns becomes available for investigation and thus many unknown subtleties of phyllotaxis come to light. Among these, Magnolia acuminata is the most prominent. In a series of experiments performed in silico with application of a simple geometric model of phyllotaxis, we were able to confront the empirical data on phyllotactic transitions occurring in magnolia flowers with the results of computer simulations. They revealed that in addition to the ratio between the sizes of plant organs, the history of developing pattern was also important, especially for the direction of ontogenetic changes. The parameters of size tolerance and vertical tolerance in positioning a new element in the first available space, brought the effects of simulations closer to the real patterns. They helped especially to resolve the enigma of multiplication of parastichies (γ-dislocations observed sometimes during determined growth of magnolia floral axes. We conclude that ontogenetic changes in phyllotaxis result mainly from changing sizes of organs in the course of development and that the changes do not always occur with mathematical accuracy.

  14. The Banana Genome Hub

    Science.gov (United States)

    Droc, Gaëtan; Larivière, Delphine; Guignon, Valentin; Yahiaoui, Nabila; This, Dominique; Garsmeur, Olivier; Dereeper, Alexis; Hamelin, Chantal; Argout, Xavier; Dufayard, Jean-François; Lengelle, Juliette; Baurens, Franc-Christophe; Cenci, Alberto; Pitollat, Bertrand; D’Hont, Angélique; Ruiz, Manuel; Rouard, Mathieu; Bocs, Stéphanie

    2013-01-01

    Banana is one of the world’s favorite fruits and one of the most important crops for developing countries. The banana reference genome sequence (Musa acuminata) was recently released. Given the taxonomic position of Musa, the completed genomic sequence has particular comparative value to provide fresh insights about the evolution of the monocotyledons. The study of the banana genome has been enhanced by a number of tools and resources that allows harnessing its sequence. First, we set up essential tools such as a Community Annotation System, phylogenomics resources and metabolic pathways. Then, to support post-genomic efforts, we improved banana existing systems (e.g. web front end, query builder), we integrated available Musa data into generic systems (e.g. markers and genetic maps, synteny blocks), we have made interoperable with the banana hub, other existing systems containing Musa data (e.g. transcriptomics, rice reference genome, workflow manager) and finally, we generated new results from sequence analyses (e.g. SNP and polymorphism analysis). Several uses cases illustrate how the Banana Genome Hub can be used to study gene families. Overall, with this collaborative effort, we discuss the importance of the interoperability toward data integration between existing information systems. Database URL: http://banana-genome.cirad.fr/ PMID:23707967

  15. Lipophilic phytochemicals from banana fruits of several Musa species.

    Science.gov (United States)

    Vilela, Carla; Santos, Sónia A O; Villaverde, Juan J; Oliveira, Lúcia; Nunes, Alberto; Cordeiro, Nereida; Freire, Carmen S R; Silvestre, Armando J D

    2014-11-01

    The chemical composition of the lipophilic extract of ripe pulp of banana fruit from several banana cultivars belonging to the Musa acuminata and Musa balbisiana species (namely 'Chinese Cavendish', 'Giant Cavendish', 'Dwarf Red', 'Grand Nain', 'Eilon', 'Gruesa', 'Silver', 'Ricasa', 'Williams' and 'Zelig') was studied by gas chromatography-mass spectrometry for the first time. The banana cultivars showed similar amounts of lipophilic extractives (ca. 0.4% of dry material weight) as well as qualitative chemical compositions. The major groups of compounds identified in these fractions were fatty acids and sterols making up 68.6-84.3% and 11.1-28.0%, respectively, of the total amount of lipophilic components. Smaller amounts of long chain aliphatic alcohols and α-tocopherol were also identified. These results are a relevant contribution for the valorisation of these banana cultivars as sources of valuable phytochemicals (ω-3 and ω-6 fatty acids, and sterols) with well-established beneficial nutritional and health effects. Copyright © 2014 Elsevier Ltd. All rights reserved.

  16. Annotation of differentially expressed genes in the somatic embryogenesis of musa and their location in the banana genome.

    Science.gov (United States)

    Maldonado-Borges, Josefina Ines; Ku-Cauich, José Roberto; Escobedo-Graciamedrano, Rosa Maria

    2013-01-01

    Analysis of cDNA-AFLP was used to study the genes expressed in zygotic and somatic embryogenesis of Musa acuminata Colla ssp. malaccensis, and a comparison was made between their differential transcribed fragments (TDFs) and the sequenced genome of the double haploid- (DH-) Pahang of the malaccensis subspecies that is available in the network. A total of 253 transcript-derived fragments (TDFs) were detected with apparent size of 100-4000 bp using 5 pairs of AFLP primers, of which 21 were differentially expressed during the different stages of banana embryogenesis; 15 of the sequences have matched DH-Pahang chromosomes, with 7 of them being homologous to gene sequences encoding either known or putative protein domains of higher plants. Four TDF sequences were located in all Musa chromosomes, while the rest were located in one or two chromosomes. Their putative individual function is briefly reviewed based on published information, and the potential roles of these genes in embryo development are discussed. Thus the availability of the genome of Musa and the information of TDFs sequences presented here opens new possibilities for an in-depth study of the molecular and biochemical research of zygotic and somatic embryogenesis of Musa.

  17. Whole genome sequencing of a banana wild relative Musa itinerans provides insights into lineage-specific diversification of the Musa genus.

    Science.gov (United States)

    Wu, Wei; Yang, Yu-Lan; He, Wei-Ming; Rouard, Mathieu; Li, Wei-Ming; Xu, Meng; Roux, Nicolas; Ge, Xue-Jun

    2016-08-17

    Crop wild relatives are valuable resources for future genetic improvement. Here, we report the de novo genome assembly of Musa itinerans, a disease-resistant wild banana relative in subtropical China. The assembled genome size was 462.1 Mb, covering 75.2% of the genome (615.2Mb) and containing 32, 456 predicted protein-coding genes. Since the approximate divergence around 5.8 million years ago, the genomes of Musa itinerans and Musa acuminata have shown conserved collinearity. Gene family expansions and contractions enrichment analysis revealed that some pathways were associated with phenotypic or physiological innovations. These include a transition from wood to herbaceous in the ancestral Musaceae, intensification of cold and drought tolerances, and reduced diseases resistance genes for subtropical marginally distributed Musa species. Prevalent purifying selection and transposed duplications were found to facilitate the diversification of NBS-encoding gene families for two Musa species. The population genome history analysis of M. itinerans revealed that the fluctuated population sizes were caused by the Pleistocene climate oscillations, and that the formation of Qiongzhou Strait might facilitate the population downsizing on the isolated Hainan Island about 10.3 Kya. The qualified assembly of the M. itinerans genome provides deep insights into the lineage-specific diversification and also valuable resources for future banana breeding.

  18. Antioxidant and Antihyperglycemic Properties of Three Banana Cultivars (Musa spp.).

    Science.gov (United States)

    Adedayo, Bukola C; Oboh, Ganiyu; Oyeleye, Sunday I; Olasehinde, Tosin A

    2016-01-01

    Background . This study sought to investigate the antioxidant and antihyperglycemic properties of Musa sapientum (Latundan banana) (MSL), Musa acuminata (Cavendish banana) (MAC), and Musa acuminate (Red Dacca) (MAR). Materials and Methods. The sugar, starch, amylose, and amylopectin contents and glycemic index (GI) of the three banana cultivars were determined. Furthermore, total phenol and vitamin C contents and α -amylase and α -glucosidase inhibitory effects of banana samples were also determined. Results . MAC and MAR had the highest starch, amylose, and amylopectin contents and estimated glycemic index (eGI) with no significant different while MSL had the lowest. Furthermore, MAR (1.07 mg GAE/g) had a higher total phenol content than MAC (0.94 mg GAE/g) and MSL (0.96 mg GAE/g), while there was no significant difference in the vitamin C content. Furthermore, MAR had the highest α -amylase (IC 50 = 3.95 mg/mL) inhibitory activity while MAC had the least (IC 50 = 4.27 mg/mL). Moreover, MAC and MAR inhibited glucosidase activity better than MSL (IC 50 3.47 mg/mL). Conclusion . The low sugar, GI, amylose, and amylopectin contents of the three banana cultivars as well as their α -amylase and α -glucosidase inhibitory activities could be possible mechanisms and justification for their recommendation in the management of type-2 diabetes.

  19. Proteomic Changes between Male and Female Worms of the Polychaetous Annelid Neanthes arenaceodentata before and after Spawning

    KAUST Repository

    Chandramouli, Kondethimmanahalli; Ravasi, Timothy; Reish, Donald; Qian, Pei-Yuan

    2013-01-01

    The Neanthes acuminata species complex (Polychaeta) are cosmopolitan in distribution. Neanthes arenaceodentata, complex, has been widely used as toxicological test animal in the marine environment. Method of reproduction is unique in this polychaete complex. Same sexes fight and opposite sexes lie side by side until egg laying. Females lose about 75% of their weight and die after laying eggs. The male, capable of reproducing up to nine times, fertilizes the eggs and incubates the embryos for 3-4 weeks. The objective of this study was to determine if there is any set of proteins that influences this unique pattern of reproduction. Gel-based two-dimensional electrophoresis (2-DE) and gel-free quantitative proteomics methods were used to identify differential protein expression patterns before and after spawning in both male and female N. arenaceodentata. Males showed a higher degree of similarity in protein expression patterns but females showed large changes in phosphoproteme before and after spawning. There was a decrease (about 70%) in the number of detected phosphoproteins in spent females. The proteins involved in muscular development, cell signaling, structure and integrity, and translation were differentially expressed. This study provides proteomic insights of the male and female worms that may serve as a foundation for better understanding of unusual reproductive patterns in polychaete worms. © 2013 Chandramouli et al.

  20. Proteomic Changes between Male and Female Worms of the Polychaetous Annelid Neanthes arenaceodentata before and after Spawning

    KAUST Repository

    Chandramouli, Kondethimmanahalli

    2013-08-30

    The Neanthes acuminata species complex (Polychaeta) are cosmopolitan in distribution. Neanthes arenaceodentata, complex, has been widely used as toxicological test animal in the marine environment. Method of reproduction is unique in this polychaete complex. Same sexes fight and opposite sexes lie side by side until egg laying. Females lose about 75% of their weight and die after laying eggs. The male, capable of reproducing up to nine times, fertilizes the eggs and incubates the embryos for 3-4 weeks. The objective of this study was to determine if there is any set of proteins that influences this unique pattern of reproduction. Gel-based two-dimensional electrophoresis (2-DE) and gel-free quantitative proteomics methods were used to identify differential protein expression patterns before and after spawning in both male and female N. arenaceodentata. Males showed a higher degree of similarity in protein expression patterns but females showed large changes in phosphoproteme before and after spawning. There was a decrease (about 70%) in the number of detected phosphoproteins in spent females. The proteins involved in muscular development, cell signaling, structure and integrity, and translation were differentially expressed. This study provides proteomic insights of the male and female worms that may serve as a foundation for better understanding of unusual reproductive patterns in polychaete worms. © 2013 Chandramouli et al.

  1. Nuclear DNA content and base composition in 28 taxa of Musa.

    Science.gov (United States)

    Kamaté, K; Brown, S; Durand, P; Bureau, J M; De Nay, D; Trinh, T H

    2001-08-01

    The nuclear DNA content of 28 taxa of Musa was assessed by flow cytometry, using line PxPC6 of Petunia hybrida as an internal standard. The 2C DNA value of Musa balbisiana (BB genome) was 1.16 pg, whereas Musa acuminata (AA genome) had an average 2C DNA value of 1.27 pg, with a difference of 11% between its subspecies. The two haploid (IC) genomes, A and B, comprising most of the edible bananas, are therefore of similar size, 0.63 pg (610 million bp) and 0.58 pg (560 million bp), respectively. The genome of diploid Musa is thus threefold that of Arabidopsis thaliana. The genome sizes in a set of triploid Musa cultivars or clones were quite different, with 2C DNA values ranging from 1.61 to 2.23 pg. Likewise, the genome sizes of tetraploid cultivars ranged from 1.94 to 2.37 pg (2C). Apparently, tetraploids (for instance, accession I.C.2) can have a genome size that falls within the range of triploid genome sizes, and vice versa (as in the case of accession Simili Radjah). The 2C values estimated for organs such as leaf, leaf sheath, rhizome, and flower were consistent, whereas root material gave atypical results, owing to browning. The genomic base composition of these Musa taxa had a median value of 40.8% GC (SD = 0.43%).

  2. Intra-Abdominal Localisation of a Buschke-Lowenstein Tumour: Case Presentation and Review of the Literature

    Directory of Open Access Journals (Sweden)

    N. E. Wester

    2013-01-01

    Full Text Available Giant condyloma acuminatum or Buschke-Lowenstein tumour is a very rare disease which usually is located in the genital, anorectal, and perianal regions. It is regarded as a type of verrucous carcinoma occurring on anogenital mucosal surfaces where it is locally invasive but displays a benign cytology. We describe a case of a 24-year-old woman with persisting condyloma acuminata progressing to a large intra-abdominal Buschke-Lowenstein tumour. To our knowledge such an advanced stage has only been reported once before. The severity and extent of the tumour both determine the treatment and patient outcome. Treatment was impeded by cachexia, an immunosuppressive state after kidney transplantation and difficulties in establishing a reliable diagnose. Interferon treatment was started which initially led to tumour reduction but was complicated by an interferon-induced pancreatitis, pneumonia, and fasciitis necroticans resulting in death. We present a literature overview on the treatment options for a Buschke-Lowenstein tumour, with emphasis on interferon therapy, with all the advantages and disadvantages.

  3. Revisiting the Zingiberales: using multiplexed exon capture to resolve ancient and recent phylogenetic splits in a charismatic plant lineage

    Directory of Open Access Journals (Sweden)

    Chodon Sass

    2016-01-01

    Full Text Available The Zingiberales are an iconic order of monocotyledonous plants comprising eight families with distinctive and diverse floral morphologies and representing an important ecological element of tropical and subtropical forests. While the eight families are demonstrated to be monophyletic, phylogenetic relationships among these families remain unresolved. Neither combined morphological and molecular studies nor recent attempts to resolve family relationships using sequence data from whole plastomes has resulted in a well-supported, family-level phylogenetic hypothesis of relationships. Here we approach this challenge by leveraging the complete genome of one member of the order, Musa acuminata, together with transcriptome information from each of the other seven families to design a set of nuclear loci that can be enriched from highly divergent taxa with a single array-based capture of indexed genomic DNA. A total of 494 exons from 418 nuclear genes were captured for 53 ingroup taxa. The entire plastid genome was also captured for the same 53 taxa. Of the total genes captured, 308 nuclear and 68 plastid genes were used for phylogenetic estimation. The concatenated plastid and nuclear dataset supports the position of Musaceae as sister to the remaining seven families. Moreover, the combined dataset recovers known intra- and inter-family phylogenetic relationships with generally high bootstrap support. This is a flexible and cost effective method that gives the broader plant biology community a tool for generating phylogenomic scale sequence data in non-model systems at varying evolutionary depths.

  4. Proteomic Changes Associated with Successive Reproductive Periods in Male Polychaetous Neanthes arenaceodentata

    KAUST Repository

    Chandramouli, Kondethimmanahalli; Reish, Donald; Zhang, Huoming; Qian, Pei-Yuan; Ravasi, Timothy

    2015-01-01

    The polychaetous annelid Neanthes acuminata complex has a widespread distribution, with the California population referred to as N. arenaceodentata. The reproductive pattern in this complex is unique, in that the female reproduces once and then dies, whereas the male can reproduce up to nine times. The male incubates the embryos until the larvae leave the male’s tube 21–28 days later and commences feeding. Reproductive success and protein expression patterns were measured over the nine reproductive periods. The percent success of the male in producing juveniles increased during the first three reproductive periods and then decreased, but the number of juveniles produced was similar through all nine periods. iTRAQ based quantitative proteomics were used to analyze the dynamics of protein expression patterns. The expression patterns of several proteins were found to be altered. The abundant expression of muscular and contractile proteins may have affected body weight and reproductive success. Sperm have never been observed; fertilization occurs within the parent’s tube. Proteins associated with sperm maturation and fertilization were identified, including ATPase, clathrin, peroxiredoxins and enolase, which may provide clues to the molecular mechanisms enabling males to reproduce multiple times.

  5. Cyclotide Evolution: Insights from the Analyses of Their Precursor Sequences, Structures and Distribution in Violets (Viola

    Directory of Open Access Journals (Sweden)

    Sungkyu Park

    2017-12-01

    Full Text Available Cyclotides are a family of plant proteins that are characterized by a cyclic backbone and a knotted disulfide topology. Their cyclic cystine knot (CCK motif makes them exceptionally resistant to thermal, chemical, and enzymatic degradation. By disrupting cell membranes, the cyclotides function as host defense peptides by exhibiting insecticidal, anthelmintic, antifouling, and molluscicidal activities. In this work, we provide the first insight into the evolution of this family of plant proteins by studying the Violaceae, in particular species of the genus Viola. We discovered 157 novel precursor sequences by the transcriptomic analysis of six Viola species: V. albida var. takahashii, V. mandshurica, V. orientalis, V. verecunda, V. acuminata, and V. canadensis. By combining these precursor sequences with the phylogenetic classification of Viola, we infer the distribution of cyclotides across 63% of the species in the genus (i.e., ~380 species. Using full precursor sequences from transcriptomes, we show an evolutionary link to the structural diversity of the cyclotides, and further classify the cyclotides by sequence signatures from the non-cyclotide domain. Also, transcriptomes were compared to cyclotide expression on a peptide level determined using liquid chromatography-mass spectrometry. Furthermore, the novel cyclotides discovered were associated with the emergence of new biological functions.

  6. Total phenolics and antioxidant activity of five medicinal plant; Fenois totais e atividade antioxidante de cinco plantas medicinais

    Energy Technology Data Exchange (ETDEWEB)

    Sousa, Cleyton Marcos de M.; Silva, Hilris Rocha e; Vieira-Junior, Gerardo Magela; Ayres, Mariane Cruz C.; Costa, Charllyton Luis S. da; Araajo, Delton Servulo; Cavalcante, Luis Carlos D.; Barros, Elcio Daniel S.; Araujo, Paulo Breitner de M.; Brandao, Marcela S.; Chaves, Mariana H. [Universidade Federal do Piaui, Teresina, PI (Brazil). Dept. de Quimica]. E-mail: mariana@ufpi.br

    2007-03-15

    This paper describes total phenolics content and antioxidant activity in the ethanolic extract of leaves, bark and roots of five medicinal plants: Terminalia brasiliensis Camb., Terminalia fagifolia Mart. and Zucc., Copernicia cerifera (Miller) H.E. Moore, Cenostigma macrophyllum Tul. var. acuminata Teles Freire and Qualea grandiflora Mart. The total phenolics content of the plant extracts, determined by the Folin-Ciocalteu method, varied from 250.0 {+-}8,2 to 763,63 {+-}13.03 mg of gallic acid equivalent/g dry EtOH extract. The antioxidant activity of extracts was evaluated using the 2,2-diphenyl-1-picrylhydrazyl (DPPH) assay system. Extract of bark from T. brasiliensis, the most active, with an EC{sub 50} value of 27.59 {+-} 0.82 {mu}g/mL, was comparable to rutin (EC{sub 50} = 27.80 {+-} 1.38) and gallic acid (EC{sub 50} = 24.27 {+-} 0.31), used as positive controls. The relationship between total phenolic content and antioxidant activity was positive and significant for T. brasiliensis, C. macrophyllum and C. cerifera. (author)

  7. Models of sustainable use of alder (Alnus acuminate Kunth hillside area in forest mist

    Directory of Open Access Journals (Sweden)

    Pacheco-Agudo Edilberto

    2016-05-01

    Full Text Available Timber extractions non planned affect negatively in the reduction of forest cover, proper management and planned with minor extractions preserve the natural production allow for longer and sustainable forms a stand to benefit local populations and the same ecosystem. In the basin of Acero Marca has two stands Alnus acuminata that they are extracted continuously. With the purpose of planning the extraction of timber resourses were constructed and evaluated matrix models sustainable harvest of this species on the basis of structures of age. For this, two old structures we worked following a dendrochronological analysis and demographic model of the forestall mass, from making local information by transectos Gentry. According to the demographic model, the potential regression evidences significant differences (p 1 and could be the most appropriate for a planned extraction becoming sustainable over time. The second structure of age proved extremely sensitive to any change. To use the matrix models is not a simple path of going over. In spite of the results, the matrix models joined to ample experience of the observer would be able to present proposals of sustainable handling of the forestal resources.

  8. Ocular dynamics of Garcinia cola (Heckel on healthy volunteers following bolus ingestion

    Directory of Open Access Journals (Sweden)

    S. A. Igwe

    2007-12-01

    Full Text Available Garcinia cola Heckel, an angiospermae belonging to the  family Guttiferae, is known in commerce as bitter cola. It is a plant found in the West African subregion, mostly in moist conditions, and often in association with Cola acuminata. The seeds are highly valued ingredients in African ethonomedicine. The seeds have several social uses and applications in folk medicine. These seeds are ordinarily chewed by the local people without prescription or restriction. In an in vivo case control study, the effects of Garcinia cola on some visual functions: pupil diameter, near point of convergence (NPC, amplitude of accommodation (AA, intraocular pressure (IOP, visual acuity (VA and habitual phoria; following bolus ingestion of 20 g was undertaken using healthy visually active volunteers. Results showed that bolus ingestion of Garcinia cola constricted the pupil by 68%, reduced the NPC by 28%, increased the AA by 17.8% at peak effect and decreased the intraocular pressure by 31% without affecting the distance and near VA. The lateral phoria at far and near tended towards esophoria. Possibly the miotic effect and reduction in IOP could be of benefit to patients with raised IOP where conventional drugs may not be effective. Also it is possible that the effects on phoria could be exploited in oculomotor function in combination with visual training.

  9. A puzzling migratory detour : Are fueling conditions in Alaska driving the movement of juvenile sharp -tailed sandpipers ?

    Science.gov (United States)

    Lindstrom, A.; Gill, Robert E.; Jamieson, S.E.; McCaffery, B.; Wennerberg, Liv; Wikelski, M.; Klaassen, M.

    2011-01-01

    Making a detour can be advantageous to a migrating bird if fuel-deposition rates at stopover sites along the detour are considerably higher than at stopover sites along a more direct route. One example of an extensive migratory detour is that of the Sharp-tailed Sandpiper (Calidris acuminata), of which large numbers of juveniles are found during fall migration in western Alaska. These birds take a detour of 1500-3400 km from the most direct route between their natal range in northeastern Siberia and nonbreeding areas in Australia. We studied the autumnal fueling rates and fuel loads of 357 Sharp-tailed Sandpipers captured in western Alaska. In early September the birds increased in mass at a rate of only 0.5% of lean body mass day?1. Later in September, the rate of mass increase was about 6% of lean body mass day?1, among the highest values found among similar-sized shorebirds around the world. Some individuals more than doubled their body mass because of fuel deposition, allowing nonstop flight of between 7100 and 9800 km, presumably including a trans-oceanic flight to the southern hemisphere. Our observations indicated that predator attacks were rare in our study area, adding another potential benefit of the detour. We conclude that the most likely reason for the Alaskan detour is that it allows juvenile Sharp-tailed Sandpipers to put on large fuel stores at exceptionally high rates. Copyright ?? The Cooper Ornithological Society 2011.

  10. Antimicrobial topical agents used in the vagina.

    Science.gov (United States)

    Frey Tirri, Brigitte

    2011-01-01

    Vaginally applied antimicrobial agents are widely used in the vagina in women with lower genital tract infections. An 'antimicrobial' is a general term that refers to a group of drugs that are effective against bacteria, fungi, viruses and protozoa. Topical treatments can be prescribed for a wide variety of vaginal infections. Many bacterial infections, such as bacterial vaginosis, desquamative inflammatory vaginitis or, as some European authors call it, aerobic vaginitis as well as infection with Staphylococcus aureus or group A streptococci, may be treated in this way. Candida vulvovaginitis is a fungal infection that is very amenable to topical treatment. The most common viral infections which can be treated with topical medications are condylomata acuminata and herpes simplex. The most often encountered protozoal vaginitis, which is caused by Trichomonas vaginalis, may be susceptible to topical medications, although this infection is treated systemically. This chapter covers the wide variety of commonly used topical antimicrobial agents for these diseases and focuses on the individual therapeutic agents and their clinical efficacy. In addition, potential difficulties that can occur in practice, as well as the usage of these medications in the special setting of pregnancy, are described in this chapter. Copyright © 2011 S. Karger AG, Basel.

  11. In vitro PHYTOTHERAPY OF VECTOR SNAILS BY BINARY COMBINATIONS OF LARVICIDAL ACTIVE COMPONENTS IN EFFECTIVE CONTROL OF FASCIOLIASIS

    Directory of Open Access Journals (Sweden)

    Kumari Sunita

    2013-09-01

    Full Text Available SUMMARY A food-borne trematode infection fascioliasis is one among common public health problems worldwide. It caused a great economic loss for the human race. Control of snail population below a certain threshold level is one of the important methods in the campaign to reduce the incidence of fascioliasis. The life cycle of the parasite can be interrupted by killing the snail or Fasciola larva redia and cercaria inside of the snail Lymnaea acuminata. In vitro toxicity of different binary combinations (1:1 ratio of plant-derived larvicidal active components such as citral, ferulic acid, umbelliferone, azadirachtin and allicin against Fasciola redia and cercaria were tested. The mortality of larvae was observed at 2h, 4h, 6h and 8h of treatment. In in vitro condition azadirachtin + allicin (1:1 ratio was highly toxic against redia and cercaria (8h LC50 0.006 and 0.005 mg/L. Toxicity of citral + ferulic acid was lowest against redia and cercaria larvae.

  12. Fascioliasis Control: In Vivo and In Vitro Phytotherapy of Vector Snail to Kill Fasciola Larva

    Directory of Open Access Journals (Sweden)

    Kumari Sunita

    2011-01-01

    Full Text Available Snail is one of the important components of an aquatic ecosystem, it acts as intermediate host of Fasciola species. Control of snail population below a certain threshold level is one of the important methods in the campaign to reduce the incidence of fascioliasis. Life cycle of the parasite can be interrupted by killing the snail or Fasciola larva redia and cercaria in the snail body. In vivo and in vitro toxicity of the plant products and their active component such as citral, ferulic acid, umbelliferone, azadirachtin, and allicin against larva of Fasciola in infected snail Lymnaea acuminata were tested. Mortality of larvae were observed at 2 h, 4 h, 6 h, and 8 h, of treatment. In in vivo treatment, azadirachtin caused highest mortality in redia and cercaria larva (8 h, LC50 0.11, and 0.05 mg/L whereas in in vitro condition allicin was highly toxic against redia and cercaria (8 h, LC50 0.01, and 0.009 mg/L. Toxicity of citral was lowest against redia and cercaria larva.

  13. Pola Penyebaran Harian Dan Karakteristik Tumbuhan Pakan Monyet Ekor Panjang (Macaca Fascicularis R. Di Hutan Rakyat Ambender, Pamekasan, Madura

    Directory of Open Access Journals (Sweden)

    Anisa Zairina

    2015-04-01

    Full Text Available Abstrak Primata merupakan salah satu fauna arboreal di hutan yang memiliki arti penting dalam kehidupan alam. Keberadan primata sangat penting artinya dalam regenerasi hutan tropik. Penelitian ini bertujuan untuk mengetahui pola penyebaran harian, populasi, serta identifikasi jenis tumbuhan pendukung terutama sebagai pakan M. fascicularis. Pengamatan penyebaran dan populasi  monyet dilakukan di kawasan hutan rakyat yang terletak di desa Ambender Kecamatan Pegantenan, Kabupaten Pamekasan. Pemetaan penyebaran harian dan daerah edar dilakukan dengan menggunakan peta dengan plotting area aktivitas harian M. fascicularis. Estimasi populasi monyet dilakukan dengan metode terkonsentrasi di lima titik pengamatan. Parameter yang diamati dalam estimasi populasi adalah jumlah, struktur umur, jenis kelamin, dan arah pergerakannya. Penentuan jenis makanan monyet dilakukan dengan metode focal animal sampling yaitu mengamati satu individu dalam jangka waktu tertentu. Proporsi tumbuhan pendukung dilakukan dengan metode kuadrat dan dihitung proporsinya terhadap seluruh tumbuhan yang ada. Identifikasi jenis tumbuhan dilakukan secara langsung di lapangan dan jika tidak memungkinkan dibuat herbarium dan diidentifikasi di laboratorium. Hasil penelitian menunjukkan monyet melakukan penyebaran harian dengan pola tertentu. Terdapat beberapa jenis tumbuhan yang menjadi pilihan M. fascicularis sebagai pakannya. Diantaranya terdapat sekitar 22 tumbuhan hutan yang teridentifikasi dan diketahui dipilih oleh M. fascicularis sebagai pakannya, jenis tumbuhan tersebut antara lain duwek (Syzygium cumini, nyato (Palaquium eriocalyx, kalak (Uvaria purpurea, polai (Alstonia scholaris, kendal (Cordia gantamensis, dan sanek (Capparis acuminata.   Kata Kunci: M. fascicularis, Pola penyebaran, Karakteristik tumbuhan pakan

  14. Structural and floristic changes caused by gamma radiation in understory vegetation of two forest types in northern Wisconsin

    International Nuclear Information System (INIS)

    Zavitkovski, J.

    1977-01-01

    Structural and floristic changes of the understory vegetation of gamma-irradiated aspen and maple-aspen-birch (MAB) communities in northern Wisconsin were quantified by comparing the pre- and postirradiation floristic composition and vegetational cover. A size-dependent radiosensitivity was determined among three vegetational strata, the tall shrubs being the most sensitive, low shrubs intermediate, and herbs the most resistant. Corylus cornuta, whose nuclear characteristics indicated that it could be resistant, was very sensitive and was completely eliminated at exposures of 500 r/20-hr day or higher. The cover of Rubus strigosus, minimal before irradiation, increased manifold and accounted for most of the shrub cover 2 years after the conclusion of irradiation. Among herbs, Carex pensylvanica and Luzula acuminata were very resistant, and Trillium grandiflorum, Aralia nudicaulis, Oryzopsis asperifolia, and Clintonia borealis were very sensitive. The herbaceous stratum of the aspen type appeared more resistant than that of the MAB. This difference apparently resulted from differences in floristic composition of the two communities

  15. Proteomic Changes Associated with Successive Reproductive Periods in Male Polychaetous Neanthes arenaceodentata

    KAUST Repository

    Chandramouli, Kondethimmanahalli

    2015-09-04

    The polychaetous annelid Neanthes acuminata complex has a widespread distribution, with the California population referred to as N. arenaceodentata. The reproductive pattern in this complex is unique, in that the female reproduces once and then dies, whereas the male can reproduce up to nine times. The male incubates the embryos until the larvae leave the male’s tube 21–28 days later and commences feeding. Reproductive success and protein expression patterns were measured over the nine reproductive periods. The percent success of the male in producing juveniles increased during the first three reproductive periods and then decreased, but the number of juveniles produced was similar through all nine periods. iTRAQ based quantitative proteomics were used to analyze the dynamics of protein expression patterns. The expression patterns of several proteins were found to be altered. The abundant expression of muscular and contractile proteins may have affected body weight and reproductive success. Sperm have never been observed; fertilization occurs within the parent’s tube. Proteins associated with sperm maturation and fertilization were identified, including ATPase, clathrin, peroxiredoxins and enolase, which may provide clues to the molecular mechanisms enabling males to reproduce multiple times.

  16. Dinophysis caudata generated lipophilic shellfish toxins in bivalves from the Nanji Islands, East China Sea

    Science.gov (United States)

    Jiang, Tao; Xu, Yixiao; Li, Yang; Qi, Yuzao; Jiang, Tianjiu; Wu, Feng; Zhang, Fan

    2014-01-01

    A 12-month program of monitoring potentially toxic microalgae (that produce lipophilic shellfish toxins; LSTs) and their toxins in bivalves was conducted from April 2006 to March 2007 in the Nanji Islands, East China Sea. Two Dinophysis species, D. caudata and D. acuminata, were identified, and D. caudata was found to be the dominant species. D. caudata was detected in water samples between April and June 2006, and between February and March 2007. It reached its highest abundances in May, with a mean abundance of 1.38×102 cells/L in surface water and 1.25×102 cells/L in bottom water (cultured bivalves sampled between April and June were contaminated with LSTs, with an average toxicity of 85 μg okadaic acid (OA) eq./100 g meat, which was four times higher than the Chinese regulatory limit (20 μg OA eq./100 g meat). Ten out of fifteen wild samples (66.7%) collected during the same period were positive for LSTs, and contained an average LST toxicity of 45 μg OA eq./100 g meat (more than twice the regulatory value). Cultured Patinopecten yessoensis collected on 15 May 2006 had the highest toxicity, 320 μg OA eq./100 g meat, and relatively high toxicities (80 to 160 μg OA eq./100 g meat) were found in bivalves until the end of July.

  17. New data on agaricoid fungi of the Katunsky State Nature Reserve and rare fungi of the Republic of Altai (Russia

    Directory of Open Access Journals (Sweden)

    Irina A. Gorbunova

    2017-08-01

    Full Text Available The article presents new data on agaricoid basidiomycetes of the Katunsky State Nature Reserve (Republic of Altai, Russia, including data on rare species. Besides the paper contains characteristics of some rare ascomycetes and basidiomycetes found in the Katunsky Reserve and in the Republic of Altai as well as about species recommended for inclusion in the new edition of the Red Data Book of the Republic of Altai. In total descriptions of 17 species of macromycetes are presented. These are Chroogomphus sibiricus, Cortinarius violaceus, Floccularia luteovirens, Ganoderma lucidum, Grifola frondosa, Lactarius lignyotus, Leucoagaricus nympharum, Leucopholiota lignicola, Gastrosporium simplex, Gyromitra sphaerospora, Laricifomes officinalis, Bovista acuminata, Hydropus atramentosus, Leucopaxillus rhodoleucus, Phallus costatus, Polyozellus multiplex and Polyporus rhizophilus. We present data on species' distribution throughout the Republic of Altai, Russia and the world; some ecological and biological features of species; major threats and their conservation status. Arguments for exclusion of Amanita echinocephala, Hericium coralloides, Cystoderma rugosoreticulatum, Leccinum percandidum, Mutinus caninus from the list of rare species of the region are presented.

  18. Identification of a novel promoter from banana aquaporin family gene (MaTIP1;2) which responses to drought and salt-stress in transgenic Arabidopsis thaliana.

    Science.gov (United States)

    Song, Shun; Xu, Yi; Huang, Dongmei; Miao, Hongxia; Liu, Juhua; Jia, Caihong; Hu, Wei; Valarezo, Ana Valeria; Xu, Biyu; Jin, Zhiqiang

    2018-07-01

    Drought and salt stresses often affect plant growth and crop yields. Identification of promoters involved in drought and salt stress responses is of great significance for genetic improvement of crop resistance. Our previous studies showed that aquaporin can respond to drought and salt stresses, but its promoter has not yet been reported in plants. In the present study, cis-acting elements of MaAQP family member promoters were systematically analyzed in banana. Expression of MaTIP1; 2 was induced by drought and salt stresses but not sensitive to cold stress, waterlogging stress, or mechanical damage, and its promoter contained five stress-related cis-acting elements. The MaTIP1; 2 promoter (841 bp upstream of translation initiation site) from banana (Musa acuminata L. AAA group cv. Brazilian) was isolated through genome walking polymerase chain reaction, and found to contain a TATA Box, CAAT box, ABRE element, CCGTCC box, CGTCA motif, and TCA element. Transformation of the MaTIP1; 2 promoter into Arabidopsis to assess its function indicated that it responds to both drought and salt stress treatments. These results suggest that MaTIP1; 2 utilization may improve drought and salt stresses resistance of the transgenic plants by promoting banana aquaporin expression. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  19. Production of bioethanol using agricultural waste: banana pseudo stem

    Directory of Open Access Journals (Sweden)

    Snehal Ingale

    2014-09-01

    Full Text Available India is amongst the largest banana (Musa acuminata producing countries and thus banana pseudo stem is commonly available agricultural waste to be used as lignocellulosic substrate. Present study focuses on exploitation of banana pseudo stem as a source for bioethanol production from the sugars released due to different chemical and biological pretreatments. Two fungal strains Aspergillus ellipticus and Aspergillus fumigatus reported to be producing cellulolytic enzymes on sugarcane bagasse were used under co-culture fermentation on banana pseudo stem to degrade holocellulose and facilitate maximum release of reducing sugars. The hydrolysate obtained after alkali and microbial treatments was fermented by Saccharomyces cerevisiae NCIM 3570 to produce ethanol. Fermentation of cellulosic hydrolysate (4.1 g% gave maximum ethanol (17.1 g/L with yield (84% and productivity (0.024 g%/h after 72 h. Some critical aspects of fungal pretreatment for saccharification of cellulosic substrate using A. ellipticus and A. fumigatus for ethanol production by S. cerevisiae NCIM 3570 have been explored in this study. It was observed that pretreated banana pseudo stem can be economically utilized as a cheaper substrate for ethanol production.

  20. Zooplankton associations and environmental factors in Ogunpa and Ona rivers, Nigeria

    Directory of Open Access Journals (Sweden)

    Gbemisola A. Akin-Oriola

    2003-06-01

    Full Text Available Zooplankton abundance, composition and environmental parameters were monitored in two tropical rivers over a twenty month period. The data was subjected to cluster, factor and correlation analysis to determine the grouping pattern of zooplankton and their relationship to environmental parameters. Environmental factors in Ogunpa and Ona rivers -included buffering capacity, trace metal ions, pH-temperature/ transparency- were primarily influenced by rainfall. The dominance of the Rotifera in both rivers was attributed to their short developmental rate and fish predation on larger zooplankton. Two groups of associations were identified in each river - a commonly occurring species group exhibiting strong homogenous correlation with environmental factors and a predominant group exhibiting weak correlation with environmental factors and whose abundance / composition may be defined by biotic factors.La abundancia, y composición del zooplancton, y parámetros ambientales fueron monitoreados en dos ríos tropicales durante un período de doce meses. Los datos fueron sometidos a análisis de agrupaciones, de factores y de correlación para determinar los patrones de agrupamiento del zooplancton y sus relaciones con parámetros ambientales. Los factores ambientales en los ríos Ogunpa y Ona, incluidos la capacidad tampón, iones metálicos traza, pH-temperatura/ transparencia, fueron influenciados principalmente por la lluvia. La dominancia de los Rotíferos en ambos ríos fue atribuida a su corta tasa de desarrollo y a la depredación del zooplancton grande por peces. Dos grupos de asociaciones fueron identificadas en cada río - la presencia de un grupo común de especies que exhiben una fuerte y homogénea correlación con factores ambientales y un grupo predominante que exhibe una débil correlación con factores ambientales y cuya abundancia / composición que podría estar definida por factores bióticos.

  1. Limnological study of Lake Shastina, Siskiyou County, California

    Science.gov (United States)

    Dong, Alex E.; Beatty, Kenneth W.; Averett, Robert C.

    1974-01-01

    about 5 million cells per litre.Zooplankton numbers were greatest in March, July, and September, with lesser concentrations in June. Three major zooplankton groups, Cladocera, Copepoda, and Rotifera, were present. The major groups of benthic organisms were Oligochaeta, Chironomidae, and Chaoborus, with numbers ranging from 3350, 890, and 8450 per square metre, respectively.A discussion on algal control is included.

  2. EVALUACIÓN DE LA ROTIFEROFAUNA PRESENTE EN EL COMPLEJO DE PAJARALES DURANTE LA ÉPOCA LLUVIOSA, DEPARTAMENTO DE MAGDALENA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    SEBASTIÁN CELIS

    2008-05-01

    Full Text Available Con miras a evaluar posibles efectos de la recomunicación del río Magdalena con su antiguo delta, se determinó la abundancia y composición de la rotiferofauna del Complejo de Pajarales (CP, durante el período de mayor abundancia anual de zooplancton. El phylum Rotifera fue seleccionado por sus altas tasas reproductivas y eficiencia en procesos de transformación energética. Las muestras se colectaron con botella van Dorn durante la segunda temporada lluviosa de 2006. En cada una de las cuatro estaciones analizadas se registraron la salinidad, temperatura, pH y oxígeno disuelto. La diversidad se calculó empleando el índice de Shannon-Wiener H’ (log10 comparando estaciones y fechas de muestreo para establecer variaciones en el período de estudio. Gráficamente se relacionaron variables fisicoquímicas con valores de diversidad que emplearon un α de 0.05 y 95% de intervalo de confianza. En total, fueron encontrados 20 morfotipos pertenecientes a las familias Brachionidae, Lecanidae, Filiniidae, Synchaetidae, Hexarthriidae y Testudinellidae, siendo Brachionidae y Lecanidae las más abundantes. La relación entre diversidad y variables fisicoquímicas, indica que la salinidad es la principal responsable de la diversidad de rotíferos. En conclusión, la rotiferofauna actual en el CP es más abundante y diversa que hace 16 años, antes de la recomunicación con el río Magdalena. Así mismo, la concentración de oxigeno disuelto, pH y salinidad son diferentes. Teniendo en cuenta que la salinidad es el factor que más influyó en la diversidad de rotíferos, la reapertura de canales probablemente favoreció el incremento en la diversidad de rotíferos en el CP.

  3. Selectividad del zooplancton y solapamiento trófico entre tallas del pez Menidia humboldtiana (Atheriniformes: Atherinopsidae en el embalse Danxhó, México

    Directory of Open Access Journals (Sweden)

    Regina Sánchez Merino

    2009-06-01

    Full Text Available El charal Menidia humboldtiana es considerado como una de las especies de gran importancia en la industria pesquera de algunos estados de México. Es necesario conocer el efecto que esta especie ejerce sobre su alimento para saber si seleccionan las presas de mayor talla, si hay competencia por el alimento entre especies nativas e introducidas, y para comprender el comportamiento del zooplancton ante peces zooplanctófagos. Se determinó si M. humboldtiana selecciona su alimento, sobre qué géneros lo hace, y si existe traslape en la dieta entre las diferentes tallas. Los peces se recolectaron por medio de un chinchorro de 88 mm de abertura de malla, en seis estaciones de muestreo durante un año, en el embalse Danxhó, y una muestra de zooplancton fue recolectada por filtrado con una red de 125 µm. El análisis de los contenidos estomacales se realizó en peces agrupados en intervalos de longitud estándar para cada época del año, por medio del método volumétrico. Para evaluar el traslape trófico entre los diferentes intervalos de longitud, se utilizó el índice de Morisita modificado por Horn. El zooplancton estuvo representado por doce géneros: Mastigodiaptomus y Cyclops (Copepoda; Bosmina, Diaphanosoma, Daphnia, Ceriodaphnia, Moina, Alonopsis y Camptocercus (Cladocera; Asplanchna, Conochillus y Filinia (Rotifera. Durante la primavera, los charales de 3-8.9 cm presentaron un marcado traslape, para el verano fueron los grandes (7-10.9 cm, en otoño el traslape fue en todas las tallas, y en invierno solo las tallas intermedias (5-8.9 cm lo presentaron.Selectivity of zooplankton and trophic overlap between size Menidia humboldtiana fish (Atheriniformes: Atherinopsidae in the reservoir Danxhó, Mexico. The Menidia humboldtiana silverside is considered one of the most important species in fisheries in some states of Mexico. Knowing the choice that this species exercises over its food gives us an understanding of the behavior of

  4. Aliso en Simbiosis Dual con Frankia y Endomicorrizas y Respuesta a Boro en un Andisol Alder in Dual Symbiosis whith Frankia and Endomycorrhizae and Response at Boron in an Andisol

    Directory of Open Access Journals (Sweden)

    Marisol Medina Sierra

    2012-06-01

    Full Text Available Resumen. Se evaluó la respuesta del aliso (Alnus acuminata Kunth a la inoculación dual con cepas de Frankia spp. y de hongos endomicorrizógenos con dos niveles de boro (B (0,3 y 0,6 mg kg-1 suelo y la aplicación de nitrógeno (N (40 kg ha-1, fósforo (P (30 mg kg-1 suelo y un control sin inoculación ni elementos químicos. Se empleó un diseño completamente aleatorizado, con 41 tratamientos y 20 repeticiones. Para el análisis estadístico de componentes principales se empleó el programa Multibiplot. Las variables respuesta correspondieron a la biomasa seca aérea y sus contenidos de N, P, Calcio (Ca y cenizas (cen. Se encontró que los tratamientos de P y N y las cepas nativas de Frankia spp. (UdeA902, UdeA904 y CUNMS502 combinados con hongos micorrizógenos (UdeA1905 y Glomus fistulosum respectivamente, favorecieron el rendimiento y contenido de N del aliso. La aplicación de B en algunos casos mejoró el rendimiento y en otros lo afectó negativamente; pero potenció la respuesta de algunas inoculaciones especialmente cuando estuvo presente G. fistulosum aún en el caso de estar acompañado de la cepa de Frankia (CUNMS502. Esta cepa, que presentó bajo rendimiento en otros tratamientos, se vio favorecida notablemente con la adición de B. La inoculación dual es efectiva para favorecer el manejo forestal del aliso siempre y cuando se haga la selección adecuada de las cepas, lo cual puede además condicionar la respuesta a algunos nutrientes como en el caso del B.Abstract. It was evaluated the response of alder (Alnus acuminata Kunth to the dual inoculation of strains of Frankia spp. and endomycorrhizal fungi with two levels of boron (B (0.3 and 0.6 mg kg-1 soil and the application of nitrogen (N (40 kg ha-1, phosphorus (P (30 mg kg-1 soil and a control without inoculation or chemical elements. The experimental design was completely randomized; it was composed kg-1of 41 treatments and 20 replications. The statistical analysis consisted

  5. Caracterización Física, Química y Mineralógica de Suelos con Vocación Forestal Protectora Región Andina Central Colombiana / Physical Chemical and Mineralogical Characterization of Soils with a Protective Forest Vocation, Central Andean Region of Colombia

    Directory of Open Access Journals (Sweden)

    Leyder Echeverri Tafur

    2014-06-01

    Full Text Available Resumen. En la Reserva Forestal Protectora Bosques de la CHEC, ubicada sobre la vertiente occidental de la cordillera central colombiana, municipios de Manizales y Villamaría, departamento de Caldas, se hizo la caracterización física, química y mineralógica de dos perfiles de suelos, descritos sobre dos laderas, con un manejo actual correspondiente a una plantación de aliso (Alnus acuminata y un bosque secundario. Los resultados permitieron establecer,desde el punto de vista físico, el dominio de clase textural areno francosa en la plantación de aliso y franco arenoso en el bosque secundario. Químicamente el suelo del perfil plantado con aliso, presentó valores de pH más bajos, mayor saturación de acidez intercambiable y menor saturación de bases en comparación con el perfil del bosque secundario. En ambos perfiles, el análisis óptico con microscopio petrográfico, permitió observar que los feldespatos, del grupo de las plagioclasas y el vidrio volcánico, se destacan como minerales abundantes en la fracción arena; mientras que en la fracción arcilla, el material no cristalino, seconsidera mineral predominante, seguido de la cristobalita y los feldespatos, según la metodología de difracción de rayos X. Se concluye que la vocación de uso forestal protector, bajo el cual se encuentran sometidos ambos suelos, es el más adecuado, teniendo en cuenta que las limitaciones químicas, dificultan el establecimiento de sistemas de producción agropecuaria. / Abstract. The physical, chemical and mineralogical characterization of two soil profiles on two slopes, with a management currently corresponding to an Andean alder plantation (Alnus acuminata and a secondary forest, was carried out at the Protective Forest Reserve of the CHEC. This reserve is located on the western slope of the Central Mountain Range of the Colombian Andes, in the municipalities of Manizales and Villamaria, Caldas Department. The results

  6. Surtos populacionais de Bemisia tabaci no estado de São Paulo Outbreaks of Bemisia tabaci in the São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    André Luiz Lourenção

    1994-01-01

    Full Text Available A partir de 1991, tem sido observada a presença da mosca-branca Bemisia tabaci (Genn. (Homoptera: Aleyrodidae em altas populações em hortaliças e orna-mentais nos municípios paulistas de Paulínia, Holambra, Jaguariúna e Artur Nogueira. Foram constatadas infestações severas em tomateiro, brócolos, berinjela e aboboreira; nesta última, o sintoma observado em plantas infestadas pela mosca-branca é o prateamento da face superior das folhas, em conjunto com queda drástica da produção. Uma lavoura de tomate severamente infestada por B. tabaci apresentava o sintoma referido colo amadurecimento irregular dos frutos do tomateiro; plantas invasoras presentes nessa área também foram intensamente colonizadas, principalmente Sida rhombifolia L., Sonchus oleraceus L., Solanum viarum Dun. e Ipomoea acuminata Roem. & Schult. Em Holambra, verificaram-se ataques intensos em plantas ornamentais, principalmente crisântemo (Chrysantemum morifolium Ramat. e bico-de-papagaio (Euphorbia pulcherrima Willd.; roseiras foral pouco colonizadas. Nessas hortaliças e nas ornamentais, a aplicação quase diária de inseticidas não reduziu a infestação do inseto. Além dessas plantas, campos de algodão, em Holambra, e de feijão, em Paulínia, também foram infestados por B. tabaci. Nos E.U.A., a capacidade de certas populações de B. tabaci de induzir o prateamento da folha em aboboreira e de colonizar intensamente E. pulcherrima, entre outros fatores, têm levado à distinção do biótipo "B" ou "poinsétia", nome vulgar dessa euforbiácea; todavia, estudos recentes na Califórnia (E.U.A. mostram a possibilidade de se tratar de duas espécies distintas. Dada a similaridade entre as infestações associadas a B. tabaci que vêm ocorrendo naquele país e, mais recentemente, no Brasil, é provável que o biótipo B ou essa nova espécie tenha sido aqui introduzido.Since 1991, an increase in the populations of the whitefly Bemisia tabaci (Genn. (Homoptera

  7. Prevalence of Sexually Transmitted Infection in Teenage Pregnancy in Rajavithi Hospital, Thailand.

    Science.gov (United States)

    Asavapiriyanont, Suvanna; Chaovarindr, Udom; Kaoien, Surasak; Chotigeat, Uraiwan; Kovavisarach, Ekachai

    2016-02-01

    Behavioral and social changes in the modern era have triggered an increase in the incidence of early sexual contact and teenage pregnancy. Since there is no routine Gonococcal & Chlamydial (GC & CT) screening in teens in antenatal clinics in Thailand, the present study was performed to find the prevalence of STI, especially Chlamydial infection, in teenage pregnancy. To evaluate the prevalence of sexually transmitted infections (STIs), especially Chlamydial infection (CT), in teenage pregnancy and its related factors. One hundred and twenty-one teenage pregnancies were recruited at the ANC in Rajavithi Hospital from October 2006 to May 2007. After signing informed consent forms, they were asked to answer questionnaires about baseline data, sexual information and risk factors, after which urine specimens were collected for screening for GC and CT using the PCR technique (AMPLICOR by Roche). Later, pelvic examination was per formed by the gynecologist at the STD (sexually transmitted disease) clinic. All the data and LAB results were recorded and analyzed by the SPSS program. Numbers, percentages, means with SD, Chi-squared test, Fisher's exact test and odds ratio were used. Potential risk factors were analyzed using binary logistic regression. The prevalence of STI in pregnant teenagers was 28.1% (CT = 19.8%, GC = 1.7%, hepatitis B = 3.3%, trichomoniasis 1.7%, Herpes simplex = 0.8% and condyloma acuminata = 0.8%). No Syphilis, chancroid or HIV were found in the present study Other non-STI like candidiasis and bacterial vaginosis were found in 45.5% of participants (candidiasis and bacterial vaginosis at 19.0% and 24.8%, respectively). The risk of CT infection was significantly related (6.9 times higher) to having previous sexual contact before the current partner (95% CI, 1.8-27.0). STI, especially Chlamydial infection, was found in a significant number of teenage pregnancies. Measures should be taken to prevent this resulting in complicated outcomes in the future.

  8. Clinical trial experience with prophylactic human papillomavirus 6/11/16/18 vaccine in young black women.

    Science.gov (United States)

    Clark, Liana R; Myers, Evan R; Huh, Warner; Joura, Elmar A; Paavonen, Jorma; Perez, Gonzalo; James, Margaret K; Sings, Heather L; Haupt, Richard M; Saah, Alfred J; Garner, Elizabeth I O

    2013-03-01

    Human papillomavirus (HPV) is the causative agent of cervical cancer. Black women are disproportionally diagnosed and have higher mortality from cervical cancer in the United States. Here we describe the prophylactic efficacy and safety of a quadrivalent HPV-6/11/16/18 vaccine in black women. A total of 700 black women from Latin America, Europe, and North America (aged 16-24 years) received the vaccine or placebo in one of two studies. Analyses focused on the efficacy and safety of the vaccine. Baseline rates of Chlamydia trachomatis infection and history of past pregnancy were more than twice as high in black women compared with the non-black women who were enrolled in these trials. HPV-6/11/16 or 18 DNA was detected in 18% of black women versus 14.6% in non-black women at day 1. For black women, vaccine efficacy against disease caused by HPV-6/11/16/18 was 100% for cervical intraepithelial neoplasia (0 vs. 15 cases; 95% confidence interval, 64.5%-100%) and 100% for vulvar and vaginal intraepithelial neoplasia and condylomata acuminata (0 vs. 17 cases; 95% confidence interval, 69.3%-100%). There were no serious vaccine-related adverse experiences. A similar proportion of pregnancies resulted in live births (75.8% vaccine; 72.7% placebo) and fetal loss (24.2% vaccine; 27.3% placebo). Prophylactic quadrivalent HPV-6/11/16/18 vaccination of young black women demonstrated high efficacy, safety, and tolerability. HPV vaccination has the potential to reduce cervical cancer-related health disparities both in the United States and around the world. Copyright © 2013 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

  9. Fire resistant behaviour of cellulosic textile functionalized with wastage plant bio-molecules: A comparative scientific report.

    Science.gov (United States)

    Basak, Santanu; Wazed Ali, S

    2018-07-15

    Three different wastage plant based bio-molecules named banana peel powder (Musa acuminata) (BPP), coconut shell (Cocos nucifera) extract (CSE) and pomegranate rind (Punica granatum) extract (PRE) have been explored as fire resistant material on the cellulosic polymer (cotton fabric). To this end, extracts have been applied to the cotton fabric in different concentration at elevated temperature for specific time period. Treated cotton fabric showed 6 (BPP), 8.5 (CSE) and 12 (PRE) times lower vertical burning rate compared to the control cotton fabric. Thermo-gravimetry (TG) curves and the limiting oxygen index (LOI) value revealed that the PRE extract (LOI: 32) treated fabric encompassed more thermal stability compared to the BPP (LOI:26) and the CSE (LOI: 27) treated fabric as it showed higher oxygen index and more weight retention (40%) at higher temperature 450°C. Moreover, the carbonaceous samples remained after the burning of the extracts and the treated fabrics showed structural integration and more carbon content [65.6 (PRE extract) and 76.3% (PRE treated cotton)] compared to the fragile, net like char of the control cotton fabric, having less carbon content (49.8%). Gas Chromatography Mass spectroscopy (GC-MS) of the different extracts (CSE, PRE, BPP) used for the study showed the presence of high molecular weight aromatic phenolic compounds, tannin based compound and the nitrogen containing alkaloids, responsible for fire resistant effect of the different extract treated fabric. Besides fire retardancy, all the treated fabric showed attractive natural colour (measured by colour strength values) and there has been no adverse effect on the tensile strength property of the fabric after the treatment. Copyright © 2018 Elsevier B.V. All rights reserved.

  10. The role of ABC genes in shaping perianth phenotype in the basal angiosperm Magnolia.

    Science.gov (United States)

    Wróblewska, M; Dołzbłasz, A; Zagórska-Marek, B

    2016-03-01

    It is generally accepted that the genus Magnolia is characterised by an undifferentiated perianth, typically organised into three whorls of nearly identical tepals. In some species, however, we encountered interesting and significant perianth modifications. In Magnolia acuminata, M. liliiflora and M. stellata the perianth elements of the first whorl are visually different from the others. In M. stellata the additional, spirally arranged perianth elements are present above the first three whorls, which suggests that they have been formed within the domain of stamen primordia. In these three species, we analysed expression patterns of the key flower genes (AP1, AGL6, AP3, PI, AG) responsible for the identity of flower elements and correlated them with results of morphological and anatomical investigations. In all studied species the elements of the first whorl lacked the identity of petals (lack of AP3 and PI expression) but also that of leaves (presence of AGL6 expression), and this seems to prove their sepal character. The analysis of additional perianth elements of M. stellata, spirally arranged on the elongated floral axis, revealed overlapping and reduced activity of genes involved in specification of the identity of the perianth (AGL6) but also of generative parts (AG), even though no clear gradient of morphological changes could be observed. In conclusion, Magnolia genus is capable of forming, in some species, a perianth differentiated into a calyx (sepals) and corolla (petals). Spirally arranged, additional perianth elements of M. stellata, despite activity of AG falling basipetally, resemble petals. © 2015 German Botanical Society and The Royal Botanical Society of the Netherlands.

  11. Monograph of Diplachne (Poaceae, Chloridoideae, Cynodonteae).

    Science.gov (United States)

    Snow, Neil; Peterson, Paul M; Romaschenko, Konstantin; Simon, Bryan K

    2018-01-01

    Diplachne P. Beauv. comprises two species with C 4 (NAD-ME) photosynthesis. Diplachne fusca has a nearly pantropical-pantemperate distribution with four subspecies: D. fusca subsp. fusca is Paleotropical with native distributions in Africa, southern Asia and Australia; the widespread Australian endemic D. f. subsp. muelleri; and D. f. subsp. fascicularis and D. f. subsp. uninervia occurring in the New World. Diplachne gigantea is known from a few widely scattered, older collections in east-central and southern Africa, and although Data Deficient clearly is of conservation concern. A discussion of previous taxonomic treatments is provided, including molecular data supporting Diplachne in its newer, restricted sense. Many populations of Diplachne fusca are highly tolerant of saline substrates and most prefer seasonally moist to saturated soils, often in disturbed areas. Some populations of Diplachne fusca in southern Asia combine nitrogen-fixation, high salinity tolerance and palatibilty to livestock, which should be pursued with further research for purposes of soil reclamation. Diplachne fusca subsp. uninervia is the most invasive of the subspecies and is becoming weedy in some non-native areas, including in the Old World. This monograph provides detailed descriptions of all taxa, a key to the species and subspecies, geographic distributions and information on the anatomy of leaves, stems, lemmatal micromorphology and discussions of the chromosome numbers. Lectotypes are designated for: Atropis carinata Grisb.; Diplachne acuminata Nash; Diplachne capensis (Nees) Nees var. concinna Nees; Diplachne capensis (Nees) Nees var. obscura Nees, Diplachne capensis (Nees) Nees var. prolifera subvar. minor Nees, Diplachne halei Nash, Diplachne maritima E.P. Bicknel, Diplachne muelleri Benth., Diplachne reverchonii Vasey, Diplachne tectoneticola Backer, Leptochloa imbricata Thurb., Leptochloa neuroglossa Peter, Leptochloa uninervia var. typica fo. abbreviata Parodi, Triodia

  12. Development of transcriptomic resources for interrogating the biosynthesis of monoterpene indole alkaloids in medicinal plant species.

    Directory of Open Access Journals (Sweden)

    Elsa Góngora-Castillo

    Full Text Available The natural diversity of plant metabolism has long been a source for human medicines. One group of plant-derived compounds, the monoterpene indole alkaloids (MIAs, includes well-documented therapeutic agents used in the treatment of cancer (vinblastine, vincristine, camptothecin, hypertension (reserpine, ajmalicine, malaria (quinine, and as analgesics (7-hydroxymitragynine. Our understanding of the biochemical pathways that synthesize these commercially relevant compounds is incomplete due in part to a lack of molecular, genetic, and genomic resources for the identification of the genes involved in these specialized metabolic pathways. To address these limitations, we generated large-scale transcriptome sequence and expression profiles for three species of Asterids that produce medicinally important MIAs: Camptotheca acuminata, Catharanthus roseus, and Rauvolfia serpentina. Using next generation sequencing technology, we sampled the transcriptomes of these species across a diverse set of developmental tissues, and in the case of C. roseus, in cultured cells and roots following elicitor treatment. Through an iterative assembly process, we generated robust transcriptome assemblies for all three species with a substantial number of the assembled transcripts being full or near-full length. The majority of transcripts had a related sequence in either UniRef100, the Arabidopsis thaliana predicted proteome, or the Pfam protein domain database; however, we also identified transcripts that lacked similarity with entries in either database and thereby lack a known function. Representation of known genes within the MIA biosynthetic pathway was robust. As a diverse set of tissues and treatments were surveyed, expression abundances of transcripts in the three species could be estimated to reveal transcripts associated with development and response to elicitor treatment. Together, these transcriptomes and expression abundance matrices provide a rich resource

  13. Development of Transcriptomic Resources for Interrogating the Biosynthesis of Monoterpene Indole Alkaloids in Medicinal Plant Species

    Science.gov (United States)

    Góngora-Castillo, Elsa; Childs, Kevin L.; Fedewa, Greg; Hamilton, John P.; Liscombe, David K.; Magallanes-Lundback, Maria; Mandadi, Kranthi K.; Nims, Ezekiel; Runguphan, Weerawat; Vaillancourt, Brieanne; Varbanova-Herde, Marina; DellaPenna, Dean; McKnight, Thomas D.; O’Connor, Sarah; Buell, C. Robin

    2012-01-01

    The natural diversity of plant metabolism has long been a source for human medicines. One group of plant-derived compounds, the monoterpene indole alkaloids (MIAs), includes well-documented therapeutic agents used in the treatment of cancer (vinblastine, vincristine, camptothecin), hypertension (reserpine, ajmalicine), malaria (quinine), and as analgesics (7-hydroxymitragynine). Our understanding of the biochemical pathways that synthesize these commercially relevant compounds is incomplete due in part to a lack of molecular, genetic, and genomic resources for the identification of the genes involved in these specialized metabolic pathways. To address these limitations, we generated large-scale transcriptome sequence and expression profiles for three species of Asterids that produce medicinally important MIAs: Camptotheca acuminata, Catharanthus roseus, and Rauvolfia serpentina. Using next generation sequencing technology, we sampled the transcriptomes of these species across a diverse set of developmental tissues, and in the case of C. roseus, in cultured cells and roots following elicitor treatment. Through an iterative assembly process, we generated robust transcriptome assemblies for all three species with a substantial number of the assembled transcripts being full or near-full length. The majority of transcripts had a related sequence in either UniRef100, the Arabidopsis thaliana predicted proteome, or the Pfam protein domain database; however, we also identified transcripts that lacked similarity with entries in either database and thereby lack a known function. Representation of known genes within the MIA biosynthetic pathway was robust. As a diverse set of tissues and treatments were surveyed, expression abundances of transcripts in the three species could be estimated to reveal transcripts associated with development and response to elicitor treatment. Together, these transcriptomes and expression abundance matrices provide a rich resource for

  14. Infection with the oncogenic human papillomavirus type 59 alters protein components of the cornified cell envelope

    International Nuclear Information System (INIS)

    Lehr, Elizabeth; Brown, Darron R.

    2003-01-01

    Infection of the genital tract with human papillomaviruses (HPVs) leads to proliferative and dysplastic epithelial lesions. The mechanisms used by the virus to escape the infected keratinocyte are not well understood. Infection of keratinocytes with HPV does not cause lysis, the mechanism used by many viruses to release newly formed virions. For HPV 11, a type associated with a low risk of neoplastic disease, the cornified cell envelope (CCE) of infected keratinocytes is thin and fragile, and transcription of loricrin, the major CCE protein, is reduced. The effects of high-risk HPV infection on components of the CCE have not been previously reported. HPV 59, an oncogenic genital type related to HPV types 18 and 45 was identified in a condylomata acuminata lesion. An extract of this lesion was used to infect human foreskin fragments, which were grown in athymic mice as xenografts. Continued propagation using extracts of xenografts permitted growth of additional HPV 59-infected xenografts. CCEs purified from HPV 59-infected xenografts displayed subtle morphologic abnormalities compared to those derived from uninfected xenografts. HPV 59-infected xenografts revealed dysplastic-appearing cells with mitotic figures. Detection of loricrin, involucrin, and cytokeratin 10 was reduced in HPV 59-infected epithelium, while small proline-rich protein 3 (SPR3) was increased. Reduction in loricrin was most apparent in regions of epithelium containing abundant HPV 59 DNA. Compared to uninfected epithelium, loricrin transcription was decreased in HPV 59-infected epithelium. We conclude that HPV 59 shares with HPV 11 the ability to alter CCE components and to specifically reduce transcription of the loricrin gene. Because loricrin is the major CCE protein, a reduction in this component could alter the physical properties of the CCE, thus facilitating virion release

  15. Risk of cancer in patients with genital warts: A nationwide, population-based cohort study in Taiwan.

    Directory of Open Access Journals (Sweden)

    Ching-Yi Cho

    Full Text Available Condyloma acuminata currently affects around 1% of sexually active adults, and its incidence is increasing. The coexistence of genital warts (GW and certain cancers and an association between human papillomavirus (HPV and various malignancies have been reported. Therefore, we conducted this large national study to analyze the risk of malignancies among men and women with GW in Taiwan.Between January 2000 and December 2013, approximately 3 million patients were reported to the National Health Insurance Research Database of Taiwan. Of these patients, 21,763 were diagnosed with GW. In the same time period, a total of 213,541 cancer cases were reported to the registry, of which 1002 were recorded among patients with GW. The age-specific incidence rates of GW and standardized incidence ratios (SIRs of malignancies compared to the general population were calculated. Women acquired GW earlier than men, with a mean age at diagnosis of 32.63±12.78 years. The highest incidence rate for both genders peaked at 20-29 years. Of the 1002 patients with GW and malignancies, the SIR was 1.95 (95%CI 1.83-2.07. The most markedly increased risk was found for HPV-related cancers, with a SIR of 9.74 (95%CI 3.70-15.77. Significantly elevated risks were also noted for smoking-related cancers, anogenital cancers, cervix in situ, colon, rectum, lung, kidney, and prostate cancers. Most cancers developed within 10 years after the diagnosis of GW.Patients with GW have an increased risk of HPV-related cancers, especially anogenital malignancies in Taiwan. The elevated risk of other cancers highlights differences in exposure and risk factors among patients with GW compared to the general population. Cancer screening and HPV vaccination programs should be emphasized for at-risk patients.

  16. Accumulation of soluble sugars in peel at high temperature leads to stay-green ripe banana fruit.

    Science.gov (United States)

    Yang, Xiaotang; Pang, Xuequn; Xu, Lanying; Fang, Ruiqiu; Huang, Xuemei; Guan, Peijian; Lu, Wangjin; Zhang, Zhaoqi

    2009-01-01

    Bananas (Musa acuminata, AAA group) fail to develop a yellow peel and stay green when ripening at temperatures >24 degrees C. The identification of the mechanisms leading to the development of stay-green ripe bananas has practical value and is helpful in revealing pathways involved in the regulation of chlorophyll (Chl) degradation. In the present study, the Chl degradation pathway was characterized and the progress of ripening and senescence was assessed in banana peel at 30 degrees C versus 20 degrees C, by monitoring relevant gene expression and ripening and senescence parameters. A marked reduction in the expression levels of the genes for Chl b reductase, SGR (Stay-green protein), and pheophorbide a oxygenase was detected for the fruit ripening at 30 degrees C, when compared with fruit at 20 degrees C, indicating that Chl degradation was repressed at 30 degrees C at various steps along the Chl catabolic pathway. The repressed Chl degradation was not due to delayed ripening and senescence, since the fruit at 30 degrees C displayed faster onset of various ripening and senescence symptoms, suggesting that the stay-green ripe bananas are of similar phenotype to type C stay-green mutants. Faster accumulation of high levels of fructose and glucose in the peel at 30 degrees C prompted investigation of the roles of soluble sugars in Chl degradation. In vitro incubation of detached pieces of banana peel showed that the pieces of peel stayed green when incubated with 150 mM glucose or fructose, but turned completely yellow in the absence of sugars or with 150 mM mannitol, at either 20 degrees C or 30 degrees C. The results suggest that accumulation of sugars in the peel induced by a temperature of 30 degrees C may be a major factor regulating Chl degradation independently of fruit senescence.

  17. A NEGLECTED INDIAN SPECIES OF CYPERUS

    Directory of Open Access Journals (Sweden)

    J. H. KERN

    2015-11-01

    Full Text Available Subgen. Cyperus; sect. Iriae Kunth. — Annuus. Culmi erecti, tenues, triquetri, laeves, 1—7 dm alti, 1—2 mm crassi, inferne paucifoliati. Folia culmo breviora vel aequilonga, plana, flaccida, longe acuminata, in supe- riore parte scabra, 1—5 mm lata. Anthela simplex vel subcomposita, laxa. Bracteae oblique patentes, 2—4 longissimae, foliis consimiles, anthelam valde superantes. Anthelae radii 3—9, e cladoprophyllis tubulosis ore oblique truncatis postice cuspidatis vel bidentatis basi bruneis 0.5—1.5 cm longis emergentes, inaequales, oblique patentes, graciles, compressi, laeves vel apice hispiduli, ad 16 cm longi, longiores nonnunquam apice pauci- ramosi; radioli brevissimi ab ochreolo caudato suffulti. Spicae ovatae vel oblonga-ovatae, laxae vel subdensae, 1—3 cm longae, 8—25(—30 mm latae, 5—20-spiculosae, rhachi flexuosa angulis hispida. Spiculae compressae, rectangule divaricatae vel imae subreflexae, ovatae usque ad oblongo-linea- res, 3—12 mm longae, 2—2.5 mm latae, 4—18-f lorae, basi saepe a seta su- buliformi suffultae. Rhachilla obscure brunea, recta, subexalata, internodiis 0.6—1 mm longis. Glumae membranaceae,1/3—1/2 parte imbricatae, patulae, concavae, fere orbiculatae, (1.75—2mm longae ac latae, sub apice emar- ginato mucronulatae, dorso viridi 7-nerviae, lateribus fulvae purpureo- notatae uninerviae, carina acuta arcuata superne angustissime alata, spinuloso-ciliata. Stamina 2; antherae breves, oblongae, interdum lineares; connectivum in appendicem brevem productum. Stylus fere nullus; stigmata 3, achenio multo breviora. Achenium ambitu obovatum, trique- trum, lateribus concavis, basi late stipitatum, apice mucronatum, atro- bruneum, nitidum, dense puncticulatum, 1.5 mm longum, 0.8—0.9 mm latum.

  18. Clavulina-Membranomyces is the most important lineage within the highly diverse ectomycorrhizal fungal community of Abies religiosa.

    Science.gov (United States)

    Argüelles-Moyao, Andrés; Garibay-Orijel, Roberto; Márquez-Valdelamar, Laura Margarita; Arellano-Torres, Elsa

    2017-01-01

    Abies religiosa is an endemic conifer of Mexico, where its monodominant forests are the winter refuge of the monarch butterfly. Due to climate change, it has been estimated that by 2090, A. religiosa populations will decline by 96.5 %. To achieve success, reforestation programs should consider its ectomycorrhizal (ECM) fungi. We used ITS nrDNA sequences to identify the ECM fungi associated with A. religiosa and, based on its abundance and frequency, determined the diversity and community structure in a pure A. religiosa forest near Mexico City. Using sequence metadata, we inferred the species geographic distribution and host preferences. We conducted phylogenetic analyses of the Clavulinaceae (the most important family). The ECM community held 83 species, among which the richest genera were Inocybe (21 species), Tomentella (10 species), and Russula (8 species). Besides its low species richness, the Clavulina-Membranomyces lineage was the most dominant family. Clavulina cf. cinerea and Membranomyces sp. exhibited the highest relative abundance and relative frequency values. Phylogenetic analyses placed the Clavulinaceae genotypes in three different clades: one within Membranomyces and two within Clavulina. A meta-analysis showed that the majority of the ECM fungi (45.78 %) associated with A. religiosa in Mexico have also been sequenced from North America and are shared by Pinaceae and Fagaceae. In contrast, because they have not been sequenced previously, 32.2 % of the species have a restricted distribution. Here, we highlight the emerging pattern that the Clavulina-Membranomyces lineage is dominant in several ECM communities in the Neotropics, including Aldinia and Dicymbe legume tropical forests in the Guyana Shield, the Alnus acuminata subtropical communities, and the A. religiosa temperate forests in Mexico.

  19. Avances de la fruticultura en México

    Directory of Open Access Journals (Sweden)

    Angel Villegas Monter

    2011-10-01

    Full Text Available Las estadísticas oficiales informaron que en 2008 se cultivaron 264 944 ha con valor de la producción de $ 14 741 millones de pesos, en 20 frutales de clima templado; mientras que, en 35 tropicales y subtropicales fue de 1 822748 ha con valor de $ 43 463 millones de pesos. De los 55 frutales, sólo naranjo (Citrus sinensis, mango (Mangifera indica, Aguacate (Persea americana, limón mexicano (C. aurantifolia, banano (Musa acuminata, lima persa (C. latifolia y manzano (Malus domestica se cultivan más de 50 000 ha, lo que explica porque es limitada la oferta de frutas en las grandes ciudades (Distrito Federal, Monterrey, Guadalajara, Puebla, Veracruz, entre otras. Considerando que el 79,27% de la superficie plantada con frutales tropicales y subtropicales es de temporal, las densidades de plantación son bajas, la propagación de plantas no se hace en viveros certificados (sólo cítricos, los rendimientos son bajos en comparación con otros países productores. Por otra parte, debido a la falta de técnicos capacitados, en los últimos 28 años la demanda de fruta se ha solucionado incrementando la superficie plantada, pero los rendimientos han disminuido. La presencia de nuevas enfermedades; Huanglongbing, Meleira, Sunblotch, plantean nuevos retos y también posibilidades si utilizamos los avances tecnológicos. La fruticultura es una alternativa viable pero deben utilizar altas densidades, árboles de porte bajo, plantas de origen genético conocido y calidad fitosanitaria probada que permitan tener mayores rendimientos y con ello competitividad.

  20. Comparative phylogeography in rainforest trees from Lower Guinea, Africa.

    Directory of Open Access Journals (Sweden)

    Myriam Heuertz

    Full Text Available Comparative phylogeography is an effective approach to assess the evolutionary history of biological communities. We used comparative phylogeography in fourteen tree taxa from Lower Guinea (Atlantic Equatorial Africa to test for congruence with two simple evolutionary scenarios based on physio-climatic features 1 the W-E environmental gradient and 2 the N-S seasonal inversion, which determine climatic and seasonality differences in the region. We sequenced the trnC-ycf6 plastid DNA region using a dual sampling strategy: fourteen taxa with small sample sizes (dataset 1, mean n = 16/taxon, to assess whether a strong general pattern of allele endemism and genetic differentiation emerged; and four taxonomically well-studied species with larger sample sizes (dataset 2, mean n = 109/species to detect the presence of particular shared phylogeographic patterns. When grouping the samples into two alternative sets of two populations, W and E, vs. N and S, neither dataset exhibited a strong pattern of allelic endemism, suggesting that none of the considered regions consistently harboured older populations. Differentiation in dataset 1 was similarly strong between W and E as between N and S, with 3-5 significant F ST tests out of 14 tests in each scenario. Coalescent simulations indicated that, given the power of the data, this result probably reflects idiosyncratic histories of the taxa, or a weak common differentiation pattern (possibly with population substructure undetectable across taxa in dataset 1. Dataset 2 identified a common genetic break separating the northern and southern populations of Greenwayodendron suaveolens subsp. suaveolens var. suaveolens, Milicia excelsa, Symphonia globulifera and Trichoscypha acuminata in Lower Guinea, in agreement with differentiation across the N-S seasonal inversion. Our work suggests that currently recognized tree taxa or suspected species complexes can contain strongly differentiated genetic lineages

  1. Floral morphology and morphogenesis in Camptotheca (Nyssaceae), and its systematic significance.

    Science.gov (United States)

    Gong, Jing-Zhi; Li, Qiu-Jie; Wang, Xi; Ma, Yue-Ping; Zhang, Xiao-Hui; Zhao, Liang; Chang, Zhao-Yang; Ronse De Craene, Louis

    2018-03-22

    Camptotheca is endemic to China and there are limited data about the breeding system and morphogenesis of the flowers. Camptotheca is thought to be related to Nyssa and Davidia in Nyssaceae, which has sometimes been included in Cornaceae. However, molecular phylogenetic studies confirmed the inclusion of Camptotheca in Nyssaceae and its exclusion from Cornaceae. The aim of this study was to reveal developmental features of the inflorescence and flowers in Camptotheca to compare with related taxa in Cornales. Inflorescences and flowers of Camptotheca acuminata at all developmental stages were collected and studied with a scanning electron microscope and stereo microscope. Camptotheca has botryoids which are composed of several capitate floral units (FUs) that are initiated acropetally. On each FU, flowers are grouped in dyads that are initiated acropetally. All floral organs are initiated centripetally. Calyx lobes are restricted to five teeth. The hypanthium, with five toothed calyx lobes, is adnate to the ovary. The five petals are free and valvate. Ten stamens are inserted in two whorls around the central depression, in which the style is immersed. Three carpels are initiated independently but the ovary is syncarpous and unilocular. The ovule is unitegmic and heterotropous. Inflorescences are functionally andromonoecious varying with the position of the FUs on the inflorescence system. Flowers on the upper FU often have robust styles and fully developed ovules. Flowers on the lower FU have undeveloped styles and aborted ovules, and the flowers on the middle FU are transitional. Camptotheca possesses several traits that unify it with Nyssa, Mastixia and Diplopanax. Inflorescence and floral characters support a close relationship with Nyssaceae and Mastixiaceae but a distant relationship with Cornus. Our results corroborate molecular inferences and support a separate family Nyssaceae.

  2. Biochemical Constituents and Nutritive Evaluation of Some Less Known Wild Edible Plants from Senapati District, Manipur, India

    Directory of Open Access Journals (Sweden)

    Sanjita Chanu KONSAM

    2016-09-01

    Full Text Available Ten lesser known wild edible plants (WEPs from Senapati District, Manipur, were analyzed for their proximate composition and mineral content. The study revealed that different WEPs have crude fat content that ranged between 0.41 - 21.5%, total sugar was found to be between 2.00 - 59.00%, total soluble protein between 1.40 - 8.0% and total amino acids between 1.50 - 5.25 mg/100 g respectively, whereas the highest and the lowest crude protein contents were recorded in H. macrocarpa (27.56% and S. suaveolens (4.37% respectively. Among the micronutrients, the highest amounts of Fe, Mn, Zn, Cu and Co were recorded in C. hirsuta (155.50 mg/100 g, E. acuminata (105.50 mg/100 g, S. suaveolens (76.50 mg/100 g in Zn and 24.0 mg/100 g in Cu and R. ellipticum (3.0 mg/100 g, while the lowest amounts were recorded in E. phaseoloides (61.50 mg/100 g, O. indicum (1 mg/100 g, E. acuminate (17.50 mg/100 g and C. montana (0.5 mg/100 g respectively. Higher amounts of Ca and Mg were observed in all the plants studied, ranging from 458 to 765 mg/100 g in Ca and 148.50 to 995.0 mg/100 g in Mg. E. lineolatum indicated the highest amount of Ca by containing 765.0 mg/100 g, while A. ciliata recorded the highest value of Mg by containing 995.0 mg/100 g. The nutritive values of the ten WEPs were found to be comparable or even higher than the conventional vegetables, with respect to proteins and minerals, especially for Ca, Mg, Fe, Mn and Zn respectively.

  3. Medicinal Plants: A Public Resource for Metabolomics and Hypothesis Development

    Directory of Open Access Journals (Sweden)

    Eve Syrkin Wurtele

    2012-11-01

    Full Text Available Specialized compounds from photosynthetic organisms serve as rich resources for drug development. From aspirin to atropine, plant-derived natural products have had a profound impact on human health. Technological advances provide new opportunities to access these natural products in a metabolic context. Here, we describe a database and platform for storing, visualizing and statistically analyzing metabolomics data from fourteen medicinal plant species. The metabolomes and associated transcriptomes (RNAseq for each plant species, gathered from up to twenty tissue/organ samples that have experienced varied growth conditions and developmental histories, were analyzed in parallel. Three case studies illustrate different ways that the data can be integrally used to generate testable hypotheses concerning the biochemistry, phylogeny and natural product diversity of medicinal plants. Deep metabolomics analysis of Camptotheca acuminata exemplifies how such data can be used to inform metabolic understanding of natural product chemical diversity and begin to formulate hypotheses about their biogenesis. Metabolomics data from Prunella vulgaris, a species that contains a wide range of antioxidant, antiviral, tumoricidal and anti-inflammatory constituents, provide a case study of obtaining biosystematic and developmental fingerprint information from metabolite accumulation data in a little studied species. Digitalis purpurea, well known as a source of cardiac glycosides, is used to illustrate how integrating metabolomics and transcriptomics data can lead to identification of candidate genes encoding biosynthetic enzymes in the cardiac glycoside pathway. Medicinal Plant Metabolomics Resource (MPM [1] provides a framework for generating experimentally testable hypotheses about the metabolic networks that lead to the generation of specialized compounds, identifying genes that control their biosynthesis and establishing a basis for modeling metabolism in less

  4. Characteristics of Three Thioredoxin Genes and Their Role in Chilling Tolerance of Harvested Banana Fruit.

    Science.gov (United States)

    Wu, Fuwang; Li, Qing; Yan, Huiling; Zhang, Dandan; Jiang, Guoxiang; Jiang, Yueming; Duan, Xuewu

    2016-09-09

    Thioredoxins (Trxs) are small proteins with a conserved redox active site WCGPC and are involved in a wide range of cellular redox processes. However, little information on the role of Trx in regulating low-temperature stress of harvested fruit is available. In this study, three full-length Trx cDNAs, designated MaTrx6, MaTrx9 and MaTrx12, were cloned from banana (Musa acuminata) fruit. Phylogenetic analysis and protein sequence alignments showed that MaTrx6 was grouped to h2 type with a typical active site of WCGPC, whereas MaTrx9 and MaTrx12 were assigned to atypical cys his-rich Trxs (ACHT) and h3 type with atypical active sites of GCAGC and WCSPC, respectively. Subcellular localization indicated that MaTrx6 and MaTrx12 were located in the plasma membrane and cytoplasm, respectively, whereas MaTrx9 showed a dual cytoplasmic and chloroplast localization. Application of ethylene induced chilling tolerance of harvested banana fruit, whereas 1-MCP, an inhibitor of ethylene perception, aggravated the development of chilling injury. RT-qPCR analysis showed that expression of MaTrx12 was up-regulated and down-regulated in ethylene- and 1-MCP-treated banana fruit at low temperature, respectively. Furthermore, heterologous expression of MaTrx12 in cytoplasmic Trx-deficient Saccharomyces cerevisiae strain increased the viability of the strain under H₂O₂. These results suggest that MaTrx12 plays an important role in the chilling tolerance of harvested banana fruit, possibly by regulating redox homeostasis.

  5. Otorhinolaryngology manifestations secondary to oral sex.

    Science.gov (United States)

    Fernández-López, Claudia; Morales-Angulo, Carmelo

    Over the last few years, oral and pharyngeal signs and symptoms due to oral sex have increased significantly. However, no review articles related to this subject have been found in the medical literature. The objective of our study was to identify otorhinolaryngological manifestations associated with orogenital/oroanal contact, both in adults and children, in the context of consensual sex or sexual abuse. We performed a review of the medical literature on otorhinolaryngological pathology associated with oral sex published in the last 20 years in the PubMed database. Otorhinolaryngological manifestations secondary to oral sex practice in adults can be infectious, tumoral or secondary to trauma. The more common signs and symptoms found in the literature were human papillomavirus infection (above all, condyloma acuminata and papilloma/condyloma), oral or pharyngeal syphilis, gonococcal pharyngitis, herpes simplex virus infection and pharyngitis from Chlamydia trachomatis. The incidence of human papillomavirus -induced oropharyngeal carcinoma has dramatically increased. In children past the neonatal period, the presence of condyloma acuminatus, syphilis, gonorrhoea or palatal ecchymosis (the last one, unless justified by other causes) should make us suspect sexual abuse. Sexual habits have changed in the last decades, resulting in the appearance of otorhinolaryngological pathology that was rarely seen previously. For this reason, it is important for primary care physicians to have knowledge about the subject to perform correct diagnosis and posterior treatment. Some sexual abuse cases in children may also be suspected based on the knowledge of the characteristic oropharyngeal manifestations secondary to them. Copyright © 2016 Elsevier España, S.L.U. and Sociedad Española de Otorrinolaringología y Cirugía de Cabeza y Cuello. All rights reserved.

  6. Potential of Tropical Fruit Waste Biomass for Production of Bio-Briquette Fuel: Using Indonesia as an Example

    Directory of Open Access Journals (Sweden)

    Anna Brunerová

    2017-12-01

    Full Text Available Within developing countries, there is an appeal to use waste biomass for energy generation in the form of bio-briquettes. This study investigated the potential use of bio-briquettes that are produced from the waste biomass of the following tropical fruits: durian (Durio zibethinus, coconut (Cocos nucifera, coffee (Coffea arabica, cacao (Theobroma cacao, banana (Musa acuminata and rambutan (Nephelium lappaceum. All fruit waste biomass samples exhibited an extremely high level of initial moisture content (78.22% in average. Fruit samples with the highest proportion of fruit waste biomass (of total unprocessed fruit mass were represented by cacao (83.82%, durian (62.56% and coconut (56.83%. Highest energy potentials (calorific value of fruit waste biomass were observed in case of coconut (18.22 MJ∙kg−1, banana (17.79 MJ∙kg−1 and durian (17.60 MJ∙kg−1 fruit samples, whereas fruit waste biomass with the lowest level of ash content originated from the rambutan (3.67%, coconut (4.52%, and durian (5.05% fruit samples. When investigating the energy demands to produce bio-briquettes from such feedstock materials, the best results (lowest amount of required deformation energy in combination with highest level of bio-briquette bulk density were achieved by the rambutan, durian and banana fruit waste biomass samples. Finally, all investigated bio-briquette samples presented satisfactory levels of bulk density (>1050 kg∙m−3. In conclusion, our results indicated the practicability and viability of such bio-briquette fuel production, as well as supporting the fact that bio-briquettes from tropical fruit waste biomass can offer a potentially attractive energy source with many benefits, especially in rural areas.

  7. Effects of tropical montane forest disturbance on epiphytic macrolichens

    Energy Technology Data Exchange (ETDEWEB)

    Benitez, Angel [Instituto de Ecologia, Herbario HUTPL, Universidad Tecnica Particular de Loja, San Cayetano s/n, Loja (Ecuador); Prieto, Maria, E-mail: maria.prieto@urjc.es [Area de Biodiversidad y Conservacion, ESCET, Universidad Rey Juan Carlos, Mostoles, E-28933, Madrid (Spain); Gonzalez, Yadira [Instituto de Ecologia, Herbario HUTPL, Universidad Tecnica Particular de Loja, San Cayetano s/n, Loja (Ecuador); Aragon, Gregorio [Area de Biodiversidad y Conservacion, ESCET, Universidad Rey Juan Carlos, Mostoles, E-28933, Madrid (Spain)

    2012-12-15

    The high diversity of epiphytes typical of undisturbed montane tropical forests has been negatively affected by continuous deforestation and forest conversion to secondary vegetation. Macrolichens are an important component of these epiphytes. Because their physiology is strongly coupled to humidity and solar radiation, we hypothesized that microclimatic changes derived from forest clearing and logging can affect the diversity of these poikilohydric organisms. In southern Ecuador, we examined three types of forests according to a disturbance gradient (primary forests, secondary forests, and monospecific forests of Alnus acuminata) for the presence/absence and coverage of epiphytic macrolichens that we identified on 240 trees. We found that total richness tended to decrease when the range of the disturbance increased. The impoverishment was particularly drastic for 'shade-adapted lichens', while the richness of 'heliophytic lichens' increased in the drier conditions of secondary growth. Epiphytic composition also differed significantly among the three types of forests, and the similarity decreased when the range of the disturbance was greater. We concluded that a span of 40 years of recovery by secondary vegetation was not enough to regenerate the diversity of epiphytic macrolichens that was lost due to forest disturbances. -- Highlights: Black-Right-Pointing-Pointer Tropical montane forest disturbance drastically reduced macrolichen diversity. Black-Right-Pointing-Pointer Species loss was most severe for the 'shade-adapted lichens' because high radiation is harmful to them. Black-Right-Pointing-Pointer In secondary forests lichen diversity of native forests was not regenerated. Black-Right-Pointing-Pointer The protection of remnants of primary tropical forest might help to preserve a diverse community of epiphytic macrolichens.

  8. Effects of tropical montane forest disturbance on epiphytic macrolichens

    International Nuclear Information System (INIS)

    Benítez, Ángel; Prieto, María; González, Yadira; Aragón, Gregorio

    2012-01-01

    The high diversity of epiphytes typical of undisturbed montane tropical forests has been negatively affected by continuous deforestation and forest conversion to secondary vegetation. Macrolichens are an important component of these epiphytes. Because their physiology is strongly coupled to humidity and solar radiation, we hypothesized that microclimatic changes derived from forest clearing and logging can affect the diversity of these poikilohydric organisms. In southern Ecuador, we examined three types of forests according to a disturbance gradient (primary forests, secondary forests, and monospecific forests of Alnus acuminata) for the presence/absence and coverage of epiphytic macrolichens that we identified on 240 trees. We found that total richness tended to decrease when the range of the disturbance increased. The impoverishment was particularly drastic for “shade-adapted lichens”, while the richness of “heliophytic lichens” increased in the drier conditions of secondary growth. Epiphytic composition also differed significantly among the three types of forests, and the similarity decreased when the range of the disturbance was greater. We concluded that a span of 40 years of recovery by secondary vegetation was not enough to regenerate the diversity of epiphytic macrolichens that was lost due to forest disturbances. -- Highlights: ► Tropical montane forest disturbance drastically reduced macrolichen diversity. ► Species loss was most severe for the “shade-adapted lichens” because high radiation is harmful to them. ► In secondary forests lichen diversity of native forests was not regenerated. ► The protection of remnants of primary tropical forest might help to preserve a diverse community of epiphytic macrolichens.

  9. DArT whole genome profiling provides insights on the evolution and taxonomy of edible Banana (Musa spp.).

    Science.gov (United States)

    Sardos, J; Perrier, X; Doležel, J; Hřibová, E; Christelová, P; Van den Houwe, I; Kilian, A; Roux, N

    2016-12-01

    Dessert and cooking bananas are vegetatively propagated crops of great importance for both the subsistence and the livelihood of people in developing countries. A wide diversity of diploid and triploid cultivars including AA, AB, AS, AT, AAA, AAB, ABB, AAS and AAT genomic constitutions exists. Within each of this genome groups, cultivars are classified into subgroups that are reported to correspond to varieties clonally derived from each other after a single sexual event. The number of those founding events at the basis of the diversity of bananas is a matter of debate. We analysed a large panel of 575 accessions, 94 wild relatives and 481 cultivated accessions belonging to the section Musa with a set of 498 DArT markers previously developed. DArT appeared successful and accurate to describe Musa diversity and help in the resolution of cultivated banana genome constitution and taxonomy, and highlighted discrepancies in the acknowledged classification of some accessions. This study also argues for at least two centres of domestication corresponding to South-East Asia and New Guinea, respectively. Banana domestication in New Guinea probably followed different schemes that those previously reported where hybridization underpins the emergence of edible banana. In addition, our results suggest that not all wild ancestors of bananas are known, especially in M. acuminata subspecies. We also estimate the extent of the two consecutive bottlenecks in edible bananas by evaluating the number of sexual founding events underlying our sets of edible diploids and triploids, respectively. The attribution of clone identity to each sample of the sets allowed the detection of subgroups represented by several sets of clones. Although morphological characterization of some of the accessions is needed to correct potentially erroneous classifications, some of the subgroups seem polyclonal. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany Company.

  10. A High-Throughput Molecular Pipeline Reveals the Diversity in Prevalence and Abundance of Pratylenchus and Meloidogyne Species in Coffee Plantations.

    Science.gov (United States)

    Bell, Christopher A; Atkinson, Howard J; Andrade, Alan C; Nguyen, Hoa X; Swibawa, I Gede; Lilley, Catherine J; McCarthy, James; Urwin, P E

    2018-05-01

    Coffee yields are adversely affected by plant-parasitic nematodes and the pathogens are largely underreported because a simple and reliable identification method is not available. We describe a polymerase chain reaction-based approach to rapidly detect and quantify the major Pratylenchus and Meloidogyne nematode species that are capable of parasitizing coffee. The procedure was applied to soil samples obtained from a number of coffee farms in Brazil, Vietnam, and Indonesia to assess the prevalence of these species associated both with coffee (Coffea arabica and C. canephora) and its intercropped species Musa acuminata (banana) and Piper nigrum (black pepper). Pratylenchus coffeae and P. brachyurus were associated with coffee in all three countries but there were distinct profiles of Meloidogyne spp. Meloidogyne incognita, M. exigua, and M. paranaensis were identified in samples from Brazil and M. incognita and M. hapla were detected around the roots of coffee in Vietnam. No Meloidogyne spp. were detected in samples from Indonesia. There was a high abundance of Meloidogyne spp. in soil samples in which Pratylenchus spp. were low or not detected, suggesting that the success of one genus may deter another. Meloidogyne spp. in Vietnam and Pratylenchus spp. in Indonesia were more numerous around intercropped plants than in association with coffee. The data suggest a widespread but differential nematode problem associated with coffee production across the regions studied. The issue is compounded by the current choice of intercrops that support large nematode populations. Wider application of the approach would elucidate the true global scale of the nematode problem and the cost to coffee production. [Formula: see text] Copyright © 2018 The Author(s). This is an open access article distributed under the CC BY 4.0 International license .

  11. Investigation of fluids as filling of a biomimetic infrared sensor based on the infrared receptors of pyrophilous insects

    Science.gov (United States)

    Kahl, T.; Li, N.; Schmitz, H.; Bousack, H.

    2012-04-01

    The beetle Melanophila acuminata is highly dependent on forest fires. The burned wood serves as food for the larvae and the adults copulate on the burned areas to put their eggs in the freshly burned trees. To be able to detect forest fires from great distances the beetle developed a highly sensitive infrared receptor which works according to a photomechanical principle. The beetle has two pit organs, one on each lateral side, of which each houses around 70 dome shaped infrared receptors. These IR-receptors consist of a hard outer cuticular shell and an inner microfluidic core. When IR-radiation is absorbed, the pressure in the core increases due to the thermal expansion. This results in a deflection of a dendritic tip of a mechanosensitiv neuron which generates the signal. This biological principle was transferred into a new kind of un-cooled technical infrared receptor. To demonstrate the functional principle and the feasibility of this IR-sensor a macroscopic demonstrator sensor was build. It consisted of an inner fluid filled cavity (pressure chamber), an IR-transmissive window and a membrane. The deflection of the membrane due to the absorbed IR-energy was measured by a sensitive commercial capacitive sensor. In the experiments ethanol with added black ink, a mix of ethanol and glucose with additional absorber, air with additional absorber and water were used as fillings of the cavity and compared against each other. In order to get insights into the physics of the results of the experiments accompanying simulations using FEM methods and analytical calculations have been performed. The results showed that ethanol and air as fillings of the cavity caused the largest deflection of the membrane. Furthermore it turned out that the thermal expansion of the sensor housing material has an important influence. The comparison of the measured deflection with calculated deflections showed a good concordance.

  12. Canopy and leaf composition drive patterns of nutrient release from pruning residues in a coffee agroforest.

    Science.gov (United States)

    Tully, Katherine L; Lawrence, Deborah

    2012-06-01

    In a coffee agroforest, the crop is cultivated under the shade of fruit-bearing and nitrogen (N)-fixing trees. These trees are periodically pruned to promote flowering and fruiting as well as to make nutrients stored in tree biomass available to plants. We investigated the effect of canopy composition and substrate quality on decomposition rates and patterns of nutrient release from pruning residues in a coffee agroforest located in Costa Rica's Central Valley. Initial phosphorus (P) release was enhanced under a canopy composed solely of N-fixing, Erythrina poeppigiana compared to a mixed canopy of Erythrina and Musa acuminata (banana). Both initial and final N release were similar under the two canopy types. However, after five months of decomposition, a higher proportion of initial N had been released under the single canopy. Although patterns of decomposition and nutrient release were not predicted by initial substrate quality, mass loss in leaf mixtures rates were well predicted by mean mass loss of their component species. This study identifies specific pruning regimes that may regulate N and P release during crucial growth periods, and it suggests that strategic pruning can enhance nutrient availability. For example, during the onset of rapid fruit growth, a two-species mixture may release more P than a three-species mixture. However, by the time of the harvest, the two- and three-species mixtures have released roughly the same amount of N and P. These nutrients do not always follow the same pattern, as N release can be maximized in single-species substrates, while P release is often facilitated in species mixtures. Our study indicates the importance of management practices in mediating patterns of nutrient release. Future research should investigate how canopy composition and farm management can also mediate on-farm nutrient losses.

  13. Differential transcriptional regulation of banana sucrose phosphate synthase gene in response to ethylene, auxin, wounding, low temperature and different photoperiods during fruit ripening and functional analysis of banana SPS gene promoter.

    Science.gov (United States)

    Roy Choudhury, Swarup; Roy, Sujit; Das, Ranjan; Sengupta, Dibyendu N

    2008-12-01

    Sucrose phosphate synthase (SPS) (EC 2.3.1.14) is the key regulatory component in sucrose formation in banana (Musa acuminata subgroup Cavendish, cv Giant governor) fruit during ripening. This report illustrates differential transcriptional responses of banana SPS gene following ethylene, auxin, wounding, low temperature and different photoperiods during ripening in banana fruit. Whereas ethylene strongly stimulated SPS transcript accumulation, auxin and cold treatment only marginally increased the abundance of SPS mRNA level, while wounding negatively regulated SPS gene expression. Conversely, SPS transcript level was distinctly increased by constant exposure to white light. Protein level, enzymatic activity of SPS and sucrose synthesis were substantially increased by ethylene and increased exposure to white light conditions as compared to other treatments. To further study the transcriptional regulation of SPS in banana fruit, the promoter region of SPS gene was cloned and some cis-acting regulatory elements such as a reverse GCC-box ERE, two ARE motifs (TGTCTC), one LTRE (CCGAA), a GAGA-box (GAGA...) and a GATA-box LRE (GATAAG) were identified along with the TATA and CAAT-box. DNA-protein interaction studies using these cis-elements indicated a highly specific cis-trans interaction in the banana nuclear extract. Furthermore, we specifically studied the light responsive characteristics of GATA-box containing synthetic as well as native banana SPS promoter. Transient expression assays using banana SPS promoter have also indicated the functional importance of the SPS promoter in regulating gene expression. Together, these results provide insights into the transcriptional regulation of banana SPS gene in response to phytohormones and other environmental factors during fruit ripening.

  14. Trace metals in vegetables and fruits cultivated around the surroundings of Tummalapalle uranium mining site, Andhra Pradesh, India

    Directory of Open Access Journals (Sweden)

    Allabaksh Murad Basha

    2014-01-01

    Full Text Available Vegetables (Tomato – Solanum lycopersicum, green chilli – Capsicum annum and bitter gourd – Momordica charantia and fruits (Banana – Musa acuminata colla, papaya – Carica papaya and mosambi – Citrus limetta from the cultivated areas around the Tummalapalle uranium mining site were analyzed for trace metals (Al, Cr, Mn, Fe, Ni, Cu, Zn, Pb, Be, V, Co, Cd and U using inductively coupled plasma-mass spectrometer (ICP-MS. As per the estimated data, the concentrations of trace metals in vegetables and fruits are found in the range of 47.5–7.8 mg/kg for Al, 9.7–1.0 mg/kg for Cr, 3.8–1.0 mg/kg for Mn, 75.5–13.9 mg/kg for Fe, 1.4–0.2 mg/kg for Ni, 2.3–0.8 mg/kg for Cu, 9.2–3.1 mg/kg for Zn, 0.2–1.4 mg/kg for Pb, 19.2–1.9 μg/kg for Be, 96.1–15.8 μg/kg for V, 48.2–12.9 μg/kg for Co, 46.5–2.3 μg/kg for Cd and 16.4–2.7 μg/kg for U. The trace metals observed are compared to the literature reported values. Trace elemental data were subjected to statistical analysis to examine the interrelationship between the investigated trace elements and possible source identification of the trace metal contamination in vegetable and fruits. Daily intake of trace metals through ingestion of vegetables and fruits are also calculated.

  15. Effects of liming and development of Curimbatá (Prochilodus lineatus larvae on the abundance of zooplankton in fish ponds Efeitos da calagem e desenvolvimento do Curimbatá (Prochilodus lineatus na abundância do zooplâncton em viveiros de piscicultura

    Directory of Open Access Journals (Sweden)

    Thécia Alfenas Silva Valente Paes

    2011-12-01

    Full Text Available AIM: We aimed to evaluate the influence of the correction of the water alkalinity in the fish ponds on the density of zooplankton under a period they were stocked with larvae of Prochilodus lineatus, a neotropical fish called "Curimbatá". METHODS: We used a factorial design completely randomized. In one plot (2 ponds there was no correction of the alkalinity of the water (20 mg CaCO3.L-1 and in two others, this variable was adjusted weekly to values around 30 and 60 mg CaCO3.L-1 ¹, with two replicates each. Zooplankton was sampled weekly and the experiment lasted 63 days. RESULTS: Significant differences in the density of the zooplankton over time (F = 6.78, p OBJETIVO: Nosso objetivo foi avaliar a influencia da correção da alcalinidade da água em viveiros de piscicultura na densidade do zooplâncton em período em que foram estocados com larvas de Prochilodus lineatus, um peixe neotropical denominado "Curimbatá". MÉTODOS: Foi utilizado um delineamento experimental fatorial, inteiramente causualizado. Em um tratamento (2 viveiros, não houve correção da alcalinidade da água, e em outros dois viveiros, a alcalinidade foi ajustada semanalmente para valores em torno de 30 e 60 mg CaCO3.L-1, com duas réplicas cada. Os organismos zooplanctônicos foram coletados semanalmente durante 63 dias. RESULTADOS: Diferenças significativas foram observadas na densidade do zooplâncton ao longo do tempo (F = 6,78, p < 0,05 e um decréscimo acentuado na densidade do zooplâncton foi observado da primeira para a segunda semana, e pequenos aumentos sucessivos na densidade da quarta semana até o final do experimento. Ao considerar todo o período experimental, a alcalinidade corrigida para 60 mg CaCO3.L-1 resultou em maiores densidades de zooplâncton. Ocorreram grandes mudanças na composição zooplanctônica. Rotifera foram dominantes no início do experimento e Cladocera e Copepoda nas últimas semanas, possivelmente devido a uma interação da

  16. New Biogeographic insight into Bauhinia s.l. (Leguminosae): integration from fossil records and molecular analyses.

    Science.gov (United States)

    Meng, Hong-Hu; Jacques, Frédéric Mb; Su, Tao; Huang, Yong-Jiang; Zhang, Shi-Tao; Ma, Hong-Jie; Zhou, Zhe-Kun

    2014-08-10

    Given that most species that have ever existed on earth are extinct, it stands to reason that the evolutionary history can be better understood with fossil taxa. Bauhinia is a typical genus of pantropical intercontinental disjunction among the Asian, African, and American continents. Geographic distribution patterns are better recognized when fossil records and molecular sequences are combined in the analyses. Here, we describe a new macrofossil species of Bauhinia from the Upper Miocene Xiaolongtan Formation in Wenshan County, Southeast Yunnan, China, and elucidate the biogeographic significance through the analyses of molecules and fossils. Morphometric analysis demonstrates that the leaf shapes of B. acuminata, B. championii, B. chalcophylla, B. purpurea, and B. podopetala closely resemble the leaf shapes of the new finding fossil. Phylogenetic relationships among the Bauhinia species were reconstructed using maximum parsimony and Bayesian inference, which inferred that species in Bauhinia species are well-resolved into three main groups. Divergence times were estimated by the Bayesian Markov chain Monte Carlo (MCMC) method under a relaxed clock, and inferred that the stem diversification time of Bauhinia was ca. 62.7 Ma. The Asian lineage first diverged at ca. 59.8 Ma, followed by divergence of the Africa lineage starting during the late Eocene, whereas that of the neotropical lineage starting during the middle Miocene. Hypotheses relying on vicariance or continental history to explain pantropical disjunct distributions are dismissed because they require mostly Palaeogene and older tectonic events. We suggest that Bauhinia originated in the middle Paleocene in Laurasia, probably in Asia, implying a possible Tethys Seaway origin or an "Out of Tropical Asia", and dispersal of legumes. Its present pantropical disjunction resulted from disruption of the boreotropical flora by climatic cooling after the Paleocene-Eocene Thermal Maximum (PETM). North Atlantic land

  17. From crossbreeding to biotechnology-facilitated improvement of banana and plantain.

    Science.gov (United States)

    Ortiz, Rodomiro; Swennen, Rony

    2014-01-01

    The annual harvest of banana and plantain (Musa spp.) is approximately 145 million tons worldwide. About 85% of this global production comes from small plots and kitchen or backyard gardens from the developing world, and only 15% goes to the export trade. Musa acuminata and Musa balbisiana are the ancestors of several hundreds of parthenocarpic Musa diploid and polyploid cultivars, which show multiple origins through inter- and intra-specific hybridizations from these two wild diploid species. Generating hybrids combining host plant resistance to pathogens and pests, short growth cycles and height, high fruit yield, parthenocarpy, and desired quality from the cultivars remains a challenge for Musa crossbreeding, which started about one century ago in Trinidad. The success of Musa crossbreeding depends on the production of true hybrid seeds in a crop known for its high levels of female sterility, particularly among polyploid cultivars. All banana export cultivars grown today are, however, selections from somatic mutants of the group Cavendish and have a very narrow genetic base, while smallholders in sub-Saharan Africa, tropical Asia and Latin America use some bred-hybrids (mostly cooking types). Musa improvement goals need to shift to address emerging threats because of the changing climate. Innovative cell and molecular biology tools have the potential to enhance the pace and efficiency of genetic improvement in Musa. Micro-propagation has been successful for high throughput of clean planting materials while in vitro seed germination assists in obtaining seedlings after inter-specific and across ploidy hybridization. Flow cytometry protocols are used for checking ploidy among genebank accessions and breeding materials. DNA markers, the genetic maps based on them, and the recent sequencing of the banana genome offer means for gaining more insights in the genetics of the crops and to identifying genes that could lead to accelerating Musa betterment. Likewise, DNA

  18. The inhibitory effect of CIL-102 on the growth of human astrocytoma cells is mediated by the generation of reactive oxygen species and induction of ERK1/2 MAPK

    Energy Technology Data Exchange (ETDEWEB)

    Teng, Chih-Chuan [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Institute of Basic Medicine Science, National Cheng Kung University, Tainan, Taiwan (China); Kuo, Hsing-Chun [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Cheng, Ho-Chen [Department of General Education, Chang Gung University of Science and Technology, CGUST, Taiwan (China); Wang, Ting-Chung [Department of Neurosurgery, Chang Gung Memorial Hospital, Chia-Yi Center, Chiayi, Taiwan (China); Graduate Institute of Clinical Medical Sciences, Chang Gung University, Gueishan, Taiwan (China); Sze, Chun-I, E-mail: szec@mail.ncku.edu.tw [Institute of Basic Medicine Science, Department of Cell Biology and Anatomy and Pathology, National Cheng Kung University, Tainan, Taiwan (China)

    2012-08-15

    CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone) is the major active agent of the alkaloid derivative of Camptotheca acuminata, with multiple pharmacological activities, including anticancer effects and promotion of apoptosis. The mechanism by which CIL-102 inhibits growth remains poorly understood in human astrocytoma cells. Herein, we investigated the molecular mechanisms by which CIL-102 affects the generation of reactive oxygen species (ROS) and cell cycle G2/M arrest in glioma cells. Treatment of U87 cells with 1.0 μM CIL-102 resulted in phosphorylation of extracellular signal-related kinase (ERK1/2), downregulation of cell cycle-related proteins (cyclin A, cyclin B, cyclin D1, and cdk1), and phosphorylation of cdk1Tyr{sup 15} and Cdc25cSer{sup 216}. Furthermore, treatment with the ERK1/2 inhibitor PD98059 abolished CIL-102-induced Cdc25cSer{sup 216} expression and reversed CIL-102-inhibited cdk1 activation. In addition, N-acetyl cysteine (NAC), an ROS scavenger, blocked cell cycle G2/M arrest and phosphorylation of ERK1/2 and Cdc25cSer{sup 216} in U87 cells. CIL-102-mediated ERK1/2 and ROS production, and cell cycle arrest were blocked by treatment with specific inhibitors. In conclusion, we have identified a novel CIL-102-inhibited proliferation in U87 cells by activating the ERK1/2 and Cdc25cSer{sup 216} cell cycle-related proteins and inducing ROS production; this might be a new mechanism in human astrocytoma cells. -- Highlights: ► We show the effects of CIL-102 on the G2/M arrest of human astrocytoma cells. ► ROS and the Ras/ERK1/2 triggering pathways are involved in the CIL-102 treatment. ► CIL-102 induces sustained activation of ERK1/2 and Cdc25c and ROS are required.

  19. MISCELLANEOUS BOTANICAL NOTES 2

    Directory of Open Access Journals (Sweden)

    A.J.G.H KOSTERMANS

    2014-01-01

    Full Text Available 1.   Durio  cupreus Ridley is considered to  represent a  distinct  species.2.   Durio wyatt-smithii Kosterm. is reported from Borneo.3.   Machilus nervosa Merr. represents Meliosma bontoeensis Merr.4.   Beilschmiedia brassii Allen represents Vavaea brassii (Allen Kosterm.5.   The author of the generic name Heritiera is Aiton.6.   Heritiera macrophylla (non Wall. Merr. is conspecific with H. ungus-tata Pierre.7.   Some specimens from N. Celebes, attributed formerly to H. sylvatica Merr., belong to H. arafurensis Kosterm.8.   Additional note on Heritiera littoralis Ait. and H. macrophylla Wall, ex Kurz.9.   Heritiera   montana   Kosterm.,   nov.   spec,   from   New   Guinea   and H. khidii Kosterm., nov. spec, from Northern Siam.10.   Additional note on Heritiera, novoguineensis Kosterm. and H. pereo-riacea Kosterm. and an undescribed species.11.   Heritiera acuminata Wall, ex Kurz represents a distinct species.12.   Heritiera  solomonensis  Kosterm.,  nov.  spec,  from the  Solomon  Isl.13.   A note on Firmiana bracteata A. DC.14.   Firmiana fulgens (Wall, ex King  Corner is based on a mixtum com-positum and has been the source of constant confusion. For the element, which occurs in Malaysia a new name is coined: F. malayana Kosterm. It does not occur in Tenasserim.15.   A revised bibliography of Firmiana colorata R. Br., F. pallens Stearn and F. malayana Kosterm. is presented.16.   Additional note on Firmiana hainanensis Kosterm.17.   Firmiana kerrii (Craib Kosterm., comb, nov., based on Sterculia kerrii Craib.18.   Additional specimens of Firmiana papuana Mildbr.19.   Cryptocarya hintonii Allen is referred to Primus as Primus hintonii (Allen  Kosterm.20.   Beilschmiedia wallichiana (G. Don   Kosterm., based on Sideroxylon wallichianum, G. Don, is described. Formerly it was relegated to Litsea by Kurz.21.   New species in Lauraceae: Beilschmiedia aborensis Kosterm., B

  20. Ostrácodos no-marinos de lagos en el altiplano este-centro de México

    Directory of Open Access Journals (Sweden)

    Liseth Pérez

    2015-06-01

    Full Text Available La fauna de ostrácodos de la zona de transición néartica-neotropical ha sido poco estudiada hasta este estudio. En el este-centro de México, habitan diez especies de ostrácodos en diez lagos: cinco lagos maar (originados por explosiones freáticas/freato-magmáticas, un lago volcánico-tectónico, tres embalses naturales y un embalse artificial. De la parte más profunda y de las zonas litorales de todos los lagos estudiados se recolectaron sedimentos superficiales para el análisis de ostrácodos. También se midieron in situ las variables ambientales: pH, temperatura, oxígeno disuelto, conductividad, SDT, además se recolectaron muestras de agua paralelas para análisis químico con el objetivo de describir el hábitat. Especies con una amplia distribución en el área de estudio (≥5 lagos incluyen: Cypridopsis vidua, Darwinula stevensoni y Eucandona cf. patzcuaro. Limnocytherina axalapasco es una especie endémica y fue recolectada en tres lagos maar y en el embalse artificial. Especies raras incluyeron: Chlamydotheca arcuata?, Fabaeformiscandona acuminata?, Ilyocypris gibba?, Limnocythere friabilis?, Potamocypris smaragdina? y Potamocypris unicaudata? La riqueza de especies más alta (6 spp. se encontró en el lago más extenso y somero, lago Metztitlán (2.6km², 5.5m de profundidad, con el tipo de agua HCO3->>SO4²->Cl--- Ca2+>Na+>Mg2+. El resto de lagos estudiados (<63m, <27km² presentaron no más de tres especies. Por ejemplo, solamente dos especies de ostrácodos fueron recolectadas en el lago Alchichica, el cual es el más extenso, profundo y salino entre los lagos maar estudiados.

  1. Efficacy of larvicidal activity of green synthesized titanium dioxide nanoparticles using Mangifera indica extract against blood-feeding parasites.

    Science.gov (United States)

    Rajakumar, Govindasamy; Rahuman, Abdul Abdul; Roopan, Selvaraj Mohana; Chung, Ill-Min; Anbarasan, Karunanithi; Karthikeyan, Viswanathan

    2015-02-01

    Titanium dioxide nanoparticles (TiO2 NPs) are considered to be among the best photocatalytic materials due to their long-term thermodynamic stability, strong oxidizing power, and relative non-toxicity. Nano-preparations with TiO2 NPs are currently under investigation as novel treatments for acne vulgaris, recurrent condyloma acuminata, atopic dermatitis, hyperpigmented skin lesions, and other non-dermatologic diseases. The present study was to investigate the acaricidal and larvicidal activity of synthesized TiO2 NPs utilizing leaf aqueous extract of Mangifera indica L. (Anacardiaceae) against hematophagous parasites. The anti-parasitic activity of TiO2 NPs against the larvae of Rhipicephalus (Boophilus) microplus, Hyalomma anatolicum anatolicum and Haemaphysalis bispinosa (Acari: Ixodidae), fourth instar larvae of Anopheles subpictus, and Culex quinquefasciatus (Diptera: Culicidae) were assessed. The green synthesized TiO2 NPs were analyzed by UV-Vis, FTIR, X-ray diffraction (XRD), AFM, SEM, and TEM. The XRD analysis of synthesized TiO2 NPs revealed the dominant peak at 2θ value of 27.81 which matched the 110 crystallographic plane of the rutile structure indicating the crystal structure. The FTIR spectra exhibited a prominent peak at 3,448 cm(-1) and showed OH stretching due to the alcoholic group, and the OH group may act as a capping agent. The SEM images of TiO2 NPs displayed spherical, oval in shape, individual, and some in aggregates. Characterization of the synthesized TiO2 NPs using AFM offered three-dimensional visualization and uneven surface morphology. The TEM micrograph showed agglomerates, round and slight elongation with an average size of 30 ± 5 nm. The maximum efficacy was observed in synthesized TiO2 NPs against the larvae of R. microplus, Hyalomma anatolicum anatolicum, Haemaphysalis bispinosa, A. subpictus, and Culex quinquefasciatus with LC50 value of 28.56, 33.17, 23.81, 5.84, and 4.34 mg/L, respectively. In the present study, a novel

  2. The inhibitory effect of CIL-102 on the growth of human astrocytoma cells is mediated by the generation of reactive oxygen species and induction of ERK1/2 MAPK

    International Nuclear Information System (INIS)

    Teng, Chih-Chuan; Kuo, Hsing-Chun; Cheng, Ho-Chen; Wang, Ting-Chung; Sze, Chun-I

    2012-01-01

    CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone) is the major active agent of the alkaloid derivative of Camptotheca acuminata, with multiple pharmacological activities, including anticancer effects and promotion of apoptosis. The mechanism by which CIL-102 inhibits growth remains poorly understood in human astrocytoma cells. Herein, we investigated the molecular mechanisms by which CIL-102 affects the generation of reactive oxygen species (ROS) and cell cycle G2/M arrest in glioma cells. Treatment of U87 cells with 1.0 μM CIL-102 resulted in phosphorylation of extracellular signal-related kinase (ERK1/2), downregulation of cell cycle-related proteins (cyclin A, cyclin B, cyclin D1, and cdk1), and phosphorylation of cdk1Tyr 15 and Cdc25cSer 216 . Furthermore, treatment with the ERK1/2 inhibitor PD98059 abolished CIL-102-induced Cdc25cSer 216 expression and reversed CIL-102-inhibited cdk1 activation. In addition, N-acetyl cysteine (NAC), an ROS scavenger, blocked cell cycle G2/M arrest and phosphorylation of ERK1/2 and Cdc25cSer 216 in U87 cells. CIL-102-mediated ERK1/2 and ROS production, and cell cycle arrest were blocked by treatment with specific inhibitors. In conclusion, we have identified a novel CIL-102-inhibited proliferation in U87 cells by activating the ERK1/2 and Cdc25cSer 216 cell cycle-related proteins and inducing ROS production; this might be a new mechanism in human astrocytoma cells. -- Highlights: ► We show the effects of CIL-102 on the G2/M arrest of human astrocytoma cells. ► ROS and the Ras/ERK1/2 triggering pathways are involved in the CIL-102 treatment. ► CIL-102 induces sustained activation of ERK1/2 and Cdc25c and ROS are required.

  3. Candona alchichica (Podocopida: Candonidae, a new ostracod species from saline, tropical Lake Alchichica, Mexico

    Directory of Open Access Journals (Sweden)

    Sergio Cohuo

    2016-09-01

    Full Text Available In North America, most species of the Candonidae family belong to the genus Candona. These species are frequently found in freshwater ecosystems and in sediment sequences, which makes them valuable tools for paleoenvironmental reconstructions. Knowledge of Mexican Candona species is limited, however, and scant information exists regarding their taxonomy and ecology. Here we describe Candona alchichica, a new ostracod species we suggest being endemic to Lake Alchichica, central Mexico. The species belongs to the acuminata group of species, based on the presence of 5+1 setae on the second segment of the mandibular palp. It is closely related to C. patzcuaro, C. tahoensis and C. ohioensis, but differs from those species in that the females have an elongated genital field, wide at the base and narrow at the end. Males have elongated hook-like prehensile palps and a particular arrangement of lobes in the hemipenis, i.e., the a-lobe is inclined with a digitiform basal projection, the b-lobe is distally rounded and the h-lobe is square-shaped and exceeding the length of the b-lobe. Candona alchichica n. sp. and C. patzcuaro display very similar shells in length and morphology, which can cause confusion if identification is carried out in the absence of soft parts, a common situation when dealing with carapace and valve remains in sediment cores. Detailed morphometric analyses, however, revealed a clear difference between the valves of the two taxa. Candona alchichica n. sp. has taller valves (p˂0.05, with concave dorsal margin, and with the anterior margin considerably narrower than posterior margin, all characteristics different from C. patzcuaro. Most important, in spite of their similar shape, the two species exhibit contrasting ecological preferences. Candona alchichica n. sp. inhabits clear, cold, saline, oligotrophic waters, whereas C. patzcuaro dwells in turbid, warm, fresh, eutrophic waters. In addition, we include a revision of the

  4. Mechanisms of haplotype divergence at the RGA08 nucleotide-binding leucine-rich repeat gene locus in wild banana (Musa balbisiana).

    Science.gov (United States)

    Baurens, Franc-Christophe; Bocs, Stéphanie; Rouard, Mathieu; Matsumoto, Takashi; Miller, Robert N G; Rodier-Goud, Marguerite; MBéguié-A-MBéguié, Didier; Yahiaoui, Nabila

    2010-07-16

    Comparative sequence analysis of complex loci such as resistance gene analog clusters allows estimating the degree of sequence conservation and mechanisms of divergence at the intraspecies level. In banana (Musa sp.), two diploid wild species Musa acuminata (A genome) and Musa balbisiana (B genome) contribute to the polyploid genome of many cultivars. The M. balbisiana species is associated with vigour and tolerance to pests and disease and little is known on the genome structure and haplotype diversity within this species. Here, we compare two genomic sequences of 253 and 223 kb corresponding to two haplotypes of the RGA08 resistance gene analog locus in M. balbisiana "Pisang Klutuk Wulung" (PKW). Sequence comparison revealed two regions of contrasting features. The first is a highly colinear gene-rich region where the two haplotypes diverge only by single nucleotide polymorphisms and two repetitive element insertions. The second corresponds to a large cluster of RGA08 genes, with 13 and 18 predicted RGA genes and pseudogenes spread over 131 and 152 kb respectively on each haplotype. The RGA08 cluster is enriched in repetitive element insertions, in duplicated non-coding intergenic sequences including low complexity regions and shows structural variations between haplotypes. Although some allelic relationships are retained, a large diversity of RGA08 genes occurs in this single M. balbisiana genotype, with several RGA08 paralogs specific to each haplotype. The RGA08 gene family has evolved by mechanisms of unequal recombination, intragenic sequence exchange and diversifying selection. An unequal recombination event taking place between duplicated non-coding intergenic sequences resulted in a different RGA08 gene content between haplotypes pointing out the role of such duplicated regions in the evolution of RGA clusters. Based on the synonymous substitution rate in coding sequences, we estimated a 1 million year divergence time for these M. balbisiana haplotypes. A

  5. Winter-summer nutrient composition linkage to algae-produced toxins in shellfish at a eutrophic coastal lagoon (Óbidos lagoon, Portugal)

    Science.gov (United States)

    Pereira, Patrícia; Botelho, Maria João; Cabrita, Maria Teresa; Vale, Carlos; Moita, Maria Teresa; Gonçalves, Célia

    2012-10-01

    The current work examines the linkage of pronounced winter-summer fluctuations on the nutrient composition with phytoplankton assemblages and mussel toxicity produced by the presence of toxic dinoflagellates. The work was performed at the Óbidos lagoon, a coastal eutrophic ecosystem that is permanently connected to an area characterized by frequent upwelling episodes. The lagoon and adjoining coastal area exhibit recurrent incidents of diarrhetic and paralytic shellfish poisoning. The conclusions are based on: (1) inorganic and organic nutrients at five sites of the lower, middle and upper Óbidos lagoon, and inorganic nutrients at two sites of the adjacent coastal area; biannual campaigns were performed in winter and summer between 2006 and 2010; (2) phytoplankton assemblages at three sites of the lagoon (located at lower and upper areas) in winter and summer of 2009; (3) algae-derived toxicity of wild mussels from the lower lagoon and coastal area, on a 1-2 week time scale, over 2006 and 2009. Nutrient molar ratios in Óbidos lagoon contrast between winter and summer. The lower median ratios DIN:P (31 and 0.8) and Si:P (11 and 3.3) in summer reflect the excess of phosphate. Excess was mainly attributed to phosphorus regeneration in sediments of the upper lagoon with accentuated symptoms of eutrophication. Dissolved organic nitrogen and dissolved organic phosphorus were also higher in summer, particularly in this area. No significant winter-summer differences were recorded for nutrient ratios in the adjacent coastal area. Phytoplankton assemblages pointed to a winter-summer contrast characterized by a shift of non-siliceous-based phytoplankton to diatoms. The toxic dinoflagellate species (Gymnodinium catenatum, Dinophysis cf. acuminata and Dinophysis acuta), presumably imported from the adjacent coast following upwelling episodes in summer, were observed in the lower lagoon. In summer of the two surveyed years, toxins produced by dinoflagellates occurred in

  6. Monitoring of DSP toxins in small-sized plankton fraction of seawater collected in Mutsu Bay, Japan, by ELISA method: relation with toxin contamination of scallop.

    Science.gov (United States)

    Imai, Ichiro; Sugioka, Hikaru; Nishitani, Goh; Mitsuya, Tadashi; Hamano, Yonekazu

    2003-01-01

    Monitorings were conducted on DSP toxins in mid-gut gland of scallop (mouse assay), cell numbers of toxic dinoflagellate species of Dinophysis, and diarrhetic shellfish poisoning (DSP) toxins in small-sized (0.7-5 microm) plankton fraction of seawater collected from surface (0 m) and 20 m depth at a station in Mutsu Bay, Aomori Prefecture, Japan, in 2000. A specific enzyme-linked immunosorbent assay (ELISA) was employed for the analysis of DSP toxins in small-sized plankton fraction using a mouse monoclonal anti-okadaic acid antibody which recognizes okadaic acid, dinophysistoxin-1, and dinophysistoxin-3. DSP toxins were detected twice in the mid-gut gland of scallops at 1.1-2.3 MU (mouse units) g(-1) on 26 June and at 0.6-1.2 MU g(-1) on 3 July, respectively. Relatively high cell densities of D. fortii were observed on 26 June and 11 September, and may only contribute to the bivalve toxicity during late June to early July. D. acuminata did not appear to be responsible for the toxicity of scallops in Mutsu Bay in 2000. ELISA monitoring of small-sized plankton fraction in seawater could detect DSP toxins two weeks before the detection of the toxin in scallops, and could do so two weeks after the loss of the bivalve toxicity by mouse assay. On 17 July, toxic D. fortii was detected at only small number, <10 cells l(-1), but DSP toxins were detected by the ELISA assay, suggesting a presence of other toxic small-sized plankton in seawater. For the purpose of reducing negative impacts of DSP occurrences, monitorings have been carried out hitherto on DSP toxins of bivalve tissues by mouse assay and on cell densities of "toxic" species of Dinophysis. Here we propose a usefulness of ELISA monitoring of plankton toxicity, especially in small-sized fraction, which are possible foods of mixotrophic Dinophysis, as a practical tool for detecting and predicting DSPs in coastal areas of fisheries grounds of bivalve aquaculture.

  7. Inhibition of the recombinant cattle tick Rhipicephalus (Boophilus) annulatus glutathione S-transferase.

    Science.gov (United States)

    Guneidy, Rasha A; Shahein, Yasser E; Abouelella, Amira M K; Zaki, Eman R; Hamed, Ragaa R

    2014-09-01

    Rhipicephalus (Boophilus) annulatus is a bloodsucking ectoparasite that causes severe production losses in the cattle industry. This study aims to evaluate the in vitro effects of tannic acid, hematin (GST inhibitors) and different plant extracts (rich in tannic acid) on the activity of the recombinant glutathione S-transferase enzyme of the Egyptian cattle tick R. annulatus (rRaGST), in order to confirm their ability to inhibit the parasitic essential detoxification enzyme glutathione S-transferase. Extraction with 70% ethanol of Hibiscus cannabinus (kenaf flowers), Punica granatum (red and white pomegranate peel), Musa acuminata (banana peel) (Musaceae), Medicago sativa (alfalfa seeds), Tamarindus indicus (seed) and Cuminum cyminum (cumin seed) were used to assess: (i) inhibitory capacities of rRaGST and (ii) their phenolic and flavonoid contents. Ethanol extraction of red pomegranate peel contained the highest content of phenolic compounds (29.95mg gallic acid/g dry tissue) compared to the other studied plant extracts. The highest inhibition activities of rRaGST were obtained with kenaf and red pomegranate peel (P. granatum) extracts with IC50 values of 0.123 and 0.136mg dry tissue/ml, respectively. Tannic acid was the more effective inhibitor of rRaGST with an IC50 value equal to 4.57μM compared to delphinidine-HCl (IC50=14.9±3.1μM). Gossypol had a weak inhibitory effect (IC50=43.7μM), and caffeic acid had almost no effect on tick GST activity. The IC50 values qualify ethacrynic acid as a potent inhibitor of rRaGST activity (IC50=0.034μM). Cibacron blue and hematin showed a considerable inhibition effect on rRaGST activity, and their IC50 values were 0.13μM and 7.5μM, respectively. The activity of rRaGST was highest for CDNB (30.2μmol/min/mg protein). The enzyme had also a peroxidatic activity (the specific activity equals 26.5μmol/min/mg protein). Both tannic acid and hematin inhibited rRaGST activity non-competitively with respect to GSH and

  8. DURABILTY OF 25 LOCAL SPECIFIC WOOD SPECIES FROM JAVA PRESERVED WITH CCB AGAINST MARINE BORERS ATTACK

    Directory of Open Access Journals (Sweden)

    Mohammad Muslich

    2010-12-01

    Full Text Available This study was conducted to provide basis information of the 25 local specific wood species indigenous from Java treated by copper bichromated boron (CCB. The full-cell process for 2 hours and 150 psi during the pressure-keeping period was employed. The IUFRO method was applied for the determination of wood treatability class. The treated and untreated wood specimens were tied together using plastic cord, arranged into a raft like assembly, and then exposed for 3, 6, and 12 months to the brackish water situated at Rambut Island’s coastal area. The Nordic Wood Preservation Council (NWPC standard No.1.4.2.2/75 was used to determine the intensity of marine borer infestation. The results revealed that 19 out of those 25 species were classified as easy to be preser ved, four species as moderate, and the remaining two were difficult to be preser ved. Those 19 species, i.e. Tamarindus indica L., Diplodiscus sp., Ficus variegate R .Br., Ehretia acuminata R .Br., Meliocope lunu-ankenda (Gaertn T.G. Hartley, Colona javanica B.L., Pouteria duclitanBachni., Stercularia oblongata R .Br., Ficus vasculosa Wall ex Miq., Callophyllum grandiflorum JJS., Turpinia sphaerocarpa Hassk., Neolitsea triplinervia Merr., Acer niveum Bl., Sloanea sigun Szysz., Castanopsis acuminatissima A.DC., Cinnamomum iners Reinw. Ex Blume., Litsea angulata Bl., Ficus nervosa Heyne., and Horsfieldia glabra Warb. were more permeable implying that the CCB retention and penetration were greater and deeper. Hymeneaecarboril.L., LitseaodoriferaVal., Gironniera subasqualisPlanch., and LinderapolyanthaBoerl. were moderately permeable. Castanopsis tunggurut A.DC. and Azadirachta indica Juss. were the least permeable judging that the CCB retention and penetration were lowest and shallowest. The treated wood specimens in this regard were able to prevent marine borers attack. Meanwhile, the untreated specimens were susceptible to marine borers attack, except Azadirachta indica. The attacking

  9. Trophic ecology of the freshwater prawn, Pseudopalaemon bouvieri (Decapoda: Palaemonidae in Northeastern Argentina: with remarks on population structure

    Directory of Open Access Journals (Sweden)

    Romina Patricia Carnevali

    2012-03-01

    Full Text Available Freshwater decapod crustaceans are important components of food webs in these environments, but little is known about the diet of species that live in tropical waters. We studied the feeding ecology of the prawn Pseudopalaemon bouvieri and its population structure in two different areas with six lagoons, with a different composition and abundance of aquatic macrophytes. At each site of macrophytes banks, 18 prawns sample was collected with a hand net (1mm mesh size from 1m². In the laboratory, prawns cephalothorax length was measured, sex determined, and a total of 208 stomachs were examined for food items. Our results showed that the population abundance varied between 10 ind/m² and 1 411 ind/m². The cephalothorax length ranged between 6mm and 21mm, and the male:female ratio varied between 0.3 and 1.0, with a higher proportion of ovigerous females (21% in area one than area two. P. bouvieri is omnivorous, and its diet was principally based on algae, plant remains, Protozoa, Rotifera, Oligochaeta, Crustacea, Insecta, detritus and other items. The analysis of the stomach content did not reveal any significant difference in the diet between juveniles and adults, and males and females of both areas consumed a similar diet (Kruskal-Wallis test p=0.8273. We concluded that the dietary items consumed by prawns and the niche breadth were similar between the two areas, although the proportion of items consumed varied between lagoons of both areas. The density of P. bouvieri was different between areas, but the size of cephalothorax (CL was similar.Los crustáceos decápodos de agua dulce son un componente importante de la cadena trófica, pero poco se sabe sobre la dieta de las especies que viven en aguas tropicales. Nosotros estudiamos la ecología alimentaria del camarón Pseudopalaemon bouvieri y la estructura de su población en dos áreas diferentes con seis lagunas, con una diferente composición y abundancia de macrófitas acuáticas. En cada

  10. Influence of net-cage fish farming on zooplankton biomass in the Itá reservoir, SC, Brazil Influência da piscicultura em tanque-rede sobre a biomassa do zooplâncton no reservatório de Itá, SC, Brasil

    Directory of Open Access Journals (Sweden)

    Bruna Roque Loureiro

    2011-12-01

    Full Text Available OBJECTIVES: This study aimed to verify the influence of net-cage fish farming on zooplankton biomass in the Itá reservoir (Uruguay River, Brazil. METHODS: Samples were collected monthly from October/2009 to May/2010 at the surface and at the bottom in two sampling stations, the net-cage area and in a control area using a Van Dorn bottle and a plankton net (68 µm. RESULTS: The Cladocera and Copepoda biomass was estimated by dry weight using a micro-analytical balance, and the Rotifera biomass by Biovolume. Total zooplankton biomass varied between 6.47 and 131.56 mgDW.m-3 Calanoida copepod presented the highest value of biomass (127.56 mgDW.m-3 and rotifers, despite having an important contribution to total density, showed a maximum biomass of 2.01 mgDW.m-3. Zooplankton biomass at the net-cage area surface was higher when compared with the control area during the months of October to January. However, the zooplankton biomass was similar at the bottom of the two areas throughout the studied period. From February until May, zooplankton biomass decreased in both sampling stations, a fact probably associated with the flushing of the reservoir, followed by an increase in water transparency and a decrease in chlorophyll-a concentration in the following months (February to May. CONCLUSIONS: The influence of fish farming on zooplankton biomass was detected at the surface of the net-cage area only from October to January. From February to May this influence was not found, probably by the influence of the flushing of the reservoir.OBJETIVO: Este estudo teve o objetivo de verificar a influencia da piscicultura em tanque-rede sobre a biomassa da comunidade zooplanctônica no reservatório de Itá (Rio Uruguai, Brasil. METODOLOGIA: Foram realizadas coletas mensais de outubro/2009 a maio/2010 na superfície e no fundo em dois pontos amostrais, ponto tanque-rede e em uma área controle, com o auxílio da garrafa Van Dorn e rede de plâncton (68 µm. RESULTADOS

  11. Indicação da anuscopia de alta resolução e citologia anal na prevenção de HPV e câncer colorretal em pacientes portadores de HIV Indication of high resolution anoscopy and anal cytology for prevention of HPV and colorectal cancer in HIV patients

    Directory of Open Access Journals (Sweden)

    Hugo Leonardo Madeiro Arcanjo Silva

    2010-12-01

    analysis. RESULTS: We found 22 males and 9 females between 20 and 67 years. Of the 31 tested, 4 were in stage of immunosuppression, 23 were using antiretroviral therapy, 16 with history of receptive anal sex and 12 with a history of condyloma acuminata. In the HRA 11 patients had changes and 7 were confirmed by cytology. We also verified eight patients with abnormal cytology who had no changes to the HRA. In the atypical squamous cells of undetermined significance (Ascus cytology had three, five with parakeratosis and/or hyperkeratosis, six intraepithelial lesions and a low grade squamous intraepithelial lesion high grade. CONCLUSION: We suggest the use of anoscopy high resolution combined with anal cytology for screening in patients with the HIV, since these examinations are complementary for the detection of lesions that are related to anorectal cancer.

  12. Viabilidade in vitro de grãos de pólen de bananeira sob diferentes concentrações de ácido bórico e sacarose In vitro viability of banana pollen grain under different concentrations of boric acid and sucrose

    Directory of Open Access Journals (Sweden)

    Ronaldo Viana dos Reis

    2011-06-01

    Full Text Available Neste trabalho, objetivou-se avaliar a germinação do grão de pólen e o comprimento do tubo polínico das bananeiras diplóides M53, 8987-01 e 9197-03, Calcutá, Lidi e 86B79-12. O delineamento utilizado foi inteiramente casualizado com cinco doses de sacarose (0, 5, 10, 15, 20% e seis concentrações de ácido bórico (0, 100, 200, 300, 400 e 500 Mg L-1 com quatro repetições. Foram utilizados grãos de pólen retirados da inflorescência masculina dos diplóides Musa acuminata (AA. O pólen foi distribuído em placas de Petri, contendo o seguinte meio de cultura: 1,27 mM de Ca(NO32.2H2O, 0,87 mM de MgSO4.7H2O, 0,99 mM de KNO3, 0,7% de ágar com pH ajustado para 7,0, variando as concentrações de sacarose e de ácido bórico. As avaliações foram realizadas 24 horas após a distribuição do pólen no meio de cultura. O meio de cultura padrão para germinação de grãos de pólen suplementado com 15% de sacarose proporcionou uma maior percentagem de germinação para os diplóides de bananeira avaliados. A concentração de ácido bórico adicionado ao meio de cultura para a germinação de grãos de pólen de bananeira diplóide é dependente do genótipo.The objective of this work was to evaluate the germination of pollen grain and pollen tube length of banana diploids (M53, 8987-01 e 9197-03, Calcutta, Lidi and 86B79-12. Five concentrations of sucrose (0, 5, 10, 15 and 20% and six concentrations of boric acid (0, 100, 200, 300, 400 and 500 mg L-1 were used, in a completely randomized experimental design, with four replicates. The pollen was distributed in Petri dishes containing the following culture medium: 1.27 mM Ca(NO32.2H2O, 0.87 mM MgSO4.7H2O, 0.99 mM KNO3, and 0.7% agar; pH adjusted to 7.0, varying the sucrose and boric acid concentrations. The evaluations were performed 24 hours after the distribution of the pollen in the culture medium. The standard culture medium for germination of pollen grains with 15% sucrose provided the

  13. Efficacy in the use of local anesthesia in patients with surgical intervention for the resolution of anorectal pathologies

    Directory of Open Access Journals (Sweden)

    Victoria Dowling

    2018-01-01

    Full Text Available A prospective, comparative, longitudinal study was conducted in the period from April 2016 to January 2017 in order to determine the efficacy of local anesthesia for the surgical resolution of anorectal pathologies in surgically operated patients who attended the General University Hospital “Luis Gomez Lopez. Thus, the population was composed of patients with anorectal pathologies of low complexity, with no previous anorectal surgical history (Hemorrhoids, anal fissure, perianal fistula, hypertrophic anal papilla, perianal condyloma acuminata, which were agreed to be included in this study, without contraindications for use of local anesthesia. A non-probabilistic, intentional sample was made up of 30 patients and the anesthetic protocol was administered following an anesthetic protocol of perianal local anesthesia using anesthetic mixture (70% of 2% lidocaine + 30% of 0.5% bupivacaine quantifying pain tolerance during the intraoperative period on the first and fifth postoperative days, as well as any adverse effects. The results were expressed in absolute numbers and percentages; a good tolerance to pain was observed with some differences related to the sex of the individuals studied; no complications were observed. Resumo: Esse estudo prospectivo, comparativo e longitudinal foi realizado no período de abril de 2016 a janeiro de 2017, com o objetivo de determinar a eficácia da anestesia local para resolução cirúrgica de patologias anorretais em pacientes cirurgicamente operados que compareceram no Hospital Geral Universitário Luis Gomez Lopes. Essa população se compunha de pacientes com patologias anorretais de baixa complexidade, sem história prévia de cirurgia anorretal (hemorroidas, fissura anal, fístula perianal, papila anal hipertrófica, condiloma acuminado perianal, com prévia concordância em participar no presente estudo e sem contraindicações para o uso de anestesia local. Foi obtida uma amostra intencional e n

  14. Detection of Human Papillomavirus Infection in Patients with Vaginal Intraepithelial Neoplasia.

    Science.gov (United States)

    Lamos, Cristina; Mihaljevic, Charlotte; Aulmann, Sebastian; Bruckner, Thomas; Domschke, Christoph; Wallwiener, Markus; Paringer, Carmen; Fluhr, Herbert; Schott, Sarah; Dinkic, Christine; Brucker, Janina; Golatta, Michael; Gensthaler, Lisa; Eichbaum, Michael; Sohn, Christof; Rom, Joachim

    2016-01-01

    (VAIN) was 53 years and in patients with HSIL (VAIN) 53.5 years. 12 women (18%) had an immunosuppression. HPV positivity was confirmed in 37 patients (55%). Except for a single patient, who had a triple infection with HPV types 6/11, 16 and 68, only infections with one single HPV genotype were detected. An infection with the HPV genotypes 31, 39, 45, 51, 58, 59, 66, 42, 43 and 44 couldn't be found in any of the patients. In 28 patients with diagnosed VAIN, an infection with HPV 16 could be shown, 24 (86%) of them were diagnosed with a HSIL (VAIN). 16 (24%) women presented condylomata and 13 of them (81%) had a positive HPV status. However, only 47% of the women without condylomata presented a positive HPV status, resulting in a significant correlation (p = 0.0164) between condylomata and HPV infection. In 28 of all 67 patients (42%), recurrence of the neoplasia occurred. HPV 16 is the main virus-type to be associated with the development of a VAIN. Also, HPV 16 infection, VIN or condylomata acuminata in the past medical history seemed to be significant factors for early relapse.

  15. Plant Mutation Reports, Vol. 3, No. 1, July 2013

    International Nuclear Information System (INIS)

    2013-07-01

    your submissions of officially released mutant varieties to our Mutant Varieties Database (MVD). This database is unique and functions as a witness for the useful application of nuclear technology in food and agriculture. Currently the database lists more than 3200 released mutant varieties in more than 200 crop species and the number of plant species subject to mutagenesis also continues to rise. The MVD is currently being improved to facilitate submission of information and to provide more advanced search and data analysis tools. As to the current and final regular volume of PMR, I am happy that we can present an interesting mixture of two short notes on the development of new mutant varieties of rice in India, a review on the current status and trends in cassava mutation breeding and four research articles dealing with various topics in plant mutation. One of the articles addresses the characterization of various types of mutations in wheat as a resource for functional genomics, thus giving an example of the trend in broadening the use of mutation induction. Another article reports on the nature of molecular variation induced by gamma irradiation of barley as analysed by Amplified Fragment Length Polymorphisms (AFLPs) and Single Sequence Repeats (SSRs). This issue of PMR also gives a forum for results produced by a recently completed CRP on ''Molecular Tools for Quality Improvement in Vegetatively Propagated Crops Including Banana and Cassava''. Reports are included on the production of haploid tissue of the diploid Musa species M. acuminata cv. 'Matti' and on the analysis of carotenoid-protein content variation in pigmented cassava storage roots and its implication for traditional breeding strategies and use of induced mutations

  16. Expressão das citoceratinas em dermatoses infecto- parasitárias associadas à hiperplasia epidérmica Expression of the cytokeratins in infectious and parasitic skin diseases associated with epidermal hyperplasia

    Directory of Open Access Journals (Sweden)

    Maria Christina Marques Nogueira-Castañon

    2004-12-01

    hyperplasia. METHODS: Histological sections obtained from formalin-fixed and paraffin-embedded tissue from cromomycosis, paracoccidioidomycosis, leishmaniasis and condylomata acuminata lesions were marked with the DEK10, LL025, LL002 and AE1 antibodies by the immunoperoxidase technique (avidina-botina. RESULTS: Different degrees of epidermal hyperplasia were observed predominantly or exclusively in the following four diseases: absence of immunoreactivity to DE-K10 in areas of intense epidermal hyperplasia and delayed K10 immunohistochemical staining in areas of moderate to discreet/absent hyperplasia; superbasal expression pattern for K16, regardless of the degree of hyperplasia as well as superbasal epitops discharging for LL002 (C14 and AE1 (C10, 14, 16, 19. CONCLUSIONS: The modifications indicate that regardless of the nature of the etiologic agent and degree of hyperplasia, changes in keratinocyte differentiation and proliferation may occur.

  17. Síndrome inflamatória da reconstituição imunológica Immune reconstitution inflammatory syndrome

    Directory of Open Access Journals (Sweden)

    Sidney Roberto Nadal

    2009-03-01

    anogenitais, sarcoma de Kaposi, obstrução intestinal devida a histoplasmose disseminada e pancolite ulcerativa por CMV, levando a perfuração intestinal. A interação entre as equipes médicas deverá identificar a síndrome e definir o tratamento mais adequado para cada doente, evitando evoluções adversas.Highly active anti-retroviral therapy (HAART reduces HIV infection mortality and morbidity, modifying natural history of opportunistic and auto-immune diseases. However, in 10 to 25% of patients, the immune system restoration will provoke severe reaction against co-existent infections, causing diseases, by opportunistic agents, with atypical features, and intense tissue inflammation. All clinical and laboratorial changes resulting from this increased inflammatory response are called immune reconstitution inflammatory syndrome (IRIS. Paradoxical clinic worsening of a known disease or appearance of a new one, after beginning of HAART, characterize this syndrome. Potential mechanisms include partial immune reconstitution or host increased immune response to the antigenic stimulus. There are two main forms: an earlier that arises up to the third month after HAART, due to immune reaction against opportunistic agents that remained in a sub-clinic disease; and other later that emerges after months or years as an immune reaction evolution against opportunistic agents whose manifestations were unexpected. This syndrome occurs mainly in those with less than 50/mm³ T CD4 and very high HIV viral load before HAART, as so non-detected antigens from micro-organisms whose clinical manifestations were unexpected. Most diseases are dermatological, mainly, genital herpes and warts. However, among those infected with Mycobacterium tuberculosis, Mycobacterium avium complex or Cryptococcus neoformans, the syndrome affects up to 45% of patients. For the sake of the Proctologist, we could mention cases of herpes simplex, herpes zoster, contagious moluscus, condylomata acuminata, Kaposi

  18. Rubitecan: 9-NC, 9-Nitro-20(S)-camptothecin, 9-nitro-camptothecin, 9-nitrocamptothecin, RFS 2000, RFS2000.

    Science.gov (United States)

    2004-01-01

    Rubitecan [Orathecin, 9-nitrocamptothecin, 9NC, RFS 2000] is a topoisomerase I inhibitor extracted from the bark and leaves of the Camptotheca acuminata tree, which is native to China. Rubitecan is an oral compound being developed for the treatment of pancreatic cancer and other solid tumours by SuperGen. One of the major benefits of rubitecan is that it can be administered in an outpatient setting, so patients can be treated in their homes. Rubitecan was isolated by the Stehlin Foundation in the US. SuperGen is currently awaiting regulatory approval in the US and the EU for rubitecan in the treatment of pancreatic cancer. At the BIO-2004 conference, SuperGen announced it is seeking a partner for rubitecan for territories outside the US. SuperGen acquired exclusive worldwide rights to rubitecan from the Stehlin Foundation in 1997 except in Mexico, Canada, Spain, Japan, the UK, France, Italy and Germany. SuperGen has also received approval from the US FDA to use its own manufactured rubitecan in clinical trials. SuperGen and the Stehlin Foundation have an 8-year research agreement that secures global rights to other camptothecins and additional anticancer compounds for the former. In December 1999, SuperGen and Abbott signed a worldwide sales and marketing agreement for rubitecan. Under the terms of the agreement, Abbott had exclusive distribution and promotion rights for rubitecan outside the US, and co-promotion rights with SuperGen within the US. In return, Abbott made an initial equity investment in SuperGen. SuperGen and Abbott Laboratories ended their collaboration agreement in February 2002 by mutual consent with SuperGen stating that the dissolution of the agreement was based on commercial motivation rather than anything to do with rubitecan's safety or efficacy. Abbott no longer has rights or obligations to purchase shares of SuperGen stock or an option to purchase up to 49% of the company. For its part, SuperGen will no longer receive milestone payments