WorldWideScience

Sample records for nostoc punctiforme geobiological

  1. 2-Methylhopanoids are maximally produced in akinetes of Nostoc punctiforme: geobiological implications

    Science.gov (United States)

    Doughty, David M.; Hunter, Ryan C.; Summons, Roger E.; Newman, Dianne K.

    2010-01-01

    2-Methylhopanes, molecular fossils of 2-methylbacteriohopanepolyol (2-MeBHP) lipids, have been proposed as biomarkers for cyanobacteria, and by extension, oxygenic photosynthesis. However, the robustness of this interpretation is unclear, as 2-methylhopanoids occur in organisms besides cyanobacteria and their physiological functions are unknown. As a first step towards understanding the role of 2-MeBHP in cyanobacteria, we examined the expression and intercellular localization of hopanoids in the three cell types of Nostoc punctiforme: vegetative cells, akinetes, and heterocysts. Cultures in which N. punctiforme had differentiated into akinetes contained approximately 10-fold higher concentrations of 2-methylhopanoids than did cultures that contained only vegetative cells. In contrast, 2-methylhopanoids were only present at very low concentrations in heterocysts. Hopanoid production initially increased 3-fold in cells starved of nitrogen but returned to levels consistent with vegetative cells within two weeks. Vegetative and akinete cell types were separated into cytoplasmic, thylakoid, and outer membrane fractions; the increase in hopanoid expression observed in akinetes was due to a 34-fold enrichment of hopanoid content in their outer membrane relative to vegetative cells. Akinetes formed in response either to low light or phosphorus limitation, exhibited the same 2-methylhopanoid localization and concentration, demonstrating that 2-methylhopanoids are associated with the akinete cell type per se. Because akinetes are resting cells that are not photosynthetically active, 2-methylhopanoids cannot be functionally linked to oxygenic photosyntheis in N. punctiforme. PMID:19811542

  2. The Nostoc punctiforme Genome

    Energy Technology Data Exchange (ETDEWEB)

    John C. Meeks

    2001-12-31

    Nostoc punctiforme is a filamentous cyanobacterium with extensive phenotypic characteristics and a relatively large genome, approaching 10 Mb. The phenotypic characteristics include a photoautotrophic, diazotrophic mode of growth, but N. punctiforme is also facultatively heterotrophic; its vegetative cells have multiple development alternatives, including terminal differentiation into nitrogen-fixing heterocysts and transient differentiation into spore-like akinetes or motile filaments called hormogonia; and N. punctiforme has broad symbiotic competence with fungi and terrestrial plants, including bryophytes, gymnosperms and an angiosperm. The shotgun-sequencing phase of the N. punctiforme strain ATCC 29133 genome has been completed by the Joint Genome Institute. Annotation of an 8.9 Mb database yielded 7432 open reading frames, 45% of which encode proteins with known or probable known function and 29% of which are unique to N. punctiforme. Comparative analysis of the sequence indicates a genome that is highly plastic and in a state of flux, with numerous insertion sequences and multilocus repeats, as well as genes encoding transposases and DNA modification enzymes. The sequence also reveals the presence of genes encoding putative proteins that collectively define almost all characteristics of cyanobacteria as a group. N. punctiforme has an extensive potential to sense and respond to environmental signals as reflected by the presence of more than 400 genes encoding sensor protein kinases, response regulators and other transcriptional factors. The signal transduction systems and any of the large number of unique genes may play essential roles in the cell differentiation and symbiotic interaction properties of N. punctiforme.

  3. Identification and topographical characterisation of microbial nanowires in Nostoc punctiforme.

    Science.gov (United States)

    Sure, Sandeep; Torriero, Angel A J; Gaur, Aditya; Li, Lu Hua; Chen, Ying; Tripathi, Chandrakant; Adholeya, Alok; Ackland, M Leigh; Kochar, Mandira

    2016-03-01

    Extracellular pili-like structures (PLS) produced by cyanobacteria have been poorly explored. We have done detailed topographical and electrical characterisation of PLS in Nostoc punctiforme PCC 73120 using transmission electron microscopy (TEM) and conductive atomic force microscopy (CAFM). TEM analysis showed that N. punctiforme produces two separate types of PLS differing in their length and diameter. The first type of PLS are 6-7.5 nm in diameter and 0.5-2 µm in length (short/thin PLS) while the second type of PLS are ~20-40 nm in diameter and more than 10 µm long (long/thick PLS). This is the first study to report long/thick PLS in N. punctiforme. Electrical characterisation of these two different PLS by CAFM showed that both are electrically conductive and can act as microbial nanowires. This is the first report to show two distinct PLS and also identifies microbial nanowires in N. punctiforme. This study paves the way for more detailed investigation of N. punctiforme nanowires and their potential role in cell physiology and symbiosis with plants.

  4. Nostopeptolide plays a governing role during cellular differentiation of the symbiotic cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Liaimer, Anton; Helfrich, Eric J N; Hinrichs, Katrin; Guljamow, Arthur; Ishida, Keishi; Hertweck, Christian; Dittmann, Elke

    2015-02-10

    Nostoc punctiforme is a versatile cyanobacterium that can live either independently or in symbiosis with plants from distinct taxa. Chemical cues from plants and N. punctiforme were shown to stimulate or repress, respectively, the differentiation of infectious motile filaments known as hormogonia. We have used a polyketide synthase mutant that accumulates an elevated amount of hormogonia as a tool to understand the effect of secondary metabolites on cellular differentiation of N. punctiforme. Applying MALDI imaging to illustrate the reprogramming of the secondary metabolome, nostopeptolides were identified as the predominant difference in the pks2(-) mutant secretome. Subsequent differentiation assays and visualization of cell-type-specific expression of nostopeptolides via a transcriptional reporter strain provided evidence for a multifaceted role of nostopeptolides, either as an autogenic hormogonium-repressing factor or as a chemoattractant, depending on its extracellular concentration. Although nostopeptolide is constitutively expressed in the free-living state, secreted levels dynamically change before, during, and after the hormogonium differentiation phase. The metabolite was found to be strictly down-regulated in symbiosis with Gunnera manicata and Blasia pusilla, whereas other metabolites are up-regulated, as demonstrated via MALDI imaging, suggesting plants modulate the fine-balanced cross-talk network of secondary metabolites within N. punctiforme.

  5. Genetic analysis reveals the identity of the photoreceptor for phototaxis in hormogonium filaments of Nostoc punctiforme.

    Science.gov (United States)

    Campbell, Elsie L; Hagen, Kari D; Chen, Rui; Risser, Douglas D; Ferreira, Daniela P; Meeks, John C

    2015-02-15

    In cyanobacterial Nostoc species, substratum-dependent gliding motility is confined to specialized nongrowing filaments called hormogonia, which differentiate from vegetative filaments as part of a conditional life cycle and function as dispersal units. Here we confirm that Nostoc punctiforme hormogonia are positively phototactic to white light over a wide range of intensities. N. punctiforme contains two gene clusters (clusters 2 and 2i), each of which encodes modular cyanobacteriochrome-methyl-accepting chemotaxis proteins (MCPs) and other proteins that putatively constitute a basic chemotaxis-like signal transduction complex. Transcriptional analysis established that all genes in clusters 2 and 2i, plus two additional clusters (clusters 1 and 3) with genes encoding MCPs lacking cyanobacteriochrome sensory domains, are upregulated during the differentiation of hormogonia. Mutational analysis determined that only genes in cluster 2i are essential for positive phototaxis in N. punctiforme hormogonia; here these genes are designated ptx (for phototaxis) genes. The cluster is unusual in containing complete or partial duplicates of genes encoding proteins homologous to the well-described chemotaxis elements CheY, CheW, MCP, and CheA. The cyanobacteriochrome-MCP gene (ptxD) lacks transmembrane domains and has 7 potential binding sites for bilins. The transcriptional start site of the ptx genes does not resemble a sigma 70 consensus recognition sequence; moreover, it is upstream of two genes encoding gas vesicle proteins (gvpA and gvpC), which also are expressed only in the hormogonium filaments of N. punctiforme. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  6. Transcript analysis of the extended hyp-operon in the cyanobacteria Nostoc sp. strain PCC 7120 and Nostoc punctiforme ATCC 29133

    Science.gov (United States)

    2011-01-01

    Background Cyanobacteria harbor two [NiFe]-type hydrogenases consisting of a large and a small subunit, the Hup- and Hox-hydrogenase, respectively. Insertion of ligands and correct folding of nickel-iron hydrogenases require assistance of accessory maturation proteins (encoded by the hyp-genes). The intergenic region between the structural genes encoding the uptake hydrogenase (hupSL) and the accessory maturation proteins (hyp genes) in the cyanobacteria Nostoc PCC 7120 and N. punctiforme were analysed using molecular methods. Findings The five ORFs, located in between the uptake hydrogenase structural genes and the hyp-genes, can form a transcript with the hyp-genes. An identical genomic localization of these ORFs are found in other filamentous, N2-fixing cyanobacterial strains. In N. punctiforme and Nostoc PCC 7120 the ORFs upstream of the hyp-genes showed similar transcript level profiles as hupS (hydrogenase structural gene), nifD (nitrogenase structural gene), hypC and hypF (accessory hydrogenase maturation genes) after nitrogen depletion. In silico analyzes showed that these ORFs in N. punctiforme harbor the same conserved regions as their homologues in Nostoc PCC 7120 and that they, like their homologues in Nostoc PCC 7120, can be transcribed together with the hyp-genes forming a larger extended hyp-operon. DNA binding studies showed interactions of the transcriptional regulators CalA and CalB to the promoter regions of the extended hyp-operon in N. punctiforme and Nostoc PCC 7120. Conclusions The five ORFs upstream of the hyp-genes in several filamentous N2-fixing cyanobacteria have an identical genomic localization, in between the genes encoding the uptake hydrogenase and the maturation protein genes. In N. punctiforme and Nostoc PCC 7120 they are transcribed as one operon and may form transcripts together with the hyp-genes. The expression pattern of the five ORFs within the extended hyp-operon in both Nostoc punctiforme and Nostoc PCC 7120 is similar to

  7. A Nostoc punctiforme sugar transporter necessary to establish a Cyanobacterium-plant symbiosis.

    Science.gov (United States)

    Ekman, Martin; Picossi, Silvia; Campbell, Elsie L; Meeks, John C; Flores, Enrique

    2013-04-01

    In cyanobacteria-plant symbioses, the symbiotic nitrogen-fixing cyanobacterium has low photosynthetic activity and is supplemented by sugars provided by the plant partner. Which sugars and cyanobacterial sugar uptake mechanism(s) are involved in the symbiosis, however, is unknown. Mutants of the symbiotically competent, facultatively heterotrophic cyanobacterium Nostoc punctiforme were constructed bearing a neomycin resistance gene cassette replacing genes in a putative sugar transport gene cluster. Results of transport activity assays using (14)C-labeled fructose and glucose and tests of heterotrophic growth with these sugars enabled the identification of an ATP-binding cassette-type transporter for fructose (Frt), a major facilitator permease for glucose (GlcP), and a porin needed for the optimal uptake of both fructose and glucose. Analysis of green fluorescent protein fluorescence in strains of N. punctiforme bearing frt::gfp fusions showed high expression in vegetative cells and akinetes, variable expression in hormogonia, and no expression in heterocysts. The symbiotic efficiency of N. punctiforme sugar transport mutants was investigated by testing their ability to infect a nonvascular plant partner, the hornwort Anthoceros punctatus. Strains that were specifically unable to transport glucose did not infect the plant. These results imply a role for GlcP in establishing symbiosis under the conditions used in this work.

  8. Composition and occurrence of lipid droplets in the cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Peramuna, Anantha; Summers, Michael L

    2014-12-01

    Inclusions of neutral lipids termed lipid droplets (LDs) located throughout the cell were identified in the cyanobacterium Nostoc punctiforme by staining with lipophylic fluorescent dyes. LDs increased in number upon entry into stationary phase and addition of exogenous fructose indicating a role for carbon storage, whereas high-light stress did not increase LD numbers. LD accumulation increased when nitrate was used as the nitrogen source during exponential growth as compared to added ammonia or nitrogen-fixing conditions. Analysis of isolated LDs revealed enrichment of triacylglycerol (TAG), α-tocopherol, and C17 alkanes. LD TAG from exponential phase growth contained mainly saturated C16 and C18 fatty acids, whereas stationary phase LD TAG had additional unsaturated fatty acids characteristic of whole cells. This is the first characterization of cyanobacterial LD composition and conditions leading to their production. Based upon their abnormally large size and atypical location, these structures represent a novel sub-organelle in cyanobacteria.

  9. Role of Phosphate Transport System Component PstB1 in Phosphate Internalization by Nostoc punctiforme.

    Science.gov (United States)

    Hudek, L; Premachandra, D; Webster, W A J; Bräu, L

    2016-11-01

    In bacteria, limited phosphate availability promotes the synthesis of active uptake systems, such as the Pst phosphate transport system. To understand the mechanisms that facilitate phosphate accumulation in the cyanobacterium Nostoc punctiforme, phosphate transport systems were identified, revealing a redundancy of Pst phosphate uptake systems that exists across three distinct operons. Four separate PstB system components were identified. pstB1 was determined to be a suitable target for creating phenotypic mutations that could result in the accumulation of excessive levels of phosphate through its overexpression or in a reduction of the capacity to accumulate phosphate through its deletion. Using quantitative real-time PCR (qPCR), it was determined that pstB1 mRNA levels increased significantly over 64 h in cells cultured in 0 mM added phosphate and decreased significantly in cells exposed to high (12.8 mM) phosphate concentrations compared to the level in cells cultured under normal (0.8 mM) conditions. Possible compensation for the loss of PstB1 was observed when pstB2, pstB3, and pstB4 mRNA levels increased, particularly in cells starved of phosphate. The overexpression of pstB1 increased phosphate uptake by N. punctiforme and was shown to functionally complement the loss of PstB in E. coli PstB knockout (PstB - ) mutants. The knockout of pstB1 in N. punctiforme did not have a significant effect on cellular phosphate accumulation or growth for the most part, which is attributed to the compensation for the loss of PstB1 by alterations in the pstB2, pstB3, and pstB4 mRNA levels. This study provides novel in vivo evidence that PstB1 plays a functional role in phosphate uptake in N. punctiforme IMPORTANCE: Cyanobacteria have been evolving over 3.5 billion years and have become highly adept at growing under limiting nutrient levels. Phosphate is crucial for the survival and prosperity of all organisms. In bacteria, limited phosphate availability promotes the

  10. Isolation and characterization of the small subunit of the uptake hydrogenase from the cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Raleiras, Patrícia; Kellers, Petra; Lindblad, Peter; Styring, Stenbjörn; Magnuson, Ann

    2013-06-21

    In nitrogen-fixing cyanobacteria, hydrogen evolution is associated with hydrogenases and nitrogenase, making these enzymes interesting targets for genetic engineering aimed at increased hydrogen production. Nostoc punctiforme ATCC 29133 is a filamentous cyanobacterium that expresses the uptake hydrogenase HupSL in heterocysts under nitrogen-fixing conditions. Little is known about the structural and biophysical properties of HupSL. The small subunit, HupS, has been postulated to contain three iron-sulfur clusters, but the details regarding their nature have been unclear due to unusual cluster binding motifs in the amino acid sequence. We now report the cloning and heterologous expression of Nostoc punctiforme HupS as a fusion protein, f-HupS. We have characterized the anaerobically purified protein by UV-visible and EPR spectroscopies. Our results show that f-HupS contains three iron-sulfur clusters. UV-visible absorption of f-HupS has bands ∼340 and 420 nm, typical for iron-sulfur clusters. The EPR spectrum of the oxidized f-HupS shows a narrow g = 2.023 resonance, characteristic of a low-spin (S = ½) [3Fe-4S] cluster. The reduced f-HupS presents complex EPR spectra with overlapping resonances centered on g = 1.94, g = 1.91, and g = 1.88, typical of low-spin (S = ½) [4Fe-4S] clusters. Analysis of the spectroscopic data allowed us to distinguish between two species attributable to two distinct [4Fe-4S] clusters, in addition to the [3Fe-4S] cluster. This indicates that f-HupS binds [4Fe-4S] clusters despite the presence of unusual coordinating amino acids. Furthermore, our expression and purification of what seems to be an intact HupS protein allows future studies on the significance of ligand nature on redox properties of the iron-sulfur clusters of HupS.

  11. Multiple ketolases involved in light regulation of canthaxanthin biosynthesis in Nostoc punctiforme PCC 73102.

    Science.gov (United States)

    Schöpf, Lotte; Mautz, Jürgen; Sandmann, Gerhard

    2013-05-01

    In the genome of Nostoc punctiforme PCC 73102, three functional β-carotene ketolase genes exist, one of the crtO and two of the crtW type. They were all expressed and their corresponding enzymes were functional inserting 4-keto groups into β-carotene as shown by functional pathway complementation in Escherichia coli. They all synthesized canthaxanthin but with different efficiencies. Canthaxanthin is the photoprotective carotenoid of N. punctiforme PCC 73102. Under high-light stress, its synthesis was enhanced. This was caused by up-regulation of the transcripts of two genes in combination. The first crtB-encoding phytoene synthase is the gate way enzyme of carotenogenesis resulting in an increased inflow into the pathway. The second was the ketolase gene crtW148 which in high light takes over β-carotene conversion into canthaxanthin from the other ketolases. The other ketolases were down-regulated under high-light conditions. CrtW148 was also exclusively responsible for the last step in 4-keto-myxoxanthophyll synthesis.

  12. 2-Methyl-3-buten-2-ol (MBO) synthase expression in Nostoc punctiforme leads to over production of phytols.

    Science.gov (United States)

    Gupta, Dinesh; Ip, Tina; Summers, Michael L; Basu, Chhandak

    2015-01-01

    Phytol is a diterpene alcohol of medicinal importance and it also has potential to be used as biofuel. We found over production of phytol in Nostoc punctiforme by expressing a 2-Methyl-3-buten-2-ol (MBO) synthase gene. MBO synthase catalyzes the conversion of dimethylallyl pyrophosphate (DMAPP) into MBO, a volatile hemiterpene alcohol, in Pinus sabiniana. The result of enhanced phytol production in N. punctiforme, instead of MBO, could be explained by one of the 2 models: either the presence of a native prenyltransferase enzyme with a broad substrate specificity, or appropriation of a MBO synthase metabolic intermediate by a native geranyl diphosphate (GDP) synthase. In this work, an expression vector with an indigenous petE promoter for gene expression in the cyanobacterium N. punctiforme was constructed and MBO synthase gene expression was successfully shown using reverse transcriptase (RT)-PCR and SDS-PAGE. Gas chromatography--mass spectrophotometry (GC-MS) was performed to confirm phytol production from the transgenic N. punctiforme strains. We conclude that the expression of MBO synthase in N. punctiforme leads to overproduction of an economically important compound, phytol. This study provides insights about metabolic channeling of isoprenoids in cyanobacteria and also illustrates the challenges of bioengineering non-native hosts to produce economically important compounds.

  13. Characterization of the hupSL promoter activity in Nostoc punctiforme ATCC 29133

    Science.gov (United States)

    2009-01-01

    Background In cyanobacteria three enzymes are directly involved in the hydrogen metabolism; a nitrogenase that produces molecular hydrogen, H2, as a by-product of nitrogen fixation, an uptake hydrogenase that recaptures H2 and oxidize it, and a bidirectional hydrogenase that can both oxidize and produce H2.Nostoc punctiforme ATCC 29133 is a filamentous dinitrogen fixing cyanobacterium containing a nitrogenase and an uptake hydrogenase but no bidirectional hydrogenase. Generally, little is known about the transcriptional regulation of the cyanobacterial uptake hydrogenases. In this study gel shift assays showed that NtcA has a specific affinity to a region of the hupSL promoter containing a predicted NtcA binding site. The predicted NtcA binding site is centred at 258.5 bp upstream the transcription start point (tsp). To further investigate the hupSL promoter, truncated versions of the hupSL promoter were fused to either gfp or luxAB, encoding the reporter proteins Green Fluorescent Protein and Luciferase, respectively. Results Interestingly, all hupsSL promoter deletion constructs showed heterocyst specific expression. Unexpectedly the shortest promoter fragment, a fragment covering 57 bp upstream and 258 bp downstream the tsp, exhibited the highest promoter activity. Deletion of the NtcA binding site neither affected the expression to any larger extent nor the heterocyst specificity. Conclusion Obtained data suggest that the hupSL promoter in N. punctiforme is not strictly dependent on the upstream NtcA cis element and that the shortest promoter fragment (-57 to tsp) is enough for a high and heterocyst specific expression of hupSL. This is highly interesting because it indicates that the information that determines heterocyst specific gene expression might be confined to this short sequence or in the downstream untranslated leader sequence. PMID:19284581

  14. Hopanoids play a role in stress tolerance and nutrient storage in the cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Ricci, J N; Morton, R; Kulkarni, G; Summers, M L; Newman, D K

    2017-01-01

    Hopanes are abundant in ancient sedimentary rocks at discrete intervals in Earth history, yet interpreting their significance in the geologic record is complicated by our incomplete knowledge of what their progenitors, hopanoids, do in modern cells. To date, few studies have addressed the breadth of diversity of physiological functions of these lipids and whether those functions are conserved across the hopanoid-producing bacterial phyla. Here, we generated mutants in the filamentous cyanobacterium, Nostoc punctiforme, that are unable to make all hopanoids (shc) or 2-methylhopanoids (hpnP). While the absence of hopanoids impedes growth of vegetative cells at high temperature, the shc mutant grows faster at low temperature. This finding is consistent with hopanoids acting as membrane rigidifiers, a function shared by other hopanoid-producing phyla. Apart from impacting fitness under temperature stress, hopanoids are dispensable for vegetative cells under other stress conditions. However, hopanoids are required for stress tolerance in akinetes, a resting survival cell type. While 2-methylated hopanoids do not appear to contribute to any stress phenotype, total hopanoids and to a lesser extent 2-methylhopanoids were found to promote the formation of cyanophycin granules in akinetes. Finally, although hopanoids support symbiotic interactions between Alphaproteobacteria and plants, they do not appear to facilitate symbiosis between N. punctiforme and the hornwort Anthoceros punctatus. Collectively, these findings support interpreting hopanes as general environmental stress biomarkers. If hopanoid-mediated enhancement of nitrogen-rich storage products turns out to be a conserved phenomenon in other organisms, a better understanding of this relationship may help us parse the enrichment of 2-methylhopanes in the rock record during episodes of disrupted nutrient cycling. © 2016 John Wiley & Sons Ltd.

  15. Molecular and cellular characterisation of the zinc uptake (Znu) system of Nostoc punctiforme.

    Science.gov (United States)

    Hudek, Lee; Pearson, Leanne A; Michalczyk, Agnes; Neilan, Brett A; Ackland, M Leigh

    2013-11-01

    Metal homoeostasis in cyanobacteria is based on uptake and export systems that are controlled by their own regulators. This study characterises the zinc uptake (Znu) system in Nostoc punctiforme. The system was found to comprise of three subunits in an ACB operon: a Zn(2+)-binding protein (ZnuA18), a transmembrane domain (ZnuB) and an ATPase (ZnuC). These proteins are encoded within the znu operon regulated by a zinc uptake transcription repressor (Zur). Interestingly, a second Zn(2+)-binding protein (ZnuA08) was also identified at a distal genomic location. Interactions between components of the ZnuACB system were investigated using knockouts of the individual genes. The znuA08(-), znuA18(-), znuB(-) and znuC(-) mutants displayed overall reduced znuACB transcript levels, suggesting that all system components are required for normal expression of znu genes. Zinc uptake assays in the Zn(2+)-binding protein mutant strains showed that the disruption of znuA18 had a greater negative effect on zinc uptake than disruption of znuA08. Complementation studies in Escherichia coli indicated that both znuA08 and znuA18 were able to restore zinc uptake in a znuA(-) mutant, with znuA18 permitting the highest zinc uptake rate. The N. punctiforme zur was also able to complement the E. coli zur(-) mutant. © 2013 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.

  16. Mutational studies of putative biosynthetic genes for the cyanobacterial sunscreen scytonemin in Nostoc punctiforme ATCC 29133

    Directory of Open Access Journals (Sweden)

    Daniela eFerreira

    2016-05-01

    Full Text Available The heterocyclic indole-alkaloid scytonemin is a sunscreen found exclusively among cyanobacteria. An 18-gene cluster is responsible for scytonemin production in Nostoc punctiforme ATCC 29133. The upstream genes scyABCDEF in the cluster are proposed to be responsible for scytonemin biosynthesis from aromatic amino acid substrates. In vitro studies of ScyA, ScyB and ScyC proved that these enzymes indeed catalyze initial pathway reactions. Here we characterize the role of ScyD, ScyE and ScyF, which were logically predicted to be responsible for late biosynthetic steps, in the biological context of N. punctiforme. In-frame deletion mutants of each were constructed (∆scyD, ∆scyE and ∆scyF and their phenotypes studied. Expectedly, ∆scyE presents a scytoneminless phenotype, but no accumulation of the predicted intermediaries. Surprisingly, ∆scyD retains scytonemin production, implying that it is not required for biosynthesis. Indeed, scyD presents an interesting evolutionary paradox: it likely originated in a duplication event from scyE, and unlike other genes in the operon, it has not been subjected to purifying selection. This would suggest that it is a pseudogene, and yet scyD is highly conserved in the scytonemin operon of cyanobacteria. ∆scyF also retains scytonemin production, albeit exhibiting a reduction of the production yield compared with the wild-type. This indicates that ScyF is not essential but may play an adjuvant role for scytonemin synthesis. Altogether, our findings suggest that these downstream genes are not responsible, as expected, for the late steps of scytonemin synthesis and we must look for those functions elsewhere. These findings are particularly important for biotechnological production of this sunscreen through heterologous expression of its genes in more tractable organisms.

  17. Characterization of the hupSL promoter activity in Nostoc punctiforme ATCC 29133

    Directory of Open Access Journals (Sweden)

    Lindberg Pia

    2009-03-01

    Full Text Available Abstract Background In cyanobacteria three enzymes are directly involved in the hydrogen metabolism; a nitrogenase that produces molecular hydrogen, H2, as a by-product of nitrogen fixation, an uptake hydrogenase that recaptures H2 and oxidize it, and a bidirectional hydrogenase that can both oxidize and produce H2.Nostoc punctiforme ATCC 29133 is a filamentous dinitrogen fixing cyanobacterium containing a nitrogenase and an uptake hydrogenase but no bidirectional hydrogenase. Generally, little is known about the transcriptional regulation of the cyanobacterial uptake hydrogenases. In this study gel shift assays showed that NtcA has a specific affinity to a region of the hupSL promoter containing a predicted NtcA binding site. The predicted NtcA binding site is centred at 258.5 bp upstream the transcription start point (tsp. To further investigate the hupSL promoter, truncated versions of the hupSL promoter were fused to either gfp or luxAB, encoding the reporter proteins Green Fluorescent Protein and Luciferase, respectively. Results Interestingly, all hupsSL promoter deletion constructs showed heterocyst specific expression. Unexpectedly the shortest promoter fragment, a fragment covering 57 bp upstream and 258 bp downstream the tsp, exhibited the highest promoter activity. Deletion of the NtcA binding site neither affected the expression to any larger extent nor the heterocyst specificity. Conclusion Obtained data suggest that the hupSL promoter in N. punctiforme is not strictly dependent on the upstream NtcA cis element and that the shortest promoter fragment (-57 to tsp is enough for a high and heterocyst specific expression of hupSL. This is highly interesting because it indicates that the information that determines heterocyst specific gene expression might be confined to this short sequence or in the downstream untranslated leader sequence.

  18. Cellular and functional specificity among ferritin-like proteins in the multicellular cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Ekman, Martin; Sandh, Gustaf; Nenninger, Anja; Oliveira, Paulo; Stensjö, Karin

    2014-03-01

    Ferritin-like proteins constitute a remarkably heterogeneous protein family, including ferritins, bacterioferritins and Dps proteins. The genome of the filamentous heterocyst-forming cyanobacterium Nostoc punctiforme encodes five ferritin-like proteins. In the present paper, we report a multidimensional characterization of these proteins. Our phylogenetic and bioinformatics analyses suggest both structural and physiological differences among the ferritin-like proteins. The expression of these five genes responded differently to hydrogen peroxide treatment, with a significantly higher rise in transcript level for Npun_F3730 as compared with the other four genes. A specific role for Npun_F3730 in the cells tolerance against hydrogen peroxide was also supported by the inactivation of Npun_F3730, Npun_R5701 and Npun_R6212; among these, only the ΔNpun_F3730 strain showed an increased sensitivity to hydrogen peroxide compared with wild type. Analysis of promoter-GFP reporter fusions of the ferritin-like genes indicated that Npun_F3730 and Npun_R5701 were expressed in all cell types of a diazotrophic culture, while Npun_F6212 was expressed specifically in heterocysts. Our study provides the first comprehensive analysis combining functional differentiation and cellular specificity within this important group of proteins in a multicellular cyanobacterium. © 2013 John Wiley & Sons Ltd and Society for Applied Microbiology.

  19. Biochemical characterization of an L-tryptophan dehydrogenase from the photoautotrophic cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Ogura, Ryutaro; Wakamatsu, Taisuke; Mutaguchi, Yuta; Doi, Katsumi; Ohshima, Toshihisa

    2014-06-10

    An NAD(+)-dependent l-tryptophan dehydrogenase from Nostoc punctiforme NIES-2108 (NpTrpDH) was cloned and overexpressed in Escherichia coli. The recombinant NpTrpDH with a C-terminal His6-tag was purified to homogeneity using a Ni-NTA agarose column, and was found to be a homodimer with a molecular mass of 76.1kDa. The enzyme required NAD(+) and NADH as cofactors for oxidative deamination and reductive amination, respectively, but not NADP(+) or NADPH. l-Trp was the preferred substrate for deamination, though l-Phe was deaminated at a much lower rate. The enzyme exclusively aminated 3-indolepyruvate; phenylpyruvate was inert. The pH optima for the deamination of l-Trp and amination of 3-indolpyruvate were 11.0 and 7.5, respectively. For deamination of l-Trp, maximum enzymatic activity was observed at 45°C. NpTrpDH retained more than 80% of its activity after incubation for 30min at pHs ranging from 5.0 to 11.5 or incubation for 10min at temperatures up to 40°C. Unlike l-Trp dehydrogenases from higher plants, NpTrpDH activity was not activated by metal ions. Typical Michaelis-Menten kinetics were observed for NAD(+) and l-Trp for oxidative deamination, but with reductive amination there was marked substrate inhibition by 3-indolepyruvate. NMR analysis of the hydrogen transfer from the C4 position of the nicotinamide moiety of NADH showed that NpTrpDH has a pro-S (B-type) stereospecificity similar to the Glu/Leu/Phe/Val dehydrogenase family. Copyright © 2014 Elsevier Inc. All rights reserved.

  20. Peroxide reduction by a metal-dependent catalase in Nostoc punctiforme (cyanobacteria).

    Science.gov (United States)

    Hudek, L; Torriero, A A J; Michalczyk, A A; Neilan, B A; Ackland, M L; Bräu, Lambert

    2017-05-01

    This study investigated the role of a novel metal-dependent catalase (Npun_R4582) that reduces hydrogen peroxide in the cyanobacterium Nostoc punctiforme. Quantitative real-time PCR showed that npun_R4582 relative mRNA levels were upregulated by over 16-fold in cells treated with either 2 μM added Co, 0.5 μM added Cu, 500 μM Mn, 1 μM Ni, or 18 μM Zn. For cells treated with 60 μM H 2 O 2 , no significant alteration in Npun_R4582 relative mRNA levels was detected, while in cells treated with Co, Cu, Mn, Ni, or Zn and 60 μM peroxide, relative mRNA levels were generally above control or peroxide only treated cells. Disruption or overexpression of npun_R4582 altered sensitivity to cells exposed to 60 μM H 2 O 2 and metals for treatments beyond the highest viable concentrations, or in a mixed metal solution for Npun_R4582 - cells. Moreover, overexpression of npun_R4582 increased cellular peroxidase activity in comparison with wild-type and Npun_R4582 - cells, and reduced peroxide levels by over 50%. The addition of cobalt, manganese, nickel, and zinc increased the capacity of Npun_R4582 to reduce the rate or total levels of peroxide produced by cells growing under photooxidative conditions. The work presented confirms the function of NpunR4582 as a catalase and provides insights as to how cells reduce potentially lethal peroxide levels produced by photosynthesis. The findings also show how trace elements play crucial roles as enzymatic cofactors and how the role of Npun_R4582 in hydrogen peroxide breakdown is dependent on the type of metal and the level available to cells.

  1. A Nostoc punctiforme Sugar Transporter Necessary to Establish a Cyanobacterium-Plant Symbiosis1[C][W

    Science.gov (United States)

    Ekman, Martin; Picossi, Silvia; Campbell, Elsie L.; Meeks, John C.; Flores, Enrique

    2013-01-01

    In cyanobacteria-plant symbioses, the symbiotic nitrogen-fixing cyanobacterium has low photosynthetic activity and is supplemented by sugars provided by the plant partner. Which sugars and cyanobacterial sugar uptake mechanism(s) are involved in the symbiosis, however, is unknown. Mutants of the symbiotically competent, facultatively heterotrophic cyanobacterium Nostoc punctiforme were constructed bearing a neomycin resistance gene cassette replacing genes in a putative sugar transport gene cluster. Results of transport activity assays using 14C-labeled fructose and glucose and tests of heterotrophic growth with these sugars enabled the identification of an ATP-binding cassette-type transporter for fructose (Frt), a major facilitator permease for glucose (GlcP), and a porin needed for the optimal uptake of both fructose and glucose. Analysis of green fluorescent protein fluorescence in strains of N. punctiforme bearing frt::gfp fusions showed high expression in vegetative cells and akinetes, variable expression in hormogonia, and no expression in heterocysts. The symbiotic efficiency of N. punctiforme sugar transport mutants was investigated by testing their ability to infect a nonvascular plant partner, the hornwort Anthoceros punctatus. Strains that were specifically unable to transport glucose did not infect the plant. These results imply a role for GlcP in establishing symbiosis under the conditions used in this work. PMID:23463784

  2. The non-metabolizable sucrose analog sucralose is a potent inhibitor of hormogonium differentiation in the filamentous cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Splitt, Samantha D; Risser, Douglas D

    2016-03-01

    Nostoc punctiforme is a filamentous cyanobacterium which forms nitrogen-fixing symbioses with several different plants and fungi. Establishment of these symbioses requires the formation of motile hormogonium filaments. Once infected, the plant partner is thought to supply a hormogonium-repressing factor (HRF) to maintain the cyanobacteria in a vegetative, nitrogen-fixing state. Evidence implies that sucrose may serve as a HRF. Here, we tested the effects of sucralose, a non-metabolizable sucrose analog, on hormogonium differentiation. Sucralose inhibited hormogonium differentiation at a concentration approximately one-tenth that of sucrose. This result implies that: (1) sucrose, not a sucrose catabolite, is perceived by the cell and (2) inhibition is not due to a more general osmolarity-dependent effect. Additionally, both sucrose and sucralose induced the accrual of a polysaccharide sheath which bound specifically to the lectin ConA, indicating the presence of α-D-mannose and/or α-D-glucose. A ConA-specific polysaccharide was also found to be expressed in N. punctiforme colonies from tissue sections of the symbiotically grown hornwort Anthoceros punctatus. These findings imply that plant-derived sucrose or sucrose analogs may have multiple effects on N. punctiforme, including both repression of hormogonia and the induction of a polysaccharide sheath that may be essential to establish and maintain the symbiotic state.

  3. Characterization of two cation diffusion facilitators NpunF0707 and NpunF1794 in Nostoc punctiforme.

    Science.gov (United States)

    Hudek, L; Pearson, L; Michalczyk, A A; Bräu, L; Neilan, B A; Ackland, M L

    2015-11-01

    To characterize genes involved in maintaining homeostatic levels of zinc in the cyanobacterium Nostoc punctiforme. Metal efflux transporters play a central role in maintaining homeostatic levels of trace elements such as zinc. Sequence analyses of the N. punctiforme genome identified two potential cation diffusion facilitator (CDF) metal efflux transporters, Npun_F0707 (Cdf31) and Npun_F1794 (Cdf33). Deletion of either Cdf31or Cdf33 resulted in increased zinc retention over 3 h. Interestingly, Cdf31(-) and Cdf33(-) mutants showed no change in sensitivity to zinc exposure in comparison with the wild type, suggesting some compensatory capacity for the loss of each other. Using qRT-PCR, a possible interaction was observed between the two cdf's, where the Cdf31(-) mutant had a more profound effect on cdf33 expression than Cdf33(-) did on cdf31. Over-expression of Cdf31 and Cdf33 in ZntA(-) - and ZitB(-) -deficient Escherichia coli revealed function similarities between the ZntA and ZitB of E. coli and the cyanobacterial transporters. The data presented shed light on the function of two important transporters that regulate zinc homeostasis in N. punctiforme. This study shows for the first time the functional characterization of two cyanobacterial zinc efflux proteins belonging to the CDF family. © 2015 The Society for Applied Microbiology.

  4. The global response of Nostoc punctiforme ATCC 29133 to UVA stress, assessed in a temporal DNA microarray study.

    Science.gov (United States)

    Soule, Tanya; Gao, Qunjie; Stout, Valerie; Garcia-Pichel, Ferran

    2013-01-01

    Cyanobacteria in nature are exposed not only to the visible spectrum of sunlight but also to its harmful ultraviolet components (UVA and UVB). We used Nostoc punctiforme ATCC 29133 as a model to study the UVA response by analyzing global gene expression patterns using genomic microarrays. UVA exposure resulted in the statistically detectable differential expression of 573 genes of the 6903 that were probed, compared with that of the control cultures. Of those genes, 473 were up-regulated, while only 100 were down-regulated. Many of the down-regulated genes were involved in photosynthetic pigment biosynthesis, indicating a significant shift in this metabolism. As expected, we detected the up-regulation of genes encoding antioxidant enzymes and the sunscreen, scytonemin. However, a majority of the up-regulated genes, 47%, were unassignable bioinformatically to known functional categories, suggesting that the UVA stress response is not well understood. Interestingly, the most dramatic up-regulation involved several contiguous genes of unassigned metabolism on plasmid A. This is the first global UVA stress response analysis of any phototrophic microorganism and the differential expression of 8% of the genes of the Nostoc genome indicates that adaptation to UVA in Nostoc has been an evolutionary force of significance. © 2012 Wiley Periodicals, Inc. Photochemistry and Photobiology © 2012 The American Society of Photobiology.

  5. Diversity and transcription of proteases involved in the maturation of hydrogenases in Nostoc punctiforme ATCC 29133 and Nostoc sp. strain PCC 7120

    Science.gov (United States)

    2009-01-01

    Background The last step in the maturation process of the large subunit of [NiFe]-hydrogenases is a proteolytic cleavage of the C-terminal by a hydrogenase specific protease. Contrary to other accessory proteins these hydrogenase proteases are believed to be specific whereby one type of hydrogenases specific protease only cleaves one type of hydrogenase. In cyanobacteria this is achieved by the gene product of either hupW or hoxW, specific for the uptake or the bidirectional hydrogenase respectively. The filamentous cyanobacteria Nostoc punctiforme ATCC 29133 and Nostoc sp strain PCC 7120 may contain a single uptake hydrogenase or both an uptake and a bidirectional hydrogenase respectively. Results In order to examine these proteases in cyanobacteria, transcriptional analyses were performed of hupW in Nostoc punctiforme ATCC 29133 and hupW and hoxW in Nostoc sp. strain PCC 7120. These studies revealed numerous transcriptional start points together with putative binding sites for NtcA (hupW) and LexA (hoxW). In order to investigate the diversity and specificity among hydrogeanse specific proteases we constructed a phylogenetic tree which revealed several subgroups that showed a striking resemblance to the subgroups previously described for [NiFe]-hydrogenases. Additionally the proteases specificity was also addressed by amino acid sequence analysis and protein-protein docking experiments with 3D-models derived from bioinformatic studies. These studies revealed a so called "HOXBOX"; an amino acid sequence specific for protease of Hox-type which might be involved in docking with the large subunit of the hydrogenase. Conclusion Our findings suggest that the hydrogenase specific proteases are under similar regulatory control as the hydrogenases they cleave. The result from the phylogenetic study also indicates that the hydrogenase and the protease have co-evolved since ancient time and suggests that at least one major horizontal gene transfer has occurred. This co

  6. Diversity and transcription of proteases involved in the maturation of hydrogenases in Nostoc punctiforme ATCC 29133 and Nostoc sp. strain PCC 7120

    Directory of Open Access Journals (Sweden)

    Lindblad Peter

    2009-03-01

    Full Text Available Abstract Background The last step in the maturation process of the large subunit of [NiFe]-hydrogenases is a proteolytic cleavage of the C-terminal by a hydrogenase specific protease. Contrary to other accessory proteins these hydrogenase proteases are believed to be specific whereby one type of hydrogenases specific protease only cleaves one type of hydrogenase. In cyanobacteria this is achieved by the gene product of either hupW or hoxW, specific for the uptake or the bidirectional hydrogenase respectively. The filamentous cyanobacteria Nostoc punctiforme ATCC 29133 and Nostoc sp strain PCC 7120 may contain a single uptake hydrogenase or both an uptake and a bidirectional hydrogenase respectively. Results In order to examine these proteases in cyanobacteria, transcriptional analyses were performed of hupW in Nostoc punctiforme ATCC 29133 and hupW and hoxW in Nostoc sp. strain PCC 7120. These studies revealed numerous transcriptional start points together with putative binding sites for NtcA (hupW and LexA (hoxW. In order to investigate the diversity and specificity among hydrogeanse specific proteases we constructed a phylogenetic tree which revealed several subgroups that showed a striking resemblance to the subgroups previously described for [NiFe]-hydrogenases. Additionally the proteases specificity was also addressed by amino acid sequence analysis and protein-protein docking experiments with 3D-models derived from bioinformatic studies. These studies revealed a so called "HOXBOX"; an amino acid sequence specific for protease of Hox-type which might be involved in docking with the large subunit of the hydrogenase. Conclusion Our findings suggest that the hydrogenase specific proteases are under similar regulatory control as the hydrogenases they cleave. The result from the phylogenetic study also indicates that the hydrogenase and the protease have co-evolved since ancient time and suggests that at least one major horizontal gene transfer

  7. Photoinduced reduction of the medial FeS center in the hydrogenase small subunit HupS from Nostoc punctiforme.

    Science.gov (United States)

    Raleiras, Patrícia; Hammarström, Leif; Lindblad, Peter; Styring, Stenbjörn; Magnuson, Ann

    2015-07-01

    The small subunit from the NiFe uptake hydrogenase, HupSL, in the cyanobacterium Nostoc punctiforme ATCC 29133, has been isolated in the absence of the large subunit (P. Raleiras, P. Kellers, P. Lindblad, S. Styring, A. Magnuson, J. Biol. Chem. 288 (2013) 18,345-18,352). Here, we have used flash photolysis to reduce the iron-sulfur clusters in the isolated small subunit, HupS. We used ascorbate as electron donor to the photogenerated excited state of Ru(II)-trisbipyridine (Ru(bpy)3), to generate Ru(I)(bpy)3 as reducing agent. Our results show that the isolated small subunit can be reduced by the Ru(I)(bpy)3 generated through flash photolysis. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. The response regulator Npun_F1278 is essential for scytonemin biosynthesis in the cyanobacterium Nostoc punctiforme ATCC 29133.

    Science.gov (United States)

    Naurin, Sejuti; Bennett, Janine; Videau, Patrick; Philmus, Benjamin; Soule, Tanya

    2016-08-01

    Following exposure to long-wavelength ultraviolet radiation (UVA), some cyanobacteria produce the indole-alkaloid sunscreen scytonemin. The genomic region associated with scytonemin biosynthesis in the cyanobacterium Nostoc punctiforme includes 18 cotranscribed genes. A two-component regulatory system (Npun_F1277/Npun_F1278) directly upstream from the biosynthetic genes was identified through comparative genomics and is likely involved in scytonemin regulation. In this study, the response regulator (RR), Npun_F1278, was evaluated for its ability to regulate scytonemin biosynthesis using a mutant strain of N. punctiforme deficient in this gene, hereafter strain Δ1278. Following UVA radiation, the typical stimulus to initiate scytonemin biosynthesis, Δ1278 was incapable of producing scytonemin. A phenotypic characterization of Δ1278 suggests that aside from the ability to produce scytonemin, the deletion of the Npun_F1278 gene does not affect the cellular morphology, cellular differentiation capability, or lipid-soluble pigment complement of Δ1278 compared to the wildtype. The mutant, however, had a slower specific growth rate under white light and produced ~2.5-fold more phycocyanin per cell under UVA than the wildtype. Since Δ1278 does not produce scytonemin, this study demonstrates that the RR gene, Npun_F1278, is essential for scytonemin biosynthesis in N. punctiforme. While most of the evaluated effects of this gene appear to be specific for scytonemin, this regulator may also influence the overall health of the cell and phycobiliprotein synthesis, directly or indirectly. This is the first study to identify a regulatory gene involved in the biosynthesis of the sunscreen scytonemin and posits a link between cell growth, pigment synthesis, and sunscreen production. © 2016 Phycological Society of America.

  9. Structural Insights into l-Tryptophan Dehydrogenase from a Photoautotrophic Cyanobacterium, Nostoc punctiforme.

    Science.gov (United States)

    Wakamatsu, Taisuke; Sakuraba, Haruhiko; Kitamura, Megumi; Hakumai, Yuichi; Fukui, Kenji; Ohnishi, Kouhei; Ashiuchi, Makoto; Ohshima, Toshihisa

    2017-01-15

    l-Tryptophan dehydrogenase from Nostoc punctiforme NIES-2108 (NpTrpDH), despite exhibiting high amino acid sequence identity (>30%)/homology (>50%) with NAD(P) + -dependent l-Glu/l-Leu/l-Phe/l-Val dehydrogenases, exclusively catalyzes reversible oxidative deamination of l-Trp to 3-indolepyruvate in the presence of NAD + Here, we determined the crystal structure of the apo form of NpTrpDH. The structure of the NpTrpDH monomer, which exhibited high similarity to that of l-Glu/l-Leu/l-Phe dehydrogenases, consisted of a substrate-binding domain (domain I, residues 3 to 133 and 328 to 343) and an NAD + /NADH-binding domain (domain II, residues 142 to 327) separated by a deep cleft. The apo-NpTrpDH existed in an open conformation, where domains I and II were apart from each other. The subunits dimerized themselves mainly through interactions between amino acid residues around the β-1 strand of each subunit, as was observed in the case of l-Phe dehydrogenase. The binding site for the substrate l-Trp was predicted by a molecular docking simulation and validated by site-directed mutagenesis. Several hydrophobic residues, which were located in the active site of NpTrpDH and possibly interacted with the side chain of the substrate l-Trp, were arranged similarly to that found in l-Leu/l-Phe dehydrogenases but fairly different from that of an l-Glu dehydrogenase. Our crystal structure revealed that Met-40, Ala-69, Ile-74, Ile-110, Leu-288, Ile-289, and Tyr-292 formed a hydrophobic cluster around the active site. The results of the site-directed mutagenesis experiments suggested that the hydrophobic cluster plays critical roles in protein folding, l-Trp recognition, and catalysis. Our results provide critical information for further characterization and engineering of this enzyme. In this study, we determined the three-dimensional structure of l-Trp dehydrogenase, analyzed its various site-directed substitution mutants at residues located in the active site, and obtained the

  10. Comparative transcriptomics with a motility-deficient mutant leads to identification of a novel polysaccharide secretion system in Nostoc punctiforme.

    Science.gov (United States)

    Risser, Douglas D; Meeks, John C

    2013-02-01

    Many filamentous cyanobacteria are capable of gliding motility by an undefined mechanism. Within the heterocyst-forming clades, some strains, such as the Nostoc spp. and Fisherella spp., are motile only as specialized filaments termed hormogonia. Here we report on the phenotype of inactivation of a methyl-accepting chemotaxis-like protein in Nostoc punctiforme, designated HmpD. The gene hmpD was found to be essential for hormogonium development, motility and polysaccharide secretion. Comparative global transcriptional profiling of the ΔhmpD strain demonstrated that HmpD has a profound effect on the transcriptional programme of hormogonium development, influencing approximately half of the genes differentially transcribed during differentiation. Utilizing this transcriptomic data, we identified a gene locus, designated here as hps, that appears to encode for a novel polysaccharide secretion system. Transcripts for the genes in the hps locus are upregulated in two steps, with the second step dependent on HmpD. Deletion of hpsA, hpsBCD or hpsEFG resulted in the complete loss of motility and polysaccharide secretion, similar to deletion of hmpD. Genes in the hps locus are highly conserved in the filamentous cyanobacteria, but generally absent in unicellular strains, implying a common mechanism of motility unique to the filamentous cyanobacteria. © 2012 Blackwell Publishing Ltd.

  11. Lack of Methylated Hopanoids Renders the Cyanobacterium Nostoc punctiforme Sensitive to Osmotic and pH Stress.

    Science.gov (United States)

    Garby, Tamsyn J; Matys, Emily D; Ongley, Sarah E; Salih, Anya; Larkum, Anthony W D; Walter, Malcolm R; Summons, Roger E; Neilan, Brett A

    2017-07-01

    To investigate the function of 2-methylhopanoids in modern cyanobacteria, the hpnP gene coding for the radical S -adenosyl methionine (SAM) methylase protein that acts on the C-2 position of hopanoids was deleted from the filamentous cyanobacterium Nostoc punctiforme ATCC 29133S. The resulting Δ hpnP mutant lacked all 2-methylhopanoids but was found to produce much higher levels of two bacteriohopanepentol isomers than the wild type. Growth rates of the Δ hpnP mutant cultures were not significantly different from those of the wild type under standard growth conditions. Akinete formation was also not impeded by the absence of 2-methylhopanoids. The relative abundances of the different hopanoid structures in akinete-dominated cultures of the wild-type and Δ hpnP mutant strains were similar to those of vegetative cell-dominated cultures. However, the Δ hpnP mutant was found to have decreased growth rates under both pH and osmotic stress, confirming a role for 2-methylhopanoids in stress tolerance. Evidence of elevated photosystem II yield and NAD(P)H-dependent oxidoreductase activity in the Δ hpnP mutant under stress conditions, compared to the wild type, suggested that the absence of 2-methylhopanoids increases cellular metabolic rates under stress conditions. IMPORTANCE As the first group of organisms to develop oxygenic photosynthesis, Cyanobacteria are central to the evolutionary history of life on Earth and the subsequent oxygenation of the atmosphere. To investigate the origin of cyanobacteria and the emergence of oxygenic photosynthesis, geobiologists use biomarkers, the remnants of lipids produced by different organisms that are found in geologic sediments. 2-Methylhopanes have been considered indicative of cyanobacteria in some environmental settings, with the parent lipids 2-methylhopanoids being present in many contemporary cyanobacteria. We have created a Nostoc punctiforme Δ hpnP mutant strain that does not produce 2-methylhopanoids to assess the

  12. Dynamic localization of HmpF regulates type IV pilus activity and directional motility in the filamentous cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Cho, Ye Won; Gonzales, Alfonso; Harwood, Thomas V; Huynh, Jessica; Hwang, Yeji; Park, Jun Sang; Trieu, Anthony Q; Italia, Parth; Pallipuram, Vivek K; Risser, Douglas D

    2017-10-01

    Many cyanobacteria exhibit surface motility powered by type 4 pili (T4P). In the model filamentous cyanobacterium Nostoc punctiforme, the T4P systems are arrayed in static, bipolar rings in each cell. The chemotaxis-like Hmp system is essential for motility and the coordinated polar accumulation of PilA on cells in motile filaments, while the Ptx system controls positive phototaxis. Using transposon mutagenesis, a gene, designated hmpF, was identified as involved in motility. Synteny among filamentous cyanobacteria and the similar expression patterns for hmpF and hmpD imply that HmpF is part of the Hmp system. Deletion of hmpF produced a phenotype distinct from other hmp genes, but indistinguishable from pilB or pilQ. Both an HmpF-GFPuv fusion protein, and PilA, as assessed by in situ immunofluorescence, displayed coordinated, unipolar localization at the leading pole of each cell. Reversals were modulated by changes in light intensity and preceded by the migration of HmpF-GFPuv to the lagging cell poles. These results are consistent with a model where direct interaction between HmpF and the T4P system activates pilus extension, the Hmp system facilitates coordinated polarity of HmpF to establish motility, and the Ptx system modulates HmpF localization to initiate reversals in response to changes in light intensity. © 2017 John Wiley & Sons Ltd.

  13. Gene expression of a two-component regulatory system associated with sunscreen biosynthesis in the cyanobacterium Nostoc punctiforme ATCC 29133.

    Science.gov (United States)

    Janssen, Jacob; Soule, Tanya

    2016-01-01

    Long-wavelength ultraviolet radiation (UVA) can damage cells through photooxidative stress, leading to harmful photosensitized proteins and pigments in cyanobacteria. To mitigate damage, some cyanobacteria secrete the UVA-absorbing pigment scytonemin into their extracellular sheath. Comparative genomic analyses suggest that scytonemin biosynthesis is regulated by the two-component regulatory system (TCRS) proteins encoded by Npun_F1277 and Npun_F1278 in the cyanobacterium Nostoc punctiforme ATCC 29133. To understand the dynamics of these genes, their expression was measured following exposure to UVA, UVB, high visible (VIS) irradiance and oxidative stress for 20, 40 and 60 min. Overall, both genes had statistically similar patterns of expression for all four conditions and were generally upregulated, except for those exposed to UVB by 60 min and for the cells under oxidative stress. The greatest UVA response was an upregulation by 20 min, while the response to UVB was the most dramatic and persisted through 40 min. High VIS irradiance resulted in a modest upregulation, while oxidative stress caused a slight downregulation. Both genes were also found to occur on the same transcript. These results demonstrate that these genes are positively responding to several light-associated conditions, which suggests that this TCRS may regulate more than just scytonemin biosynthesis under UVA stress. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  14. Extracellular Polysaccharide Production in a Scytonemin-Deficient Mutant of Nostoc punctiforme Under UVA and Oxidative Stress.

    Science.gov (United States)

    Soule, Tanya; Shipe, Dexter; Lothamer, Justin

    2016-10-01

    Some cyanobacteria can protect themselves from ultraviolet radiation by producing sunscreen pigments. In particular, the sheath pigment scytonemin protects cells against long-wavelength UVA radiation and is only found in cyanobacteria which are capable of extracellular polysaccharide (EPS) production. The presence of a putative glycosyltransferase encoded within the scytonemin gene cluster, along with the localization of scytonemin and EPS to the extracellular sheath, prompted us to investigate the relationship between scytonemin and EPS production under UVA stress. In this study, it was hypothesized that there would be a relationship between the biosynthesis of scytonemin and EPS under both UVA and oxidative stress, since the latter is a by-product of UVA radiation. EPS production was measured following exposure of wild-type Nostoc punctiforme and the non-scytonemin-producing strain SCY59 to UVA and oxidative stress. Under UVA, SCY59 produced significantly more EPS than the unstressed controls and the wild type, while both strains produced more EPS under oxidative stress compared to the controls. The results suggest that EPS secretion occurs in response to the oxidative stress by-product of UVA rather than as a direct response to UVA radiation.

  15. Characterization of a novel debranching enzyme from Nostoc punctiforme possessing a high specificity for long branched chains

    International Nuclear Information System (INIS)

    Choi, Ji-Hye; Lee, Heeseob; Kim, Young-Wan; Park, Jong-Tae; Woo, Eui-Jeon; Kim, Myo-Jeong; Lee, Byong-Hoon; Park, Kwan-Hwa

    2009-01-01

    A novel debranching enzyme from Nostoc punctiforme PCC73102 (NPDE) exhibits hydrolysis activity toward both α-(1,6)- and α-(1,4)-glucosidic linkages. The action patterns of NPDE revealed that branched chains are released first, and the resulting maltooligosaccharides are then hydrolyzed. Analysis of the reaction with maltooligosaccharide substrates labeled with 14 C-glucose at the reducing end shows that NPDE specifically liberates glucose from the reducing end. Kinetic analyses showed that the hydrolytic activity of NPDE is greatly affected by the length of the substrate. The catalytic efficiency of NPDE increased considerably upon using substrates that can occupy at least eight glycone subsites such as maltononaose and maltooctaosyl-α-(1,6)-β-cyclodextrin. These results imply that NPDE has a unique subsite structure consisting of -8 to +1 subsites. Given its unique subsite structure, side chains shorter than maltooctaose in amylopectin were resistant to hydrolysis by NPDE, and the population of longer side chains was reduced.

  16. A hydrogen-producing, hydrogenase-free mutant strain of Nostoc punctiforme ATCC 29133

    Energy Technology Data Exchange (ETDEWEB)

    Lindberg, P.; Lindblad, P. [Uppsala Univ. (Sweden). Dept. of Physiological Botany; Schuetz, K.; Happe, T. [Universitaet Bonn (Germany). Botanisches Inst.

    2002-12-01

    The hupL gene, encoding the uptake hydrogenase large subunit, in Nostoc sp. strain ATCC 29133, a strain lacking a bidirectional hydrogenase, was inactivated by insertional mutagenesis. Recombinant strains were isolated and analysed, and one hupL{sup -} strain, NHM5, was selected for further study. Cultures of NHM5 were grown under nitrogen-fixing conditions and H{sub 2} evolution under air was observed using an H{sub 2} electrode. (Author)

  17. Molecular Cloning and Biochemical Characterization of the Iron Superoxide Dismutase from the Cyanobacterium Nostoc punctiforme ATCC 29133 and Its Response to Methyl Viologen-Induced Oxidative Stress.

    Science.gov (United States)

    Moirangthem, Lakshmipyari Devi; Ibrahim, Kalibulla Syed; Vanlalsangi, Rebecca; Stensjö, Karin; Lindblad, Peter; Bhattacharya, Jyotirmoy

    2015-12-01

    Superoxide dismutase (SOD) detoxifies cell-toxic superoxide radicals and constitutes an important component of antioxidant machinery in aerobic organisms, including cyanobacteria. The iron-containing SOD (SodB) is one of the most abundant soluble proteins in the cytosol of the nitrogen-fixing cyanobacterium Nostoc punctiforme ATCC 29133, and therefore, we investigated its biochemical properties and response to oxidative stress. The putative SodB-encoding open reading frame Npun_R6491 was cloned and overexpressed in Escherichia coli as a C-terminally hexahistidine-tagged protein. The purified recombinant protein had a SodB specific activity of 2560 ± 48 U/mg protein at pH 7.8 and was highly thermostable. The presence of a characteristic iron absorption peak at 350 nm, and its sensitivity to H2O2 and azide, confirmed that the SodB is an iron-containing SOD. Transcript level of SodB in nitrogen-fixing cultures of N. punctiforme decreased considerably (threefold) after exposure to an oxidative stress-generating herbicide methyl viologen for 4 h. Furthermore, in-gel SOD activity analysis of such cultures grown at increasing concentrations of methyl viologen also showed a loss of SodB activity. These results suggest that SodB is not the primary scavenger of superoxide radicals induced by methyl viologen in N. punctiforme.

  18. A high constitutive catalase activity confers resistance to methyl viologen-promoted oxidative stress in a mutant of the cyanobacterium Nostoc punctiforme ATCC 29133.

    Science.gov (United States)

    Moirangthem, Lakshmipyari Devi; Bhattacharya, Sudeshna; Stensjö, Karin; Lindblad, Peter; Bhattacharya, Jyotirmoy

    2014-04-01

    A spontaneous methyl viologen (MV)-resistant mutant of the nitrogen-fixing cyanobacterium Nostoc punctiforme ATCC 29133 was isolated and the major enzymatic antioxidants involved in combating MV-induced oxidative stress were evaluated. The mutant displayed a high constitutive catalase activity as a consequence of which, the intracellular level of reactive oxygen species in the mutant was lower than the wild type (N. punctiforme) in the presence of MV. The superoxide dismutase (SOD) activity that consisted of a SodA (manganese-SOD) and a SodB (iron-SOD) was not suppressed in the mutant following MV treatment. The mutant was, however, characterised by a lower peroxidase activity compared with its wild type, and its improved tolerance to externally added H₂O₂ could only be attributed to enhanced catalase activity. Furthermore, MV-induced toxic effects on the wild type such as (1) loss of photosynthetic performance assessed as maximal quantum yield of photosystem II, (2) nitrogenase inactivation, and (3) filament fragmentation and cell lysis were not observed in the mutant. These findings highlight the importance of catalase in preventing MV-promoted oxidative damage and cell death in the cyanobacterium N. punctiforme. Such oxidative stress resistant mutants of cyanobacteria are likely to be a better source of biofertilisers, as they can grow and fix nitrogen in an unhindered manner in agricultural fields that are often contaminated with the herbicide MV, also commonly known as paraquat.

  19. Crystallization and preliminary X-ray crystallographic analysis of the GluR0 ligand-binding core from Nostoc punctiforme

    International Nuclear Information System (INIS)

    Lee, Jun Hyuck; Park, Soo Jeong; Rho, Seong-Hwan; Im, Young Jun; Kim, Mun-Kyoung; Kang, Gil Bu; Eom, Soo Hyun

    2005-01-01

    The GluR0 ligand-binding core from N. punctiforme was expressed, purified and crystallized in the presence of l-glutamate. A diffraction data set was collected to a resolution of 2.1 Å. GluR0 from Nostoc punctiforme (NpGluR0) is a bacterial homologue of the ionotropic glutamate receptor. The ligand-binding core of NpGluR0 was crystallized at 294 K using the hanging-drop vapour-diffusion method. The l-glutamate-complexed crystal belongs to space group C222 1 , with unit-cell parameters a = 78.0, b = 145.1, c = 132.1 Å. The crystals contain three subunits in the asymmetric unit, with a V M value of 2.49 Å 3 Da −1 . The diffraction limit of the l-glutamate complex data set was 2.1 Å using synchrotron X-ray radiation at beamline BL-4A of the Pohang Accelerator Laboratory (Pohang, Korea)

  20. The ZntA-like NpunR4017 plays a key role in maintaining homeostatic levels of zinc in Nostoc punctiforme.

    Science.gov (United States)

    Hudek, L; Bräu, L; Michalczyk, A A; Neilan, B A; Meeks, J C; Ackland, M L

    2015-12-01

    Analysis of cellular response to zinc exposure provides insights into how organisms maintain homeostatic levels of zinc that are essential, while avoiding potentially toxic cytosolic levels. Using the cyanobacterium Nostoc punctiforme as a model, qRT-PCR analyses established a profile of the changes in relative mRNA levels of the ZntA-like zinc efflux transporter NpunR4017 in response to extracellular zinc. In cells treated with 18 μM of zinc for 1 h, NpunR4017 mRNA levels increased by up to 1300 % above basal levels. The accumulation and retention of radiolabelled (65)Zn by NpunR4107-deficient and overexpressing strains were compared to wild-type levels. Disruption of NpunR4017 resulted in a significant increase in zinc accumulation up to 24 % greater than the wild type, while cells overexpressing NpunR4107 accumulated 22 % less than the wild type. Accumulation of (65)Zn in ZntA(-) Escherichia coli overexpressing NpunR4017 was reduced by up to 21 %, indicating the capacity for NpunR4017 to compensate for the loss of ZntA. These findings establish the newly identified NpunR4017 as a zinc efflux transporter and a key transporter for maintaining zinc homeostasis in N. punctiforme.

  1. Crystallization and preliminary X-ray crystallographic analysis of the GluR0 ligand-binding core from Nostoc punctiforme

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jun Hyuck; Park, Soo Jeong; Rho, Seong-Hwan; Im, Young Jun; Kim, Mun-Kyoung; Kang, Gil Bu; Eom, Soo Hyun, E-mail: eom@gist.ac.kr [Department of Life Science, Gwangju Institute of Science and Technology, Gwangju 500-712 (Korea, Republic of)

    2005-11-01

    The GluR0 ligand-binding core from N. punctiforme was expressed, purified and crystallized in the presence of l-glutamate. A diffraction data set was collected to a resolution of 2.1 Å. GluR0 from Nostoc punctiforme (NpGluR0) is a bacterial homologue of the ionotropic glutamate receptor. The ligand-binding core of NpGluR0 was crystallized at 294 K using the hanging-drop vapour-diffusion method. The l-glutamate-complexed crystal belongs to space group C222{sub 1}, with unit-cell parameters a = 78.0, b = 145.1, c = 132.1 Å. The crystals contain three subunits in the asymmetric unit, with a V{sub M} value of 2.49 Å{sup 3} Da{sup −1}. The diffraction limit of the l-glutamate complex data set was 2.1 Å using synchrotron X-ray radiation at beamline BL-4A of the Pohang Accelerator Laboratory (Pohang, Korea)

  2. Systems Level Approaches to Understanding and Manipulating Heterocyst Differentiation in Nostoc Punctiforme: Sites of Hydrogenase and Nitrogenase Synthesis and Activity

    Energy Technology Data Exchange (ETDEWEB)

    Meeks, John C. [University of California, Davis, CA (United States)

    2015-04-02

    Heterocysts are specialized cells that establish a physiologically low oxygen concentration; they function as the sites of oxygen-sensitive nitrogen fixation and hydrogen metabolism in certain filamentous cyanobacteria. They are present at a frequency of less than 10% of the cells and singly in a nonrandom spacing pattern in the filaments. The extent of differential gene expression during heterocyst differentiation was defined by DNA microarray analysis in wild type and mutant cultures of Nostoc punctiforme. The results in wild-type cultures identified two groups of genes; approximately 440 that are unique to heterocyst formation and function, and 500 that respond positively and negatively to the transient stress of nitrogen starvation. Nitrogen fixation is initiated within 24 h after induction, but the cultures require another 24 h before growth is reinitiated. Microarray analyses were conducted on strains with altered expression of three genes that regulate the presence and spacing of heterocysts in the filaments; loss of function or over expression of these genes increases the heterocyst frequency 2 to 3 fold compared to the wild-type. Mutations in the genes hetR and hetF result in the inability to differentiate heterocysts, whereas over expression of each gene individually yields multiple contiguous heterocysts at sites in the filaments; they are positive regulatory elements. Mutation of the gene patN results in an increase in heterocysts frequency, but, in this case, the heterocysts are singly spaced in the filaments with a decrease in the number of vegetative cells in the interval between heterocysts; this is a negative regulatory element. However, over expression of patN resulted in the wild-type heterocyst frequency and spacing pattern. Microarray results indicated HetR and HetF influence the transcription of a common set of about 395 genes, as well as about 350 genes unique to each protein. HetR is known to be a transcriptional regulator and HetF is

  3. A Putative O-Linked β-N-Acetylglucosamine Transferase Is Essential for Hormogonium Development and Motility in the Filamentous Cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Khayatan, Behzad; Bains, Divleen K; Cheng, Monica H; Cho, Ye Won; Huynh, Jessica; Kim, Rachelle; Omoruyi, Osagie H; Pantoja, Adriana P; Park, Jun Sang; Peng, Julia K; Splitt, Samantha D; Tian, Mason Y; Risser, Douglas D

    2017-05-01

    Most species of filamentous cyanobacteria are capable of gliding motility, likely via a conserved type IV pilus-like system that may also secrete a motility-associated polysaccharide. In a subset of these organisms, motility is achieved only after the transient differentiation of hormogonia, which are specialized filaments that enter a nongrowth state dedicated to motility. Despite the fundamental importance of hormogonia to the life cycles of many filamentous cyanobacteria, the molecular regulation of hormogonium development is largely undefined. To systematically identify genes essential for hormogonium development and motility in the model heterocyst-forming filamentous cyanobacterium Nostoc punctiforme , a forward genetic screen was employed. The first gene identified using this screen, designated ogtA , encodes a putative O-linked β- N -acetylglucosamine transferase (OGT). The deletion of ogtA abolished motility, while ectopic expression of ogtA induced hormogonium development even under hormogonium-repressing conditions. Transcription of ogtA is rapidly upregulated (1 h) following hormogonium induction, and an OgtA-GFPuv fusion protein localized to the cytoplasm. In developing hormogonia, accumulation of PilA but not HmpD is dependent on ogtA Reverse transcription-quantitative PCR (RT-qPCR) analysis indicated equivalent levels of pilA transcript in the wild-type and Δ ogtA mutant strains, while a reporter construct consisting of the intergenic region in the 5' direction of pilA fused to gfp produced lower levels of fluorescence in the Δ ogtA mutant strain than in the wild type. The production of hormogonium polysaccharide in the Δ ogtA mutant strain is reduced compared to that in the wild type but comparable to that in a pilA deletion strain. Collectively, these results imply that O -GlcNAc protein modification regulates the accumulation of PilA via a posttranscriptional mechanism in developing hormogonia. IMPORTANCE Filamentous cyanobacteria are among

  4. Enabling cell-cell communication via nanopore formation: structure, function and localization of the unique cell wall amidase AmiC2 of Nostoc punctiforme.

    Science.gov (United States)

    Büttner, Felix M; Faulhaber, Katharina; Forchhammer, Karl; Maldener, Iris; Stehle, Thilo

    2016-04-01

    To orchestrate a complex life style in changing environments, the filamentous cyanobacterium Nostoc punctiforme facilitates communication between neighboring cells through septal junction complexes. This is achieved by nanopores that perforate the peptidoglycan (PGN) layer and traverse the cell septa. The N-acetylmuramoyl-l-alanine amidase AmiC2 (Npun_F1846; EC 3.5.1.28) in N. punctiforme generates arrays of such nanopores in the septal PGN, in contrast to homologous amidases that mediate daughter cell separation after cell division in unicellular bacteria. Nanopore formation is therefore a novel property of AmiC homologs. Immunofluorescence shows that native AmiC2 localizes to the maturing septum. The high-resolution crystal structure (1.12 Å) of its catalytic domain (AmiC2-cat) differs significantly from known structures of cell splitting and PGN recycling amidases. A wide and shallow binding cavity allows easy access of the substrate to the active site, which harbors an essential zinc ion. AmiC2-cat exhibits strong hydrolytic activity in vitro. A single point mutation of a conserved glutamate near the zinc ion results in total loss of activity, whereas zinc removal leads to instability of AmiC2-cat. An inhibitory α-helix, as found in the Escherichia coli AmiC(E. coli) structure, is absent. Taken together, our data provide insight into the cell-biological, biochemical and structural properties of an unusual cell wall lytic enzyme that generates nanopores for cell-cell communication in multicellular cyanobacteria. The novel structural features of the catalytic domain and the unique biological function of AmiC2 hint at mechanisms of action and regulation that are distinct from other amidases. The AmiC2-cat structure has been deposited in the Protein Data Bank under accession number 5EMI. © 2016 Federation of European Biochemical Societies.

  5. Analysis of the early heterocyst Cys-proteome in the multicellular cyanobacterium Nostoc punctiforme reveals novel insights into the division of labor within diazotrophic filaments.

    Science.gov (United States)

    Sandh, Gustaf; Ramström, Margareta; Stensjö, Karin

    2014-12-04

    In the filamentous cyanobacterium Nostoc punctiforme ATCC 29133, removal of combined nitrogen induces the differentiation of heterocysts, a cell-type specialized in N2 fixation. The differentiation involves genomic, structural and metabolic adaptations. In cyanobacteria, changes in the availability of carbon and nitrogen have also been linked to redox regulated posttranslational modifications of protein bound thiol groups. We have here employed a thiol targeting strategy to relatively quantify the putative redox proteome in heterocysts as compared to N2-fixing filaments, 24 hours after combined nitrogen depletion. The aim of the study was to expand the coverage of the cell-type specific proteome and metabolic landscape of heterocysts. Here we report the first cell-type specific proteome of newly formed heterocysts, compared to N2-fixing filaments, using the cysteine-specific selective ICAT methodology. The data set defined a good quantitative accuracy of the ICAT reagent in complex protein samples. The relative abundance levels of 511 proteins were determined and 74% showed a cell-type specific differential abundance. The majority of the identified proteins have not previously been quantified at the cell-type specific level. We have in addition analyzed the cell-type specific differential abundance of a large section of proteins quantified in both newly formed and steady-state diazotrophic cultures in N. punctiforme. The results describe a wide distribution of members of the putative redox regulated Cys-proteome in the central metabolism of both vegetative cells and heterocysts of N. punctiforme. The data set broadens our understanding of heterocysts and describes novel proteins involved in heterocyst physiology, including signaling and regulatory proteins as well as a large number of proteins with unknown function. Significant differences in cell-type specific abundance levels were present in the cell-type specific proteomes of newly formed diazotrophic filaments

  6. Enhancement of stability of L-tryptophan dehydrogenase from Nostoc punctiforme ATCC29133 and its application to L-tryptophan assay.

    Science.gov (United States)

    Matsui, Daisuke; Okazaki, Seiji; Matsuda, Motoki; Asano, Yasuhisa

    2015-02-20

    Microbial NAD(+)-dependent L-tryptophan dehydrogenase (TrpDH, EC1.4.1.19), which catalyzes the reversible oxidative deamination and the reductive amination between L-tryptophan and indole-3-pyruvic acid, was found in the scytonemin biosynthetic pathway of Nostoc punctiforme ATCC29133. The TrpDH exhibited high specificity toward L-tryptophan, but its instability was a drawback for L-tryptophan determination. The mutant enzyme TrpDH L59F/D168G/A234D/I296N with thermal stability was obtained by screening of Escherichia coli transformants harboring various mutant genes, which were generated by error-prone PCR using complementation in an L-tryptophan auxotroph of E. coli. The specific activity and stability of this mutant enzyme were higher than those of the wild type enzyme. We also revealed here that in these four mutation points, the two amino acid residues Asp168 and Ile296 contributed to increase the enzyme stability, and the Leu59, Ala234 residues to increase its specific activity. Growth of the strain harboring the gene of above 4 point mutated enzyme was accelerated by the enhanced performance. In the present study, we demonstrated that TrpDH L59F/D168G/A234D/I296N was available for determination of L-tryptophan in human plasma. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. Characterization and in vivo regulon determination of an ECF sigma factor and its cognate anti-sigma factor in Nostoc punctiforme.

    Science.gov (United States)

    Bell, Nicole; Lee, Jamie J; Summers, Michael L

    2017-04-01

    Based on primary sequence comparisons and genomic context, Npun_F4153 (SigG)/Npun_F4154 (SapG) of the cyanobacterium Nostoc punctiforme were hypothesized to encode an ECF sigma factor/anti-sigma factor pair. Transcription of sigG increased in heterocysts and akinetes, and after EDTA treatment. Interaction between SigG and the predicted cytoplasmic domain of SapG was observed in vitro. A SigG-GFP translational fusion protein localized to the periphery of vegetative cells in vivo, but lost this association following heat stress. A sigG mutant was unable to survive envelope damage caused by heat or EDTA, but was able to form functional heterocysts. Akinetes in the mutant strain appeared normal, but these cultures were less resistant to lysozyme and cold treatments than those of the wild-type strain. The SigG in vivo regulon was determined before and during akinete differentiation using DNA microarray analysis, and found to include multiple genes with putative association to the cell envelope. Mapped promoters common to both arrays enabled identification of a SigG promoter-binding motif that was supported in vivo by reporter studies, and in vitro by run-off transcription experiments. These findings support SigG/SapG as a sigma/anti-sigma pair involved in repair of envelope damage resulting from exogenous sources or cellular differentiation. © 2017 John Wiley & Sons Ltd.

  8. Second-chance forward isomerization dynamics of the red/green cyanobacteriochrome NpR6012g4 from Nostoc punctiforme.

    Science.gov (United States)

    Kim, Peter W; Freer, Lucy H; Rockwell, Nathan C; Martin, Shelley S; Lagarias, J Clark; Larsen, Delmar S

    2012-01-11

    The primary ultrafast Z-to-E isomerization photodynamics of the phytochrome-related cyanobacteriochrome NpR6012g4 from Nostoc punctiforme was studied by transient absorption pump-dump-probe spectroscopy. A 2 ps dump pulse resonant with the stimulated emission band depleted 21% of the excited-state population, while the initial photoproduct Lumi-R was depleted by only 11%. We observed a red-shifted ground-state intermediate (GSI) that we assign to a metastable state that failed to isomerize fully. Multicomponent global analysis implicates the generation of additional Lumi-R from the GSI via crossing over the ground-state thermal barrier for full isomerization, explaining the discrepancy between excited-state and Lumi-R depletion by the dump pulse. This second-chance ground-state dynamics provides a plausible explanation for the unusually high quantum yield of 40% for the primary isomerization step in the forward reaction of NpR6012g4. © 2011 American Chemical Society

  9. Traceless splicing enabled by substrate-induced activation of the Nostoc punctiforme Npu DnaE intein after mutation of a catalytic cysteine to serine.

    Science.gov (United States)

    Cheriyan, Manoj; Chan, Siu-Hong; Perler, Francine

    2014-12-12

    Inteins self-catalytically cleave out of precursor proteins while ligating the surrounding extein fragments with a native peptide bond. Much attention has been lavished on these molecular marvels with the hope of understanding and harnessing their chemistry for novel biochemical transformations including coupling peptides from synthetic or biological origins and controlling protein function. Despite an abundance of powerful applications, the use of inteins is still hampered by limitations in our understanding of their specificity (defined as flanking sequences that permit splicing) and the challenge of inserting inteins into target proteins. We examined the frequently used Nostoc punctiforme Npu DnaE intein after the C-extein cysteine nucleophile (Cys+1) was mutated to serine or threonine. Previous studies demonstrated reduced rates and/or splicing yields with the Npu DnaE intein after mutation of Cys+1 to Ser+1. In this study, genetic selection identified extein sequences with Ser+1 that enabled the Npu DnaE intein to splice with only a 5-fold reduction in rate compared to the wild-type Cys+1 intein and without mutation of the intein itself to activate Ser+1 as a nucleophile. Three different proteins spliced efficiently after insertion of the intein flanked by the selected sequences. We then used this selected specificity to achieve traceless splicing in a targeted enzyme at a location predicted by primary sequence similarity to only the selected C-extein sequence. This study highlights the latent catalytic potential of the Npu DnaE intein to splice with an alternative nucleophile and enables broader intein utility by increasing insertion site choices. Copyright © 2014. Published by Elsevier Ltd.

  10. Quantitative analysis of UV-A shock and short term stress using iTRAQ, pseudo selective reaction monitoring (pSRM) and GC-MS based metabolite analysis of the cyanobacterium Nostoc punctiforme ATCC 29133.

    Science.gov (United States)

    Wase, Nishikant; Pham, Trong Khoa; Ow, Saw Yen; Wright, Phillip C

    2014-09-23

    A quantitative proteomics and metabolomics analysis was performed using iTRAQ, HPLC and GC-MS in the filamentous cyanobacterium Nostoc punctiforme ATCC 29133 to understand the effect of short and long term UV-A exposure. Changes in the proteome were measured for short-term stress (4-24h) using iTRAQ. Changes in the photosynthetic pigments and intracellular metabolites were observed at exposures of up to 7days (pigments) and up to 11days (intracellular metabolites). To assess iTRAQ measurement quality, pseudo selected reaction monitoring (pSRM) was used, with this confirming underestimation of protein abundance levels by iTRAQ. Our results suggest that short term UV-A radiation lowers the abundance of PS-I and PS-II proteins. We also observed an increase in abundance of intracellular redox homeostasis proteins and plastocyanin. Additionally, we observed statistically significant changes in scytonemin, Chlorophyll A, astaxanthin, zeaxanthin, and β-carotene. Assessment of intracellular metabolites showed significant changes in several, suggesting their potential role in the Nostoc's stress mitigation strategy. Cyanobacteria under UV-A radiation have reduced growth due to intensive damage to essential functions, but the organism shows a defense response by remodeling bioenergetics pathway, induction of the UV protection compound scytonemin and increased levels of proline and tyrosine as a mitigation response. The effect of UV-A radiation on the proteome and intracellular metabolites of N. punctiforme ATCC 29133 including photosynthetic pigments has been described. We also verify the expression of 13 iTRAQ quantified protein using LC-pSRM. Overall we observed that UV-A radiation has a drastic effect on the photosynthetic machinery, photosynthetic pigments and intracellular amino acids. As a mitigation strategy against UV-A radiation, proline, glycine, and tyrosine were accumulated. Copyright © 2014. Published by Elsevier B.V.

  11. The two Dps proteins, NpDps2 and NpDps5, are involved in light-induced oxidative stress tolerance in the N2-fixing cyanobacterium Nostoc punctiforme.

    Science.gov (United States)

    Moparthi, Vamsi K; Li, Xin; Vavitsas, Konstantinos; Dzhygyr, Ievgen; Sandh, Gustaf; Magnuson, Ann; Stensjö, Karin

    2016-11-01

    Cyanobacteria are photosynthetic prokaryotes that are considered biotechnologically prominent organisms for production of high-value compounds. Cyanobacteria are subject to high-light intensities, which is a challenge that needs to be addressed in design of efficient bio-engineered photosynthetic organisms. Dps proteins are members of the ferritin superfamily and are omnipresent in prokaryotes. They play a major role in oxidative stress protection and iron homeostasis. The filamentous, heterocyst-forming Nostoc punctiforme, has five Dps proteins. In this study we elucidated the role of these Dps proteins in acclimation to high light intensity, the gene loci organization and the transcriptional regulation of all five dps genes in N. punctiforme was revealed, and dps-deletion mutant strains were used in physiological characterization. Two mutants defective in Dps2 and Dps5 activity displayed a reduced fitness under increased illumination, as well as a differential Photosystem (PS) stoichiometry, with an elevated Photosystem II to Photosystem I ratio in the dps5 deletion strain. This work establishes a Dps-mediated link between light tolerance, H 2 O 2 detoxification, and iron homeostasis, and provides further evidence on the non-redundant role of multiple Dps proteins in this multicellular cyanobacterium. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Production of 10S-hydroxy-8(E)-octadecenoic acid from oleic acid by whole recombinant Escherichia coli cells expressing 10S-dioxygenase from Nostoc punctiforme PCC 73102 with the aid of a chaperone.

    Science.gov (United States)

    Kim, Min-Ji; Seo, Min-Ju; Shin, Kyung-Chul; Oh, Deok-Kun

    2017-01-01

    To increase the production of 10S-hydroxy-8(E)-octadecenoic acid from oleic acid by whole recombinant Escherichia coli cells expressing Nostoc punctiforme 10S-dioxygenase with the aid of a chaperone. The optimal conditions for 10S-hydroxy-8(E)-octadecenoic acid production by recombinant cells co-expressing chaperone plasmid were pH 9, 35 °C, 15 % (v/v) dimethyl sulfoxide, 40 g cells l -1 , and 10 g oleic acid l -1 . Under these conditions, recombinant cells co-expressing chaperone plasmid produced 7.2 g 10S-hydroxy-8(E)-octadecenoic acid l -1 within 30 min, with a conversion yield of 72 % (w/w) and a volumetric productivity of 14.4 g l -1 h -1 . The activity of recombinant cells expressing 10S-dioxygenase was increased by 200 % with the aid of a chaperone, demonstrating the first biotechnological production of 10S-hydroxy-8(E)-octadecenoic acid using recombinant cells expressing 10S-dioxygenase.

  13. Geobiology in the Lab

    Science.gov (United States)

    José López-Galindo, María

    2017-04-01

    Geobiology is, nowadays, one of the most important lines of research of USGS. It is the interdisciplinary study of the interactions of microorganisms and earth materials (including soil, sediment, the atmosphere, the hydrosphere, minerals, and rocks) (U.S. Geological Survey, 2007). A study about geobiolgical interactions between microorganisms and felsic rock surfaces was carried out in San Blas Secondary School with students, aged 16-17, as an enforcement of a part of this abstract author's thesis work, and developed in the Coruña University. The activity took place in the school laboratory as a complement of the theoretical Spanish curriculum about living things. After visiting a granitic area, near the famous Rio Tinto mining district, students collected different rock samples. They learned about bioweathering on igneous rocks, and how microorganisms can play an essential double role on rock surface: dissolution and mineral deposition. These organisms, living in hard and basic environments, are considered extremophiles (López-Galindo, 2013) which is an important translatable concept to the life beyond the Earth. Afterwards, students had the opportunity to grow these microorganisms under different conditions and examine them through a scholar microscope, comparing these images with SEM ones, taken in Central Services of Research Building in the Coruña University, to determine genus and species, when it was possible. An opportunity to study rare living things, an introduction to geobiology, hostile environments and different physical and chemical conditions out of Earth is hereafter offered, through these simple experiences, to other secondary teachers in the world. U.S. Geological Survey, 2007, Facing tomorrow's challenges—U.S. Geological Survey science in the decade 2007-2017: U.S. Geological Survey Circular 1309, x + 70 p. López-Galindo, M.J. 2013, Bioweathering in Igneous Rocks. Siliceous Speleothems from a Geobiological Viewpoint. Doctoral Dissertation

  14. Arabinogalactan proteins occur in the free-living cyanobacterium genus Nostoc and in plant-Nostoc symbioses.

    Science.gov (United States)

    Jackson, Owen; Taylor, Oliver; Adams, David G; Knox, J Paul

    2012-10-01

    Arabinogalactan proteins (AGP) are a diverse family of proteoglycans associated with the cell surfaces of plants. AGP have been implicated in a wide variety of plant cell processes, including signaling in symbioses. This study investigates the existence of putative AGP in free-living cyanobacterial cultures of the nitrogen-fixing, filamentous cyanobacteria Nostoc punctiforme and Nostoc sp. strain LBG1 and at the symbiotic interface in the symbioses between Nostoc spp. and two host plants, the angiosperm Gunnera manicata (in which the cyanobacterium is intracellular) and the liverwort Blasia pusilla (in which the cyanobacterium is extracellular). Enzyme-linked immunosorbent assay, immunoblotting, and immunofluorescence analyses demonstrated that three AGP glycan epitopes (recognized by monoclonal antibodies LM14, MAC207, and LM2) are present in free-living Nostoc cyanobacterial species. The same three AGP glycan epitopes are present at the Gunnera-Nostoc symbiotic interface and the LM2 epitope is detected during the establishment of the Blasia-Nostoc symbiosis. Bioinformatic analysis of the N. punctiforme genome identified five putative AGP core proteins that are representative of AGP classes found in plants. These results suggest a possible involvement of AGP in cyanobacterial-plant symbioses and are also suggestive of a cyanobacterial origin of AGP.

  15. Discovery of Rare and Highly Toxic Microcystins from Lichen-Associated Cyanobacterium Nostoc sp. Strain IO-102-I

    Science.gov (United States)

    Oksanen, Ilona; Jokela, Jouni; Fewer, David P.; Wahlsten, Matti; Rikkinen, Jouko; Sivonen, Kaarina

    2004-01-01

    The production of hepatotoxic cyclic heptapeptides, microcystins, is almost exclusively reported from planktonic cyanobacteria. Here we show that a terrestrial cyanobacterium Nostoc sp. strain IO-102-I isolated from a lichen association produces six different microcystins. Microcystins were identified with liquid chromatography-UV mass spectrometry by their retention times, UV spectra, mass fragmentation, and comparison to microcystins from the aquatic Nostoc sp. strain 152. The dominant microcystin produced by Nostoc sp. strain IO-102-I was the highly toxic [ADMAdda5]microcystin-LR, which accounted for ca. 80% of the total microcystins. We assigned a structure of [DMAdda5]microcystin-LR and [d-Asp3,ADMAdda5]microcystin-LR and a partial structure of three new [ADMAdda5]-XR type of microcystin variants. Interestingly, Nostoc spp. strains IO-102-I and 152 synthesized only the rare ADMAdda and DMAdda subfamilies of microcystin variants. Phylogenetic analyses demonstrated congruence between genes involved directly in microcystin biosynthesis and the 16S rRNA and rpoC1 genes of Nostoc sp. strain IO-102-I. Nostoc sp. strain 152 and the Nostoc sp. strain IO-102-I are distantly related, revealing a sporadic distribution of toxin production in the genus Nostoc. Nostoc sp. strain IO-102-I is closely related to Nostoc punctiforme PCC 73102 and other symbiotic Nostoc strains and most likely belongs to this species. Together, this suggests that other terrestrial and aquatic strains of the genus Nostoc may have retained the genes necessary for microcystin biosynthesis. PMID:15466511

  16. Molecular and phylogenetic characterization of two species of the genus Nostoc (Cyanobacteria based on the cpcB-IGS-cpcA locus of the phycocyanin operon

    Directory of Open Access Journals (Sweden)

    IVANKA TENEVA

    2012-01-01

    Full Text Available Traditionally, the taxonomy of the genus Nostoc is based on morphological and physiological characters. The extreme morphological variability of the Nostoc species, due to their life cycle and environmental conditions, hampers the correct identification of the individual species. This is also one of the reasons for the disputed taxonomic positions and relationships between the genera Anabaena–Aphanizomenon as well as between Anabaena–Nostoc. Therefore, it is necessary to use additional markers for development of a polyphasic classification system of order Nostocales. In light of this, we here present the first molecular and phy-logenetic characterization of two species of the genus Nostoc (Nostoc linckia and Nostoc punctiforme based on the cpcB-IGS-cpcA locus of the phycocyanin oper-on. The phylogenetic position of these two species within order Nostocales as well as within division Cyanobacteria has been determined. Our results indicate that genus Nostoc is heterogeneous. Analysis of the IGS region between cpcB and cpcA showed that Nostoc and Anabaena are distinct genera. Reported molecular and phylogenetic data will be useful to solve other problematic points in the tax-onomy of genera Aphanizomenon, Anabaena and Nostoc.

  17. Morphological characterization and molecular fingerprinting of Nostoc strains by multiplex RAPD.

    Science.gov (United States)

    Hillol, Chakdar; Pabbi, Sunil

    2012-01-01

    Morphological parameters studied for the twenty selected Nostoc strains were mostly found to be consistent with the earlier reports. But the shape of akinetes observed in this study was a little deviation from the existing descriptions and heterocyst frequency was also found to be different in different strains in spite of growing in the same nitrogen free media. Multiplex RAPD produced reproducible and completely polymorphic amplification profiles for all the strains including some strain specific unique bands which are intended to be useful for identification of those strains. At least one to a maximum of two unique bands was produced by different dual primer combinations. For ten strains out of twenty, strain specific bands were found to be generated. Cluster analysis revealed a vast heterogeneity among these Nostoc strains and no specific clustering based on geographical origin was found except a few strains. It was also observed that morphological data may not necessarily correspond to the genetic data in most of the cases. CCC92 (Nostoc muscorum) and CCC48 (Nostoc punctiforme) showed a high degree of similarity which was well supported by high bootstrap value. The level of similarity of the strains ranged from 0.15 to 0.94. Cluster analysis based on multiplex RAPD showed a good fit revealing the discriminatory power of this technique.

  18. Sequestration of chromium by exopolysaccharides of Nostoc and Gloeocapsa from dilute aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, Mona [Department of Environmental Science and Engineering, Guru Jambheshwar University of Science and Technology, Hisar-125 001 (India); Kaushik, Anubha [Department of Environmental Science and Engineering, Guru Jambheshwar University of Science and Technology, Hisar-125 001 (India)], E-mail: aks_10@yahoo.com; Somvir,; Bala, Kiran; Kamra, Anjana [Department of Environmental Science and Engineering, Guru Jambheshwar University of Science and Technology, Hisar-125 001 (India)

    2008-09-15

    This article reports the chromium removal potential of exopolysaccharides (EPS) of two indigenously isolated cyanobacterial strains, Gloeocapsa calcarea and Nostoc punctiforme. The biosorption was studied by varying pH from 2 to 6 and initial chromium concentration from 5 to 20 mg/L to find out the optimized conditions for maximum chromium removal by EPS. Two equilibrium models, Langmuir and Freundlich, were used to explain these results. The Freundlich model was found to be better applicable to the experimental data as compared to Langmuir as inferred from high value of coefficient of determination whereas the optimal conditions were found to be same for the two (pH 2 and initial chromium concentration 20 mg/L). EPS production by the two strains was also studied which was found to be higher for Gloeocapsa. On the basis of experimental results and model parameters, it can be inferred that the EPS extracted from Nostoc has comparatively high biosorption capacity and can be utilized for the removal of chromium from dilute aqueous solution. Adsorption of chromium on EPS was further confirmed by surface morphology observed in scanning electron micrographs.

  19. Sequestration of chromium by exopolysaccharides of Nostoc and Gloeocapsa from dilute aqueous solutions

    International Nuclear Information System (INIS)

    Sharma, Mona; Kaushik, Anubha; Somvir,; Bala, Kiran; Kamra, Anjana

    2008-01-01

    This article reports the chromium removal potential of exopolysaccharides (EPS) of two indigenously isolated cyanobacterial strains, Gloeocapsa calcarea and Nostoc punctiforme. The biosorption was studied by varying pH from 2 to 6 and initial chromium concentration from 5 to 20 mg/L to find out the optimized conditions for maximum chromium removal by EPS. Two equilibrium models, Langmuir and Freundlich, were used to explain these results. The Freundlich model was found to be better applicable to the experimental data as compared to Langmuir as inferred from high value of coefficient of determination whereas the optimal conditions were found to be same for the two (pH 2 and initial chromium concentration 20 mg/L). EPS production by the two strains was also studied which was found to be higher for Gloeocapsa. On the basis of experimental results and model parameters, it can be inferred that the EPS extracted from Nostoc has comparatively high biosorption capacity and can be utilized for the removal of chromium from dilute aqueous solution. Adsorption of chromium on EPS was further confirmed by surface morphology observed in scanning electron micrographs

  20. Distinctive characters of Nostoc genomes in cyanolichens.

    Science.gov (United States)

    Gagunashvili, Andrey N; Andrésson, Ólafur S

    2018-06-05

    Cyanobacteria of the genus Nostoc are capable of forming symbioses with a wide range of organism, including a diverse assemblage of cyanolichens. Only certain lineages of Nostoc appear to be able to form a close, stable symbiosis, raising the question whether symbiotic competence is determined by specific sets of genes and functionalities. We present the complete genome sequencing, annotation and analysis of two lichen Nostoc strains. Comparison with other Nostoc genomes allowed identification of genes potentially involved in symbioses with a broad range of partners including lichen mycobionts. The presence of additional genes necessary for symbiotic competence is likely reflected in larger genome sizes of symbiotic Nostoc strains. Some of the identified genes are presumably involved in the initial recognition and establishment of the symbiotic association, while others may confer advantage to cyanobionts during cohabitation with a mycobiont in the lichen symbiosis. Our study presents the first genome sequencing and genome-scale analysis of lichen-associated Nostoc strains. These data provide insight into the molecular nature of the cyanolichen symbiosis and pinpoint candidate genes for further studies aimed at deciphering the genetic mechanisms behind the symbiotic competence of Nostoc. Since many phylogenetic studies have shown that Nostoc is a polyphyletic group that includes several lineages, this work also provides an improved molecular basis for demarcation of a Nostoc clade with symbiotic competence.

  1. Future directions in geobiology and low-temperature geochemistry

    Science.gov (United States)

    Freeman, Katherine H.; Goldhaber, M.B.

    2011-01-01

    Humanity is confronted with an enormous challenge, as succinctly stated by the late Steven Schneider (2001; quoted by Jantzen 2004*): “Humans are forcing the Earth’s environmental systems to change at a rate that is more advanced than their knowledge of the consequences.” Geobiologists and low-temperature geochemists characterize material from the lithosphere, hydrosphere, atmosphere, and biosphere to understand processes operating within and between these components of the Earth system from the atomic to the planetary scale. For this reason, the interwoven disciplines of geobiology and low-temperature geochemistry are central to understanding and ultimately predicting the behavior of these life-sustaining systems. We present here comments and recommendations from the participants of a workshop entitled “Future Directions in Geobiology and Low-Temperature Geochemistry,” hosted by the Carnegie Institution of Washington, Geophysical Laboratory, Washington, DC, on 27–28 August 2010. The goal of the workshop was to suggest ways to leverage the vast intellectual and analytical capabilities of our diverse scientific community to characterize the Earth’s past, present, and future geochemical habitat as we enter the second decade of what E. O. Wilson dubbed “the century of the environment.”

  2. The geobiological nitrogen cycle: From microbes to the mantle.

    Science.gov (United States)

    Zerkle, A L; Mikhail, S

    2017-05-01

    Nitrogen forms an integral part of the main building blocks of life, including DNA, RNA, and proteins. N 2 is the dominant gas in Earth's atmosphere, and nitrogen is stored in all of Earth's geological reservoirs, including the crust, the mantle, and the core. As such, nitrogen geochemistry is fundamental to the evolution of planet Earth and the life it supports. Despite the importance of nitrogen in the Earth system, large gaps remain in our knowledge of how the surface and deep nitrogen cycles have evolved over geologic time. Here, we discuss the current understanding (or lack thereof) for how the unique interaction of biological innovation, geodynamics, and mantle petrology has acted to regulate Earth's nitrogen cycle over geologic timescales. In particular, we explore how temporal variations in the external (biosphere and atmosphere) and internal (crust and mantle) nitrogen cycles could have regulated atmospheric pN 2 . We consider three potential scenarios for the evolution of the geobiological nitrogen cycle over Earth's history: two in which atmospheric pN 2 has changed unidirectionally (increased or decreased) over geologic time and one in which pN 2 could have taken a dramatic deflection following the Great Oxidation Event. It is impossible to discriminate between these scenarios with the currently available models and datasets. However, we are optimistic that this problem can be solved, following a sustained, open-minded, and multidisciplinary effort between surface and deep Earth communities. © 2017 The Authors Geobiology Published by John Wiley & Sons Ltd.

  3. Secondary metabolites of cyanobacteria Nostoc sp.

    Science.gov (United States)

    Kobayashi, Akio; Kajiyama, Shin-Ichiro

    1998-03-01

    Cyanobacteria attracted much attention recently because of their secondary metabolites with potent biological activities and unusual structures. This paper reviews some recent studies on the isolation, structural, elucidation and biological activities of the bioactive compounds from cyanobacteria Nostoc species.

  4. Isolation and in silico analysis of Fe-superoxide dismutase in the cyanobacterium Nostoc commune.

    Science.gov (United States)

    Kesheri, Minu; Kanchan, Swarna; Richa; Sinha, Rajeshwar P

    2014-12-15

    Cyanobacteria are known to endure various stress conditions due to the inbuilt potential for oxidative stress alleviation owing to the presence of an array of antioxidants. The present study shows that Antarctic cyanobacterium Nostoc commune possesses two antioxidative enzymes viz., superoxide dismutase (SOD) and catalase that jointly cope with environmental stresses prevailing at its natural habitat. Native-PAGE analysis illustrates the presence of a single prominent isoform recognized as Fe-SOD and three distinct isoforms of catalase. The protein sequence of Fe-SOD in N. commune retrieved from NCBI protein sequence database was used for in silico analysis. 3D structure of N. commune was predicted by comparative modeling using MODELLER 9v11. Further, this model was validated for its quality by Ramachandran plot, ERRAT, Verify 3D and ProSA-web which revealed good structure quality of the model. Multiple sequence alignment showed high conservation in N and C-terminal domain regions along with all metal binding positions in Fe-SOD which were also found to be highly conserved in all 28 cyanobacterial species under study, including N. commune. In silico prediction of isoelectric point and molecular weight of Fe-SOD was found to be 5.48 and 22,342.98Da respectively. The phylogenetic tree revealed that among 28 cyanobacterial species, Fe-SOD in N. commune was the closest evolutionary homolog of Fe-SOD in Nostoc punctiforme as evident by strong bootstrap value. Thus, N. commune may serve as a good biological model for studies related to survival of life under extreme conditions prevailing at the Antarctic region. Moreover cyanobacteria may be exploited for biochemical and biotechnological applications of enzymatic antioxidants. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Enhancement of soybean (Glycine max L.) growth by bio-fertilizers of Nostoc muscorum and Nostoc rivulare

    International Nuclear Information System (INIS)

    Sholkamy, E.N.; Komy, H.M.E.

    2015-01-01

    In the present study the nitrogenase activity of Nostoc muscorum and Nostoc rivulare was evaluated in vitro; the test showed that Nostoc muscorum and Nostoc rivulare have the ability to fix nitrogen. In a pot experiment under field conditions, the results of the present study showed that inoculation of the soybean plant with Nostoc muscorum and Nostoc rivulare, either alone or in combination with N-fertilizer at 50 and 100 kg N/ha, caused a significant increase in the growth of these plants, as reflected in plant height, leaf area, weight of plant as well as the legume weight of soybeans. The combination of biofertilization and N-fertilization, especially at 100 kg N/ha, had more effect on both the growth of soybeans and nitrogenase activity compared to biofertilization alone. Nostoc muscorum and Nostoc rivulare are a promising biofertilizers for achieving an efficient association between N2 fixing cyanobacteria and soybeans; and thus enhancement of the growth. (author)

  6. Protein (Cyanobacteria): 35831 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available etical protein Npun_F5100 Nostoc punctiforme PCC 73102 MKTLVNLTQQSVVGEIESVLDTYPYHPYQKAFAIPDLRQELIVFVLTRLPSFDGAMSEGHISLAEAEQGSLAYYKLPRKPLEQQLHLQNLIHQGICLIVQEKSDWINDRVCEIVQPACEASHWFG ...

  7. Consumption of fa cai Nostoc soup: a potential for BMAA exposure from Nostoc cyanobacteria in China?

    Science.gov (United States)

    Roney, Britton R; Renhui, Li; Banack, Sandra Anne; Murch, Susan; Honegger, Rosmarie; Cox, Paul Alan

    2009-01-01

    Grown in arid regions of western China the cyanobacterium Nostoc flagelliforme--called fa cai in Mandarin and fat choy in Cantonese--is wild-harvested and used to make soup consumed during New Year's celebrations. High prices, up to $125 USD/kg, led to overharvesting in Inner Mongolia, Ningxia, Gansu, Qinghai, and Xinjiang. Degradation of arid ecosystems, desertification, and conflicts between Nostoc harvesters and Mongol herdsmen concerned the Chinese environmental authorities, leading to a government ban of Nostoc commerce. This ban stimulated increased marketing of a substitute made from starch. We analysed samples purchased throughout China as well as in Chinese markets in the United States and the United Kingdom. Some were counterfeits consisting of dyed starch noodles. A few samples from California contained Nostoc flagelliforme but were adulterated with starch noodles. Other samples, including those from the United Kingdom, consisted of pure Nostoc flagelliforme. A recent survey of markets in Cheng Du showed no real Nostoc flagelliforme to be marketed. Real and artificial fa cai differ in the presence of beta-N-methylamino-L-alanine (BMAA). Given its status as a high-priced luxury food, the government ban on collection and marketing, and the replacement of real fa cai with starch substitutes consumed only on special occasions, it is anticipated that dietary exposure to BMAA from fa cai will be reduced in the future in China.

  8. Punctiform and Polychromatophilic Dominant Pre-Descemet Corneal Dystrophy.

    Science.gov (United States)

    Lagrou, Lisa; Midgley, Julian; Romanchuk, Kenneth Gerald

    2016-04-01

    To describe the slit-lamp appearance and corneal confocal microscopy of autosomal dominant punctiform and polychromatophilic pre-Descemet corneal dystrophy in 3 members of the same family. Slit-lamp examination of a 9-year-old boy showed bilateral polychromatophilic corneal opacities in a pre-Descemet membrane location evenly deposited limbus to limbus, both horizontally and vertically, with an intervening clear cornea. The corneal endothelium was normal on corneal confocal microscopy, with hyperreflective opacities of various sizes located pre-Descemet membrane. Slit-lamp examination of the patient's father and brother revealed identical crystalline deposition in the pre-Descemet corneal stroma. The remainders of the eye examinations were otherwise normal in all 3 individuals, and all were asymptomatic. The general physical examination and laboratory investigations of the patient were all normal, as were the laboratory investigations of the other 2 family members. There was no progression in the corneal findings over 6 months of follow-up. These patients likely illustrate a rare autosomal dominant pre-Descemet crystalline keratopathy that has been reported only once previously.

  9. Lietuvos Nostoc ir Desmonostoc genčių melsvabakterių morfologija, ekologija ir filogenija

    OpenAIRE

    Špakaitė, Ina

    2014-01-01

    The aim of the study was to investigate the morphology, ecology and phylogeny of cyanobacteria belonging to genera Nostoc and Desmonostoc in Lithuania. The detailed research of freshwater and terrestrial Nostoc and Desmonostoc species provided new data on taxonomy, biology and ecology of these cyanobacteria and the overall diversity of algae in Lithuania. 20 Nostoc species and two intraspecific taxa, and 18 taxa to the Nostoc genus level were identified. Twelve Nostoc species and intraspecifi...

  10. Morphology, ecology and phylogeny of cyanobacteria belonging to genera Nostoc and Desmonostoc in Lithuania

    OpenAIRE

    Špakaitė, Ina

    2014-01-01

    The aim of the study was to investigate the morphology, ecology and phylogeny of cyanobacteria belonging to genera Nostoc and Desmonostoc in Lithuania. The detailed research of freshwater and terrestrial Nostoc and Desmonostoc species provided new data on taxonomy, biology and ecology of these cyanobacteria and the overall diversity of algae in Lithuania. 20 Nostoc species and two intraspecific taxa, and 18 taxa to the Nostoc genus level were identified. Twelve Nostoc species and intraspecifi...

  11. Nostoc thermotolerans sp. nov., a soil-dwelling species of Nostoc (Cyanobacteria).

    Science.gov (United States)

    Suradkar, Archana; Villanueva, Chelsea; Gaysina, Lira A; Casamatta, Dale A; Saraf, Aniket; Dighe, Gandhali; Mergu, Ratnaprabha; Singh, Prashant

    2017-05-01

    A filamentous, soil-dwelling cyanobacterial strain (9C-PST) was isolated from Mandsaur, Madhya Pradesh, India, and is described as a new species of the genus Nostoc. Extensive morphological and molecular characterization along with a thorough assessment of ecology was performed. The style of filament orientation, type and nature of the sheath (e.g. distribution and visibility across the trichome), and vegetative and heterocyte cell dimensions and shape were assessed for over one year using both the laboratory grown culture and the naturally occurring samples. Sequencing of the 16S rRNA gene showed 94 % similarity with Nostocpiscinale CENA21 while analyses of the secondary structures of the 16S-23S ITS region showed unique folding patterns that differentiated this strain from other species of Nostoc. The level of rbcl and rpoC1 gene sequence similarity was 91 and 94 % to Nostocsp. PCC 7524 and Nostocpiscinale CENA21, respectively, while the nifD gene sequence similarity was found to be 99 % with Nostocpiscinale CENA21. The phenotypic, ecological, genetic and phylogenetic observations indicate that the strain 9C-PST represents a novel species of the genus Nostoc with the name proposed being Nostoc thermotolerans sp. nov. according to the International Code of Nomenclature for Algae, Fungi, and Plants.

  12. Outcomes of the 'Data Curation for Geobiology at Yellowstone National Park' Workshop

    Science.gov (United States)

    Thomer, A.; Palmer, C. L.; Fouke, B. W.; Rodman, A.; Choudhury, G. S.; Baker, K. S.; Asangba, A. E.; Wickett, K.; DiLauro, T.; Varvel, V.

    2013-12-01

    The continuing proliferation of geological and biological data generated at scientifically significant sites (such as hot springs, coral reefs, volcanic fields and other unique, data-rich locales) has created a clear need for the curation and active management of these data. However, there has been little exploration of what these curation processes and policies would entail. To that end, the Site-Based Data Curation (SBDC) project is developing a framework of guidelines and processes for the curation of research data generated at scientifically significant sites. A workshop was held in April 2013 at Yellowstone National Park (YNP) to gather input from scientists and stakeholders. Workshop participants included nine researchers actively conducting geobiology research at YNP, and seven YNP representatives, including permitting staff and information professionals from the YNP research library and archive. Researchers came from a range of research areas -- geology, molecular and microbial biology, ecology, environmental engineering, and science education. Through group discussions, breakout sessions and hands-on activities, we sought to generate policy recommendations and curation guidelines for the collection, representation, sharing and quality control of geobiological datasets. We report on key themes that emerged from workshop discussions, including: - participants' broad conceptions of the long-term usefulness, reusability and value of data. - the benefits of aggregating site-specific data in general, and geobiological data in particular. - the importance of capturing a dataset's originating context, and the potential usefulness of photographs as a reliable and easy way of documenting context. - researchers' and resource managers' overlapping priorities with regards to 'big picture' data collection and management in the long-term. Overall, we found that workshop participants were enthusiastic and optimistic about future collaboration and development of community

  13. Protein (Cyanobacteria): 186682931 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 63737:1993 ... hypothetical protein Npun_R2630 Nostoc punctiforme PCC 73102 MDTLDLQSVSTEDVMLRYGIKSRTTLNKFLENAGVNSFKEGRKTFIRMYQLGVLDRSAH...ELNYPINQSSNQSIQSIHPTDSIKSEQMELAESTGLFPLTTVDLLYITCEYENLPRLAKWLAGYAFLEKMSSGRVILPRDVVLKILDYKRLPTCKDGYFRYGNFVFLMIGDHKKEWLVSKK

  14. Evolution of space food in Nostoc sp. HK-01

    Science.gov (United States)

    Tomita-Yokotani, Kaori; Yamashita, Masamichi; Hashimoto, Hirofumi; Sato, Seigo; Kimura, Yasuko; Katoh, Hiroshi; Arai, Mayumi

    2012-07-01

    Habitation in outer space is one of our challenges. We have been studying future space agriculture to provide food and oxygen for the habitation area in the space environment, on Mars. A cyanobacteria, Nostoc sp. HK-01, has high several outer space environmental tolerance. We have already confirmed that Nostoc sp.HK-01 had an ability to grow for over several years on the Martian regolith simulant in a laboratory experiment. Nostoc sp HK-01 would have high contribution to change the atmosphere in Mars as a photosynthetic creature. In outer environment, all of materials have to circulate for all of creature living in artificial eco-systems on Mars. This material has several functions as the utilization in space agriculture. Here, we are proposing using them as a food after its growing on Mars. We are trying to determine the best conditions and evolution for space food using Nostoc sp.HK-01 and studying the proposal of utilization of cyanobacteria, Nostoc sp HK-01, for the variation of meal as space agriculture.

  15. Metabolism and resources of spherical colonies of Nostoc zetterstedtii

    DEFF Research Database (Denmark)

    Jensen, Kaj Sand; Raun, Ane-Marie Løvendahl; Borum, Jens

    2009-01-01

    Constraints imposed by the spherical form and gelatinous matrix of centimeter-thick colonies of the cyanobacterium Nostoc zetterstedtii on its functional properties were tested by examining the scaling of its composition, light absorption, photosynthesis, and respiration to individual size....... Nostoc absorbed 96% of incident light from the surface to the center because of high areal pigment density, but absorbed photons were used with low quantum efficiency (11- 38 mmol O2 mol21 photon) and photosynthesis was low relative to dark respiration (2.0-5.4). Therefore, N. zetterstedtii is threatened...... by reduced light availability and only extended to lake depths receiving about 12% of surface irradiance, whereas mosses, characeans, and angiosperms with thin photosynthetic tissues grew deeper (3.1-7.5% of surface irradiance). Nostoc ameliorated the restrictions of low lake DIC and long diffusion paths...

  16. Biochemical changes induced by fungicides in nitrogen fixing Nostoc sp.

    Science.gov (United States)

    Deviram, G V N S; Pant, Gaurav; Prasuna, R Gyana

    2013-01-01

    The present study indicates the effect of fungicides (approved by WHO) and their behavior on nitrogen fixer of rice eco system Nostoc sp. Application of plant protecting chemicals at recommended levels braced up the growth of blue green algae thereby enhancing heterocyst formation and nitrogenase activity. Nostoc sp demoed varying degrees of sensitivity to fungicides. Biomass yield, protein, carbohydrate content reduced after 3pg/mL concentration. Heterocyst damage was observed from 4μg/mL, Proline content increased with increase in fungicide concentration, utmost yellowing of the culture started from 4μg/mL. The decreasing order of the toxicity to Nostoc sp with fungicides was Mancozeb> Ediphenphos> Carbendazim> Hexaconazole.

  17. Contribution to the study of the influence of geo-biological factors on animal health: bio-geophysics, 'biodomy'

    International Nuclear Information System (INIS)

    Watrin, Estelle Suzanne Madeleine

    1999-01-01

    Geo-biology is the science of the influence of Earth and cosmos on the health of living things. The author proposes a general overview of this issue, first by giving an overview of geo-biological factors from the cosmos (Universe, Sun, Moon) and of those from the Earth: atmospheric electricity, air ionization, Earth magnetic field, telluric currents, Schumann waves, networks (global network or Hartmann network, diagonal Curry and Withmann networks, other networks, active crossings and star points), underground water streams, geological fault, mineralised or metal veins, cosmic-telluric chimneys, high activity points, radon. The author also addresses factors related to human activity such as electric and electromagnetic pollution (50/60 Hz electric and magnetic fields from different sources, cathodic screens, radio-electric frequencies and hyper-frequencies, steady electric and magnetic fields). Then, she proposes an overview of physio-pathology related to electromagnetic fields. She addresses the various means and techniques to detect and measure these different factors, and describes how to be protected against these geo-biological factors. She finally discusses the issue of clinic cases [fr

  18. Growth response to temperature and irradiance in Nostoc spongiaeforme

    Science.gov (United States)

    California water-seeded rice fields are typically shallow and have high nutrient levels, which are ideal growing conditions for algae and cyanobacteria. Nostoc spongiaeforme is problematic in California rice fields because floating mats may dislodge seedlings or smother them when the mats accumulat...

  19. Understanding nutrient exchange between Azolla and its symbiont, Nostoc

    OpenAIRE

    Eily, Ariana

    2017-01-01

    This is an in-depth look at the research I am doing for my doctoral degree at Duke University, investigating the exchange of nutrients between the aquatic fern genus, Azolla, and its cyanobacterial symbiont, Nostoc azollae. All of the illustrations and microscopy images within this presentation are my own.

  20. Antagonistic interactions between filamentous heterotrophs and the cyanobacterium Nostoc muscorum

    Directory of Open Access Journals (Sweden)

    Wolf Sarah

    2011-09-01

    Full Text Available Abstract Background Little is known about interactions between filamentous heterotrophs and filamentous cyanobacteria. Here, interactions between the filamentous heterotrophic bacteria Fibrella aestuarina (strain BUZ 2 and Fibrisoma limi (BUZ 3 with an axenic strain of the autotrophic filamentous cyanobacterium Nostoc muscorum (SAG 25.82 were studied in mixed cultures under nutrient rich (carbon source present in medium and poor (carbon source absent in medium conditions. Findings F. aestuarina BUZ 2 significantly reduced the cyanobacterial population whereas F. limi BUZ 3 did not. Physical contact between heterotrophs and autotroph was observed and the cyanobacterial cells showed some level of damage and lysis. Therefore, either contact lysis or entrapment with production of extracellular compounds in close vicinity of host cells could be considered as potential modes of action. The supernatants from pure heterotrophic cultures did not have an effect on Nostoc cultures. However, supernatant from mixed cultures of BUZ 2 and Nostoc had a negative effect on cyanobacterial growth, indicating that the lytic compounds were only produced in the presence of Nostoc. The growth and survival of tested heterotrophs was enhanced by the presence of Nostoc or its metabolites, suggesting that the heterotrophs could utilize the autotrophs and its products as a nutrient source. However, the autotroph could withstand and out-compete the heterotrophs under nutrient poor conditions. Conclusions Our results suggest that the nutrients in cultivation media, which boost or reduce the number of heterotrophs, were the important factor influencing the outcome of the interplay between filamentous heterotrophs and autotrophs. For better understanding of these interactions, additional research is needed. In particular, it is necessary to elucidate the mode of action for lysis by heterotrophs, and the possible defense mechanisms of the autotrophs.

  1. Arsenic biotransformation by a cyanobacterium Nostoc sp. PCC 7120.

    Science.gov (United States)

    Xue, Xi-Mei; Yan, Yu; Xiong, Chan; Raber, Georg; Francesconi, Kevin; Pan, Ting; Ye, Jun; Zhu, Yong-Guan

    2017-09-01

    Nostoc sp. PCC 7120 (Nostoc), a typical filamentous cyanobacterium ubiquitous in aquatic system, is recognized as a model organism to study prokaryotic cell differentiation and nitrogen fixation. In this study, Nostoc cells incubated with arsenite (As(III)) for two weeks were extracted with dichloromethane/methanol (DCM/MeOH) and the extract was partitioned between water and DCM. Arsenic species in aqueous and DCM layers were determined using high performance liquid chromatography - inductively coupled plasma mass spectrometer/electrospray tandem mass spectrometry (HPLC-ICPMS/ESIMSMS). In addition to inorganic arsenic (iAs), the aqueous layer also contained monomethylarsonate (MAs(V)), dimethylarsinate (DMAs(V)), and the two arsenosugars, namely a glycerol arsenosugar (Oxo-Gly) and a phosphate arsenosugar (Oxo-PO4). Two major arsenosugar phospholipids (AsSugPL982 and AsSugPL984) were detected in DCM fraction. Arsenic in the growth medium was also investigated by HPLC/ICPMS and shown to be present mainly as the inorganic forms As(III) and As(V) accounting for 29%-38% and 29%-57% of the total arsenic respectively. The total arsenic of methylated arsenic, arsenosugars, and arsenosugar phospholipids in Nostoc cells with increasing As(III) exposure were not markedly different, indicating that the transformation to organoarsenic in Nostoc was not dependent on As(III) concentration in the medium. Our results provide new insights into the role of cyanobacteria in the biogeochemical cycling of arsenic. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Geobiological Cycling of Gold: From Fundamental Process Understanding to Exploration Solutions

    Directory of Open Access Journals (Sweden)

    Frank Reith

    2013-11-01

    Full Text Available Microbial communities mediating gold cycling occur on gold grains from (sub-tropical, (semi-arid, temperate and subarctic environments. The majority of identified species comprising these biofilms are β-Proteobacteria. Some bacteria, e.g., Cupriavidus metallidurans, Delftia acidovorans and Salmonella typhimurium, have developed biochemical responses to deal with highly toxic gold complexes. These include gold specific sensing and efflux, co-utilization of resistance mechanisms for other metals, and excretion of gold-complex-reducing siderophores that ultimately catalyze the biomineralization of nano-particulate, spheroidal and/or bacteriomorphic gold. In turn, the toxicity of gold complexes fosters the development of specialized biofilms on gold grains, and hence the cycling of gold in surface environments. This was not reported on isoferroplatinum grains under most near-surface environments, due to the lower toxicity of mobile platinum complexes. The discovery of gold-specific microbial responses can now drive the development of geobiological exploration tools, e.g., gold bioindicators and biosensors. Bioindicators employ genetic markers from soils and groundwaters to provide information about gold mineralization processes, while biosensors will allow in-field analyses of gold concentrations in complex sampling media.

  3. Genetic Diversity of Nostoc Symbionts Endophytically Associated with Two Bryophyte Species

    OpenAIRE

    Costa, José-Luis; Paulsrud, Per; Rikkinen, Jouko; Lindblad, Peter

    2001-01-01

    The diversity of the endophytic Nostoc symbionts of two thalloid bryophytes, the hornwort Anthoceros fusiformis and the liverwort Blasia pusilla, was examined using the tRNALeu (UAA) intron sequence as a marker. The results confirmed that many different Nostoc strains are involved in both associations under natural conditions in the field. The level of Nostoc diversity within individual bryophyte thalli varied, but single DNA fragments were consistently amplified from individual symbiotic col...

  4. Allophycocyanin forms isolated from Nostoc sp. phycobilisomes

    Energy Technology Data Exchange (ETDEWEB)

    Zilinskas, B.A.; Zimmerman, B.K.; Gantt, E.

    1978-01-01

    Allophycocyanin from dissociated phycobilisomes of Nostoc sp. occurs in three spectrally identifiable forms that fractionate on calcium phosphate adsorption chromatography as: allophycocyanin (APC) I (15 to 20%), APC II (40 to 50%), and APC III (30 to 40%). APC I has a single absorption maximum at 654 nm, and a fluorescence emission peak at 678 nm. The absorption peaks of APC II and III are both at 650 nm, but the relative absorbance at 620/650 nm of APC III is less than that of APC II. The emission of both is maximum at 660 nm. On zone sedimentation in sucrose, their S/sub 20 w/ values of 6.0 +- 0.1 (APC I), 5.0 +- 0.1 (APC II), and 5.3 +-0.2 (APC III) were comparable to the order of their elution from Sephadex G-200. On SDS acrylamide gel electrophoresis two subunits were resolved with apparent molecular weights of 16,900 and 18,400 daltons. When stained by Coomassie blue, they were present in a ratio of 1..cap alpha..:1..beta.. in APC II and III, and a probable ratio of 2..cap alpha..:3..beta.. in APC I. The larger size of APC I may be accounted for by additional ..beta.. subunits, by the presence of an additional polypeptide of 35,000 daltons, or both. Over several days, bleaching as noted by a decrease in absorbance at 650 nm, occurred in all three forms; in addition, the more pronounced bleaching at 650 nm, relative to 620 nm, results in APC III becoming spectrally identical to APC II. A trace of a fourth pigment, probably comparable to allophycocyanin-B, was occasionally detected. The results suggest that several in vitro APC forms (sharing similar subunits) arise upon phycobilisome dissociation, and that APC I is the form most closely related to the final fluorescence emitter of intact phycobilisomes. In this form it probably serves as the bridging pigment in energy transfer from the phycobilisomes to chlorophyll.

  5. Dried Colony in Cyanobacterium, Nostoc sp. HK-01 — Several high Space Environment Tolerances for ``Tanpopo'' Mission

    Science.gov (United States)

    Tomita-Yokotani, K.; Kimura, S.; Kimura, Y.; Igarashi, Y.; Ajioka, R.; Sato, S.; Katoh, H.; Baba, K.

    2013-11-01

    A cyanobacterium, Nostoc sp. HK-01, has high several space environmental tolerance. Nostoc sp HK-01 would have high contribution for the “Tanpopo” mission in Japan Experimental Module of the International Space Station.

  6. Light influences cytokinin biosynthesis and sensing in Nostoc (cyanobacteria).

    Science.gov (United States)

    Frébortová, Jitka; Plíhal, Ondřej; Florová, Vendula; Kokáš, Filip; Kubiasová, Karolina; Greplová, Marta; Šimura, Jan; Novák, Ondřej; Frébort, Ivo

    2017-06-01

    Cytokinins are an important group of plant hormones that are also found in other organisms, including cyanobacteria. While various aspects of cytokinin function and metabolism are well understood in plants, the information is limited for cyanobacteria. In this study, we first experimentally confirmed a prenylation of tRNA by recombinant isopentenyl transferase NoIPT2 from Nostoc sp. PCC 7120, whose encoding gene we previously identified in Nostoc genome along with the gene for adenylate isopentenyl transferase NoIPT1. In contrast to NoIPT2, the transcription of NoIPT1 was strongly activated during the dark period and was followed by an increase in the cytokinin content several hours later in the light period. Dominant cytokinin metabolites detected at all time points were free bases and monophosphates of isopentenyladenine and cis-zeatin, while N-glucosides were not detected at all. Whole transcriptome differential expression analysis of cultures of the above Nostoc strain treated by cytokinin compared to untreated controls indicated that cytokinin together with light trigger expression of several genes related to signal transduction, including two-component sensor histidine kinases and two-component hybrid sensors and regulators. One of the affected histidine kinases with a cyclase/histidine kinase-associated sensory extracellular domain similar to the cytokinin-binding domain in plant cytokinin receptors was able to modestly bind isopentenyladenine. The data show that the genetic disposition allows Nostoc not only to produce free cytokinins and prenylate tRNA but also modulate the cytokinin biosynthesis in response to light, triggering complex changes in sensing and regulation. © 2017 Phycological Society of America.

  7. Light influences cytokinin biosynthesis and sensing in Nostoc (cyanobacteria)

    Czech Academy of Sciences Publication Activity Database

    Frébortová, J.; Plíhal, O.; Florová, P.; Kokáš, F.; Kubiasová, K.; Greplová, M.; Šimura, J.; Novák, Ondřej; Frébort, I.

    2017-01-01

    Roč. 53, č. 3 (2017), s. 703-714 ISSN 0022-3646 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : cytokinin * expression profiling * miaA * Nostoc * RNA-seq * sensor kinase * tRNA IPT Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 2.608, year: 2016

  8. Studies of polysaccharides from three edible species of Nostoc (cyanobacteria) with different colony morphologies : structural characterization and effect on the complement system of polysaccharides from Nostoc commune

    NARCIS (Netherlands)

    Brüll, L.P.; Huang, Z.; Thomas-Oates, J.E.; Smestad-Paulsen, B.; Cohen, E.H.; Michaelsen, T.E.

    2000-01-01

    The cyanobacterium Nostoc commune Vaucher produces quite complex extracellular polysaccharides. The cyanobacterium is nitrogen fixing, and on growing the cyanobacterium in media with and without nitrogen, different types of extracellular polysaccharides were obtained. These were also different from

  9. Impacts of varying light regimes on phycobiliproteins of Nostoc sp. HKAR-2 and Nostoc sp. HKAR-11 isolated from diverse habitats.

    Science.gov (United States)

    Kannaujiya, Vinod K; Sinha, Rajeshwar P

    2015-11-01

    The adaptability of cyanobacteria in diverse habitats is an important factor to withstand harsh conditions. In the present investigation, the impacts of photosynthetically active radiation (PAR; 400-700 nm), ultraviolet-B (UV-B; 280-315 nm), and PAR + UV-B radiations on two cyanobacteria viz., Nostoc sp. HKAR-2 and Nostoc sp. HKAR-11 inhabiting diverse habitats such as hot springs and rice fields, respectively, were studied. Cell viability was about 14 % in Nostoc sp. HKAR-2 and Nostoc sp. HKAR-11 after 48 h of UV-B exposure. PAR had negligible negative impact on the survival of both cyanobacteria. The continuous exposure of UV-B and PAR + UV-B showed rapid uncoupling, bleaching, fragmentation, and degradation in both phycocyanin (C-PC) and phycoerythrin (C-PE) subunits of phycobiliproteins (PBPs). Remarkable bleaching effect of C-PE and C-PC was not only observed with UV-B or PAR + UV-B radiation, but longer period (24-48 h) of exposure with PAR alone also showed noticeable negative impact. The C-PE and C-PC subunits of the rice field isolate Nostoc sp. HKAR-11 were severely damaged in comparison to the hot spring isolate Nostoc sp. HKAR-2 with rapid wavelength shifting toward shorter wavelengths denoting the bleaching of both the accessory light harvesting pigments. The results indicate that PBPs of the hot spring isolate Nostoc sp. HKAR-2 were more stable under various light regimes in comparison to the rice field isolate Nostoc sp. HKAR-11 that could serve as a good source of valuable pigments to be used in various biomedical and biotechnological applications.

  10. Geochemistry and geobiology of a present-day serpentinization site in California: The Cedars

    Science.gov (United States)

    Morrill, Penny L.; Kuenen, J. Gijs; Johnson, Orion J.; Suzuki, Shino; Rietze, Amanda; Sessions, Alex L.; Fogel, Marilyn L.; Nealson, Kenneth H.

    2013-05-01

    Ultra-basic (pH 11-12) reducing (-656 to -585 mV) groundwater springs discharging from serpentinized peridotite of The Cedars, CA, were investigated for their geochemistry and geobiology. The spring waters investigated were of meteoric origin; however, geochemical modeling suggests that there were two sources of groundwater, a shallow source with sufficient contact with The Cedars' peridotite body to be altered geochemically by serpentinization, and a deeper groundwater source that not only flows through the peridotite body but was also in contact with the marine sediments of the Franciscan Subduction Complex (FSC) below the peridotite body. We propose that the groundwater discharging from lower elevations (GPS1 and CS1) reflect the geochemistry of the deeper groundwater in contact with FSC, while groundwaters discharging from springs at higher elevations (NS1 and BSC) were a mixture of the shallow peridotite-only groundwater and the deeper groundwater that has been in contact with the FSC. Cell densities of suspended microbes within these waters were extremely low. In the NS1 and BSC spring fluids, cell densities ranged from 102 to 103 cells/ml, while suspended cells at GPS were lower than 10 cells/mL. However, glass slides incubated in the BSC and GPS1 springs for 2-3 weeks were colonized by cells with densities ranging from 106 to 107 cells/cm2 attached to their surfaces. All of the springs were very low (⩽1 μM) in several essential elements and electron acceptors (e.g. nitrate/ammonium, sulfate, and phosphate) required for (microbial) growth, which is not uncommon at sites of continental serpentinization. Gases rich in N2, H2, and CH4 were exsolving from the springs. The stable carbon isotope value (δ13CCH4 = -68 ± 0.6‰) and the CH4/C2+ (>103) of methane and other gaseous hydrocarbons exsolving from NS1 were typical of microbially sourced methane, whereas the isotope values and the CH4/C2+ of BSC and CS1 springs were more enriched in 13C and had CH4/C2

  11. Characterization of a microcystin and detection of microcystin synthetase genes from a Brazilian isolate of Nostoc.

    Science.gov (United States)

    Genuário, Diego Bonaldo; Silva-Stenico, Maria Estela; Welker, Martin; Beraldo Moraes, Luiz Alberto; Fiore, Marli Fátima

    2010-04-01

    A nostocalean nitrogen-fixing cyanobacterium isolated from an eutrophic freshwater reservoir located in Piracicaba, São Paulo, Brazil, was evaluated for the production of hepatotoxic cyclic heptapeptides, microcystins. Morphologically this new cyanobacterium strain appears closest to Nostoc, however, in the phylogenetic analysis of 16S rRNA gene it falls into a highly stable cluster distantly only related to the typical Nostoc cluster. Extracts of Nostoc sp. CENA88 cultured cells, investigated using ELISA assay, gave positive results and the microcystin profile revealed by ESI-Q-TOF/MS/MS analysis confirmed the production of [Dha(7)]MCYST-YR. Further, Nostoc sp. CENA88 genomic DNA was analyzed by PCR for sequences of mcyD, mcyE and mcyG genes of microcystin synthetase (mcy) cluster. The result revealed the presence of mcyD, mcyE and mcyG genes with similarities to those from mcy of Nostoc sp. strains 152 and IO-102-I and other cyanobacterial genera. The phylogenetic tree based on concatenated McyG, McyD and McyE amino acids clustered the sequences according to cyanobacterial genera, with exception of the Nostoc sp. CENA88 sequence, which was placed in a clade distantly related from other Nostoc strains, as previously observed also in the 16S rRNA phylogenetic analysis. The present study describes for the first time a Brazilian Nostoc microcystin producer and also the occurrence of demethyl MCYST-YR variant in this genus. The sequenced Nostoc genes involved in the microcystin synthesis can contribute to a better understanding of the toxigenicity and evolution of this cyanotoxin. Copyright 2009 Elsevier Ltd. All rights reserved.

  12. Geobiology of the Critical Zone: the Hierarchies of Process, Form and Life provide an Integrated Ontology

    Science.gov (United States)

    Cotterill, Fenton P. D.

    2016-04-01

    through to continental scales). Our ability to reconstruct narratives of landscape dynamics of encompassing - mega-geomorphic - patterns can only be as good as the details of individual events we can discern in Earth history. Obviously, recognizing the centrality of "Conquering the Mesoscale" as the intrinsic prerequisite to test competing hypotheses of landscape dynamics, in the earth system context, calls for innovative research approaches. This is where Africa holds vast potential. The continent is the most remarkable natural laboratory to explore and tackle these challenges where we seek to build the composite mega-geomorphic chronicle informed in the detail of mesoscale process and form. But how does geomorphology, embedded in an earth system framework, advance beyond the established approaches in process and mega-geomorphology? The latter's limitations to reconstruct the tempo and mode of African landforms and palaeoenviroments reveal the stark limits for researchers. This is where a geobiological approach brings interesting opportunities, especially for Africa. Consider, for one, the interlinking patterns of high endemism and geographical heterogeneity of extant biodiversity across the continent, and moreover the interplay in biotic turnovers since the Mesozoic that shaped these regional and more local patterns. These individuated biotic assemblages making up the continent's biomes and ecoregions reveal strident congruence with physiographic controls: especially relief, drainage and edaphic variables. Calibrated by molecular clocks, resolved with DNA evidence, timetrees of this phylogenetic diversity reveal a richness of evolutionary signals; the spectrum of these spectacular biotic radiations of African biodiversity range from the Late Mesozoic to Recent. The temporal spread of this phylogenetic diversity is exemplified, for example, in the extant mammal fauna: witness the Afrotheria compared to the Bovidae (Kingdon J et al. 2013. Mammals of Africa. Bloomsbury

  13. Photo- and heterotrophic nitrogenase activity by the cyano-bacterium Nostoc in symbiosis with the bryophyte Anthoceros

    International Nuclear Information System (INIS)

    Steinberg, N.A.; Meeks, J.C.

    1987-01-01

    In symbiosis with Anthoceros, Nostoc is thought to do little or no photosynthesis. However, light-dependent 14 CO 2 fixation by symbiotic Nostoc, freshly isolated from pure cultures of the reconstituted Anthoceros-Nostoc association, was 16% of that by free-living Nostoc. A DCMU-resistant mutant of Nostoc was isolated that fixed CO 2 at rates comparable to wild-type in both symbiotic and free-living growth states. To determine if symbiotic Nostoc can use its photosynthate directly to fix nitrogen, acetylene reduction by Anthoceros associations reconstituted with wild-type Nostoc was compared to associations with the DCMU-resistant mutant. In wild-type Anthoceros-Nostoc acetylene reduction was inhibited 97% by 5 μM DCMU, while inhibition of the DCMU-resistant Nostoc association was only 63%. Additions of glucose, fructose, maltose or sucrose to wild-type associations completely restored DCMU-inhibited acetylene reduction in the light. Acetylene reduction in the dark was stimulated by glucose, attaining 84% of the uninhibited light-dependent value. The authors conclude that symbiotic Nostoc maintains a pool of photosynthate which supports nitrogenase activity. The pool can also be supplemented from plant sources

  14. Genomic Changes Associated with the Evolutionary Transitions of Nostoc to a Plant Symbiont

    Science.gov (United States)

    Liaimer, Anton; Pederson, Eric; Kim, Sea-Yong; Shapiro, Nicole; Woyke, Tanja; Altermark, Bjørn; Pawlowski, Katharina; Weyman, Philip D; Dupont, Christopher L

    2018-01-01

    Abstract Cyanobacteria belonging to the genus Nostoc comprise free-living strains and also facultative plant symbionts. Symbiotic strains can enter into symbiosis with taxonomically diverse range of host plants. Little is known about genomic changes associated with evolutionary transition of Nostoc from free-living to plant symbiont. Here, we compared the genomes derived from 11 symbiotic Nostoc strains isolated from different host plants and infer phylogenetic relationships between strains. Phylogenetic reconstructions of 89 Nostocales showed that symbiotic Nostoc strains with a broad host range, entering epiphytic and intracellular or extracellular endophytic interactions, form a monophyletic clade indicating a common evolutionary history. A polyphyletic origin was found for Nostoc strains which enter only extracellular symbioses, and inference of transfer events implied that this trait was likely acquired several times in the evolution of the Nostocales. Symbiotic Nostoc strains showed enriched functions in transport and metabolism of organic sulfur, chemotaxis and motility, as well as the uptake of phosphate, branched-chain amino acids, and ammonium. The genomes of the intracellular clade differ from that of other Nostoc strains, with a gain/enrichment of genes encoding proteins to generate l-methionine from sulfite and pathways for the degradation of the plant metabolites vanillin and vanillate, and of the macromolecule xylan present in plant cell walls. These compounds could function as C-sources for members of the intracellular clade. Molecular clock analysis indicated that the intracellular clade emerged ca. 600 Ma, suggesting that intracellular Nostoc symbioses predate the origin of land plants and the emergence of their extant hosts. PMID:29554291

  15. A new UV-A/B protecting pigment in the terrestrial cyanobacterium Nostoc commune

    International Nuclear Information System (INIS)

    Scherer, S.; Chen, T.W.; Boeger, P.

    1988-01-01

    A new ultraviolet (UV)-A/B absorbing pigment with maxima at 312 and 330 nanometers from the cosmopolitan terrestrial cyanobacterium Nostoc commune is described. The pigment is found in high amounts (up to 10% of dry weight) in colonies grown under solar UV radiation but only in low concentrations in laboratory cultures illuminated by artificial light without UV. Its experimental induction by UV as well as its capacity to efficiently protect Nostoc against UV radiation is reported

  16. Biochemical characterization of sunscreening mycosporine-like amino acids from two Nostoc species inhabiting diverse habitats.

    Science.gov (United States)

    Richa; Sinha, Rajeshwar P

    2015-01-01

    We have screened two Nostoc species inhabiting diverse habitats for the presence of sunscreening mycosporine-like amino acid (MAA) compounds. The identification and characterization of one MAA (RT 3.1-3.8 min, λmax -334 nm) from both Nostoc species were performed using absorption spectroscopy, high-performance liquid chromatography (HPLC), electrospray ionization-mass spectrometry (ESI-MS), Fourier transform infrared (FTIR) spectroscopy and nuclear magnetic resonance (NMR) spectroscopy. Shinorine and porphyra-334 were commonly present in both Nostoc sp. strain HKAR-2 and Nostoc sp. strain HKAR-6. Nostoc sp. strain HKAR-2 also showed the presence of an unknown MAAs with retention time of 6.9 min and a corresponding λmax of 334 nm. Present investigation clearly demonstrated the presence of diverse profile of MAAs in the hot spring cyanobacterium in comparison to the rice field isolate. Thus, Nostoc sp. strain HKAR-2 would be a better source for the production of MAAs that can be used as a potent natural sunscreen against UV-B irradiation.

  17. Root colonization and phytostimulation by phytohormones producing entophytic Nostoc sp. AH-12.

    Science.gov (United States)

    Hussain, Anwar; Hamayun, Muhammad; Shah, Syed Tariq

    2013-11-01

    Nostoc, a nitrogen-fixing cyanobacterium, has great potential to make symbiotic associations with a wide range of plants and benefit its hosts with nitrogen in the form of nitrates. It may also use phytohormones as a tool to promote plant growth. Phytohormones [cytokinin (Ck) and IAA] were determined in the culture of an endophytic Nostoc isolated from rice roots. The strain was able to accumulate as well as release phytohormones to the culture media. Optimum growth conditions for the production of zeatin and IAA were a temperature of 25 °C and a pH of 8.0. Time-dependent increase in the accumulation and release of phytohormones was recorded. To evaluate the impact of cytokinins, an ipt knockout mutant in the background of Nostoc was generated by homologous recombination method. A sharp decline (up to 80 %) in the zeatin content was observed in the culture of mutant strain Nostoc AHM-12. Association of the mutant and wild type strain with rice and wheat roots was studied under axenic conditions. The efficacy of Nostoc to colonize plant root was significantly reduced (P Nostoc to colonize plant root and promote its growth.

  18. Genetic diversity of Nostoc microsymbionts from Gunnera tinctoria revealed by PCR-STRR fingerprinting.

    Science.gov (United States)

    Guevara, R; Armesto, J J; Caru, M

    2002-08-01

    The cyanobacteria belonging to the genus Nostoc fix atmospheric nitrogen, both as free-living organisms and in symbiotic associations with a wide range of hosts, including bryophytes, gymnosperms (cycads), the small water fern Azolla (Pteridophyte), the angiosperm genus Gunnera, and fungi (lichens). The Gunnera-Nostoc symbiosis is the only one that involves a flowering plant. In Chile, 12 species of Gunnera have been described with a broad distribution in the temperate region. We examined the genetic diversity of Nostoc symbionts from three populations of Gunnera tinctoria from Abtao, Chiloé Island, southern Chile, and microsymbionts from other two species of Gunnera from southern Chile, using PCR amplification of STRR (short tandemly repeated repetitive) sequences of the Nostoc infected tissue. To our knowledge, this is the first report of PCR fingerprinting obtained directly from symbiotic tissue of Gunnera. Genetic analyses revealed that Nostoc symbionts exhibit important genetic diversity among host plants, both within and between Gunnera populations. It was also found that only one Nostoc strain, or closely related strains, established symbiosis with an individual plant host.

  19. Optimization of macronutrient kinetics for biomass production in Nostoc calcicola

    Science.gov (United States)

    Aiyer, Subramanian Seshadri C.; Akshai, A.; Kumar, B. G. Prakash; Ramachandran, S.

    2018-04-01

    To assess the feasibility of Allen and Arnon’s (AA) media addition to increase the biomass productivity, (0, 2.5, 5, 7.5 ml of 10x media concentrate - MC) was added to aerated culture every six days, in two separate conditions i.e., single harvest (SH) and continuous harvest (CH) after 15th day. Results show that with addition of 5 ml of MC produced maximum amount of biomass is 1.32 g/L and 2.88 g/L for Sh and CH respectively. These results show that with addition of 5 ml of MC to an aerated culture every six days with continuous biomass harvesting leads to maximum growth of Nostoc calcicola @25°C

  20. [Response of Nostoc flageliforme cell to Cu2+, Cr2+ and Pb2+ stress].

    Science.gov (United States)

    Guo, Jinying; Shi, Mingke; Zhao, Yanli; Ren, Guoyan; Yi, Junpeng; Niu, Leilei; Li, Juan

    2013-06-04

    This study aimed to investigate the effects of Cu2+, Cr2+ and Pb2+ stress on Nostoc flagelliforme cell. The response of Nostoc flagelliforme cell was analyzed under the stress. The modified BG11 culture medium containing different heavy metal ions of 0, 0.1, 1.0, 10, 100 mg/L was used to cultivate Nostoc flagelliforme cell at 25 degrees C and light intensity of 80 micromol/(m x s). Electrolyte leakage, the activities of superoxide dismutase, the content of malondialdehyde, proline, soluble protein and trehalose were analyzed. Under 1 - 100 mg/L Cu2+, Cr2+ and Pb2+ stress, electrolyte leakage and malondialdehyde contents in Nostoc flagelliforme cell were higher than those in the control group during heavy metal ions stress. Meanwhile, superoxide dismutase activity increased slightly under 10 mg/L, but was lower afterwards. The contents of proline, soluble protein and trehalose increased under 10 mg/L heavy metal ions stress, while declined under extreme heavy metal ions stress (100 mg/L). Nostoc flagelliforme cell has resistance to low heavy metal ions stress, but is damaged badly under extreme heavy metal ions stress.

  1. Phycobiliprotein accumulation in cyanobacterium Nostoc linckia and modification of antioxidant activity

    Directory of Open Access Journals (Sweden)

    Ana VALUTA

    2015-01-01

    Full Text Available The article deals with iron(III coordination compounds with Schiff bases as ligands and their impact on phycobiliprotein accumulation by cyanobacterium Nostoc linckia. Stimulatory effect depends on the applied dose and in case of three compounds, the concentration 20 mg/L was determined as one with moderate intensity. Lower concentrations resulted in an increase of the phycobiliprotein synthesis. There was found a significant positive correlation between phycobiliprotein content and ABTS (2.2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid assay values displayed by aqueous extracts from Nostoc linckia biomass cultivated in nutrient medium with these coordination compounds. Hence, it is possible to modify the antioxidant activity of Nostoc biomass by applying low concentrations of chemical stimuli.

  2. Effect of IAA on in vitro growth and colonization of Nostoc in plant roots

    Science.gov (United States)

    Hussain, Anwar; Shah, Syed T.; Rahman, Hazir; Irshad, Muhammad; Iqbal, Amjad

    2015-01-01

    Nostoc is widely known for its ability to fix atmospheric nitrogen and the establishment of symbiotic relationship with a wide range of plants from various taxonomic groups. Several strains of Nostoc produce phytohormones that promote growth of its plant partners. Nostoc OS-1 was therefore selected for study because of the presence of putative ipdC gene that encodes a key enzyme to produce Indole-3-acetic acid (IAA). The results indicated that both cellular and released IAA was found high with increasing incubation time and reached to a peak value (i.e., 21 pmol mg-1ch-a) on the third week as determined by UPLC-ESI-MS/MS. Also the Nostoc OS-1 strain efficiently colonized the roots and promoted the growth of rice as well as wheat under axenic conditions and induced ipdC gene that suggested the possible involvement of IAA in these phenotypes. To confirm the impact of IAA on root colonization efficiency and plant promoting phenotypes of Nostoc OS-1, an ipdC knockout mutant was generated by homologous recombinant method. The amount of releasing IAA, in vitro growth, root colonization, and plant promoting efficiency of the ipdC knockout mutant was observed significantly lower than wild type strain under axenic conditions. Importantly, these phenotypes were restored to wild-type levels when the ipdC knockout mutant was complemented with wild type ipdC gene. These results together suggested that ipdC and/or synthesized IAA of Nostoc OS-1 is required for its efficient root colonization and plant promoting activity. PMID:25699072

  3. COMPONENŢA AMINOACIZILOR DIN BIOMASA ALGEI CIANOFITE NOSTOC GELATINOSUM (SCHOUSB ELENK.

    Directory of Open Access Journals (Sweden)

    Sergiu DOBROJAN

    2016-02-01

    Full Text Available În articol este analizată componenţa aminoacizilor din biomasa algei cianofite Nostoc gelatinosum (Schousb Elenk. colectate de pe mediul nutritiv Drew. Din grupa aminoacizilor esenţiali în biomasa algei Nostoc gelatinosum (Schousb Elenk. se conţine în cantităţi majore leucina (2,142±0,06 mg/100 mg, treonina (1,188±0,02 mg/100 mg şi valina (1,085±0,03 mg/100 mg. Din aminoacizii neesenţiali predomină acidul aspartic (4,523±0,11 mg/100 mg şi acidul glutamic (2,774±0,07 mg/100 mg. Alga Nostoc gelatinosum (Schousb Elenk. are un conţinut bogat de aminoacizi şi poate servi ca sursă pentru vaste domenii de aplicare.THE AMINO ACIDS COMPOSITION OF THE BLUE-GREEN ALGANOSTOC GELATINOSUM (SCHOUSB ELENKThis article presents the amino acid content of the blue-green alga Nostoc gelatinosum (Schousb Elenk. collected from the Drew nutritive medium. From the essential amino group in Nostoc gelatinosum (Schousb Elenk. biomass, major amounts are contained leucine (2,142 ± 0,06 mg/100 mg, threonine (1,188 ± 0,02 mg/100 mg and valine (1,085 ± 0,03 mg/100 mg. From nonessential amino acids predominates aspartic acid (4,523 ± 0,11 mg/100 mg and glutamic acid (2,774 ± 0.07 mg/100 mg. The alga Nostoc gelatinosum (Schousb Elenk. has a high content of amino acids and can serve as a source for vast areas of application. 

  4. Interactions of copper and lead with Nostoc muscorum

    Energy Technology Data Exchange (ETDEWEB)

    Schecher, W.D.; Driscoll, C.T.

    1985-01-01

    Experiments were conducted to evaluate the effects of cell concentration, time of exposure, cellular activity and solution chemistry, on Pb (10/sup -6/ M) and Cu (10/sup -5/ M) uptake by the alga Nostoc muscorum. Surface equilibrium, with respect to aqueous metal levels, was established within an equilibration period of 8 h and maximum metal removal was observed in the pH range of 7.5 to 8.0. The observed removal of Cu and Pb from solution was similar to adsorption observed for inorganic surfaces at pH values less than 8.0. Removal of metallic ions decreased at pH values greater than 8.0 which was thought to be due to aqueous complexation with organic extracellular material. The extent to which the cells were able to remove trace metals from solution in the presence of citrate, sulfate, and Ca ion (10/sup -3/ M) was also evaluated. Additions of citrate and Ca ion mitigated metal uptake by algal suspensions. The presence of sulfate resulted in a reduction of Cu removal below pH values of 5.6 but enhanced the removal of Pb over the entire pH range. The chemical equilibrium model MINEQL was utilized to compare theoretical and observed phenomena so that possible mechanisms for metal-cell interactions could be assessed.

  5. Active accumulation of internal DIC pools reduces transport limitation in large colonies of Nostoc pruniforme

    DEFF Research Database (Denmark)

    Raun, Ane-Marie Løvendahl; Borum, Jens; Jensen, Kaj Sand

    2009-01-01

    Nostoc pruniforme is a freshwater cyanobacterium forming large spherical colonies of up to several centimeters in diameter. The size and shape result in low surface area to volume (SA/V) ratios that potentially put severe constraints on resource acquisition. In the present study we have specifica......Nostoc pruniforme is a freshwater cyanobacterium forming large spherical colonies of up to several centimeters in diameter. The size and shape result in low surface area to volume (SA/V) ratios that potentially put severe constraints on resource acquisition. In the present study we have...

  6. Nitrogenase activity (acetylene reduction activity) and diversity of six soil Nostoc strains

    Czech Academy of Sciences Publication Activity Database

    Hrouzek, P.; Šimek, Miloslav; Komárek, Jiří

    2003-01-01

    Roč. 108, - (2003), s. 87-101 ISSN 0342-1120 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6066911 Keywords : cyanobacteria * Nostoc * morphology Subject RIV: EH - Ecology, Behaviour

  7. Genus .i.Nostoc./i. - a source of novel trypsin inhibitors

    Czech Academy of Sciences Publication Activity Database

    Drápalová, P.; Štys, D.; Lukešová, Alena; Kopecký, Jiří

    2008-01-01

    Roč. 127, č. 1 (2008), s. 61-82 ISSN 1864-1318 R&D Projects: GA MŠk ME 874 Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z50200510 Keywords : cyanobacteria * LC/MS * Nostoc Subject RIV: EH - Ecology, Behaviour

  8. Nostoc PCC7524, a cyanobacterium which contains five sequence-specific deoxyribonucleases

    NARCIS (Netherlands)

    Reaston, J.; Duybesteyn, M.G.C.; Waard, Adrian de

    1982-01-01

    Five nucleotide sequence-specific deoxyribonucleases present in cell-free extracts of the filamentous cyanobacterium Nostoc PCC7524 have been purified and characterized. One of these enzymes, designated Nsp(7524)I cleaves at a new kind of nucleotide sequence i.e. 5'-PuCATG λ Py-3'. The other four

  9. Unprecedented slow growth and mortality of the rare colonial cyanobacterium, Nostoc zetterstedtii, in oligotrophic lakes

    DEFF Research Database (Denmark)

    Jensen, Kaj Sand; Møller, Claus Lindskov

    2011-01-01

    Centimeter-large colonies of Nostoc zetterstedtii from a Swedish oligotrophic lake had the lowest growth and mortality rates of any studied temperate macrophyte. Annual growth rates at two shallow sites averaged 0.57– 0.73 3 1023 d21, corresponding to doubling times of colony dry weight in 2...

  10. Effect of a combination of two rice herbicides on the cyanobacterium, Nostoc spongiaeforme

    Science.gov (United States)

    Cyanobacteria grow in California rice fields where they form large mats that may smoother seedlings or cause them to dislodge, resulting in yield loss. The most troublesome species is Nostoc spongiaeforme. It is very difficult to control using currently accepted methods, i.e., aerial applications of...

  11. Simultaneous Production of Anabaenopeptins and Namalides by the Cyanobacterium Nostoc sp. CENA543.

    Science.gov (United States)

    Shishido, Tânia K; Jokela, Jouni; Fewer, David P; Wahlsten, Matti; Fiore, Marli F; Sivonen, Kaarina

    2017-11-17

    Anabaenopeptins are a diverse group of cyclic peptides, which contain an unusual ureido linkage. Namalides are shorter structural homologues of anabaenopeptins, which also contain an ureido linkage. The biosynthetic origins of namalides are unknown despite a strong resemblance to anabaenopeptins. Here, we show the cyanobacterium Nostoc sp. CENA543 strain producing new (nostamide B-E (2, 4, 5, and 6)) and known variants of anabaenopeptins (schizopeptin 791 (1) and anabaenopeptin 807 (3)). Surprisingly, Nostoc sp. CENA543 also produced namalide B (8) and the new namalides D (7), E (9), and F (10) in similar amounts to anabaenopeptins. Analysis of the complete Nostoc sp. CENA543 genome sequence indicates that both anabaenopeptins and namalides are produced by the same biosynthetic pathway through module skipping during biosynthesis. This unique process involves the skipping of two modules present in different nonribosomal peptide synthetases during the namalide biosynthesis. This skipping is an efficient mechanism since both anabaenopeptins and namalides are synthesized in similar amounts by Nostoc sp. CENA543. Consequently, gene skipping may be used to increase and possibly broaden the chemical diversity of related peptides produced by a single biosynthetic gene cluster. Genome mining demonstrated that the anabaenopeptin gene clusters are widespread in cyanobacteria and can also be found in tectomicrobia bacteria.

  12. The cyanobiont in an Azolla fern is neither Anabaena nor Nostoc.

    Science.gov (United States)

    Baker, Judith A; Entsch, Barrie; McKay, David B

    2003-12-05

    The cyanobacterial symbionts in the fern Azolla have generally been ascribed to either the Anabaena or Nostoc genera. By using comparisons of the sequences of the phycocyanin intergenic spacer and a fragment of the 16S rRNA, we found that the cyanobiont from an Azolla belongs to neither of these genera.

  13. INFLUENCE OF NOSTOC VAUCHER EX BORNET ET FLAHAULT STRAINS ON GROWTH AND DEVELOPMENT OF PISUM SATIVUM L.

    Directory of Open Access Journals (Sweden)

    Maltsev Ye. I.

    2015-12-01

    Full Text Available We investigated the positive impact of cultures cyanobacteria genus Nostoc Vaucher ex Bornet et Flahault on growth and development of higher plants as an example Pisum sativum L. All the Nostoc species have a positive effect on the viability, germination energy, and biometric characteristics of Pisum sativum. The greatest positive influence was registered for N. entophytum Born. et. Flah. and N. linckia (Roth Bornetet Flahault f. linckia.

  14. Discovery of Rare and Highly Toxic Microcystins from Lichen-Associated Cyanobacterium Nostoc sp. Strain IO-102-I

    OpenAIRE

    Oksanen, Ilona; Jokela, Jouni; Fewer, David P.; Wahlsten, Matti; Rikkinen, Jouko; Sivonen, Kaarina

    2004-01-01

    The production of hepatotoxic cyclic heptapeptides, microcystins, is almost exclusively reported from planktonic cyanobacteria. Here we show that a terrestrial cyanobacterium Nostoc sp. strain IO-102-I isolated from a lichen association produces six different microcystins. Microcystins were identified with liquid chromatography-UV mass spectrometry by their retention times, UV spectra, mass fragmentation, and comparison to microcystins from the aquatic Nostoc sp. strain 152. The dominant micr...

  15. Nodularin, a cyanobacterial toxin, is synthesized in planta by symbiotic Nostoc sp.

    Science.gov (United States)

    Gehringer, Michelle M; Adler, Lewis; Roberts, Alexandra A; Moffitt, Michelle C; Mihali, Troco K; Mills, Toby J T; Fieker, Claus; Neilan, Brett A

    2012-01-01

    The nitrogen-fixing bacterium, Nostoc, is a commonly occurring cyanobacterium often found in symbiotic associations. We investigated the potential of cycad cyanobacterial endosymbionts to synthesize microcystin/nodularin. Endosymbiont DNA was screened for the aminotransferase domain of the toxin biosynthesis gene clusters. Five endosymbionts carrying the gene were screened for bioactivity. Extracts of two isolates inhibited protein phosphatase 2A and were further analyzed using electrospray ionization mass spectrometry (ESI-MS)/MS. Nostoc sp. ‘Macrozamia riedlei 65.1' and Nostoc sp. ‘Macrozamia serpentina 73.1' both contained nodularin. High performance liquid chromatography (HPLC) HESI-MS/MS analysis confirmed the presence of nodularin at 9.55±2.4 ng μg−1 chlorophyll a in Nostoc sp. ‘Macrozamia riedlei 65.1' and 12.5±8.4 ng μg−1 Chl a in Nostoc sp. ‘Macrozamia serpentina 73.1' extracts. Further scans indicated the presence of the rare isoform [L-Har2] nodularin, which contains ℒ-homoarginine instead of ℒ-arginine. Nodularin was also present at 1.34±0.74 ng ml−1 (approximately 3 pmol per g plant ww) in the methanol root extracts of M. riedlei MZ65, while the presence of [L-Har2] nodularin in the roots of M. serpentina MZ73 was suggested by HPLC HESI-MS/MS analysis. The ndaA-B and ndaF genomic regions were sequenced to confirm the presence of the hybrid polyketide/non-ribosomal gene cluster. A seven amino-acid insertion into the NdaA-C1 domain of N. spumigena NSOR10 protein was observed in all endosymbiont-derived sequences, suggesting the transfer of the nda cluster from N. spumigena to terrestrial Nostoc species. This study demonstrates the synthesis of nodularin and [L-Har2] nodularin in a non-Nodularia species and the production of cyanobacterial hepatotoxin by a symbiont in planta. PMID:22456448

  16. Nodularin, a cyanobacterial toxin, is synthesized in planta by symbiotic Nostoc sp.

    Science.gov (United States)

    Gehringer, Michelle M; Adler, Lewis; Roberts, Alexandra A; Moffitt, Michelle C; Mihali, Troco K; Mills, Toby J T; Fieker, Claus; Neilan, Brett A

    2012-10-01

    The nitrogen-fixing bacterium, Nostoc, is a commonly occurring cyanobacterium often found in symbiotic associations. We investigated the potential of cycad cyanobacterial endosymbionts to synthesize microcystin/nodularin. Endosymbiont DNA was screened for the aminotransferase domain of the toxin biosynthesis gene clusters. Five endosymbionts carrying the gene were screened for bioactivity. Extracts of two isolates inhibited protein phosphatase 2A and were further analyzed using electrospray ionization mass spectrometry (ESI-MS)/MS. Nostoc sp. 'Macrozamia riedlei 65.1' and Nostoc sp. 'Macrozamia serpentina 73.1' both contained nodularin. High performance liquid chromatography (HPLC) HESI-MS/MS analysis confirmed the presence of nodularin at 9.55±2.4 ng μg-1 chlorophyll a in Nostoc sp. 'Macrozamia riedlei 65.1' and 12.5±8.4 ng μg-1 Chl a in Nostoc sp. 'Macrozamia serpentina 73.1' extracts. Further scans indicated the presence of the rare isoform [L-Har(2)] nodularin, which contains L-homoarginine instead of L-arginine. Nodularin was also present at 1.34±0.74 ng ml(-1) (approximately 3 pmol per g plant ww) in the methanol root extracts of M. riedlei MZ65, while the presence of [L-Har(2)] nodularin in the roots of M. serpentina MZ73 was suggested by HPLC HESI-MS/MS analysis. The ndaA-B and ndaF genomic regions were sequenced to confirm the presence of the hybrid polyketide/non-ribosomal gene cluster. A seven amino-acid insertion into the NdaA-C1 domain of N. spumigena NSOR10 protein was observed in all endosymbiont-derived sequences, suggesting the transfer of the nda cluster from N. spumigena to terrestrial Nostoc species. This study demonstrates the synthesis of nodularin and [L-Har(2)] nodularin in a non-Nodularia species and the production of cyanobacterial hepatotoxin by a symbiont in planta.

  17. Comprehensive geobiological characterization of a bituminous carbonate facies with Ediacara-type fossils (Shibantan Member, South China)

    Science.gov (United States)

    Duda, Jan-Peter; Blumenberg, Martin; Thiel, Volker; Simon, Klaus; Zhu, Maoyan; Reitner, Joachim

    2015-04-01

    The Shibantan Member (Dengying Formation, Ediacaran Period) is one of only few carbonate settings with Ediacara-type fossils worldwide (e.g. Ding & Chen, 1981; Sun, 1986; Xiao et al., 2005; Shen et al., 2009; Chen et al., 2014). However, only little is known about the sedimentology and biogeochemistry of the environments in which these organisms throve. Here we provide a comprehensive geobiological characterization of the Shibantan Member, addressing the interplay between sedimentary and (bio-) geochemical processes. Sedimentary analysis revealed that black laminated limestones of the lower Shibantan Member were deposited after a sudden local deepening in a subtidal lower- to middle ramp environment close to the storm wave base, while the dark wavy dolomites of the upper Shibantan Member were deposited in a subtidal middle ramp environment between storm- and fair weather wave base. Sedimentation in the Shibantan basin was generally highly dynamic as evidenced by a distinct slumping horizon and mass-flow deposits that were possibly due to synsedimentary tectonic processes. The microbial-mat associated biota including Ediacara-type fossils is restricted to the lower Shibantan Member. Sedimentary analysis of this part reveals a close relationship between autochthonous mat growth and allochthonous and/or para-autochthonous event deposition. During deposition of the lower Shibantan Member the water column was probably temporarily stratified, with a sub- to anoxic water layer (evidenced by Ni/Co-, V/(V+Ni) and V/Sc ratios) overlain by a oxygenated upper layer (evidenced by negative Ce anomalies and low V/Cr ratios). However, such stratification was not permanent, as mixing by storm events is evidenced by hummocky cross stratification structures. 13C-enrichments in carbonates of the Lower Shibantan Member (δ13C = +3.3 to +4.0o VPDB) together with 13C-depletions of syngenetic n-alkanes cleaved from the respective extraction residue using catalytic hydropyrolysis (HyPy;

  18. Role of enzymatic and non enzymatic antioxidant in ameliorating salinity induced damage in nostoc muscorum

    International Nuclear Information System (INIS)

    Hend, A.; Abeer, A.; Allah, A.

    2015-01-01

    Presence of high salt concentration in the growth medium adversely affected the plant growth and productivity by altering its metabolic activities. Experiments were conducted on cyanobacteriaum Nostoc muscorum grown in nitrogen free medium supplemented with 250 mM NaCl to evaluate the salt stress induced changes in growth, antioxidants and lipid composition. Salt stress significantly reduced the growth and physio-biochemical attributes. Salt stress increased malonaldehyde content thereby causing alterations in the lipid fraction. Significant reduction in polyunsaturated fatty acids including phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidylglycerol (PG), phosphatidylinositol (PI) and phosphatidylserine (PS) was observed. Where as diacylglycerol, sterol ester and non-esterified fatty acids were increased. Activities of antioxidant enzymes and contents of non-enzymatic antioxidants including glutathione enhanced due to salt stress. An increase in accumulation of proline was also observed. Hence increased activity of antioxidants and altered fatty acid composition was observed in salt stressed Nostoc muscorum. (author)

  19. Antioxidative activity of ethanol extracts from Spirulina platensis and Nostoc linckia measured by various methods

    OpenAIRE

    Liliana CEPOI; Ludmila RUDI; Vera MISCU; Angela COJOCARI; Tatiana CHIRIAC; Daniela SADOVNIC

    2009-01-01

    The goal of this work is to determine the level of antioxidative activity of various ethanol extracts from Spirulina platensis and Nostoc linckia biomass, and also to demonstrate the possibility to select suitable methods for evaluation of these characteristics. The methods for determination of antioxidative activity were selected concerning their possible use for complex preparations: phosphomolybdenum method for evaluation of antioxidant capacity (PMRC), radical-scavenging activity by DPPH ...

  20. Multiple Roles of Soluble Sugars in the Establishment of Gunnera-Nostoc Endosymbiosis1[OA

    Science.gov (United States)

    Khamar, Hima J.; Breathwaite, Erick K.; Prasse, Christine E.; Fraley, Elizabeth R.; Secor, Craig R.; Chibane, Fairouz L.; Elhai, Jeff; Chiu, Wan-Ling

    2010-01-01

    Gunnera plants have the unique ability to form endosymbioses with N2-fixing cyanobacteria, primarily Nostoc. Cyanobacteria enter Gunnera through transiently active mucilage-secreting glands on stems. We took advantage of the nitrogen (N)-limitation-induced gland development in Gunnera manicata to identify factors that may enable plant tissue to attract and maintain cyanobacteria colonies. Cortical cells in stems of N-stressed Gunnera plants were found to accumulate a copious amount of starch, while starch in the neighboring mature glands was nearly undetectable. Instead, mature glands accumulated millimolar concentrations of glucose (Glc) and fructose (Fru). Successful colonization by Nostoc drastically reduced sugar accumulation in the surrounding tissue. Consistent with the abundance of Glc and Fru in the gland prior to Nostoc colonization, genes encoding key enzymes for sucrose and starch hydrolysis (e.g. cell wall invertase, α-amylase, and starch phosphorylase) were expressed at higher levels in stem segments with glands than those without. In contrast, soluble sugars were barely detectable in mucilage freshly secreted from glands. Different sugars affected Nostoc’s ability to differentiate motile hormogonia in a manner consistent with their locations. Galactose and arabinose, the predominant constituents of polysaccharides in the mucilage, had little or no inhibitory effect on hormogonia differentiation. On the other hand, soluble sugars that accumulated in gland tissue, namely sucrose, Glc, and Fru, inhibited hormogonia differentiation and enhanced vegetative growth. Results from this study suggest that, in an N-limited environment, mature Gunnera stem glands may employ different soluble sugars to attract Nostoc and, once the cyanobacteria are internalized, to maintain them in the N2-fixing vegetative state. PMID:20833727

  1. Impact of warming on Nostoc colonies (Cyanobacteria) in a wet hummock meadow, Spitsbergen

    Czech Academy of Sciences Publication Activity Database

    Elster, Josef; Kvíderová, Jana; Hájek, Tomáš; Láska, K.; Šimek, Miloslav

    2012-01-01

    Roč. 33, č. 4 (2012), 395-420 ISSN 0138-0338 R&D Projects: GA MŠk ME 934; GA MŠk LA341 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60660521 Institutional support: RVO:67985939 ; RVO:60077344 Keywords : global climate change * Nostoc * OTC Subject RIV: EH - Ecology, Behaviour Impact factor: 0.745, year: 2012

  2. Nostoc sphaeroides Kützing, an excellent candidate producer for CELSS

    Science.gov (United States)

    Hao, Zongjie; Li, Dunhai; Li, Yanhui; Wang, Zhicong; Xiao, Yuan; Wang, Gaohong; Liu, Yongding; Hu, Chunxiang; Liu, Qifang

    2011-11-01

    Some phytoplankton can be regarded as possible candidates in the establishment of Controlled Ecological Life Support System (CELSS) for some intrinsic characteristics, the first characteristic is that they should grow rapidly, secondly, they should be able to endure some stress factors and develop some corresponding adaptive strategies; also it is very important that they could provide food rich in nutritious protein and vitamins for the crew; the last but not the least is they can also fulfill the other main functions of CELSS, including supplying oxygen, removing carbon dioxide and recycling the metabolic waste. According to these characteristics, Nostoc sphaeroides, a potential healthy food in China, was selected as the potential producer in CELSS. It was found that the oxygen average evolution rate of this algae is about 150 μmol O 2 mg -1 h -1, and the size of them are ranged from 2 to 20 mm. Also it can be cultured with high population density, which indicated that the potential productivity of Nostoc sphaeroides is higher than other algae in limited volume. We measured the nutrient contents of the cyanobacterium and concluded it was a good food for the crew. Based on above advantages, Nostoc sphaeroides was assumed to a suitable phytoplankton for the establishment of Controlled Ecological Life Support System. We plan to develop suitable bioreactor with the cyanobacterium for supplying oxygen and food in future space missions.

  3. Secondary metabolite from Nostoc XPORK14A inhibits photosynthesis and growth of Synechocystis PCC 6803.

    Science.gov (United States)

    Shunmugam, Sumathy; Jokela, Jouni; Wahlsten, Matti; Battchikova, Natalia; Ateeq ur Rehman; Vass, Imre; Karonen, Maarit; Sinkkonen, Jari; Permi, Perttu; Sivonen, Kaarina; Aro, Eva-Mari; Allahverdiyeva, Yagut

    2014-06-01

    Screening of 55 different cyanobacterial strains revealed that an extract from Nostoc XPORK14A drastically modifies the amplitude and kinetics of chlorophyll a fluorescence induction of Synechocystis PCC6803 cells.After 2 d exposure to the Nostoc XPORK14A extract, Synechocystis PCC 6803 cells displayed reduced net photosynthetic activity and significantly modified electron transport properties of photosystem II under both light and dark conditions. However, the maximum oxidizable amount of P700 was not strongly affected. The extract also induced strong oxidative stress in Synechocystis PCC 6803 cells in both light and darkness. We identified the secondary metabolite of Nostoc XPORK14A causing these pronounced effects on Synechocystis cells. Mass spectrometry and nuclear magnetic resonance analyses revealed that this compound, designated as M22, has a non-peptide structure. We propose that M22 possesses a dualaction mechanism: firstly, by photogeneration of reactive oxygen species in the presence of light, which in turn affects the photosynthetic machinery of Synechocystis PCC 6803; and secondly, by altering the in vivo redox status of cells, possibly through inhibition of protein kinases.

  4. Physicochemical Characterization and Functional Analysis of the Polysaccharide from the Edible Microalga Nostoc sphaeroides

    Directory of Open Access Journals (Sweden)

    Haifeng Li

    2018-02-01

    Full Text Available Nostoc colonies have been used as food and medicine for centuries, and their main supporting matrix is polysaccharides, which help Nostoc cells resist various environmental stresses including oxidative stress. Here we isolated a polysaccharide, nostoglycan, from cultured Nostoc sphaeroides colonies and determined its physicochemical properties, which revealed a characteristic infrared absorption spectrum typical of polysaccharides and an amorphous morphology with rough surfaces. We also show that nostoglycan has strong moisture absorption and retention capacities and a high relative viscosity. Using Caenorhabditis elegans models, we then demonstrate that nostoglycan is capable of improving overall survival rate of the animals under increased oxidative stress caused by paraquat. Nostoglycan also reduces reactive oxygen species level, inhibits protein carbonyl formation and lipid peroxidation, and increases activities of superoxide dismutase and catalase in paraquat-exposed nematodes. As oxidative stress may drive tumor progression, we further demonstrate that nostoglycan can suppress the proliferation of several types of tumor cells and induce apoptosis of human lung adenocarcinoma A549 cells via caspase-3 activation. Together, our results yield important information on the physicochemical characteristics and demonstrate the antioxidant and anti-proliferative functions of nostoglycan, and thus provide an insight into its potential in food and health industries.

  5. Diversity of endosymbiotic Nostoc in Gunnera magellanica from Tierra del Fuego, Chile [corrected].

    Science.gov (United States)

    Fernández-Martínez, M A; de Los Ríos, A; Sancho, L G; Pérez-Ortega, S

    2013-08-01

    Global warming is causing ice retreat in glaciers worldwide, most visibly over the last few decades in some areas of the planet. One of the most affected areas is the region of Tierra del Fuego (southern South America). Vascular plant recolonisation of recently deglaciated areas in this region is initiated by Gunnera magellanica, which forms symbiotic associations with the cyanobacterial genus Nostoc, a trait that likely confers advantages in this colonisation process. This symbiotic association in the genus Gunnera is notable as it represents the only known symbiotic relationship between angiosperms and cyanobacteria. The aim of this work was to study the genetic diversity of the Nostoc symbionts in Gunnera at three different, nested scale levels: specimen, population and region. Three different genomic regions were examined in the study: a fragment of the small subunit ribosomal RNA gene (16S), the RuBisCO large subunit gene coupled with its promoter sequence and a chaperon-like protein (rbcLX) and the ribosomal internal transcribed spacer (ITS) region. The identity of Nostoc as the symbiont was confirmed in all the infected rhizome tissue analysed. Strains isolated in the present study were closely related to strains known to form symbioses with other organisms, such as lichen-forming fungi or bryophytes. We found 12 unique haplotypes in the 16S rRNA (small subunit) region analysis, 19 unique haplotypes in the ITS region analysis and 57 in the RuBisCO proteins region (rbcLX). No genetic variability was found among Nostoc symbionts within a single host plant while Nostoc populations among different host plants within a given sampling site revealed major differences. Noteworthy, interpopulation variation was also shown between recently deglaciated soils and more ancient ones, between eastern and western sites and between northern and southern slopes of Cordillera Darwin. The cell structure of the symbiotic relationship was observed with low-temperature scanning

  6. Transcription and Regulation of the Bidirectional Hydrogenase in the Cyanobacterium Nostoc sp. Strain PCC 7120▿

    Science.gov (United States)

    Sjöholm, Johannes; Oliveira, Paulo; Lindblad, Peter

    2007-01-01

    The filamentous, heterocystous cyanobacterium Nostoc sp. strain PCC 7120 (Anabaena sp. strain PCC 7120) possesses an uptake hydrogenase and a bidirectional enzyme, the latter being capable of catalyzing both H2 production and evolution. The completely sequenced genome of Nostoc sp. strain PCC 7120 reveals that the five structural genes encoding the bidirectional hydrogenase (hoxEFUYH) are separated in two clusters at a distance of approximately 8.8 kb. The transcription of the hox genes was examined under nitrogen-fixing conditions, and the results demonstrate that the cluster containing hoxE and hoxF can be transcribed as one polycistronic unit together with the open reading frame alr0750. The second cluster, containing hoxU, hoxY, and hoxH, is transcribed together with alr0763 and alr0765, located between the hox genes. Moreover, alr0760 and alr0761 form an additional larger operon. Nevertheless, Northern blot hybridizations revealed a rather complex transcription pattern in which the different hox genes are expressed differently. Transcriptional start points (TSPs) were identified 66 and 57 bp upstream from the start codon of alr0750 and hoxU, respectively. The transcriptions of the two clusters containing the hox genes are both induced under anaerobic conditions concomitantly with the induction of a higher level of hydrogenase activity. An additional TSP, within the annotated alr0760, 244 bp downstream from the suggested translation start codon, was identified. Electrophoretic mobility shift assays with purified LexA from Nostoc sp. strain PCC 7120 demonstrated specific interactions between the transcriptional regulator and both hox promoter regions. However, when LexA from Synechocystis sp. strain PCC 6803 was used, the purified protein interacted only with the promoter region of the alr0750-hoxE-hoxF operon. A search of the whole Nostoc sp. strain PCC 7120 genome demonstrated the presence of 216 putative LexA binding sites in total, including recA and rec

  7. POTENŢIALUL NUTRIŢIONAL AL BIOMASEI ALGALE DE NOSTOC FLAGELLIFORME (BERK ET CURT ELENK.

    Directory of Open Access Journals (Sweden)

    Irina STRATULAT

    2016-05-01

    Full Text Available În prezentul studiu este prezentată componenţa biochimică a biomasei algei cianofite Nostoc flagelli­forme (Berk et Curt Elenk. cultivată în condiţii de laborator pe mediul mineral Z-8. Biomasa algei conţine: Mn – 683,9 mg/kg, Zn – 131,5 mg/kg, Pb – <10 mg/kg, Fe – 1,09 g/kg, Na+ – 2,10 g/kg, K+ – 8,01 g/kg, Mg 2+ – 5,40 g/kg, Ca2+ – 7,94 g/kg. În componenţa aminoacizilor predomină: acidul glutamic – 3,8012 mg/100 mg, acidul aspartic – 2,7838 mg/100 mg, leucina – 2,4651 mg/100 mg, alanina – 2,3513 mg/100 mg. Conform acestor rezultate, biomasa algei cianofite Nostoc flagelliforme poate fi utilizată ca sursă importantă de supli­mente alimentare. THE NUTRITIONAL POTENTIAL OF ALGAL BIOMASS OF NOSTOC FLAGELLIFORME (BERK ET CURT ELENK. In this study is presented the biochemical components of algal biomass Nostoc flagelliforme (Berk et Curt Elenk. cultivated in laboratory conditions in Z-8 medium. The algal biomass has the following chemical content: Mn – 683,9 mg/kg, Zn – 131,5 mg/kg, Pb – <10 mg/kg, Fe – 1,09 g/kg, Na+ - 2,10 g/kg, K+ – 8,01 g/kg, Mg2+ – 5,40 g/kg, Ca2+ – 7,94 g/kg. The highest amount of amino acids are specific for: glutamic acid – 3,8012 mg/100 mg, aspartic acid – 2,7838 mg/100 mg, leucine – 2,4651 mg/100 mg, alanine – 2,3513 mg/100 mg. According to these results the blue-green alga Nostoc flagelliforme can be considered an important potential source of nutritional supplements. 

  8. Colour evaluation of a phycobiliprotein-rich extract obtained from Nostoc PCC9205 in acidic solutions and yogurt.

    Science.gov (United States)

    de O Moreira, Isabela; Passos, Thaís S; Chiapinni, Claudete; Silveira, Gabrielle K; Souza, Joana C M; Coca-Vellarde, Luis Guillermo; Deliza, Rosires; de Lima Araújo, Kátia G

    2012-02-01

    Phycobiliproteins are coloured proteins produced by cyanobacteria, which have several applications because of their colour properties. However, there is no available information about the colour stability of phycobiliproteins from Nostoc sp. in food systems. The aim of this work was to study the colour stability of a purple-coloured phycobiliprotein-rich extract from the cyanobacterium Nostoc PCC9205 in acidic solutions and yogurt. Variations of pH for Nostoc PCC9205 extract have shown stability for the L* (lightness) and a* (redness) indexes in the range 1.0-7.0. The b* index (blueness), however, increased at pH values below 4.0, indicating loss of the blue colour. The Nostoc PCC9205 extract was used as colorant in yogurt (pH 4.17) stored for 60 days. Instrumental colour analysis showed no changes for the L* and a* indexes during storage, whereas the b* index changed after 20 days of storage. A multiple comparison test showed colour instability after 20 days of storage. A hedonic scale test performed on the 60th day of storage showed acceptability of the product. The red component of the phycobiliprotein-rich extract from Nostoc PCC9205 presented an improved stability in acidic media and yogurt compared with the blue component of this extract. Copyright © 2011 Society of Chemical Industry.

  9. The epistemological and historical concept of nostoc from an indiciary lecture of George Canguilhem's "The cell theory"

    Directory of Open Access Journals (Sweden)

    Maurício de Carvalho Ramos

    2016-05-01

    Full Text Available Through an indiciary lecture of Canguilhem's article  "The cell theory", I propose, methodically guided by a epistemological-historical style research, the construction of the concept of nostoc as a metamorphic concept that integrated the concepts of primordial blastema and biblical slime of the French botanist Charles Naudin, set up a scientific culture of broad reach committed to solving the riddle of the morphological unity of organic and vital beings. The concept of Nostoc refers alchemically a gelatinous substance from the stars and endowed with balsamic medical virtues and botanically, a cianoficea algae of Nostoc genus. Examined the ideas of Canguilhem, Naudin, Jung and Paracelsus, this concept is proposed as a nucleoplasmatic oscillation, understood as a specific form of expression of the mythical-scientific theme of tension between continuity and discontinuity, as shown by Canguilhem in his history of cell concept.

  10. Phylogenetically distant clade of Nostoc-like taxa with the description of Aliinostoc gen. nov. and Aliinostoc morphoplasticum sp. nov.

    Science.gov (United States)

    Bagchi, Suvendra Nath; Dubey, Neelam; Singh, Prashant

    2017-09-01

    Nostoc is a complex and tough genus to differentiate, and its morphological plasticity makes it taxonomically complicated. Its cryptic diversity and almost no distinguishable morphological characteristics make this genus incredibly heterogeneous to evaluate on taxonomic scales. The strain NOS, isolated from a eutrophic water body, is being described as a new genus Aliinostoc with the strain showing motile hormogonia with gas vesicles as an atypical feature, which is currently considered as the diacritical feature of the genus but should be subjected to critical evaluation in the near future. The phylogenetic placement of Aliinostoc along with some other related sequences of Nostoc clearly separated this clade from Nostoc sensu stricto with high bootstrap support and robust topology in all the methods tested, thus providing strong proof of the taxa being representative of a new genus which morphologically appears to be Nostoc-like. Subsequent phylogenetic assessment using the rbcL, psbA, rpoC1 and tufA genes was done with the aim of facilitating future multi-locus studies on the proposed genus for better taxonomic clarity and resolution. Folding of the 16S-23S internal transcribed spacer region and subsequent comparisons with members of the genera Nostoc, Anabaena, Aulosira, Cylindrospermum, Sphaerospermopsis, Raphidiopsis, Desmonostoc and Mojavia gave entirely new secondary structures for the D1-D1' and box-B helix. Clear and separate clustering from Nostoc sensu stricto supports the establishment of Aliinostoc gen. nov. with the type species being Aliinostoc morphoplasticum sp. nov. in accordance with the International Code of Nomenclature for algae, fungi and plants.

  11. [Promotion effects of vitamin B12 on the degradation of 2, 4, 4'-trichlorobiphenyl by Nostoc PD-2].

    Science.gov (United States)

    Liu, Jia-Yu; Xiao, Wen-Feng; Lu, Li-Ping; Zhang, Hang-Jun

    2014-08-01

    Polychlorinated biphenyls are typical persistent chlorinated organic compounds in the environment. Bioremediation of PCB-contaminated environment has become one of the hot issues. In this study, vitamin B12 (VB12) and chlorine-free culture medium were applied to study the effects of VB12 on the degradation of 2,4,4'-trichlorobiphenyl (PCB28) by Nostoc PD-2 and the gene expression during the PCB-degradation process. Results showed that addition of different concentrations of vitamin B12 could improve the PCB-biodegradation rates by Nostoc PD-2. Compared with the control group, the 7-day degradation rate in 10 microg x L(-1), 100 microg x L(-1), and 1 000 microg x L(-1) VB12-treated groups increased by 11.0%, 19.7%, and 21.9% , respectively. The degradation half-time decreased from 5.53 days (treated with 10 microg x L(-1) VB12) to 3.08 days (treated with 100 microg x L(-1) VB12). The expression of cytochrome b6f complex iron-sulfur protein gene and dioxygenase gene showed significant correlation with PCB28-degradation by Nostoc PD-2. While the expression of iron-sulfur protein gene showed more significant correlation with PCB28-degradation. Results in this study indicated that adding VB12 could promote PCB28-degradation by Nostoc PD-2. Moreover, VB12 addition improved the PCB-degradation activity of Nostoc PD-2 at the gene level. The above conclusions could provide a new choice for developing efficient bioremediation technology for PCB-contaminated environment and a new insight into the PCB-biodegradation mechanism by Nostoc PD-2.

  12. Isoprenoid hydrocarbons produced by thermal alteration of Nostoc muscorum and Rhodopseudomonas spheroides

    Science.gov (United States)

    Philp, R. P.; Brown, S.; Calvin, M.

    1978-01-01

    The potential of algae and photosynthetic bacteria to serve as precursors of kerogen was studied to determine what factors affect the relative rates of formation of precursor hydrocarbons. Cells of Nostoc muscorum and Rhodopseudomonas spheroides were subjected to thermal alteration (by heating samples in glass tubes sealed under nitrogen) for two, four, and twelve weeks. Both unextracted and extracted cells in the absence and presence of montmorillonite were investigated, and the isoprenoid hydrocarbons produced in these experiments were determined. Phytane and five isomeric phytenes were the main hydrocarbons observed; their relative rates of formation in the different experimental conditions are described. No phytadienes, pristane, or pristenes were detected.

  13. Production of High Amounts of Hepatotoxin Nodularin and New Protease Inhibitors Pseudospumigins by the Brazilian Benthic Nostoc sp. CENA543

    Science.gov (United States)

    Jokela, Jouni; Heinilä, Lassi M. P.; Shishido, Tânia K.; Wahlsten, Matti; Fewer, David P.; Fiore, Marli F.; Wang, Hao; Haapaniemi, Esa; Permi, Perttu; Sivonen, Kaarina

    2017-01-01

    Nostoc is a cyanobacterial genus, common in soils and a prolific producer of natural products. This research project aimed to explore and characterize Brazilian cyanobacteria for new bioactive compounds. Here we report the production of hepatotoxins and new protease inhibitors from benthic Nostoc sp. CENA543 isolated from a small, shallow, saline-alkaline lake in the Nhecolândia, Pantanal wetland area in Brazil. Nostoc sp. CENA543 produces exceptionally high amounts of nodularin-R. This is the first free-living Nostoc that produces nodularin at comparable levels as the toxic, bloom-forming, Nodularia spumigena. We also characterized pseudospumigins A–F, which are a novel family of linear tetrapeptides. Pseudospumigins are structurally related to linear tetrapeptide spumigins and aeruginosins both present in N. spumigena but differ in respect to their diagnostic amino acid, which is Ile/Leu/Val in pseudospumigins, Pro/mPro in spumigins, and Choi in aeruginosins. The pseudospumigin gene cluster is more similar to the spumigin biosynthetic gene cluster than the aeruginosin gene cluster. Pseudospumigin A inhibited trypsin (IC50 4.5 μM after 1 h) in a similar manner as spumigin E from N. spumigena but was almost two orders of magnitude less potent. This study identifies another location and environment where the hepatotoxic nodularin has the potential to cause the death of eukaryotic organisms. PMID:29062311

  14. Life cycle as a stable trait in the evaluation of diversity of Nostoc from biofilms in rivers.

    Science.gov (United States)

    Mateo, Pilar; Perona, Elvira; Berrendero, Esther; Leganés, Francisco; Martín, Marta; Golubić, Stjepko

    2011-05-01

    The diversity within the genus Nostoc is still controversial and more studies are needed to clarify its heterogeneity. Macroscopic species have been extensively studied and discussed; however, the microscopic forms of the genus, especially those from running waters, are poorly known and likely represented by many more species than currently described. Nostoc isolates from biofilms of two Spanish calcareous rivers were characterized comparing the morphology and life cycle in two culture media with different levels of nutrients and also comparing the 16S rRNA gene sequences. The results showed that trichome shape and cellular dimensions varied considerably depending on the culture media used, whereas the characteristics expressed in the course of the life cycle remained stable for each strain independent of the culture conditions. Molecular phylogenetic analysis confirmed the distinction between the studied strains established on morphological grounds. A balanced approach to the evaluation of diversity of Nostoc in the service of autecological studies requires both genotypic information and the evaluation of stable traits. The results of this study show that 16S rRNA gene sequence similarity serves as an important criterion for characterizing Nostoc strains and is consistent with stable attributes, such as the life cycle. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  15. Production of High Amounts of Hepatotoxin Nodularin and New Protease Inhibitors Pseudospumigins by the Brazilian Benthic Nostoc sp. CENA543

    Directory of Open Access Journals (Sweden)

    Jouni Jokela

    2017-10-01

    Full Text Available Nostoc is a cyanobacterial genus, common in soils and a prolific producer of natural products. This research project aimed to explore and characterize Brazilian cyanobacteria for new bioactive compounds. Here we report the production of hepatotoxins and new protease inhibitors from benthic Nostoc sp. CENA543 isolated from a small, shallow, saline-alkaline lake in the Nhecolândia, Pantanal wetland area in Brazil. Nostoc sp. CENA543 produces exceptionally high amounts of nodularin-R. This is the first free-living Nostoc that produces nodularin at comparable levels as the toxic, bloom-forming, Nodularia spumigena. We also characterized pseudospumigins A–F, which are a novel family of linear tetrapeptides. Pseudospumigins are structurally related to linear tetrapeptide spumigins and aeruginosins both present in N. spumigena but differ in respect to their diagnostic amino acid, which is Ile/Leu/Val in pseudospumigins, Pro/mPro in spumigins, and Choi in aeruginosins. The pseudospumigin gene cluster is more similar to the spumigin biosynthetic gene cluster than the aeruginosin gene cluster. Pseudospumigin A inhibited trypsin (IC50 4.5 μM after 1 h in a similar manner as spumigin E from N. spumigena but was almost two orders of magnitude less potent. This study identifies another location and environment where the hepatotoxic nodularin has the potential to cause the death of eukaryotic organisms.

  16. Two-Step Separation of Nostotrebin 6 from Cultivated Soil Cyanobacterium (Nostoc sp.) by High Performance Countercurrent Chromatography

    Czech Academy of Sciences Publication Activity Database

    Cheel, José; Kučerová, P.; Garrard, I.; Ignatova, S.; Hrouzek, Pavel; Kopecký, Jiří

    2014-01-01

    Roč. 19, č. 4 (2014), s. 8773-8787 ISSN 1420-3049 R&D Projects: GA MŠk ED2.1.00/03.0110; GA MŠk EE2.3.30.0059 Institutional support: RVO:61388971 Keywords : nostotrebin 6 * cyanobacterium * Nostoc * HPLC separation Subject RIV: EE - Microbiology, Virology Impact factor: 2.416, year: 2014

  17. Feathermoss and epiphytic Nostoc cooperate differently: expanding the spectrum of plant–cyanobacteria symbiosis

    Science.gov (United States)

    Warshan, Denis; Espinoza, Josh L; Stuart, Rhona K; Richter, R Alexander; Kim, Sea-Yong; Shapiro, Nicole; Woyke, Tanja; C Kyrpides, Nikos; Barry, Kerrie; Singan, Vasanth; Lindquist, Erika; Ansong, Charles; Purvine, Samuel O; M Brewer, Heather; Weyman, Philip D; Dupont, Christopher L; Rasmussen, Ulla

    2017-01-01

    Dinitrogen (N2)-fixation by cyanobacteria in symbiosis with feathermosses is the primary pathway of biological nitrogen (N) input into boreal forests. Despite its significance, little is known about the cyanobacterial gene repertoire and regulatory rewiring needed for the establishment and maintenance of the symbiosis. To determine gene acquisitions and regulatory changes allowing cyanobacteria to form and maintain this symbiosis, we compared genomically closely related symbiotic-competent and -incompetent Nostoc strains using a proteogenomics approach and an experimental set up allowing for controlled chemical and physical contact between partners. Thirty-two gene families were found only in the genomes of symbiotic strains, including some never before associated with cyanobacterial symbiosis. We identified conserved orthologs that were differentially expressed in symbiotic strains, including protein families involved in chemotaxis and motility, NO regulation, sulfate/phosphate transport, and glycosyl-modifying and oxidative stress-mediating exoenzymes. The physical moss–cyanobacteria epiphytic symbiosis is distinct from other cyanobacteria–plant symbioses, with Nostoc retaining motility, and lacking modulation of N2-fixation, photosynthesis, GS-GOGAT cycle and heterocyst formation. The results expand our knowledge base of plant–cyanobacterial symbioses, provide a model of information and material exchange in this ecologically significant symbiosis, and suggest new currencies, namely nitric oxide and aliphatic sulfonates, may be involved in establishing and maintaining the cyanobacteria–feathermoss symbiosis. PMID:28800136

  18. Nostoc sphaeroides Kütz, a candidate producer par excellence for CELSS

    Science.gov (United States)

    Wang, Gaohong; Hao, Zongjie; Liu, Yongding

    A lot of aquatic organisms could be regarded as suitable candidates par excellence in the establishment of CELSS, since they are relatively easy and fast to grow and resistant to changes in environmental condition as well as providing nutritious, protein-and vitamin-rich foods for the crew, which can fulfill the main functions of CELSS, including supplying oxygen, water and food, removing carbon dioxide and making daily life waste reusable. Our labotory has developed mass culture of Nostoc sphaeroides Kütz, which is one of traditional healthy food in China and. The oxygen evolution rate of the cyanobacterium is about 150 molO2.mg-1.h-1, and it usually grows into colony with size between 2-20mm, which is easy to be harvested. It also can be cultured with high density, which show that the productivity of the cyanobacterium in limited volume is higher than other microalgae. We had measured the nutrient content of the cyanobacterium and developed some Chinese Dishes and Soups with Nostoc sphaeroides Kütz, which showed that it was a good food for crew. Using remote sensing technique, we also investigated its growth in Closed System under microgravity by SHENZHOU-2 spacecraft in January 2001. We plan to develop suitable bioreactor with the cyanobacterium for supplying oxygen and food to crew in future.

  19. Feathermoss and epiphytic Nostoc cooperate differently: expanding the spectrum of plant-cyanobacteria symbiosis.

    Science.gov (United States)

    Warshan, Denis; Espinoza, Josh L; Stuart, Rhona K; Richter, R Alexander; Kim, Sea-Yong; Shapiro, Nicole; Woyke, Tanja; C Kyrpides, Nikos; Barry, Kerrie; Singan, Vasanth; Lindquist, Erika; Ansong, Charles; Purvine, Samuel O; M Brewer, Heather; Weyman, Philip D; Dupont, Christopher L; Rasmussen, Ulla

    2017-12-01

    Dinitrogen (N 2 )-fixation by cyanobacteria in symbiosis with feathermosses is the primary pathway of biological nitrogen (N) input into boreal forests. Despite its significance, little is known about the cyanobacterial gene repertoire and regulatory rewiring needed for the establishment and maintenance of the symbiosis. To determine gene acquisitions and regulatory changes allowing cyanobacteria to form and maintain this symbiosis, we compared genomically closely related symbiotic-competent and -incompetent Nostoc strains using a proteogenomics approach and an experimental set up allowing for controlled chemical and physical contact between partners. Thirty-two gene families were found only in the genomes of symbiotic strains, including some never before associated with cyanobacterial symbiosis. We identified conserved orthologs that were differentially expressed in symbiotic strains, including protein families involved in chemotaxis and motility, NO regulation, sulfate/phosphate transport, and glycosyl-modifying and oxidative stress-mediating exoenzymes. The physical moss-cyanobacteria epiphytic symbiosis is distinct from other cyanobacteria-plant symbioses, with Nostoc retaining motility, and lacking modulation of N 2 -fixation, photosynthesis, GS-GOGAT cycle and heterocyst formation. The results expand our knowledge base of plant-cyanobacterial symbioses, provide a model of information and material exchange in this ecologically significant symbiosis, and suggest new currencies, namely nitric oxide and aliphatic sulfonates, may be involved in establishing and maintaining the cyanobacteria-feathermoss symbiosis.

  20. Novel Aeruginosin-865 from Nostoc sp. as a potent anti-inflammatory agent.

    Science.gov (United States)

    Kapuścik, Aleksandra; Hrouzek, Pavel; Kuzma, Marek; Bártová, Simona; Novák, Petr; Jokela, Jouni; Pflüger, Maren; Eger, Andreas; Hundsberger, Harald; Kopecký, Jiří

    2013-11-25

    Aeruginosin-865 (Aer-865), isolated from terrestrial cyanobacterium Nostoc sp. Lukešová 30/93, is the first aeruginosin-type peptide containing both a fatty acid and a carbohydrate moiety, and is the first aeruginosin to be found in the genus Nostoc. Mass spectrometry, chemical and spectroscopic analysis as well as one- and two-dimensional NMR and chiral HPLC analysis of Marfey derivatives were applied to determine the peptidic sequence: D-Hpla, D-Leu, 5-OH-Choi, Agma, with hexanoic and mannopyranosyl uronic acid moieties linked to Choi. We used an AlphaLISA assay to measure the levels of proinflammatory mediators IL-8 and ICAM-1 in hTNF-α-stimulated HLMVECs. Aer-865 showed significant reduction of both: with EC50 values of (3.5±1.5) μg mL(-1) ((4.0±1.7) μM) and (50.0±13.4) μg mL(-1) ((57.8±15.5) μM), respectively. Confocal laser scanning microscopy revealed that the anti-inflammatory effect of Aer-865 was directly associated with inhibition of NF-κB translocation to the nucleus. Moreover, Aer-865 did not show any cytotoxic effect. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Biochemical Characterization of Putative Adenylate Dimethylallyltransferase and Cytokinin Dehydrogenase from Nostoc sp. PCC 7120.

    Science.gov (United States)

    Frébortová, Jitka; Greplová, Marta; Seidl, Michael F; Heyl, Alexander; Frébort, Ivo

    2015-01-01

    Cytokinins, a class of phytohormones, are adenine derivatives common to many different organisms. In plants, these play a crucial role as regulators of plant development and the reaction to abiotic and biotic stress. Key enzymes in the cytokinin synthesis and degradation in modern land plants are the isopentyl transferases and the cytokinin dehydrogenases, respectively. Their encoding genes have been probably introduced into the plant lineage during the primary endosymbiosis. To shed light on the evolution of these proteins, the genes homologous to plant adenylate isopentenyl transferase and cytokinin dehydrogenase were amplified from the genomic DNA of cyanobacterium Nostoc sp. PCC 7120 and expressed in Escherichia coli. The putative isopentenyl transferase was shown to be functional in a biochemical assay. In contrast, no enzymatic activity was detected for the putative cytokinin dehydrogenase, even though the principal domains necessary for its function are present. Several mutant variants, in which conserved amino acids in land plant cytokinin dehydrogenases had been restored, were inactive. A combination of experimental data with phylogenetic analysis indicates that adenylate-type isopentenyl transferases might have evolved several times independently. While the Nostoc genome contains a gene coding for protein with characteristics of cytokinin dehydrogenase, the organism is not able to break down cytokinins in the way shown for land plants.

  2. Merocyclophanes C and D from the Cultured Freshwater Cyanobacterium Nostoc sp. (UIC 10110).

    Science.gov (United States)

    May, Daniel S; Chen, Wei-Lun; Lantvit, Daniel D; Zhang, Xiaoli; Krunic, Aleksej; Burdette, Joanna E; Eustaquio, Alessandra; Orjala, Jimmy

    2017-04-28

    Merocyclophanes C and D (1 and 2) were isolated from the cell extract of the cultured cyanobacterium UIC 10110. The structures were determined by one-dimensional nuclear magnetic resonance (NMR) and high-resolution electrospray ionization mass spectrometry and confirmed by 2D NMR techniques. The absolute configurations were determined using electronic circular dichroism spectroscopy. Merocyclophanes C and D represent the first known analogues of the merocyclophane core structure, a recently discovered scaffold of [7,7] paracyclophanes characterized by an α-branched methyl at C-1/C-14; 1 and 2 showed antiproliferative activity against the MDA-MB-435 cell line with IC 50 values of 1.6 and 0.9 μM, respectively. Partial 16S analysis determined UIC 10110 to be a Nostoc sp., and it was found to clade with UIC 10062 Nostoc sp., the only other strain known to produce merocyclophanes. The genome of UIC 10110 was sequenced, and a biosynthetic gene cluster was identified that is proposed to encode type I and type III polyketide synthases that are potentially responsible for production of the merocyclophanes; however, further experiments will be required to verify the true function of the gene cluster. The gene cluster provides a genetic basis for the observed structural differences of the [7,7] paracyclophane core structures.

  3. Effects of Halide Ions on the Carbamidocyclophane Biosynthesis in Nostoc sp. CAVN2

    Science.gov (United States)

    Preisitsch, Michael; Heiden, Stefan E.; Beerbaum, Monika; Niedermeyer, Timo H. J.; Schneefeld, Marie; Herrmann, Jennifer; Kumpfmüller, Jana; Thürmer, Andrea; Neidhardt, Inga; Wiesner, Christoph; Daniel, Rolf; Müller, Rolf; Bange, Franz-Christoph; Schmieder, Peter; Schweder, Thomas; Mundt, Sabine

    2016-01-01

    In this study, the influence of halide ions on [7.7]paracyclophane biosynthesis in the cyanobacterium Nostoc sp. CAVN2 was investigated. In contrast to KI and KF, supplementation of the culture medium with KCl or KBr resulted not only in an increase of growth but also in an up-regulation of carbamidocyclophane production. LC-MS analysis indicated the presence of chlorinated, brominated, but also non-halogenated derivatives. In addition to 22 known cylindrocyclophanes and carbamidocyclophanes, 27 putative congeners have been detected. Nine compounds, carbamidocyclophanes M−U, were isolated, and their structural elucidation by 1D and 2D NMR experiments in combination with HRMS and ECD analysis revealed that they are brominated analogues of chlorinated carbamidocyclophanes. Quantification of the carbamidocyclophanes showed that chloride is the preferably utilized halide, but incorporation is reduced in the presence of bromide. Evaluation of the antibacterial activity of 30 [7.7]paracyclophanes and related derivatives against selected pathogenic Gram-positive and Gram-negative bacteria exhibited remarkable effects especially against methicillin- and vancomycin-resistant staphylococci and Mycobacterium tuberculosis. For deeper insights into the mechanisms of biosynthesis, the carbamidocyclophane biosynthetic gene cluster in Nostoc sp. CAVN2 was studied. The gene putatively coding for the carbamoyltransferase has been identified. Based on bioinformatic analyses, a possible biosynthetic assembly is discussed. PMID:26805858

  4. Viruses Infecting a Freshwater Filamentous Cyanobacterium (Nostoc sp. Encode a Functional CRISPR Array and a Proteobacterial DNA Polymerase B

    Directory of Open Access Journals (Sweden)

    Caroline Chénard

    2016-06-01

    Full Text Available Here we present the first genomic characterization of viruses infecting Nostoc, a genus of ecologically important cyanobacteria that are widespread in freshwater. Cyanophages A-1 and N-1 were isolated in the 1970s and infect Nostoc sp. strain PCC 7210 but remained genomically uncharacterized. Their 68,304- and 64,960-bp genomes are strikingly different from those of other sequenced cyanophages. Many putative genes that code for proteins with known functions are similar to those found in filamentous cyanobacteria, showing a long evolutionary history in their host. Cyanophage N-1 encodes a CRISPR array that is transcribed during infection and is similar to the DR5 family of CRISPRs commonly found in cyanobacteria. The presence of a host-related CRISPR array in a cyanophage suggests that the phage can transfer the CRISPR among related cyanobacteria and thereby provide resistance to infection with competing phages. Both viruses also encode a distinct DNA polymerase B that is closely related to those found in plasmids of Cyanothece sp. strain PCC 7424, Nostoc sp. strain PCC 7120, and Anabaena variabilis ATCC 29413. These polymerases form a distinct evolutionary group that is more closely related to DNA polymerases of proteobacteria than to those of other viruses. This suggests that the polymerase was acquired from a proteobacterium by an ancestral virus and transferred to the cyanobacterial plasmid. Many other open reading frames are similar to a prophage-like element in the genome of Nostoc sp. strain PCC 7524. The Nostoc cyanophages reveal a history of gene transfers between filamentous cyanobacteria and their viruses that have helped to forge the evolutionary trajectory of this previously unrecognized group of phages.

  5. In vivo assessment of the hepatotoxicity of a new Nostoc isolate from the Nile River: Nostoc sp. strain NRI.

    Science.gov (United States)

    Abu-Serie, Marwa M; Nasser, Nermine; Abd El-Wahab, Abeer; Shehawy, Rehab; Pienaar, Harrison; Baddour, Nahed; Amer, Ranya

    2018-03-01

    Nostoc sp. is one of the most widely distributed cyanobacterial genera that produce potentially protein phosphatase (PP) inhibitor; microcystins (MCs). MCs have posed a worldwide concern due to predominant hepatotoxicity to human health. We have previously isolated a Nostoc strain (NR1) from the Nile River (the main water supply in Egypt) and this strain exerted production of rare and highly toxic MC; demethylated microcystin-LR. There is no data concerning risk factors of liver diseases for human and animal exposure to NR1-contaminated drinking water yet. It is thus important to evaluate acute (LD 50 dose), subacute (0.01% and 10% of LD 50 dose) and subchronic (0.01% and 10% of LD 50 dose) hepatotoxicity's NR1 extract using experimental mice. Mice groups, who orally received 0.01% LD 50 , represented a permissible concentration of the World Health Organization (WHO) for MC in drinking water. Several parameters were detected, including hepatotoxicity (i.e. PP activity, liver function, oxidative stress markers and DNA fragmentation), pro-inflammatory cytokine (TNF-α) and liver histopathology. Our results demonstrated LD 50 of NR1 extract was at 15,350 mg/kg body weight and caused hepatotoxicity that attributed to PP inhibition and a significant increase of hepatic damage biomarkers with lipid accumulation. Moreover, NR1 extract induced hepatic oxidative damage that may have led to DNA fragmentation and production of TNF-α. As demonstrated from the histopathological study, NR1 extract caused a severe collapse of cytoskeleton with subsequent focal degeneration of hepatocytes, necroinflammation and steatosis. The grade of hepatotoxicity in subacute (10% of LD 50 ) group was higher than that in the subchronic (10% of LD 50 and 0.01% of LD 50 , WHOch, respectively) groups. No significant hepatotoxicity was detectable for subacute (0.01% of LD 50 , WHOac) group. NR1 is therefore considered as one of the harmful and life-threatening cyanobacteria for Egyptian people

  6. Transcription of the extended hyp-operon in Nostoc sp. strain PCC 7120

    Directory of Open Access Journals (Sweden)

    Lindblad Peter

    2008-04-01

    Full Text Available Abstract Background The maturation of hydrogenases into active enzymes is a complex process and e.g. a correctly assembled active site requires the involvement of at least seven proteins, encoded by hypABCDEF and a hydrogenase specific protease, encoded either by hupW or hoxW. The N2-fixing cyanobacterium Nostoc sp. strain PCC 7120 may contain both an uptake and a bidirectional hydrogenase. The present study addresses the presence and expression of hyp-genes in Nostoc sp. strain PCC 7120. Results RT-PCRs demonstrated that the six hyp-genes together with one ORF may be transcribed as a single operon. Transcriptional start points (TSPs were identified 280 bp upstream from hypF and 445 bp upstream of hypC, respectively, demonstrating the existence of several transcripts. In addition, five upstream ORFs located in between hupSL, encoding the small and large subunits of the uptake hydrogenase, and the hyp-operon, and two downstream ORFs from the hyp-genes were shown to be part of the same transcript unit. A third TSP was identified 45 bp upstream of asr0689, the first of five ORFs in this operon. The ORFs are annotated as encoding unknown proteins, with the exception of alr0692 which is identified as a NifU-like protein. Orthologues of the four ORFs asr0689-alr0692, with a highly conserved genomic arrangement positioned between hupSL, and the hyp genes are found in several other N2-fixing cyanobacteria, but are absent in non N2-fixing cyanobacteria with only the bidirectional hydrogenase. Short conserved sequences were found in six intergenic regions of the extended hyp-operon, appearing between 11 and 79 times in the genome. Conclusion This study demonstrated that five ORFs upstream of the hyp-gene cluster are co-transcribed with the hyp-genes, and identified three TSPs in the extended hyp-gene cluster in Nostoc sp. strain PCC 7120. This may indicate a function related to the assembly of a functional uptake hydrogenase, hypothetically in the

  7. Transcription of the extended hyp-operon in Nostoc sp. strain PCC 7120

    Science.gov (United States)

    Agervald, Åsa; Stensjö, Karin; Holmqvist, Marie; Lindblad, Peter

    2008-01-01

    Background The maturation of hydrogenases into active enzymes is a complex process and e.g. a correctly assembled active site requires the involvement of at least seven proteins, encoded by hypABCDEF and a hydrogenase specific protease, encoded either by hupW or hoxW. The N2-fixing cyanobacterium Nostoc sp. strain PCC 7120 may contain both an uptake and a bidirectional hydrogenase. The present study addresses the presence and expression of hyp-genes in Nostoc sp. strain PCC 7120. Results RT-PCRs demonstrated that the six hyp-genes together with one ORF may be transcribed as a single operon. Transcriptional start points (TSPs) were identified 280 bp upstream from hypF and 445 bp upstream of hypC, respectively, demonstrating the existence of several transcripts. In addition, five upstream ORFs located in between hupSL, encoding the small and large subunits of the uptake hydrogenase, and the hyp-operon, and two downstream ORFs from the hyp-genes were shown to be part of the same transcript unit. A third TSP was identified 45 bp upstream of asr0689, the first of five ORFs in this operon. The ORFs are annotated as encoding unknown proteins, with the exception of alr0692 which is identified as a NifU-like protein. Orthologues of the four ORFs asr0689-alr0692, with a highly conserved genomic arrangement positioned between hupSL, and the hyp genes are found in several other N2-fixing cyanobacteria, but are absent in non N2-fixing cyanobacteria with only the bidirectional hydrogenase. Short conserved sequences were found in six intergenic regions of the extended hyp-operon, appearing between 11 and 79 times in the genome. Conclusion This study demonstrated that five ORFs upstream of the hyp-gene cluster are co-transcribed with the hyp-genes, and identified three TSPs in the extended hyp-gene cluster in Nostoc sp. strain PCC 7120. This may indicate a function related to the assembly of a functional uptake hydrogenase, hypothetically in the assembly of the small subunit of

  8. Viruses Infecting a Freshwater Filamentous Cyanobacterium (Nostoc sp.) Encode a Functional CRISPR Array and a Proteobacterial DNA Polymerase B.

    Science.gov (United States)

    Chénard, Caroline; Wirth, Jennifer F; Suttle, Curtis A

    2016-06-14

    Here we present the first genomic characterization of viruses infecting Nostoc, a genus of ecologically important cyanobacteria that are widespread in freshwater. Cyanophages A-1 and N-1 were isolated in the 1970s and infect Nostoc sp. strain PCC 7210 but remained genomically uncharacterized. Their 68,304- and 64,960-bp genomes are strikingly different from those of other sequenced cyanophages. Many putative genes that code for proteins with known functions are similar to those found in filamentous cyanobacteria, showing a long evolutionary history in their host. Cyanophage N-1 encodes a CRISPR array that is transcribed during infection and is similar to the DR5 family of CRISPRs commonly found in cyanobacteria. The presence of a host-related CRISPR array in a cyanophage suggests that the phage can transfer the CRISPR among related cyanobacteria and thereby provide resistance to infection with competing phages. Both viruses also encode a distinct DNA polymerase B that is closely related to those found in plasmids of Cyanothece sp. strain PCC 7424, Nostoc sp. strain PCC 7120, and Anabaena variabilis ATCC 29413. These polymerases form a distinct evolutionary group that is more closely related to DNA polymerases of proteobacteria than to those of other viruses. This suggests that the polymerase was acquired from a proteobacterium by an ancestral virus and transferred to the cyanobacterial plasmid. Many other open reading frames are similar to a prophage-like element in the genome of Nostoc sp. strain PCC 7524. The Nostoc cyanophages reveal a history of gene transfers between filamentous cyanobacteria and their viruses that have helped to forge the evolutionary trajectory of this previously unrecognized group of phages. Filamentous cyanobacteria belonging to the genus Nostoc are widespread and ecologically important in freshwater, yet little is known about the genomic content of their viruses. Here we report the first genomic analysis of cyanophages infecting

  9. BMAA Inhibits Nitrogen Fixation in the Cyanobacterium Nostoc sp. PCC 7120

    Directory of Open Access Journals (Sweden)

    Birgitta Bergman

    2013-08-01

    Full Text Available Cyanobacteria produce a range of secondary metabolites, one being the neurotoxic non-protein amino acid β-N-methylamino-L-alanine (BMAA, proposed to be a causative agent of human neurodegeneration. As for most cyanotoxins, the function of BMAA in cyanobacteria is unknown. Here, we examined the effects of BMAA on the physiology of the filamentous nitrogen-fixing cyanobacterium Nostoc sp. PCC 7120. Our data show that exogenously applied BMAA rapidly inhibits nitrogenase activity (acetylene reduction assay, even at micromolar concentrations, and that the inhibition was considerably more severe than that induced by combined nitrogen sources and most other amino acids. BMAA also caused growth arrest and massive cellular glycogen accumulation, as observed by electron microscopy. With nitrogen fixation being a process highly sensitive to oxygen species we propose that the BMAA effects found here may be related to the production of reactive oxygen species, as reported for other organisms.

  10. Space-environmental tolerances in a cyanobacterium, Nostoc sp. HK-01

    Science.gov (United States)

    Tomita-Yokotani, Kaori; Yokobori, Shin-ichi; Kimura, Shunta; Sato, Seigo; Katoh, Hiroshi; Ajioka, Reiko; Yamagishi, Akihiko; Inoue, Kotomi

    2016-07-01

    We have been investigating the tolerances to space-environments of a cyanobacterium, Nostoc sp. HK-01 (hereafter referred to as HK-01). Dry colonies of HK-01 had high tolerance to dry conditions, but more detailed information about tolerance to high-temperature, UV, gamma-ray and heavy particle beams were not deeply investigated. The obtained dry colonies of HK-01 after exposure to each of the conditions described above were investigated. In all of the tested colonies of HK-01 after exposure, all or some of the cells in the colonies were alive. One of the purposes of space agriculture is growing plants on Mars. In the early stages, of our research, cyanobacteria are introduced on Mars to promote the oxidation of the atmosphere and the formation of soil from Mars's regolith. HK-01 will contribute to each of these factors in the future.

  11. UV-induced developmental abnormalities in the filamentous blue-green alga Nostoc linckia

    International Nuclear Information System (INIS)

    Tiwari, D.N.

    1978-01-01

    Germinating spores of Nostoc linckia showed higher resistance against UV-irradiation compared to resting spores, maximal resistance being attained more rapidly in the presence of ammonium nitrogen. UV-irradiated germinating spores on further growth formed colonies consisting of abnormally large and spheroidal cells under non-photoreactivating conditions. The formation and fate of these abnormal cells was followed in detail in a mutant clone (M-5) raised from such a colony. Many of these cells formed spores which on return to growth-conducdive conditions germinated giving rise to different types of germlings from the abnormals which in certain cases proved lethal. The possibility of a transient polyenergidic and/or heterozygous state of these 'giant' cells has been discussed. (author)

  12. Study on activity measurement of Nostoc flagelliforme cells based on color identification

    Science.gov (United States)

    Wang, Yizhong; Su, Jianyu; Liu, Tiegen; Kong, Fanzhi; Jia, Shiru

    2008-12-01

    In order to measure the activities of Nostoc flagelliforme cells, a new method based on color identification was proposed in this paper. N. flagelliforme cells were colored with fluoreseein diaeetate. Then, an image of colored N. flagelliforme cells was taken, and changed from RGB model to HIS model. Its histogram of hue H was calculated, which was used as the input of a designed BP network. The output of the BP network was the description of measured activity of N. flagelliforme cells. After training, the activity of N. flagelliforme cells was identified by the BP network according to the histogram of H of their colored image. Experiments were conducted with satisfied results to show the feasibility and usefulness of activity measurement of N. flagelliforme cells based on color identification.

  13. BMAA Inhibits Nitrogen Fixation in the Cyanobacterium Nostoc sp. PCC 7120

    Science.gov (United States)

    Berntzon, Lotta; Erasmie, Sven; Celepli, Narin; Eriksson, Johan; Rasmussen, Ulla; Bergman, Birgitta

    2013-01-01

    Cyanobacteria produce a range of secondary metabolites, one being the neurotoxic non-protein amino acid β-N-methylamino-L-alanine (BMAA), proposed to be a causative agent of human neurodegeneration. As for most cyanotoxins, the function of BMAA in cyanobacteria is unknown. Here, we examined the effects of BMAA on the physiology of the filamentous nitrogen-fixing cyanobacterium Nostoc sp. PCC 7120. Our data show that exogenously applied BMAA rapidly inhibits nitrogenase activity (acetylene reduction assay), even at micromolar concentrations, and that the inhibition was considerably more severe than that induced by combined nitrogen sources and most other amino acids. BMAA also caused growth arrest and massive cellular glycogen accumulation, as observed by electron microscopy. With nitrogen fixation being a process highly sensitive to oxygen species we propose that the BMAA effects found here may be related to the production of reactive oxygen species, as reported for other organisms. PMID:23966039

  14. Effects of light wavelengths on extracellular and capsular polysaccharide production by Nostoc flagelliforme.

    Science.gov (United States)

    Han, Pei-pei; Sun, Ying; Jia, Shi-ru; Zhong, Cheng; Tan, Zhi-lei

    2014-05-25

    The influences of different wavelengths of light (red 660nm, yellow 590nm, green 520nm, blue 460nm, purple 400nm) and white light on extracellular polysaccharide (EPS) and capsular polysaccharide (CPS) production by Nostoc flagelliforme in liquid culture were demonstrated in this study. The results showed that, compared with white light, red and blue lights significantly increased both EPS and CPS production while yellow light reduced their production; purple and green lights stimulated EPS production but inhibited CPS formation. Nine constituent monosaccharides and one uronic acid were detected in both EPS and CPS, and their ratios showed significant differences among treatment with different light wavelengths. However, the advanced structure of EPS and CPS from various light conditions did not present obvious difference through Fourier transform infrared spectroscopy and X-ray diffraction characterization. These findings establish a basis for development of high-yielding polysaccharide production process and understanding their regulation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. System analysis of salt and osmotic stress induced proteins in Nostoc muscorum and Bradyrhizobium japonicum

    Directory of Open Access Journals (Sweden)

    Vipin Kaithwas

    2017-06-01

    Full Text Available In this study the proteome response of the two diazotrophic organism’s viz. Nostoc muscorum and Bradyrhizobium japonicum exposed to salt (NaCl and osmotic (sucrose stresses was compared. Out of the total over expressed proteins; we have selected only three over expressed proteins viz. GroEL chaperonin, nitrogenase Mo-Fe protein and argininosuccinate synthase for further analysis, and then we analyzed the amino acid frequencies of all the three over expressed proteins. That led to the conclusion that amino acids e.g. alanine, glycine and valine that were energetically cheaper to produce were showing higher frequencies. This study would help in tracing the phylogenetic relationship between protein families.

  16. Utilization of a terrestrial cyanobacterium, Nostoc sp. HK-01, for space habitation

    Science.gov (United States)

    Kimura, Shunta; Tomita-Yokotani, Kaori; Arai, Mayumi; Yamashita, Masamichi; Katoh, Hiroshi; Ajioka, Reiko; Inoue, Kotomi

    2016-07-01

    A terrestrial cyanobacterium, Nostoc sp. HK-01 (hereafter HK-01), has several useful abilities for space habitation; photosynthesis, nitrogen fixation, and space environmental tolerances to vacuum, UV, gamma-ray, heavy particle beam, low and high temperature. Space environmental tolerances are important for transportation to Mars. HK-01 can grow on Martian regolith simulant (MRS) in vitro. Furthermore, HK-01 is useful as food. HK-01 may be utilized as oxygen supply, soil formation and food material for bio-chemical circulation in closed bio-ecosystems, including space habitation such as Mars. HK-01 was adopted as a biological material for the "TANPOPO" mission (JAXA et al.,), because of their high environmental tolerances. The "TANPOPO" mission is performing the space exposure experiments on the Japan Experimental Module (JEM) of the International Space Station (ISS). The results of these experiments will show the ability of HK-01 to survive in space.

  17. Immunomodulatory Potential of the Polysaccharide-Rich Extract from Edible Cyanobacterium Nostoc commune

    Directory of Open Access Journals (Sweden)

    Hui-Fen Liao

    2015-11-01

    Full Text Available A dry sample of Nostoc commune from an organic farm in Pingtung city (Taiwan was used to prepare polysaccharide-rich (NCPS extract. The conditioned medium (CM from NCPS-treated human peripheral blood (PB-mononuclear cells (MNC effectively inhibited the growth of human leukemic U937 cells and triggered differentiation of U937 monoblast cells into monocytic/macrophagic lines. Cytokine levels in MNC-CMs showed upregulation of granulocyte/macrophage-colony stimulatory factor and IL-1β and downregulation of IL-6 and IL-17 upon treatment with NCPS. Moreover, murine macrophage RAW264.7 cells treated with NCPS exhibited the stimulatory effects of nitric oxide and superoxide secretion, indicating that NCPS might activate the immunity of macrophages. Collectively, the present study demonstrates that NCPS from N. commune could be potentially used for macrophage activation and consequently inhibited the leukemic cell growth and induced monocytic/macrophagic differentiation.

  18. Physicochemical parameters optimization, and purification of phycobiliproteins from the isolated Nostoc sp.

    Science.gov (United States)

    Johnson, Eldin M; Kumar, Kanhaiya; Das, Debabrata

    2014-08-01

    The present study investigated the effects of several physicochemical parameters on the improvement of phycobiliproteins (especially phycocyanin) synthesis in a newly isolated species of Nostoc sp. Standard BG11₀ medium was modified to enhance the biomass productivity in different photobioreactors. The initial pH of 8, light intensity of 40 μmol m(-2)s(-1), temperature of 35 °C, diurnal cycle of 16:8 h (light:dark regime), 75.48 μM Na₂CO₃ and 17.65 mM NaNO₃ were found most suitable for the phycobiliproteins synthesis. Cyanobacteria exhibited chromatic adaptation, causing overexpression of phycocyanin in red and phycoerythrin in green light. The maximum phycobiliproteins yield of 0.13 gg(-1) dry cell weight was obtained in green light. Phycocyanin was further purified using thin layer chromatography (TLC), anion exchange chromatography and SDS-PAGE (denaturing gel) electrophoresis. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Accumulation of radioactive cesium released from Fukushima Daiichi Nuclear Power Plant in terrestrial cyanobacteria Nostoc commune.

    Science.gov (United States)

    Sasaki, Hideaki; Shirato, Susumu; Tahara, Tomoya; Sato, Kenji; Takenaka, Hiroyuki

    2013-01-01

    The Fukushima Daiichi Nuclear Power Plant accident released large amounts of radioactive substances into the environment and contaminated the soil of Tohoku and Kanto districts in Japan. Removal of radioactive material from the environment is an urgent problem, and soil purification using plants is being considered. In this study, we investigated the ability of 12 seed plant species and a cyanobacterium to accumulate radioactive material. The plants did not accumulate radioactive material at high levels, but high accumulation was observed in the terrestrial cyanobacterium Nostoc commune. In Nihonmatsu City, Fukushima Prefecture, N. commune accumulated 415,000 Bq/kg dry weight (134)Cs and 607,000 Bq kg(-1) dry weight (137)Cs. The concentration of cesium in N. commune tended to be high in areas where soil radioactivity was high. A cultivation experiment confirmed that N. commune absorbed radioactive cesium from polluted soil. These data demonstrated that radiological absorption using N. commune might be suitable for decontaminating polluted soil.

  20. Investigation of a Quadruplex-Forming Repeat Sequence Highly Enriched in Xanthomonas and Nostoc sp.

    Science.gov (United States)

    Rehm, Charlotte; Wurmthaler, Lena A; Li, Yuanhao; Frickey, Tancred; Hartig, Jörg S

    2015-01-01

    In prokaryotes simple sequence repeats (SSRs) with unit sizes of 1-5 nucleotides (nt) are causative for phase and antigenic variation. Although an increased abundance of heptameric repeats was noticed in bacteria, reports about SSRs of 6-9 nt are rare. In particular G-rich repeat sequences with the propensity to fold into G-quadruplex (G4) structures have received little attention. In silico analysis of prokaryotic genomes show putative G4 forming sequences to be abundant. This report focuses on a surprisingly enriched G-rich repeat of the type GGGNATC in Xanthomonas and cyanobacteria such as Nostoc. We studied in detail the genomes of Xanthomonas campestris pv. campestris ATCC 33913 (Xcc), Xanthomonas axonopodis pv. citri str. 306 (Xac), and Nostoc sp. strain PCC7120 (Ana). In all three organisms repeats are spread all over the genome with an over-representation in non-coding regions. Extensive variation of the number of repetitive units was observed with repeat numbers ranging from two up to 26 units. However a clear preference for four units was detected. The strong bias for four units coincides with the requirement of four consecutive G-tracts for G4 formation. Evidence for G4 formation of the consensus repeat sequences was found in biophysical studies utilizing CD spectroscopy. The G-rich repeats are preferably located between aligned open reading frames (ORFs) and are under-represented in coding regions or between divergent ORFs. The G-rich repeats are preferentially located within a distance of 50 bp upstream of an ORF on the anti-sense strand or within 50 bp from the stop codon on the sense strand. Analysis of whole transcriptome sequence data showed that the majority of repeat sequences are transcribed. The genetic loci in the vicinity of repeat regions show increased genomic stability. In conclusion, we introduce and characterize a special class of highly abundant and wide-spread quadruplex-forming repeat sequences in bacteria.

  1. Effect of UV-B on enzymes of nitrogen metabolism in the cyanobacterium Nostoc calcicola

    International Nuclear Information System (INIS)

    Kumar, A.; Sinha, R.P.; Häder, D. P.

    1996-01-01

    The effects of ultraviolet-B (UV-B; 280–315 nm) irradiation on nitrogenase and nitrate reductase (NR) activity have been studied in the filamentous and heterocystous N 2 -fixing cyanobacterium Nostoc calcicola. Exposure of cultures to UV-B (5W/m 2 ) for as little as 30 min caused complete inactivation of nitrogenase activity whereas nitrate reductase activity was stimulated twofold in comparison to one exposed to fluorescent white light. GS activity was also inhibited by UV-B treatment, but there was no total loss of activity even after 4 h. NR activity showed a gradual stimulation up to 4 h and thereafter it became constant. Stimulation was also obtained in reductant deficient cultures (12 h incubation in the dark) suggesting independence of NR of PS-II under UV-B. NR activity was also unaffected in the presence of DCMU, a known inhibitor of PS-II. However, both O 2 evolution and 14 CO 2 uptake were completely abolished following 30 min of UV-B treatment. Addition of the protein synthesis inhibitor chloramphenicol (25 μg/mL) to cultures did not show any inhibitory effect on NR activity. SDS-PAGE analysis of UV-B treated cultures elicited gradual loss of protein bands with increasing duration of exposure. Our findings suggest that UV-B irradiance has differential effects on the enzymes of the nitrogen metabolism in the cyanobacterium Nostoc calcicola. Further studies are needed to reveal the exact mechanism involved in the stimulation of NR activity by UV-B. Whether UV-B has a direct effect on NO 2 − accumulation in the cells needs detailed investigation. (author)

  2. The mechanisms of protection of antioxidants on Nostoc sphaeroides against UV-B radiation

    Science.gov (United States)

    Wang, G. H.

    UV radiation is one of space harmful factor for earth organisms in space exploration In the present work we studied on the role of antioxidant system in Nostoc sphaeroides K u tz Cyanobacteria and the effects of exogenous antioxidant molecules on its photosynthetic rate under UV-B radiation It was found that UV-B radiation decreased the photosynthetic activity of cyanobacterium but promoted the activity of antioxidant system to protect photosystem II PSII and exogenous antioxidant sodium nitroprusside SNP N-acetylcysteine NAC had an obvious protection on PSII activity under UV-B radiation The activity of SOD Superoxide Dismutase EC 1 15 1 1 CAT Catalase EC 1 11 1 6 POD Peroxidase EC 1 11 1 7 and content of MDA and ASC were improved by 0 5mM and 1mM SNP but 0 1mM SNP decreased the activity of antioxide system Exogenous NAC addition decreased the activity of SOD POD CAT and the content MDA and ASC but exogenous NAC addition increased the content of GSH The results suggested that exogenous SNP and NAC may protect algae by different mechanisms in which SNP maybe play double roles as sources of reactive free radicals or ROS scavengers in formation of algae s protection of PSII under UV-B radiation while NAC does function as antioxidant reagent or precursor of glutathione which could protect PSII directly from UV-B radiation Keyword antioxidant system exogenous or endogenous antioxidant Nostoc sphaeroides photosynthesis UV-B radiation

  3. Arsenic Demethylation by a C·As Lyase in Cyanobacterium Nostoc sp. PCC 7120.

    Science.gov (United States)

    Yan, Yu; Ye, Jun; Xue, Xi-Mei; Zhu, Yong-Guan

    2015-12-15

    Arsenic, a ubiquitous toxic substance, exists mainly as inorganic forms in the environment. It is perceived that organoarsenicals can be demethylated and degraded into inorganic arsenic by microorganisms. Few studies have focused on the mechanism of arsenic demethylation in bacteria. Here, we investigated arsenic demethylation in a typical freshwater cyanobacterium Nostoc sp. PCC 7120. This bacterium was able to demethylate monomethylarsenite [MAs(III)] rapidly to arsenite [As(III)] and also had the ability to demethylate monomethylarsenate [MAs(V)] to As(III). The NsarsI encoding a C·As lyase responsible for MAs(III) demethylation was cloned from Nostoc sp. PCC 7120 and heterologously expressed in an As-hypersensitive strain Escherichia coli AW3110 (ΔarsRBC). Expression of NsarsI was shown to confer MAs(III) resistance through arsenic demethylation. The purified NsArsI was further identified and functionally characterized in vitro. NsArsI existed mainly as the trimeric state, and the kinetic data were well-fit to the Hill equation with K0.5 = 7.55 ± 0.33 μM for MAs(III), Vmax = 0.79 ± 0.02 μM min(-1), and h = 2.7. Both of the NsArsI truncated derivatives lacking the C-terminal 10 residues (ArsI10) or 23 residues (ArsI23) had a reduced ability of MAs(III) demethylation. These results provide new insights for understanding the important role of cyanobacteria in arsenic biogeochemical cycling in the environment.

  4. Identification of the n-1 fatty acid as an antibacterial constituent from the edible freshwater cyanobacterium Nostoc verrucosum.

    Science.gov (United States)

    Oku, Naoya; Yonejima, Kohsuke; Sugawa, Takao; Igarashi, Yasuhiro

    2014-01-01

    The cyanobacterium Nostoc verrucosum occurs in cool, clear streams and its gelatinous colonies, called "ashitsuki," have been eaten in ancient Japan. Its ethanolic extract was found to inhibit the growth of Gram-positive bacteria and activity-guided fractionation yielded an unusual n-1 fatty acid, (9Z,12Z)-9,12,15-hexadecatrienoic acid (1), as one of the active principles. It inhibited the growth of Staphylococcus aureus at MIC 64 μg/mL.

  5. Complete genome sequence of cyanobacterium Nostoc sp. NIES-3756, a potentially useful strain for phytochrome-based bioengineering.

    Science.gov (United States)

    Hirose, Yuu; Fujisawa, Takatomo; Ohtsubo, Yoshiyuki; Katayama, Mitsunori; Misawa, Naomi; Wakazuki, Sachiko; Shimura, Yohei; Nakamura, Yasukazu; Kawachi, Masanobu; Yoshikawa, Hirofumi; Eki, Toshihiko; Kanesaki, Yu

    2016-01-20

    To explore the diverse photoreceptors of cyanobacteria, we isolated Nostoc sp. strain NIES-3756 from soil at Mimomi-Park, Chiba, Japan, and determined its complete genome sequence. The Genome consists of one chromosome and two plasmids (total 6,987,571 bp containing no gaps). The NIES-3756 strain carries 7 phytochrome and 12 cyanobacteriochrome genes, which will facilitate the studies of phytochrome-based bioengineering. Copyright © 2015. Published by Elsevier B.V.

  6. Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120*

    Science.gov (United States)

    Baniulis, Danas; Yamashita, Eiki; Whitelegge, Julian P.; Zatsman, Anna I.; Hendrich, Michael P.; Hasan, S. Saif; Ryan, Christopher M.; Cramer, William A.

    2009-01-01

    The crystal structure of the cyanobacterial cytochrome b6f complex has previously been solved to 3.0-Å resolution using the thermophilic Mastigocladus laminosus whose genome has not been sequenced. Several unicellular cyanobacteria, whose genomes have been sequenced and are tractable for mutagenesis, do not yield b6f complex in an intact dimeric state with significant electron transport activity. The genome of Nostoc sp. PCC 7120 has been sequenced and is closer phylogenetically to M. laminosus than are unicellular cyanobacteria. The amino acid sequences of the large core subunits and four small peripheral subunits of Nostoc are 88 and 80% identical to those in the M. laminosus b6f complex. Purified b6f complex from Nostoc has a stable dimeric structure, eight subunits with masses similar to those of M. laminosus, and comparable electron transport activity. The crystal structure of the native b6f complex, determined to a resolution of 3.0Å (PDB id: 2ZT9), is almost identical to that of M. laminosus. Two unique aspects of the Nostoc complex are: (i) a dominant conformation of heme bp that is rotated 180° about the α- and γ-meso carbon axis relative to the orientation in the M. laminosus complex and (ii) acetylation of the Rieske iron-sulfur protein (PetC) at the N terminus, a post-translational modification unprecedented in cyanobacterial membrane and electron transport proteins, and in polypeptides of cytochrome bc complexes from any source. The high spin electronic character of the unique heme cn is similar to that previously found in the b6f complex from other sources. PMID:19189962

  7. Reconstruction of structural evolution in the trnL intron P6b loop of symbiotic Nostoc (Cyanobacteria).

    Science.gov (United States)

    Olsson, Sanna; Kaasalainen, Ulla; Rikkinen, Jouko

    2012-02-01

    In this study we reconstruct the structural evolution of the hyper-variable P6b region of the group I trnLeu intron in a monophyletic group of lichen-symbiotic Nostoc strains and establish it as a useful marker in the phylogenetic analysis of these organisms. The studied cyanobacteria occur as photosynthetic and/or nitrogen-fixing symbionts in lichen species of the diverse Nephroma guild. Phylogenetic analyses and secondary structure reconstructions are used to improve the understanding of the replication mechanisms in the P6b stem-loop and to explain the observed distribution patterns of indels. The variants of the P6b region in the Nostoc clade studied consist of different combinations of five sequence modules. The distribution of indels together with the ancestral character reconstruction performed enables the interpretation of the evolution of each sequence module. Our results indicate that the indel events are usually associated with single nucleotide changes in the P6b region and have occurred several times independently. In spite of their homoplasy, they provide phylogenetic information for closely related taxa. Thus we recognize that features of the P6b region can be used as molecular markers for species identification and phylogenetic studies involving symbiotic Nostoc cyanobacteria.

  8. A sustainable route to produce the scytonemin precursor using Escherichia coli

    DEFF Research Database (Denmark)

    Malla, Sailesh; Sommer, Morten O. A.

    2014-01-01

    moiety of scytonemin from tryptophan and tyrosine in Escherichia coli. We heterologously expressed the biosynthetic pathway from Nostoc punctiforme and discovered that only three enzymes from N. punctiforme are required for the in vivo production of the monomer moiety of scytonemin in E. coli. We also...

  9. Investigation of a Quadruplex-Forming Repeat Sequence Highly Enriched in Xanthomonas and Nostoc sp.

    Directory of Open Access Journals (Sweden)

    Charlotte Rehm

    Full Text Available In prokaryotes simple sequence repeats (SSRs with unit sizes of 1-5 nucleotides (nt are causative for phase and antigenic variation. Although an increased abundance of heptameric repeats was noticed in bacteria, reports about SSRs of 6-9 nt are rare. In particular G-rich repeat sequences with the propensity to fold into G-quadruplex (G4 structures have received little attention. In silico analysis of prokaryotic genomes show putative G4 forming sequences to be abundant. This report focuses on a surprisingly enriched G-rich repeat of the type GGGNATC in Xanthomonas and cyanobacteria such as Nostoc. We studied in detail the genomes of Xanthomonas campestris pv. campestris ATCC 33913 (Xcc, Xanthomonas axonopodis pv. citri str. 306 (Xac, and Nostoc sp. strain PCC7120 (Ana. In all three organisms repeats are spread all over the genome with an over-representation in non-coding regions. Extensive variation of the number of repetitive units was observed with repeat numbers ranging from two up to 26 units. However a clear preference for four units was detected. The strong bias for four units coincides with the requirement of four consecutive G-tracts for G4 formation. Evidence for G4 formation of the consensus repeat sequences was found in biophysical studies utilizing CD spectroscopy. The G-rich repeats are preferably located between aligned open reading frames (ORFs and are under-represented in coding regions or between divergent ORFs. The G-rich repeats are preferentially located within a distance of 50 bp upstream of an ORF on the anti-sense strand or within 50 bp from the stop codon on the sense strand. Analysis of whole transcriptome sequence data showed that the majority of repeat sequences are transcribed. The genetic loci in the vicinity of repeat regions show increased genomic stability. In conclusion, we introduce and characterize a special class of highly abundant and wide-spread quadruplex-forming repeat sequences in bacteria.

  10. Antioxidative activity of ethanol extracts from Spirulina platensis and Nostoc linckia measured by various methods

    Directory of Open Access Journals (Sweden)

    Liliana CEPOI

    2009-11-01

    Full Text Available The goal of this work is to determine the level of antioxidative activity of various ethanol extracts from Spirulina platensis and Nostoc linckia biomass, and also to demonstrate the possibility to select suitable methods for evaluation of these characteristics. The methods for determination of antioxidative activity were selected concerning their possible use for complex preparations: phosphomolybdenum method for evaluation of antioxidant capacity (PMRC, radical-scavenging activity by DPPH method (DPPH, antioxidant activity by the ABTS+ radical cation assay (ABTS, Folin-Ciocalteu reducing capacity (FCRC. We showed the presence of antioxidative substances in ethanol extractions from 2 species of cyanobacteria, and possibility to increase their activity varying ethanol concentration. It facilitates the extraction both water- and lipid-soluble components from biomass. Regarding used methods for antioxidative activity determination, we have used only those based on reaction of electrons return (which widely used nowadays in vitro. Obtained in different ways results demonstrate high reduction capacity of the extracts and possibility to select suitable analytical methods for each case.

  11. Investigation on characteristics of 3D printing using Nostoc sphaeroides biomass.

    Science.gov (United States)

    An, Yan-Jun; Guo, Chao-Fan; Zhang, Min; Zhong, Ze-Ping

    2018-06-27

    Gel-like constructs can be produced using an extrusion-based 3D food printing (3D-FP) technique. Nostoc sphaeroides biomass is a natural gel material. Considering its good nutrition and rheological properties, these algae were chosen in this study as supply material (ink) for 3D-FP. With this gel material, the extrusion-based 3D printing system was set as a model, and the printing behavior was investigated. Furthermore, the 3D-FP mechanisms were explained through low-field nuclear magnetic resonance and rheological measurements. Results indicated that although fresh biomass gel was printable, nonuniformity and instability occurred during printing. Blanched inks showed nonsmooth printing behavior, which was associated with a decrease in elasticity and viscosity. The printability was improved by increasing the rehydration time to 24 h when rehydrated powder was used. Increasing the rehydration time increased the water-binding degree. Pre-gelatinized potato starch was added to the mixture at ratios ranging from 1 to 100 g kg -1 . The best printing outcome was observed at 40 g kg -1 potato starch. We emphasize that elasticity and viscosity balance is an essential parameter to achieve printability. The strategies adopted in this work provide new insights into the development of personalized food regarding texture and nutritional additive content. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  12. Provision of water by halite deliquescence for Nostoc commune biofilms under Mars relevant surface conditions

    Science.gov (United States)

    Jänchen, Jochen; Feyh, Nina; Szewzyk, Ulrich; de Vera, Jean-Pierre P.

    2016-04-01

    Motivated by findings of new mineral related water sources for organisms under extremely dry conditions on Earth we studied in an interdisciplinary approach the water sorption behaviour of halite, soil component and terrestrial Nostoc commune biofilm under Mars relevant environmental conditions. Physicochemical methods served for the determination of water sorption equilibrium data and survival of heterotrophic bacteria in biofilm samples with different water contents was assured by recultivation. Deliquescence of halite provides liquid water at temperatures <273 K and may serve as water source on Mars during the morning stabilized by the CO2 atmosphere for a few hours. The protecting biofilm of N. commune is rather hygroscopic and tends to store water at lower humidity values. Survival tests showed that a large proportion of the Alphaproteobacteria dominated microbiota associated to N. commune is very desiccation tolerant and water uptake from saturated NaCl solutions (either by direct uptake of brine or adsorption of humidity) did not enhance recultivability in long-time desiccated samples. Still, a minor part can grow under highly saline conditions. However, the salinity level, although unfavourable for the host organism, might be for parts of the heterotrophic microbiota no serious hindrance for growing in salty Mars-like environments.

  13. Anti-MRSA-acting carbamidocyclophanes H-L from the Vietnamese cyanobacterium Nostoc sp. CAVN2.

    Science.gov (United States)

    Preisitsch, Michael; Harmrolfs, Kirsten; Pham, Hang T L; Heiden, Stefan E; Füssel, Anna; Wiesner, Christoph; Pretsch, Alexander; Swiatecka-Hagenbruch, Monika; Niedermeyer, Timo H J; Müller, Rolf; Mundt, Sabine

    2015-03-01

    The methanol extract of the Vietnamese freshwater cyanobacterium Nostoc sp. CAVN2 exhibited cytotoxic effects against MCF-7 and 5637 cancer cell lines as well as against nontumorigenic FL and HaCaT cells and was active against methicillin-resistant Staphylococcus aureus (MRSA) and Streptococcus pneumoniae. High-resolution mass spectrometric analysis indicated the presence of over 60 putative cyclophane-like compounds in an antimicrobially active methanol extract fraction. A paracyclophanes-focusing extraction and separation methodology led to the isolation of 5 new carbamidocyclophanes (1-5) and 11 known paracyclophanes (6-16). The structures and their stereochemical configurations were elucidated by a combination of spectrometric and spectroscopic methods including HRMS, 1D and 2D NMR analyses and detailed comparative CD analysis. The newly described monocarbamoylated [7.7]paracyclophanes (1, 2, 4 and 5) differ by a varying degree of chlorination in the side chains. Carbamidocyclophane J (3) is the very first reported carbamidocyclophane bearing a single halogenation in both butyl residues. Based on previous studies a detailed phylogenetic examination of cyclophane-producing cyanobacteria was carried out. The biological evaluation of 1-16 against various clinical pathogens highlighted a remarkable antimicrobial activity against MRSA with MICs of 0.1-1.0 μM, and indicated that the level of antibacterial activity is related to the presence of carbamoyl moieties.

  14. Differential effect of ultraviolet-B radiation on certain metabolic processes in a chromatically adapting Nostoc

    Energy Technology Data Exchange (ETDEWEB)

    Tyagi, R.; Srinivas, G.; Vyas, D.; Kumar, A.; Kumar, H.D. (Banaras Hindu Univ., Varanasi (India))

    1992-03-01

    The impact of UV-B radiation on growth, pigmentation and certain physiological processes was studied in a N{sub 2}-fixing chromatically adapting cyanobacterium, Nostoc spongiaeforme. A brownish form (phycoerythrin rich) was found to be more tolerant to UV-B than the blue-green (phycocyanin rich) form of N. spongiaeforme. Continuous exposure to UV-B (5.5 W m{sup -2}) for 90 min caused complete killing of the blue-green strain whereas the brown strain showed complete loss of survival after 180 min. Pigment content was more strongly inhibited in the blue-green strain than in the brown. Nitrogenase activity was completely abolished in both strains within 35 min of UV-B treatment. Restoration of nitrogenase occurred upon transfer to fluorescent or incandescent light after a lag of 5-6 h, suggesting fresh synthesis of nitrogenase. In vivo nitrate reductase activity was stimulated by UV-B treatment, the degree of enhancement being significantly higher in the blue-green strain. {sup 14}CO{sub 2} uptake was also completely abolished by UV-B treatment in both strains. (author).

  15. Metabolomic approach to optimizing and evaluating antibiotic treatment in the axenic culture of cyanobacterium Nostoc flagelliforme.

    Science.gov (United States)

    Han, Pei-pei; Jia, Shi-ru; Sun, Ying; Tan, Zhi-lei; Zhong, Cheng; Dai, Yu-jie; Tan, Ning; Shen, Shi-gang

    2014-09-01

    The application of antibiotic treatment with assistance of metabolomic approach in axenic isolation of cyanobacterium Nostoc flagelliforme was investigated. Seven antibiotics were tested at 1-100 mg L(-1), and order of tolerance of N. flagelliforme cells was obtained as kanamycin > ampicillin, tetracycline > chloromycetin, gentamicin > spectinomycin > streptomycin. Four antibiotics were selected based on differences in antibiotic sensitivity of N. flagelliforme and associated bacteria, and their effects on N. flagelliforme cells including the changes of metabolic activity with antibiotics and the metabolic recovery after removal were assessed by a metabolomic approach based on gas chromatography-mass spectrometry combined with multivariate analysis. The results showed that antibiotic treatment had affected cell metabolism as antibiotics treated cells were metabolically distinct from control cells, but the metabolic activity would be recovered via eliminating antibiotics and the sequence of metabolic recovery time needed was spectinomycin, gentamicin > ampicillin > kanamycin. The procedures of antibiotic treatment have been accordingly optimized as a consecutive treatment starting with spectinomycin, then gentamicin, ampicillin and lastly kanamycin, and proved to be highly effective in eliminating the bacteria as examined by agar plating method and light microscope examination. Our work presented a strategy to obtain axenic culture of N. flagelliforme and provided a method for evaluating and optimizing cyanobacteria purification process through diagnosing target species cellular state.

  16. Sorption and desorption studies of chromium(VI) from nonviable cyanobacterium Nostoc muscorum biomass

    International Nuclear Information System (INIS)

    Gupta, V.K.; Rastogi, A.

    2008-01-01

    This communication presents results pertaining to the sorptive and desorptive studies carried out on chromium(VI) removal onto nonviable freshwater cyanobacterium (Nostoc muscorum) biomass. Influence of varying the conditions for removal of chromium(VI), such as the pH of aqueous solution, the dosage of biosorbent, the contact time with the biosorbent, the temperature for the removal of chromium, the effect of light metal ions and the adsorption-desorption studies were investigated. Sorption interaction of chromium on to cyanobacterial species obeyed both the first and the second-order rate equation and the experimental data showed good fit with both the Langmuir and freundlich adsorption isotherm models. The maximum adsorption capacity was 22.92 mg/g at 25 o C and pH 3.0. The adsorption process was endothermic and the values of thermodynamic parameters of the process were calculated. Various properties of the cyanobacterium, as adsorbent, explored in the characterization part were chemical composition of the adsorbent, surface area calculation by BET method and surface functionality by FTIR. Sorption-desorption of chromium into inorganic solutions and distilled water were observed and this indicated the biosorbent could be regenerated using 0.1 M HNO 3 and EDTA with upto 80% recovery. The biosorbents were reused in five biosorption-desorption cycles without a significant loss in biosorption capacity. Thus, this study demonstrated that the cyanobacterial biomass N. muscorum could be used as an efficient biosorbent for the treatment of chromium(VI) bearing wastewater

  17. Bacterial Species and Biochemical Characteristic Investigations of Nostoc flagelliforme Concentrates during its Storage.

    Science.gov (United States)

    Yue, Lifang; Lv, Hexin; Zhen, Jing; Jiang, Shengping; Jia, Shiru; Shen, Shigang; Gao, Lu; Dai, Yujie

    2016-04-28

    Preservation of fresh algae plays an important role in algae seed subculture and aquaculture. The determination and examination of the changes of cell viability, composition, and bacterial species during storage would help to take suitable preservation methods to prolong the preservation time of fresh algae. Nostoc flagelliforme is a kind of edible cyanobacterium with important herbal and dietary values. This article investigated the changes of bacterial species and biochemical characteristics of fresh N. flagelliforme concentrate during natural storage. It was found that the viability of cells decreased along with the storage time. Fourteen bacteria strains in the algae concentrate were identified by PCR-DGGE and were grouped into four phyla, including Cyanobacteria, Firmicutes, Proteobacteria, and Bacteroidetes. Among them, Enterococcus viikkiensis may be a concern in the preservation. Eleven volatile organic compounds were identified from N. flagelliforme cells, in which geosmin could be treated as an indicator of the freshness of N. flagelliforme. The occurrence of indole compound may be an indicator of the degradation of cells.

  18. Differential effect of ultraviolet-B radiation on certain metabolic processes in a chromatically adapting Nostoc

    International Nuclear Information System (INIS)

    Tyagi, R.; Srinivas, G.; Vyas, D.; Kumar, A.; Kumar, H.D.

    1992-01-01

    The impact of UV-B radiation on growth, pigmentation and certain physiological processes was studied in a N 2 -fixing chromatically adapting cyanobacterium, Nostoc spongiaeforme. A brownish form (phycoerythrin rich) was found to be more tolerant to UV-B than the blue-green (phycocyanin rich) form of N. spongiaeforme. Continuous exposure to UV-B (5.5 W m -2 ) for 90 min caused complete killing of the blue-green strain whereas the brown strain showed complete loss of survival after 180 min. Pigment content was more strongly inhibited in the blue-green strain than in the brown. Nitrogenase activity was completely abolished in both strains within 35 min of UV-B treatment. Restoration of nitrogenase occurred upon transfer to fluorescent or incandescent light after a lag of 5-6 h, suggesting fresh synthesis of nitrogenase. In vivo nitrate reductase activity was stimulated by UV-B treatment, the degree of enhancement being significantly higher in the blue-green strain. 14 CO 2 uptake was also completely abolished by UV-B treatment in both strains. (author)

  19. Near infrared fluorescent biliproteins generated from bacteriophytochrome AphB of Nostoc sp. PCC 7120.

    Science.gov (United States)

    Yuan, Che; Li, Hui-Zhen; Tang, Kun; Gärtner, Wolfgang; Scheer, Hugo; Zhou, Ming; Zhao, Kai-Hong

    2016-04-01

    The genome of the cyanobacterium Nostoc sp. PCC 7120 encodes a large number of putative bacteriophytochrome and cyanobacteriochrome photoreceptors that, due to their long-wavelength absorption and fluorescence emission, might serve as fluorescent tags in intracellular investigations. We show that the PAS-GAF domain of the bacteriophytochrome, AphB, binds biliverdin covalently and exhibits, besides its reversible photochemistry, a moderate fluorescence in the near infrared (NIR) spectral region. It was selected for further increasing the brightness while retaining the NIR fluorescence. In the first step, amino acids assumed to improve fluorescence were selectively mutated. The resulting variants were then subjected to several rounds of random mutagenesis and screened for enhanced fluorescence in the NIR. The brightness of optimized PAS-GAF variants increased more than threefold compared to that of wt AphB(1-321), with only insignificant spectral shifts (Amax around 695 nm, and Fmax around 720 nm). In general, the brightness increases with decreasing wavelengths, which allows for a selection of the fluorophore depending on the optical properties of the tissue. A spectral heterogeneity was observed when residue His260, located in close proximity to the chromophore, was mutated to Tyr, emphasizing the strong effects of the environment on the electronic properties of the bound biliverdin chromophore.

  20. Effect of light with different wavelengths on Nostoc flagelliforme cells in liquid culture.

    Science.gov (United States)

    Dai, Yu-Jie; Li, Jing; Wei, Shu-Mei; Chen, Nan; Xiao, Yu-Peng; Tan, Zhi-Lei; Jia, Shi-Ru; Yuan, Nan-Nan; Tan, Ning; Song, Yi-Jie

    2013-04-01

    The effects of lights with different wavelengths on the growth and the yield of extracellular polysaccharides of Nostoc flagelliforme cells were investigated in a liquid cultivation. N. flagelliforme cells were cultured for 16 days in 500 ml conical flasks containing BG11 culture medium under 27 micromol·m-2·s-1 of light intensity and 25 degrees C on a rotary shaker (140 rpm). The chlorophyll a, phycocyanin, allophycocyanin, and phycoerythrin contents in N. flagelliforme cells under the lights of different wavelengths were also measured. It was found that the cell biomass and the yield of polysaccharide changed with different wavelengths of light. The biomass and the yield of extracellular polysaccharides under the red or violet light were higher than those under other light colors. Chlorophyll a, phycocyanin, and allophycocyanin are the main pigments in N. flagelliforme cells. The results showed that N. flagelliforme, like other cyanobacteria, has the ability of adjusting the contents and relative ratio of its pigments with the light quality. As a conclusion, N. flagelliforme cells favor red and violet lights and perform the complementary chromatic adaptation ability to acclimate to the changes of the light quality in the environment.

  1. Preparation of desiccation-resistant aquatic-living Nostoc flagelliforme (Cyanophyceae) for potential ecological application

    Science.gov (United States)

    Gao, Xiang; Yang, Yi-Wen; Cui, Li-Juan; Zhou, De-Bao; Qiu, Bao-Sheng

    2015-01-01

    Nostoc flagelliforme is a terrestrial edible cyanobacterium that grows in arid and semi-arid steppes. The continued over-exploitation in the last century has led to a sharp decline of this resource and a severe deterioration of the steppe ecology. Liquid-cultured N. flagelliforme serves as promising algal ‘seeds’ for resource restoration. In this study, macroscopic (or visible) aquatic-living colonies (MaACs) of N. flagelliforme were developed under weak light and high nitrogen conditions. In a 24 day shake-flask culture, MaACs were propagated by about 4.5-fold in biomass without loss of their macro-morphology; at the same time, the addition of weak UV-B treatment resulted in slightly bigger MaACs. Polyvinylpyrrolidone (PVP) k30, a water-soluble polymer, was used to generate the coating around MaACs, and after full desiccation, the coated MaACs could recover their photosynthetic physiological activity when rehydrated, with 4% PVP k30 for coating being most effective. In contrast, PVP k30-coated microscopic aquatic-living colonies of N. flagelliforme and non-coated MaACs showed no resistance to full desiccation. The macroscopic morphology or structure of MaACs should be crucial for the formation of protection by PVP k30 coating. PVP k30-coated MaACs were more approaching to actual application for resource restoration. PMID:25847617

  2. Raman spectroscopic analysis of the responds of desert cyanobacterium Nostoc sp under UV-B radiation

    Science.gov (United States)

    Wang, Gaohong; Hao, Zongjie; Hu, Chunxiang; Liu, Yongding

    Cyanobacteria are renowned for tolerating extremes of desiccation, UV radiation, freezethaw cycles, hypersalinity and oligotrophy, which make them as candidate par excellence for terraforming in extraterrestrial planet. Recently Raman spectrum was applied to study the biochemical information changes in different field of life science. In this study, we investigated the respond of desert cyanobactreium Nostoc sp under UV-B radiation via FT-Raman spectra. It was found that the spectral biomarkers of protectant molecular of UV radiation such as β-carotene and scytonemin were induced by UV-B radiation, but Chlorophyll a content was decreased, and also the photosynthesis activity was inhibited significantly. After light adaptation without UV-B radiation, the Chlorophyll a content and photosynthesis activity returned to high level, butβ-carotene and scytonemin content remained in the cells. Those results indicated that desert Cyanobacteria have good adaptation ability for UV-B radiation and synthesis of protectant molecular may be an effective strategy for its adaptation in evolution.

  3. The biotechnology of hydrogen production by Nostoc flagelliforme grown under chemostat conditions

    Energy Technology Data Exchange (ETDEWEB)

    Lichtl, R.R.; Bazin, M.J.; Hall, D.O. [Div. of Life Sciences, King`s College, London Univ. (United Kingdom)

    1997-11-01

    The potential of using N{sub 2}-fixing cyanobacteria to produce hydrogen photobiologically has stimulated research on the physiology and biotechnology of species exhibiting high H{sub 2} production rates over long periods of time. In this work Nostoc flagelliforme, a terrestrial N{sub 2}-fixing cyanobacterium, has been examined to establish its physiology and potential for H{sub 2} production under controlled conditions. Cell filaments of N. flagelliforme were purified and grown in liquid culture to optimize its H{sub 2} metabolism. In batch-grown cultures the activity of nitrogenase, the key enzyme for H{sub 2} production in N{sub 2}-fixing organisms, was found to be high only during a short phase of exponential growth. A chemostat system was thus constructed for long-term experiments using continuous cultures, with the aim of exploiting the exponential growth phase. The dilution rate (D) and environmental factors, such as N{sub 2} concentration in the gas phase and temperature, significantly influenced H{sub 2} production. Cells grown continuously under the optimized conditions of D=0.022 h{sup -1}, 34 C and 5.1 kPa N{sub 2} in the gas phase exhibited H{sub 2} production rates that were more than four times higher than the maximal rates under standard batch growth conditions. (orig.)

  4. Structural elucidation and molecular docking of a novel antibiotic compound from cyanobacterium Nostoc sp. MGL001

    Directory of Open Access Journals (Sweden)

    Niveshika No Name

    2016-11-01

    Full Text Available Cyanobacteria are rich source of array of bioactive compounds. The present study reports a novel antibacterial bioactive compound purified from cyanobacterium Nostoc sp. MGL001 using various chromatographic techniques viz. thin layer chromatography (TLC and high performance liquid chromatography (HPLC. Further characterization was done using electrospray ionisation mass spectroscopy (ESIMS and nuclear magnetic resonance (NMR and predicted structure of bioactive compound was 9-Ethyliminomethyl-12-(morpholin - 4 - ylmethoxy -5, 8, 13, 16 – tetraaza – hexacene - 2, 3 dicarboxylic acid (EMTAHDCA. Structure of EMTAHDCA clearly indicated that it is a novel compound that was not reported in literature or natural product database. The compound exhibited growth inhibiting effects mainly against the gram negative bacterial strains and produced maximum zone of inhibition at 150 μg/mL concentration. The compound was evaluated through in silico studies for its ability to bind 30S ribosomal fragment (PDB ID: 1YRJ, 1MWL, 1J7T and 1LC4 and OmpF porin protein (4GCP, 4GCQ and 4GCS which are the common targets of various antibiotic drugs. Comparative molecular docking study revealed that EMTAHDCA has strong binding affinity for these selected targets in comparison to a number of most commonly used antibiotics. The ability of EMTAHDCA to bind the active sites on the proteins and 30S ribosomal fragments where the antibiotic drugs generally bind indicated that it is functionally similar to the commercially available drugs.

  5. Biosorption of Cd(II) and Zn(II) by nostoc commune: isotherm and kinetics studies

    Energy Technology Data Exchange (ETDEWEB)

    Morsy, Fatthy M. [Faculty of Science, Botany Department, Assiut University, Assiut (Egypt); Hassan, Sedky H.A. [Department of Biological Environment, Kangwon National University, Kangwon-do (Korea, Republic of); Koutb, Mostafa [Faculty of Science, Botany Department, Assiut University, Assiut (Egypt); Umm Al-Qura University, Faculty of Applied Science, Biology Department, Mecca (Saudi Arabia)

    2011-07-15

    In this study, Nostoc commune (cyanobacterium) was used as an inexpensive and efficient biosorbent for Cd(II) and Zn(II) removal from aqueous solutions. The effect of various physicochemical factors on Cd(II) and Zn(II) biosorption such as pH 2.0-7.0, initial metal concentration 0.0-300 mg/L and contact time 0-120 min were studied. Optimum pH for removal of Cd(II) and Zn(II) was 6.0, while the contact time was 30 min at room temperature. The nature of biosorbent and metal ion interaction was evaluated by infrared (IR) technique. IR analysis of bacterial biomass revealed the presence of amino, carboxyl, hydroxyl, and carbonyl groups, which are responsible for biosorption of Cd(II) and Zn (II). The maximum biosorption capacities for Cd(II) and Zn(II) biosorption by N. commune calculated from Langmuir biosorption isotherm were 126.32 and 115.41 mg/g, respectively. The biosorption isotherm for two biosorbents fitted well with Freundlich isotherm than Langmuir model with correlation coefficient (r{sup 2} < 0.99). The biosorption kinetic data were fitted well with the pseudo-second-order kinetic model. Thus, this study indicated that the N. commune is an efficient biosorbent for the removal of Cd(II) and Zn(II) from aqueous solutions. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Feathermoss and epiphytic Nostoc cooperate differently: expanding the spectrum of plant–cyanobacteria symbiosis

    Energy Technology Data Exchange (ETDEWEB)

    Warshan, Denis; Espinoza, Josh L.; Stuart, Rhona; Richter, Alexander R.; Kim, Sea-Yong; Shapiro, Nicole; Woyke, Tanja; Kyripides, Nikos; Barry, Kerrie W.; Singan, Vasanth; Lindquist, Erika; Ansong, Charles K.; Purvine, Samuel O.; Brewer, Heather M.; Weyman, Philip D.; Dupont, Chris; Rasmussen, Ulla

    2017-12-31

    Dinitrogen (N2)-fixation by cyanobacteria in symbiosis with feather mosses represents the main pathway of biological N input into boreal forests. Despite its significance, little is known about the gene repertoire needed for the establishment and maintenance of the symbiosis. To determine gene acquisitions or regulatory rewiring allowing cyanobacteria to form this symbiosis, we compared closely related Nostoc strains that were either symbiosis-competent or non-competent, using a proteogenomics approach and a unique experimental setup allowing for controlled chemical and physical contact between partners. Thirty-two protein families were only in the genomes of competent strains, including some never before associated with symbiosis. We identified conserved orthologs that were differentially expressed in competent strains, including gene families involved in chemotaxis and motility, NO regulation, sulfate/phosphate transport, sugar metabolism, and glycosyl-modifying and oxidative stress-mediating exoenzymes. In contrast to other cyanobacteria-plant symbioses, the moss-cyanobacteria epiphytic symbiosis is distinct, with the symbiont retaining motility and chemotaxis, and not modulating N-fixation, photosynthesis, GS-GOGAT cycle, and heterocyst formation. Our work expands our knowledge of plant cyanobacterial symbioses, provides an interaction model of this ecologically significant symbiosis, and suggests new currencies, namely nitric oxide and aliphatic sulfonates, may be involved in establishing and maintaining this symbiosis.

  7. Evolutive and structural characterization of Nostoc commune iron-superoxide dismutase that is fit for modification.

    Science.gov (United States)

    Ma, Y; Lu, M; Li, J-Y; Qin, Y; Gong, X-G

    2012-10-04

    Superoxide dismutase (SOD) has extensive clinical applications for protecting organisms from toxic oxidation. In this study, the integrated iron-superoxide dismutase gene (fe-sod) coding sequence of Nostoc commune stain CHEN was cloned from genomic DNA and compared to sods from other reported algae. These analyses of immunology and phylogenetics indicated that this Fe-SOD is considerably homologous with SODs from lower prokaryotes (Fe-SOD or Mn-SOD) but not those from higher animals (Cu/Zn-SOD). In addition, the N. commune Fe-SOD shows 67 to 93% protein sequence identity to 10 other algal Fe-SODs (or Mn-SODs) and 69 to 93% gene sequence identity. Rare nonsynonymous substitutions imply that algal SODs are being subjected to strong natural selection. Interestingly, the N. commune Fe-SOD enzyme molecule has a compact active center that is highly conserved (38.1% of residues are absolutely conserved), and 2 loose ends localized outside the molecule and inclined to mutate (only 11.5% of residues are absolutely conserved). Based on associative analyses of evolution, structure, and function, this special phenomenon is attributed to function-dependent evolution through negative natural selection. Under strong natural selection, although the mutation is random on the gene level, the exterior region is inclined to mutate on the protein level owing to more nonsynonymous substitutions in the exterior region, which demonstrates the theoretical feasibility of modifying Fe-SOD on its ends to overcome its disadvantages in clinical applications.

  8. Geobiological Responses to Ocean Acidification

    Science.gov (United States)

    Potts, D. C.

    2008-12-01

    During 240Ma of evolution, scleractinian corals survived major changes in ocean chemistry, yet recent concerns with rapid acidification after ca. 40Ma of almost constant oceanic pH have tended to distract attention from natural pH variation in coastal waters, where most corals and reefs occur. Unaltered skeletal environmental proxies reflect conditions experienced by individual organisms, with any variation on micro- habitat and micro-time scales appropriate for that individual's ecology, behavior and physiology, but proxy interpretation usually extrapolates to larger spatial (habitat, region to global) and temporal (seasonal, annual, interannual) scales. Therefore, predicting consequences of acidification for both corals and reefs requires greater understanding of: 1. Many potential indirect consequences of pH change that may affect calcification and/or carbonate accretion: e.g. an individual's developmental rates, growth, final size, general physiology and reproductive success; its population's distribution and abundance, symbionts, food availability, predators and pathogens; and its community and ecosystem services. 2. Potentially diverse responses to declining pH, ranging from non-evolutionary, rapid physiological changes (acclimation) or long term (seasonal to interannual) plasticity (acclimatization) of individuals, through genetic adaptation in local populations, and up to directional changes in species" characteristics and/or radiations/extinctions. 3. The evolutionary and environmental history of an organism's lineage, its ecological (own lifetime) exposure to environmental variation, and "pre-adaptation" via other factors acting on correlated characters.

  9. Geobiology of Marine Magnetotactic Bacteria

    Science.gov (United States)

    2006-06-01

    prokaryotic cells of diverse phylogeny when grown in media containing 45 1mM iron, suggesting some kind of detoxification function . The inclusions were...salt marsh productivity. FISH also showed that aggregates consist of genetically identical cells. QPCR data indicated that populations are finely...my advisor Katrina Edwards for taking a chance on someone who initially knew nothing about magnetotactic bacteria, microbial ecology , or microbiology

  10. Ecophysiology of gelatinous Nostoc colonies: unprecedented slow growth and survival in resource-poor and harsh environments.

    Science.gov (United States)

    Sand-Jensen, Kaj

    2014-07-01

    The cyanobacterial genus Nostoc includes several species forming centimetre-large gelatinous colonies in nutrient-poor freshwaters and harsh semi-terrestrial environments with extended drought or freezing. These Nostoc species have filaments with normal photosynthetic cells and N2-fixing heterocysts embedded in an extensive gelatinous matrix of polysaccharides and many other organic substances providing biological and environmental protection. Large colony size imposes constraints on the use of external resources and the gelatinous matrix represents extra costs and reduced growth rates. The objective of this review is to evaluate the mechanisms behind the low rates of growth and mortality, protection against environmental hazards and the persistence and longevity of gelatinous Nostoc colonies, and their ability to economize with highly limiting resources. Simple models predict the decline in uptake of dissolved inorganic carbon (DIC) and a decline in the growth rate of spherical freshwater colonies of N. pruniforme and N. zetterstedtii and sheet-like colonies of N. commune in response to a thicker diffusion boundary layer, lower external DIC concentration and higher organic carbon mass per surface area (CMA) of the colony. Measured growth rates of N. commune and N. pruniforme at high DIC availability comply with general empirical predictions of maximum growth rate (i.e. doubling time 10-14 d) as functions of CMA for marine macroalgae and as functions of tissue thickness for aquatic and terrestrial plants, while extremely low growth rates of N. zetterstedtii (i.e. doubling time 2-3 years) are 10-fold lower than model predictions, either because of very low ambient DIC and/or an extremely costly colony matrix. DIC uptake is limited by diffusion at low concentrations for all species, although they exhibit efficient HCO3(-) uptake, accumulation of respiratory DIC within the colonies and very low CO2 compensation points. Long light paths and light attenuation by

  11. Effect of UV-B and high visual radiation on photosynthesis in freshwater (nostoc spongiaeforme) and marine (Phormidium corium) cyanobacteria.

    Science.gov (United States)

    Bhandari, Rupali; Sharma, Prabhat Kumar

    2007-08-01

    Human activity is causing depletion of ozone in stratosphere, resulting in increased UV-B radiation and global warming. However, impact of these climatic changes on the aquatic organism (especially marine) is not fully understood. Here, we have studied the effect of excess UV-B and visible radiation on photosynthetic pigments, fatty acids content, lipid peroxidation, nitrogen content, nitrogen reductase activity and membrane proteins, induction of mycosporine-like amino acids (MAAs) and antioxidant enzymes superoxide dismutase (SOD) and ascorbate peroxidase (APX) in freshwater (Nostoc spongiaeform) and marine (Phormidium corium) cyanobacteria. UV-B treatment resulted in an increase in photosynthetic pigments in Nostoc and decrease in Phormidium, but high light treatment caused photobleaching of most of the pigments in both the species. Unsaturation level of fatty acids of both total and glycolipids remained unchanged in both the cyanobacteria, as a result of UV-B and high light treatments. Saturated fatty acids of total and glycolipids declined slightly in Nostoc by both the treatments. but remained unchanged in Phormidium. No changes in the unsaturated lipid content in our study probably suggested adaptation of the organism to the treatments. However, both treatments resulted in peroxidation of membrane lipids, indicating oxidative damage to lipids without any change in the level of unsaturation of fatty acid in the cell membrane. Qualitative and quantitative changes were observed in membrane protein profile due to the treatments. Cyanobacteria were able to synthesize MAAs in response to the UV-B treatment. Both treatments also increased the activities of SOD and APX. In conclusion, the study demonstrated induction of antioxidants such as SOD and APX under visible light treatment and screening pigment (MAAs) under UV-B treatment, which might protect the cyanobacteria from oxidative damage caused by high light and UV-B radiation.

  12. Composición bioquímica y toxicidad de colonias comestibles de la cianobacteria andina Nostoc sp. Llayta

    OpenAIRE

    Galetovic, Alexandra; E. Araya, Jorge; Gómez-Silva, Benito

    2017-01-01

    RESUMEN Llayta es el nombre asignado a la biomasa seca de macrocolonias de una cianobacteria filamentosa, clasificada como Nostoc sp. Llayta crece en humedales andinos de Sudamérica y ha sido considerada como un ingrediente alimenticio desde tiempos precolombinos. Este estudio pretende contribuir a la definición de la calidad nutritiva de la Llayta, proporcionando información sobre su composición bioquímica e identificar aspectos críticos de interés toxicológico. Los resultados mostraron que ...

  13. Effects of light intensity on components and topographical structures of extracellular polysaccharides from the cyanobacteria Nostoc sp.

    Science.gov (United States)

    Ge, Hongmei; Xia, Ling; Zhou, Xuping; Zhang, Delu; Hu, Chunxiang

    2014-02-01

    A study on the effects of light intensity (40 and 80 μE/m(2)/sec) on the components and topographical structures of extracellular polysaccharides (EPS) was carried out in cyanobacteria Nostoc sp.. EPS yield increased with light intensity. However, light intensity did not significantly affect the EPS fractions and monosaccharide composition. Higher light intensity generally resulted in higher protein content of EPS in similar fractions. The topographical structure of EPS, investigated by atomic force microscopy, appeared as spherical lumps, chains and networks. The long chains were observed at higher light intensity. Thus, light intensity affected the yield and nature of EPS.

  14. Preparation of desiccation-resistant aquatic-living Nostoc flagelliforme (Cyanophyceae) for potential ecological application.

    Science.gov (United States)

    Gao, Xiang; Yang, Yi-Wen; Cui, Li-Juan; Zhou, De-Bao; Qiu, Bao-Sheng

    2015-11-01

    Nostoc flagelliforme is a terrestrial edible cyanobacterium that grows in arid and semi-arid steppes. The continued over-exploitation in the last century has led to a sharp decline of this resource and a severe deterioration of the steppe ecology. Liquid-cultured N. flagelliforme serves as promising algal 'seeds' for resource restoration. In this study, macroscopic (or visible) aquatic-living colonies (MaACs) of N. flagelliforme were developed under weak light and high nitrogen conditions. In a 24 day shake-flask culture, MaACs were propagated by about 4.5-fold in biomass without loss of their macro-morphology; at the same time, the addition of weak UV-B treatment resulted in slightly bigger MaACs. Polyvinylpyrrolidone (PVP) k30, a water-soluble polymer, was used to generate the coating around MaACs, and after full desiccation, the coated MaACs could recover their photosynthetic physiological activity when rehydrated, with 4% PVP k30 for coating being most effective. In contrast, PVP k30-coated microscopic aquatic-living colonies of N. flagelliforme and non-coated MaACs showed no resistance to full desiccation. The macroscopic morphology or structure of MaACs should be crucial for the formation of protection by PVP k30 coating. PVP k30-coated MaACs were more approaching to actual application for resource restoration. © 2015 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

  15. Sorption and desorption studies of chromium(VI) from nonviable cyanobacterium Nostoc muscorum biomass

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, V.K. [Department of Chemistry, Indian Institute of Technology Roorkee, Roorkee 247667 (India)], E-mail: vinodfcy@iitr.ernet.in; Rastogi, A. [Department of Chemistry, Indian Institute of Technology Roorkee, Roorkee 247667 (India)

    2008-06-15

    This communication presents results pertaining to the sorptive and desorptive studies carried out on chromium(VI) removal onto nonviable freshwater cyanobacterium (Nostoc muscorum) biomass. Influence of varying the conditions for removal of chromium(VI), such as the pH of aqueous solution, the dosage of biosorbent, the contact time with the biosorbent, the temperature for the removal of chromium, the effect of light metal ions and the adsorption-desorption studies were investigated. Sorption interaction of chromium on to cyanobacterial species obeyed both the first and the second-order rate equation and the experimental data showed good fit with both the Langmuir and freundlich adsorption isotherm models. The maximum adsorption capacity was 22.92 mg/g at 25 {sup o}C and pH 3.0. The adsorption process was endothermic and the values of thermodynamic parameters of the process were calculated. Various properties of the cyanobacterium, as adsorbent, explored in the characterization part were chemical composition of the adsorbent, surface area calculation by BET method and surface functionality by FTIR. Sorption-desorption of chromium into inorganic solutions and distilled water were observed and this indicated the biosorbent could be regenerated using 0.1 M HNO{sub 3} and EDTA with upto 80% recovery. The biosorbents were reused in five biosorption-desorption cycles without a significant loss in biosorption capacity. Thus, this study demonstrated that the cyanobacterial biomass N. muscorum could be used as an efficient biosorbent for the treatment of chromium(VI) bearing wastewater.

  16. Cytotoxicity and Secondary Metabolites Production in Terrestrial Nostoc Strains, Originating From Different Climatic/Geographic Regions and Habitats: Is Their Cytotoxicity Environmentally Dependent?

    Czech Academy of Sciences Publication Activity Database

    Hrouzek, Pavel; Tomek, P.; Lukešová, Alena; Urban, J.; Voloshko, L.; Pushparaj, B.; Ventura, S.; Lukavský, Jaromír; Štys, D.; Kopecký, J.

    2011-01-01

    Roč. 26, č. 4 (2011), s. 345-358 ISSN 1520-4081 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60660521; CEZ:AV0Z50200510 Keywords : cytotoxicity * cyanobacteria * nostoc Subject RIV: EE - Microbiology, Virology Impact factor: 2.407, year: 2011

  17. Metabolic adaptation, a specialized leaf organ structure and vascular responses to diurnal N2 fixation by nostoc azollae sustain the astonishing productivity of azolla ferns without nitrogen fertilizer

    NARCIS (Netherlands)

    Brouwer, Paul; Bräutigam, Andrea; Buijs, Valerie A.; Tazelaar, Anne O.E.; van der Werf, Adrie; Schlüter, Urte; Reichart, Gert-Jan; Bolger, Anthony; Usadel, Björn; Weber, Andreas P.M.; Schluepmann, Henriette

    2017-01-01

    Sustainable agriculture demands reduced input of man-made nitrogen (N) fertilizer, yet N2 fixation limits the productivity of crops with heterotrophic diazotrophic bacterial symbionts. We investigated floating ferns from the genus Azolla that host phototrophic diazotrophic Nostoc azollae in leaf

  18. Characterization and Optimization of Bioflocculant Exopolysaccharide Production by Cyanobacteria Nostoc sp. BTA97 and Anabaena sp. BTA990 in Culture Conditions.

    Science.gov (United States)

    Tiwari, Onkar Nath; Khangembam, Romi; Shamjetshabam, Minerva; Sharma, Aribam Subhalaxmi; Oinam, Gunapati; Brand, Jerry J

    2015-08-01

    Bioflocculant exopolysaccharide (EPS) production by 40 cyanobacterial strains during their photoautotrophic growth was investigated. Highest levels of EPS were produced by Nostoc sp. BTA97 and Anabaena sp. BTA990. EPS production was maximum during stationary growth phase, when nitrogenase activity was very low. Maximum EPS production occurred at pH 8.0 in the absence of any combined nitrogen source. The cyanobacterial EPS consisted of soluble protein and polysaccharide that included substantial amounts of neutral sugars and uronic acid. The EPS isolated from Anabaena sp. BTA990 and Nostoc sp. BTA97 demonstrated high flocculation capacity. There was a positive correlation between uronic acid content and flocculation activity. The flocculant bound a cationic dye, Alcian Blue, indicating it to be polyanionic. The 16S rRNA gene sequences for Nostoc sp. BTA97 and Anabaena sp. BTA990 were deposited at NCBI GenBank, and accession numbers were obtained as KJ830951 and KJ830948, respectively. The results of these experiments indicate that strains Anabaena sp. BTA990 and Nostoc sp. BTA97 are good candidates for the commercial production of EPS and might be utilized in industrial applications as an alternative to synthetic and abiotic flocculants.

  19. Influence of a non-copper algicide on the cyanobacterium, Nostoc spongiaeforme, and the green alga, Hydrodictyon reticulatum, in field and laboratory experiments

    Science.gov (United States)

    Cyanobacteria grow in California rice fields where they form large mats that may smoother seedlings or cause them to dislodge, resulting in yield loss. The most troublesome species is Nostoc spongiaeforme. It is very difficult to control using currently accepted methods, i.e., aerial applications of...

  20. Phylogeny of Indonesian Nostoc (Cyanobac teria Isolated from Paddy Fields as Inferred from Partial Se quence of 16S rRNA Gene

    Directory of Open Access Journals (Sweden)

    Dian Hendrayanti

    2012-12-01

    Full Text Available In order to collect Indonesian Nostoc, isolation of soil microflora from several paddy fields in West Java, Bali, andSouth Celebes was carried out. Fast-growing isolates of Nostoc were selected to describe and perform molecular identification using partial sequences of 16S rRNA. The results showed that partial sequences of 16S rRNA could not resolve the phylogeny of the isolates. However, it supported the morphological studies that recognize isolates as different species of Nostoc. Potential use of Nostoc as a nitrogen source for paddy growth was carried out using six strains as single inoculums. A total biomass of 2 g (fresh weight for each strain was inoculated, respectively, into the pot planted with three paddy plants. This experiment was conducted in the green house for 115 days. Statistical analyses (ANOVA; α = 0.05 showed that of six strains tested in this study, only strain GIA13a had influence on the augmentation of root length and the total number of filled grains.

  1. HupW Protease Specifically Required for Processing of the Catalytic Subunit of the Uptake Hydrogenase in the Cyanobacterium Nostoc sp. Strain PCC 7120

    Science.gov (United States)

    Lindberg, Pia; Devine, Ellenor; Stensjö, Karin

    2012-01-01

    The maturation process of [NiFe] hydrogenases includes a proteolytic cleavage of the large subunit. We constructed a mutant of Nostoc strain PCC 7120 in which hupW, encoding a putative hydrogenase-specific protease, is inactivated. Our results indicate that the protein product of hupW selectively cleaves the uptake hydrogenase in this cyanobacterium. PMID:22020512

  2. Establishment of an isolation method of Nostoc commune cells free from extracellular polysaccharides (EPS using Percoll centrifugation

    Directory of Open Access Journals (Sweden)

    Makiko Kosugi

    2012-11-01

    Full Text Available The terrestrial cyanobacterium Nostoc commune Vaucher ex Bornet et Flahault occurs worldwide, including in Japan and Antarctica. N. commune has a large amount of extracellular polysaccharides (EPS that hold moisture and protect the cells and at the same time accumulate light-blocking substances which is believed to play an important part in adaptation to a severe environment. To evaluate the photoadaptation processes in N. commune and clarify the role(s of EPS under ambient environmental condition at Antarctica, separation of cells from EPS is necessary. High yield is a prerequisite for the use of only small amount of natural N. commune from Antarctica. For this purpose, we developed a separation method by improving the Percoll density gradient centrifugation method using an EPS-coated field-grown Nostoc population. We established the most suitable condition to separate naked cells from EPS at high yield retaining high photosynthetic activity. The method is composed of centrifugation of cell homogenated N. commune in 10% (v/v Percoll to separate cells efficiently from EPS followed by fractionating centrifugation to remove impurities using the gradient of Percoll (80% and 50%, v/v.

  3. Short Communication: Effects of temperature on growth, pigment composition and protein content of an Antarctic Cyanobacterium Nostoc commune

    Directory of Open Access Journals (Sweden)

    RANJANA TRIPATHI

    2012-11-01

    Full Text Available Tripathi R, Dhuldhaj UP, Singh S. 2012. Short Communication: Effects of temperature on growth, pigment composition and protein content of an Antarctic Cyanobacterium Nostoc commune. Nusantara Bioscience 4: 134-137. Effect of temperature variation on biomass accumulation, pigment composition and protein content were studied for the cyanobacterium Nostoc commune, isolated from Antarctica. Results confirmed the psychrotrophic behavior (optimum growth temperature 25◦C of the cyanobacterium. Low temperature increased the duration of lag phase and exponential growth phase. Maximum increase in biomass was recorded on 24th day at 25◦C and on 12th day at 50C. The downshift from 25 to 5◦C had almost negligible effect on chl a content. Maximal protein content was recorded for cultures growing at 50C on 12th day. The carotenoids/chl a ratio was maximum (2.48 at 50C on 9th day. It remained almost constant for cultures growing at 5 and 350C. There was an induction in protein synthesis following downshift in temperature from 25 to 5◦C.

  4. Dry heat tolerance of the dry colony in Nostoc sp. HK-01 for useful usage in space agriculture

    Science.gov (United States)

    Kimura, Shunta; Tomita-Yokotani, Kaori; Yamashita, Masamichi; Sato, Seigo; Katoh, Hiroshi

    Space agriculture producing foods is important as one of approach for space habitation. Nostoc sp. HK-01 is one of terrestrial cyanobacterium having a high dry tolerance and it has several ability, photosynthesis, nitrogen fixation and usefulness as a food, it is thought that it can be used for space agriculture. Besides, a study on each tolerance predicted at the time of introduction to space agriculture is necessary. Therefore, as one of the tolerance that are intended to space environment, dry heat ( 100(°) C, 10 h ) tolerance of dry colony in Nostoc sp. HK-01 has been investigated, but the detail function of them has not yet been elucidated. We focused on the extracellular polysaccharides ( EPS ) having the various tolerance, desiccation, low temperature, NaCl, and heavy particle beam. We will consider the function and useful usage of this cyanobacterum in space agriculture after the consideration of the results of contribution of the possibility that EPS improves dry heat tolerance under a dry condition.

  5. Contribution of two ζ-carotene desaturases to the poly-cis desaturation pathway in the cyanobacterium Nostoc PCC 7120.

    Science.gov (United States)

    Breitenbach, Jürgen; Bruns, Marius; Sandmann, Gerhard

    2013-07-01

    The presence of two completely unrelated ζ-carotene desaturases CrtQa and CrtQb in some Nostoc strains is unique. CrtQb is the ζ-carotene desaturase, which was acquired by almost all cyanobacteria. The additional CrtQa can be regarded as an evolutionary relict of the CrtI desaturase present in non-photosynthetic bacteria. By reconstruction of the carotene desaturation pathway, we showed that both enzymes from Nostoc PCC 7120 were active. However, they differed in their preferred utilization of ζ-carotene Z isomers. CrtQa converted ζ-carotene isomers that were poorly metabolized by CrtQb. In this respect, CrtQa complemented the reactions of CrtQb, which is an advantage avoiding dead ends in the poly-cis desaturation pathway. In addition to ζ-carotene desaturation, CrtQa still possesses the Z to E isomerase function of the ancestral desaturase CrtI. Biochemical characterization showed that CrtQb is an enzyme with one molecule of tightly bound FAD and acts as a dehydrogenase transferring hydrogen to oxidized plastoquinone.

  6. Fungal lectin of Peltigera canina induces chemotropism of compatible Nostoc cells by constriction-relaxation pulses of cyanobiont cytoskeleton.

    Science.gov (United States)

    Díaz, Eva Maria; Vicente-Manzanares, Miguel; Sacristan, Mara; Vicente, Carlos; Legaz, Maria-Estrella

    2011-10-01

    A glycosylated arginase acting as a fungal lectin from Peltigera canina is able to produce recruitment of cyanobiont Nostoc cells and their adhesion to the hyphal surface. This implies that the cyanobiont would develop organelles to motility towards the chemoattractant. However when visualized by transmission electron microscopy, Nostoc cells recently isolated from P. canina thallus do not reveal any motile, superficial organelles, although their surface was covered by small spindles and serrated layer related to gliding. The use of S-(3,4-dichlorobenzyl)isothiourea, blebbistatin, phalloidin and latrunculin A provide circumstantial evidence that actin microfilaments rather than MreB, the actin-like protein from prokaryota, and, probably, an ATPase which develops contractile function similar to that of myosin II, are involved in cell motility. These experimental facts, the absence of superficial elements (fimbriae, pili or flagellum) related to cell movement, and the appearance of sunken cells during of after movement verified by scanning electron microscopy, support the hypothesis that the motility of lichen cyanobionts could be achieved by contraction-relaxation episodes of the cytoskeleton induced by fungal lectin act as a chemoattractant.

  7. Toxicity of nickel and silver to Nostoc muscorum: interaction with ascorbic acid, glutathione, and sulfur-containing amino acids.

    Science.gov (United States)

    Rai, L C; Raizada, M

    1987-08-01

    Exposure of Nostoc muscorum to different concentrations of Ni and Ag brought about reduction in growth, carbon fixation, heterocyst production, and nitrogenase activity and increase in the loss of ions (K+, Na+). In an attempt to ameliorate the toxicity of test metals by ascorbic acid, glutathione, and sulfur-containing amino acids (L-cysteine and L-methionine), it was found that the level of protection by ascorbic acid and glutathione was more for Ag than Ni. However, metal-induced inhibition of growth and carbon fixation was equally ameliorated by methionine. But the level of protection by cysteine was quite different, i.e., 27% for Ni and 22% for Ag. Protection of metal toxicity in N. muscorum by amino acids lends further support to self-detoxifying ability of cyanobacteria because they are known to synthesize all essential amino acids.

  8. Effects of light intensity and quality on phycobiliprotein accumulation in the cyanobacterium Nostoc sphaeroides Kützing.

    Science.gov (United States)

    Ma, Rui; Lu, Fan; Bi, Yonghong; Hu, Zhengyu

    2015-08-01

    To assess the effects of light intensity and quality on the growth and phycobiliproteins (PBP) accumulation in Nostoc sphaeroides Kützing (N. sphaeroides). Dry weights, dry matter, protein, chlorophyll and PBP contents were higher under 90 μmol m(-2) s(-1) than under other intensities (both higher and lower). Phycocyanin and allophycocyanin increased with light intensity while phycoerythrin decreased. Fresh weights, protein and PBP contents increased at the highest rates under blue light. Red light resulted in higher values of dry matter, phycocyanin and chlorophyll a. White light at 90 μmol m(-2) s(-1) or blue light 30 μmol m(-2) s(-1) were optimal for the growth and phycobiliprotein accumulation in N. sphaeroides.

  9. A Proposal on the Restoration of Nostoc flagelliforme for Sustainable Improvement in the Ecology of Arid Steppes in China

    Directory of Open Access Journals (Sweden)

    Xiang Gao

    2016-06-01

    Full Text Available Nostoc flagelliforme, a filamentous nitrogen-fixing cyanobacterium, is widely distributed in arid steppes of the west and northwestern parts of China. However, as a food delicacy this species has been overexploited from 1970 to 2000. Moreover, overgrazing, land reclamation and the removal of medicinal herbs have caused severely reduced vegetation coverage there. In this communication, a badly damaged but slowly rehabilitating N. flagelliforme-inhibiting steppe is described, and the rehabilitation of desertified steppes by the renewed growth of N. flagelliforme is proposed. The restoration of this dominant nitrogen supplier would be an ecologically sustainable solution for supplementing current measures already taken in the desertified regions. In addition, a goal of 50%–60% vegetation coverage is proposed by the N. flagelliforme restoration.

  10. Wet season cyanobacterial N enrichment highly correlated with species richness and Nostoc in the northern Australian savannah

    Directory of Open Access Journals (Sweden)

    W. Williams

    2018-04-01

    Full Text Available The Boodjamulla National Park research station is situated in the north-western Queensland dry savannah, where the climate is dominated by summer monsoons and virtually dry winters. Under shrub canopies and in between the tussock grasses cyanobacterial crusts almost entirely cover the flood plain soil surfaces. Seasonality drives N fixation, and in the savannah this has a large impact on both plant and soil function. Many cyanobacteria fix dinitrogen that is liberated into the soil in both inorganic and organic N forms. We examined cyanobacterial species richness and bioavailable N spanning 7 months of a typical wet season. Over the wet season cyanobacterial richness ranged from 6 to 19 species. N-fixing Scytonema accounted for seasonal averages between 51 and 93 % of the biocrust. Cyanobacterial richness was highly correlated with N fixation and bioavailable N in 0–1 cm. Key N-fixing species such as Nostoc, Symploca and Gloeocapsa significantly enriched soil N although Nostoc was the most influential. Total seasonal N fixation by cyanobacteria demonstrated the variability in productivity according to the number of wet days as well as the follow-on days where the soil retained adequate moisture. Based on total active days per month we estimated that N soil enrichment via cyanobacteria would be  ∼  5.2 kg ha−1 annually which is comparable to global averages. This is a substantial contribution to the nutrient-deficient savannah soils that are almost entirely reliant on the wet season for microbial turnover of organic matter. Such well-defined seasonal trends and synchronisation in cyanobacterial species richness, N fixation, bioavailable N and C fixation (Büdel et al., 2018 provide important contributions to multifunctional microprocesses and soil fertility.

  11. Wet season cyanobacterial N enrichment highly correlated with species richness and Nostoc in the northern Australian savannah

    Science.gov (United States)

    Williams, Wendy; Büdel, Burkhard; Williams, Stephen

    2018-04-01

    The Boodjamulla National Park research station is situated in the north-western Queensland dry savannah, where the climate is dominated by summer monsoons and virtually dry winters. Under shrub canopies and in between the tussock grasses cyanobacterial crusts almost entirely cover the flood plain soil surfaces. Seasonality drives N fixation, and in the savannah this has a large impact on both plant and soil function. Many cyanobacteria fix dinitrogen that is liberated into the soil in both inorganic and organic N forms. We examined cyanobacterial species richness and bioavailable N spanning 7 months of a typical wet season. Over the wet season cyanobacterial richness ranged from 6 to 19 species. N-fixing Scytonema accounted for seasonal averages between 51 and 93 % of the biocrust. Cyanobacterial richness was highly correlated with N fixation and bioavailable N in 0-1 cm. Key N-fixing species such as Nostoc, Symploca and Gloeocapsa significantly enriched soil N although Nostoc was the most influential. Total seasonal N fixation by cyanobacteria demonstrated the variability in productivity according to the number of wet days as well as the follow-on days where the soil retained adequate moisture. Based on total active days per month we estimated that N soil enrichment via cyanobacteria would be ˜ 5.2 kg ha-1 annually which is comparable to global averages. This is a substantial contribution to the nutrient-deficient savannah soils that are almost entirely reliant on the wet season for microbial turnover of organic matter. Such well-defined seasonal trends and synchronisation in cyanobacterial species richness, N fixation, bioavailable N and C fixation (Büdel et al., 2018) provide important contributions to multifunctional microprocesses and soil fertility.

  12. The application of two-step linear temperature program to thermal analysis for monitoring the lipid induction of Nostoc sp. KNUA003 in large scale cultivation.

    Science.gov (United States)

    Kang, Bongmun; Yoon, Ho-Sung

    2015-02-01

    Recently, microalgae was considered as a renewable energy for fuel production because its production is nonseasonal and may take place on nonarable land. Despite all of these advantages, microalgal oil production is significantly affected by environmental factors. Furthermore, the large variability remains an important problem in measurement of algae productivity and compositional analysis, especially, the total lipid content. Thus, there is considerable interest in accurate determination of total lipid content during the biotechnological process. For these reason, various high-throughput technologies were suggested for accurate measurement of total lipids contained in the microorganisms, especially oleaginous microalgae. In addition, more advanced technologies were employed to quantify the total lipids of the microalgae without a pretreatment. However, these methods are difficult to measure total lipid content in wet form microalgae obtained from large-scale production. In present study, the thermal analysis performed with two-step linear temeperature program was applied to measure heat evolved in temperature range from 310 to 351 °C of Nostoc sp. KNUA003 obtained from large-scale cultivation. And then, we examined the relationship between the heat evolved in 310-351 °C (HE) and total lipid content of the wet Nostoc cell cultivated in raceway. As a result, the linear relationship was determined between HE value and total lipid content of Nostoc sp. KNUA003. Particularly, there was a linear relationship of 98% between the HE value and the total lipid content of the tested microorganism. Based on this relationship, the total lipid content converted from the heat evolved of wet Nostoc sp. KNUA003 could be used for monitoring its lipid induction in large-scale cultivation. Copyright © 2014 Elsevier Inc. All rights reserved.

  13. A Genetic and Chemical Perspective on Symbiotic Recruitment of Cyanobacteria of the Genus Nostoc into the Host Plant Blasia pusilla L.

    Directory of Open Access Journals (Sweden)

    Anton Liaimer

    2016-11-01

    Full Text Available Liverwort Blasia pusilla L. recruits soil nitrogen-fixing cyanobacteria of genus Nostoc as symbiotic partners. In this work we compared Nostoc community composition inside the plants and in the soil around them from two distant locations in Northern Norway. STRR fingerprinting and 16S rDNA phylogeny reconstruction showed a remarkable local diversity among isolates assigned to several Nostoc clades. An extensive web of negative allelopathic interactions was recorded at an agricultural site, but not at the undisturbed natural site. The cell extracts of the cyanobacteria did not show antimicrobial activities, but four isolates were shown to be cytotoxic to human cells. The secondary metabolite profiles of the isolates were mapped by MALDI-TOF MS, and the most prominent ions were further analysed by Q-TOF for MS/MS aided identification. Symbiotic isolates produced a great variety of small peptide-like substances, most of which lack any record in the databases. Among identified compounds we found microcystin and nodularin variants toxic to eukaryotic cells. Microcystin producing chemotypes were dominating as symbiotic recruits but not in the free-living community. In addition, we were able to identify several novel aeruginosins and banyaside-like compounds, as well as nostocyclopeptides and nosperin.

  14. A Genetic and Chemical Perspective on Symbiotic Recruitment of Cyanobacteria of the Genus Nostoc into the Host Plant Blasia pusilla L.

    Science.gov (United States)

    Liaimer, Anton; Jensen, John B.; Dittmann, Elke

    2016-01-01

    Liverwort Blasia pusilla L. recruits soil nitrogen-fixing cyanobacteria of genus Nostoc as symbiotic partners. In this work we compared Nostoc community composition inside the plants and in the soil around them from two distant locations in Northern Norway. STRR fingerprinting and 16S rDNA phylogeny reconstruction showed a remarkable local diversity among isolates assigned to several Nostoc clades. An extensive web of negative allelopathic interactions was recorded at an agricultural site, but not at the undisturbed natural site. The cell extracts of the cyanobacteria did not show antimicrobial activities, but four isolates were shown to be cytotoxic to human cells. The secondary metabolite profiles of the isolates were mapped by MALDI-TOF MS, and the most prominent ions were further analyzed by Q-TOF for MS/MS aided identification. Symbiotic isolates produced a great variety of small peptide-like substances, most of which lack any record in the databases. Among identified compounds we found microcystin and nodularin variants toxic to eukaryotic cells. Microcystin producing chemotypes were dominating as symbiotic recruits but not in the free-living community. In addition, we were able to identify several novel aeruginosins and banyaside-like compounds, as well as nostocyclopeptides and nosperin. PMID:27847500

  15. Identification and characterization of a carboxysomal γ-carbonic anhydrase from the cyanobacterium Nostoc sp. PCC 7120.

    Science.gov (United States)

    de Araujo, Charlotte; Arefeen, Dewan; Tadesse, Yohannes; Long, Benedict M; Price, G Dean; Rowlett, Roger S; Kimber, Matthew S; Espie, George S

    2014-09-01

    Carboxysomes are proteinaceous microcompartments that encapsulate carbonic anhydrase (CA) and ribulose 1,5-bisphosphate carboxylase/oxygenase (Rubisco); carboxysomes, therefore, catalyze reversible HCO3 (-) dehydration and the subsequent fixation of CO2. The N- and C-terminal domains of the β-carboxysome scaffold protein CcmM participate in a network of protein-protein interactions that are essential for carboxysome biogenesis, organization, and function. The N-terminal domain of CcmM in the thermophile Thermosynechococcus elongatus BP-1 is also a catalytically active, redox regulated γ-CA. To experimentally determine if CcmM from a mesophilic cyanobacterium is active, we cloned, expressed and purified recombinant, full-length CcmM from Nostoc sp. PCC 7120 as well as the N-terminal 209 amino acid γ-CA-like domain. Both recombinant proteins displayed ethoxyzolamide-sensitive CA activity in mass spectrometric assays, as did the carboxysome-enriched TP fraction. NstCcmM209 was characterized as a moderately active and efficient γ-CA with a k cat of 2.0 × 10(4) s(-1) and k cat/K m of 4.1 × 10(6) M(-1) s(-1) at 25 °C and pH 8, a pH optimum between 8 and 9.5 and a temperature optimum spanning 25-35 °C. NstCcmM209 also catalyzed the hydrolysis of the CO2 analog carbonyl sulfide. Circular dichroism and intrinsic tryptophan fluorescence analysis demonstrated that NstCcmM209 was progressively and irreversibly denatured above 50 °C. NstCcmM209 activity was inhibited by the reducing agent tris(hydroxymethyl)phosphine, an effect that was fully reversed by a molar excess of diamide, a thiol oxidizing agent, consistent with oxidative activation being a universal regulatory mechanism of CcmM orthologs. Immunogold electron microscopy and Western blot analysis of TP pellets indicated that Rubisco and CcmM co-localize and are concentrated in Nostoc sp. PCC 7120 carboxysomes.

  16. Effects of radio frequency and high pressure steam sterilisation on the colour and flavour of prepared Nostoc sphaeroides.

    Science.gov (United States)

    Xu, Jicheng; Zhang, Min; An, Yanjun; Roknul, Azam Sm; Adhikari, Benu

    2018-03-01

    Nostoc sphaeroides has been used as a highly effective herbal medicine and dietary supplement for thousands of years. The desired dark green colour of fresh N. sphaeroides is converted into an undesirable dark brown during conventional high pressure (HP) steam sterilisation. Radio frequency (RF) sterilisation technology was used in this study to determine its effectiveness in sterilising N. sphaeroides and to achieve better preservation of natural colour and desirable flavour. Sterilisation was carried out using a 6 kW, 27 MHz RF instrument for 10, 20 and 30 min. The degree of microbial kill and the effects of RF sterilisation on colour and flavour were determined and compared with those obtained from HP steam (121 °C, 30 min) sterilisation. The effects of RF sterilisation on colour and flavour (measured using electronic nose) parameters were significantly lower than that in HP steam sterilisation. The RF sterilisation carried out for 20 min achieved logarithmic reduction of bacterial population and met China's national standard while preserving the colour and flavour better. Results of the present study indicated that application of RF sterilisation would improve the quality of sterilised N. sphaeroides and broaden its application in the food and health food industries. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  17. Evolution of the tRNALeu (UAA) Intron and Congruence of Genetic Markers in Lichen-Symbiotic Nostoc.

    Science.gov (United States)

    Kaasalainen, Ulla; Olsson, Sanna; Rikkinen, Jouko

    2015-01-01

    The group I intron interrupting the tRNALeu UAA gene (trnL) is present in most cyanobacterial genomes as well as in the plastids of many eukaryotic algae and all green plants. In lichen symbiotic Nostoc, the P6b stem-loop of trnL intron always involves one of two different repeat motifs, either Class I or Class II, both with unresolved evolutionary histories. Here we attempt to resolve the complex evolution of the two different trnL P6b region types. Our analysis indicates that the Class II repeat motif most likely appeared first and that independent and unidirectional shifts to the Class I motif have since taken place repeatedly. In addition, we compare our results with those obtained with other genetic markers and find strong evidence of recombination in the 16S rRNA gene, a marker widely used in phylogenetic studies on Bacteria. The congruence of the different genetic markers is successfully evaluated with the recently published software Saguaro, which has not previously been utilized in comparable studies.

  18. Quality evaluation of the edible blue-green alga Nostoc flagelliforme using a chlorophyll fluorescence parameter and several biochemical markers.

    Science.gov (United States)

    Gao, Xiang; Yang, Yiwen; Ai, Yufeng; Luo, Hongyi; Qiu, Baosheng

    2014-01-15

    Nostoc flagelliforme is an edible blue-green alga with herbal and dietary values. Due to the diminishing supply of natural N. flagelliforme and the large investment on the development of its cultivation technology, it is anticipated that artificially cultured N. flagelliforme will soon sustain the market supply. Once this change occurs, the storage-associated quality problem will become the focus of attention for future trade. In this paper, we used a chlorophyll fluorescence parameter, maximum quantum efficiency of Photosystem II (Fv/Fm), and several biomarkers to evaluate the quality of several N. flagelliforme samples. It was found that longer storage times resulted in darker coloured solutions (released pigments) and decreased amounts of chlorophyll a (Chl a) and water-soluble sugars (WSS). Additionally, a higher Fv/Fm value suggests better physiological recovery and quality. In actual application, determination of Fv/Fm would be the first step for evaluating the quality of N. flagelliforme, and the biochemical indexes would serve as good secondary markers. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. Control of light-dependent keto carotenoid biosynthesis in Nostoc 7120 by the transcription factor NtcA.

    Science.gov (United States)

    Sandmann, Gerhard; Mautz, Jürgen; Breitenbach, Jürgen

    2016-09-01

    In Nostoc PCC 7120, two different ketolases, CrtW and CrtO are involved in the formation of keto carotenoids from β-carotene. In contrast to other cyanobacteria, CrtW catalyzes the formation of monoketo echinenone whereas CrtO is the only enzyme for the synthesis of diketo canthaxanthin. This is the major photo protective carotenoid in this cyanobacterium. Under high-light conditions, basic canthaxanthin formation was transcriptionally up-regulated. Upon transfer to high light, the transcript levels of all investigated carotenogenic genes including those coding for phytoene synthase, phytoene desaturase and both ketolases were increased. These transcription changes proceeded via binding of the transcription factor NtcA to the promoter regions of the carotenogenic genes. The binding was absolutely dependent on the presence of reductants and oxo-glutarate. Light-stimulated transcript formation was inhibited by DCMU. Therefore, photosynthetic electron transport is proposed as the sensor for high-light and a changing redox state as a signal for NtcA binding.

  20. The effects of the exopolysaccharide and growth rate on the morphogenesis of the terrestrial filamentous cyanobacterium Nostoc flagelliforme

    Directory of Open Access Journals (Sweden)

    Lijuan Cui

    2017-09-01

    Full Text Available The terrestrial cyanobacterium Nostoc flagelliforme, which contributes to carbon and nitrogen supplies in arid and semi-arid regions, adopts a filamentous colony form. Owing to its herbal and dietary values, this species has been overexploited. Largely due to the lack of understanding on its morphogenesis, artificial cultivation has not been achieved. Additionally, it may serve as a useful model for recognizing the morphological adaptation of colonial cyanobacteria in terrestrial niches. However, it shows very slow growth in native habitats and is easily disintegrated under laboratory conditions. Thus, a novel experimental system is necessary to explore its morphogenetic mechanism. Liquid-cultured N. flagelliforme has been well developed for exopolysaccharide (EPS production, in which microscopic colonies (micro-colonies are generally formed. In this study, we sought to gain some insight into the morphogenesis of N. flagelliforme by examining the effects of two external factors, the EPS and environmental stress-related growth rate, on the morphological shaping of micro-colonies. Our findings indicate that the EPS matrix could act as a basal barrier, leading to the bending of trichomes during their elongation, while very slow growth is conducive to their straight elongation. These findings will guide future cultivation and application of this cyanobacterium for ecological improvement.

  1. Effect of Light Intensity and Photoperiod on Growth and Biochemical Composition of a Local Isolate of Nostoc calcicola.

    Science.gov (United States)

    Khajepour, Fateme; Hosseini, Seyed Abbas; Ghorbani Nasrabadi, Rasoul; Markou, Giorgos

    2015-08-01

    A study was conducted to investigate the effect of light intensity (21, 42, and 63 μmol photons m(-2) s(-1)) and photoperiod (8:16, 12:12, and 16:8 h light/dark) on the biomass production and its biochemical composition (total carotenoids, chlorophyll a, phycoerythrin (PE), phycocyanin (PC) and allophycocyanin (APC), total protein, and carbohydrates) of a local isolate of Nostoc calcicola. The results revealed that N. calcicola prefers dim light; however, the most of the levels of light intensity and photoperiod investigated did not have a significant impact on biomass production. Increasing light intensity biomass content of chlorophyll a, PE, PC, APC, and total protein decreased, while total carotenoids and carbohydrate increased. The same behavior was observed also when light duration (photoperiod) increased. The interaction effect of increasing light intensity and photoperiod resulted in an increase of carbohydrate and total carotenoids, and to the decrease of chlorophyll a, PE, PC, APC, and total protein content. The results indicate that varying the light regime, it is capable to manipulate the biochemical composition of the local isolate of N. calcicola, producing either valuable phycobiliproteins or proteins under low light intensity and shorter photoperiods, or producing carbohydrates and carotenoids under higher light intensities and longer photoperiods.

  2. Evolution of the tRNALeu (UAA Intron and Congruence of Genetic Markers in Lichen-Symbiotic Nostoc.

    Directory of Open Access Journals (Sweden)

    Ulla Kaasalainen

    Full Text Available The group I intron interrupting the tRNALeu UAA gene (trnL is present in most cyanobacterial genomes as well as in the plastids of many eukaryotic algae and all green plants. In lichen symbiotic Nostoc, the P6b stem-loop of trnL intron always involves one of two different repeat motifs, either Class I or Class II, both with unresolved evolutionary histories. Here we attempt to resolve the complex evolution of the two different trnL P6b region types. Our analysis indicates that the Class II repeat motif most likely appeared first and that independent and unidirectional shifts to the Class I motif have since taken place repeatedly. In addition, we compare our results with those obtained with other genetic markers and find strong evidence of recombination in the 16S rRNA gene, a marker widely used in phylogenetic studies on Bacteria. The congruence of the different genetic markers is successfully evaluated with the recently published software Saguaro, which has not previously been utilized in comparable studies.

  3. Hydrogen production and metal-dye bioremoval by a Nostoc linckia strain isolated from textile mill oxidation pond.

    Science.gov (United States)

    Mona, Sharma; Kaushik, Anubha; Kaushik, C P

    2011-02-01

    Biohydrogen production by Nostoc linckia HA-46, isolated from a textile-industry oxidation-pond was studied by varying light/dark period, pH, temperature and ratio of carbon-dioxide and argon in the gas-mixture. Hydrogen production rates were maximum under 18 h of light and 6 h of darkness, pH 8.0, 31°C, a CO(2):Ar ratio 2:10. Hydrogen production of the strain acclimatized to 20 mg/L of chromium/cobalt and 100 mg/L of Reactive red 198/crystal violet dye studied in N-supplemented/deficient medium was 6-10% higher in the presence of 1.5 g/L of NaNO(3). Rates of hydrogen production in the presence of dyes/metals by the strain (93-105 μmol/h/mg Chlorophyll) were significantly higher than in medium without metals/dyes serving as control (91.3 μmol/h/mg Chlorophyll). About 58-60% of the two metals and 35-73% of dyes were removed by cyanobacterium. Optimal conditions of temperature, pH and metals/dyes concentration for achieving high hydrogen production and wastewater treatment were found practically applicable as similar conditions are found in the effluent of regional textile-mills. Copyright © 2010 Elsevier Ltd. All rights reserved.

  4. Isolation and Purification of C-phycocyanin from Nostoc muscorum (Cyanophyceae and Cyanobacteria Exhibits Antimalarial Activity In vitro

    Directory of Open Access Journals (Sweden)

    Sukla Biswas

    2010-10-01

    Full Text Available The Phycobilin pigments are intensively fluorescent and water soluble. They are categorized into three types, such as pigments containing high, intermediate and low energies are Phycoerythrins (Phycoerythrocyanins, Phycocyanins and Allophycocyanins, respectively. Besides light harvesting, the Phycobiliproteins have shown industrial and biomedical importance. Among them, C-phycocyanin (C-PC has been considered to be the most preferred one. The present study was undertaken to evaluate the antimalarial activity of C-PC isolated from a Nitrogen-fixing Cyanobacterium and Nostoc muscorum. C- PC was extracted and purified by acetone extraction and ammonium sulfate precipitation and dialysis followed by amicon filtration. It was isolated as a~124 kDa water soluble protein molecule. It showed antimalarial activity in vitro against Chloroquine sensitive and resistant Plasmodium falciparum strains. Inhibitory concentrations at 50%, 90% and 95% were determined as 10.27±2.79, 53.53±6.26 and 73.78±6.92 µg/ml against the Chloroquine-sensitive strains; 10.37±1.43, 56.99±11.07 and 72.79±8.59 µg/ml against Chloroquine resistant of Plasmodium falciparum strains. C-PC was found to have antimalarial activity even at a concentration of 3.0 µg/ml. The possible mechanism might be relied on the destruction of polymerization of Haemozoin by binding of C-PC with Ferriprotoporphyrin-IX at the water surface of the plasma membrane.

  5. Differential physiological and biochemical responses of two cyanobacteria Nostoc muscorum and Phormidium foveolarum against oxyfluorfen and UV-B radiation.

    Science.gov (United States)

    Sheeba; Pratap Singh, Vijay; Kumar Srivastava, Prabhat; Mohan Prasad, Sheo

    2011-10-01

    In the present study, degree of tolerance and tolerance strategies of two paddy field cyanobacteria viz. Nostoc muscorum and Phormidium foveolarum against oxyfluorfen (10 and 20 μg ml(-1)) and UV-B (7.2 kJ m(-2)d(-1)) stress were investigated. Oxyfluorfen and UV-B decreased growth, photosynthesis, nutrient uptake, nitrate reductase, acid and alkaline phosphatase activities, which accompanied with the increase in the level of oxidative stress. However, growth was more affected in N. muscorum than P. foveolarum. Antioxidants exhibited differential responses against oxyfluorfen and UV-B stress. Ascorbate and proline levels were higher in P. foveolarum. A protein of 66 kDa was expressed in N. muscorum, however, it was absent in P. foveolarum than those of N. muscorum. Besides this, a protein of 29 kDa appeared in P. foveolarum under all the treatments, but it was present only in control cells of N. muscorum cells. Overall results indicated resistant nature of P. foveolarum against oxyfluorfen and UV-B stress in comparison to N. muscorum. Copyright © 2011 Elsevier Inc. All rights reserved.

  6. New Insight into the Cleavage Reaction of Nostoc sp. Strain PCC 7120 Carotenoid Cleavage Dioxygenase in Natural and Nonnatural Carotenoids

    Science.gov (United States)

    Heo, Jinsol; Kim, Se Hyeuk

    2013-01-01

    Carotenoid cleavage dioxygenases (CCDs) are enzymes that catalyze the oxidative cleavage of carotenoids at a specific double bond to generate apocarotenoids. In this study, we investigated the activity and substrate preferences of NSC3, a CCD of Nostoc sp. strain PCC 7120, in vivo and in vitro using natural and nonnatural carotenoid structures. NSC3 cleaved β-apo-8′-carotenal at 3 positions, C-13C-14, C-15C-15′, and C-13′C-14′, revealing a unique cleavage pattern. NSC3 cleaves the natural structure of carotenoids 4,4′-diaponeurosporene, 4,4′-diaponeurosporen-4′-al, 4,4′-diaponeurosporen-4′-oic acid, 4,4′-diapotorulene, and 4,4′-diapotorulen-4′-al to generate novel cleavage products (apo-14′-diaponeurosporenal, apo-13′-diaponeurosporenal, apo-10′-diaponeurosporenal, apo-14′-diapotorulenal, and apo-10′-diapotorulenal, respectively). The study of carotenoids with natural or nonnatural structures produced by using synthetic modules could provide information valuable for understanding the cleavage reactions or substrate preferences of other CCDs in vivo and in vitro. PMID:23524669

  7. Effects of UV-B Radiation and Periodic Desiccation on the Morphogenesis of the Edible Terrestrial Cyanobacterium Nostoc flagelliforme

    Science.gov (United States)

    Feng, Yan-Na; Zhang, Zhong-Chun; Feng, Jun-Li

    2012-01-01

    The terrestrial cyanobacterium Nostoc flagelliforme Berk. et M. A. Curtis has been a popular food and herbal ingredient for hundreds of years. To meet great market demand and protect the local ecosystem, for decades researchers have tried to cultivate N. flagelliforme but have failed to get macroscopic filamentous thalli. In this study, single trichomes with 50 to 200 vegetative cells were induced from free-living cells by low light and used to investigate the morphogenesis of N. flagelliforme under low UV-B radiation and periodic desiccation. Low-fluence-rate UV-B (0.1 W m−2) did not inhibit trichome growth; however, it significantly increased the synthesis of extracellular polysaccharides and mycosporine-like amino acids and promoted sheath formation outside the trichomes. Under low UV-B radiation, single trichomes developed into filamentous thalli more than 1 cm long after 28 days of cultivation, most of which grew separately in liquid BG11 medium. With periodic desiccation treatment, the single trichomes formed flat or banded thalli that grew up to 2 cm long after 3 months on solid BG11 medium. When trichomes were cultivated on solid BG11 medium with alternate treatments of low UV-B and periodic desiccation, dark and scraggly filamentous thalli that grew up to about 3 cm in length after 40 days were obtained. In addition, the cultivation of trichomes on nitrogen-deficient solid BG11 medium (BG110) suggested that nitrogen availability could affect the color and lubricity of newly developed thalli. This study provides promising techniques for artificial cultivation of N. flagelliforme in the future. PMID:22865081

  8. The response of antioxidant systems in Nostoc sphaeroides against UV-B radiation and the protective effects of exogenous antioxidants

    Science.gov (United States)

    Wang, Gaohong; Hu, Chunxiang; Li, Dunhai; Zhang, Delu; Li, Xiaoyan; Chen, Kun; Liu, Yongding

    UV radiation is one of many harmful factors found in space that are detrimental to organisms on earth in space exploration. In the present work, we examined the role of antioxidant system in Nostoc sphaeroides Kütz (Cyanobacterium) and the effects of exogenously applied antioxidant molecules on its photosynthetic rate under UV-B radiation. It was found that UV-B radiation promoted the activity of antioxidant system to protect photosystem II (PSII) and exogenously applied antioxidant: sodium nitroprusside (SNP) and N-acetylcysteine (NAC) had an obvious protection on PSII activity under UV-B radiation. The activity of superoxide dismutase (SOD, EC 1.15.1.1), catalase (CAT, EC 1.11.1.6), peroxidase (POD, EC 1.11.1.7) and content of MDA (malondialdehyde) and ASC (ascorbate) were improved by 0.5 mM and 1 mM SNP, but 0.1 mM SNP decreased the activity of antioxidant system. Addition of exogenous NAC decreased the activity of SOD, POD, CAT and the content MDA and ASC. In contrast, exogenously applied NAC increased GSH content. The results suggest that exogenous SNP and NAC may protect algae by different mechanisms: SNP may play double roles as both sources of reactive free radicals as well as ROS scavengers in mediating the protective role of PSII on algae under UV-B radiation. On the other hand, NAC functions as an antioxidant or precursor of glutathione, which could protect PSII directly from UV-B radiation.

  9. Higher production of C-phycocyanin by nitrogen-free (diazotrophic) cultivation of Nostoc sp. NK and simplified extraction by dark-cold shock.

    Science.gov (United States)

    Lee, Na Kyeong; Oh, Hee-Mock; Kim, Hee-Sik; Ahn, Chi-Yong

    2017-03-01

    Nostoc sp. NK (KCTC 12772BP) was isolated and cultivated in a BG11 medium and a nitrate-free BG11 medium (BG11 0 ). To enhance C-phycocyanin (C-PC) content in the cells, different fluorescent lamps (white, plant, and red) were used as light sources for complementary chromatic adaptation (CCA). The maximum biomass productivity was 0.42g/L/d and 0.32g/L/d under BG11 and BG11 0 conditions, respectively. The maximum C-PC contents were 8.4% (w/w) under white lamps, 13.6% (w/w) under plant lamps, and 18% (w/w) under BG11 0 and the red light condition. The maximum C-PC productivity was 57.4mg/L/d in BG11 0 under the red lamp condition. These results indicate that a higher C-PC content could be obtained under a diazotrophic condition and a CCA reaction. The C-PC could be released naturally from cells without any extraction processes, when Nostoc sp. NK was cultivated in the BG11 0 medium with CO 2 aeration and put in dark conditions at 5°C. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Comparison of bacterial community structures of terrestrial cyanobacterium Nostoc flagelliforme in three different regions of China using PCR-DGGE analysis.

    Science.gov (United States)

    Han, Pei-pei; Shen, Shi-gang; Jia, Shi-ru; Wang, Hui-yan; Zhong, Cheng; Tan, Zhi-lei; Lv, He-xin

    2015-07-01

    Filamentous Nostoc flagelliforme form colloidal complex, with beaded cells interacting with other bacteria embedded in the complex multilayer sheath. However, the species of bacteria in the sheath and the interaction between N. flagelliforme and associated bacteria remain unclear. In this study, PCR-denaturing gradient gel electrophoresis (DGGE) was used to investigate the bacterial communities of N. flagelliforme from three regions of China. DGGE patterns showed variations in all samples, exhibiting 25 discrete bands with various intensities. The diversity index analysis of bands profiles suggested the high similarity of bacterial communities to each other but also the dependence of microbial composition on each location. Phylogenetic affiliation indicated that the majority of the sequences obtained were affiliated with Actinobacteria, Cyanobacteria, Proteobacteria, Acidobacteria, Bacteroidetes, of which Cyanobacteria was dominant, followed the Proteobacteria. Members of the genus Nostoc were the most abundant in all samples. Rhizobiales and Actinobacteria were identified, whereas, Craurococcus, Caulobacter, Pseudomonas, Terriglobus and Mucilaginibacter were also identified at low levels. Through comparing the bacterial composition of N. flagelliforme from different regions, it was revealed that N. flagelliforme could facilitate the growth of other microorganisms including both autotrophic bacteria and heterotrophic ones and positively contributed to their harsh ecosystems. The results indicated N. flagelliforme played an important role in diversifying the microbial community composition and had potential application in soil desertification.

  11. Growth kinetic and fuel quality parameters as selective criterion for screening biodiesel producing cyanobacterial strains.

    Science.gov (United States)

    Gayathri, Manickam; Shunmugam, Sumathy; Mugasundari, Arumugam Vanmathi; Rahman, Pattanathu K S M; Muralitharan, Gangatharan

    2018-01-01

    The efficiency of cyanobacterial strains as biodiesel feedstock varies with the dwelling habitat. Fourteen indigenous heterocystous cyanobacterial strains from rice field ecosystem were screened based on growth kinetic and fuel parameters. The highest biomass productivity was obtained in Nostoc punctiforme MBDU 621 (19.22mg/L/day) followed by Calothrix sp. MBDU 701 (13.43mg/L/day). While lipid productivity and lipid content was highest in Nostoc spongiaeforme MBDU 704 (4.45mg/L/day and 22.5%dwt) followed by Calothrix sp. MBDU 701 (1.54mg/L/day and 10.75%dwt). Among the tested strains, Nostoc spongiaeforme MBDU 704 and Nostoc punctiforme MBDU 621 were selected as promising strains for good quality biodiesel production by Preference Ranking Organization Method for Enrichment Evaluation (PROMETHEE) and Graphical Analysis for Interactive Assistance (GAIA) analysis. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Development of a low-cost oxy-hydrogen bio-fuel cell for generation of electricity using Nostoc as a source of hydrogen

    Energy Technology Data Exchange (ETDEWEB)

    Sangeeta Dawar; Behera, B.K. [Maharshi Dayanand University, Rohtak (India). Dept. of Biosciences; Prasanna Mohanty [Jawaharlal Nehru University, New Delhi (India). School of Life Sciences

    1998-10-10

    An oxy-hydrogen bio-fuel cell, based on a carbon-carbon electrode has been fabricated. The electrode pellets were prepared by taking carbon powder mixed with polyvinylalcohol as a binder. The anode was charged with Co-Al spinel mixed oxide at 700{sup o}C, 30% KOH acted as an electrolyte. For the cyanobacterial bioreactor, a potential heterocystous blue green alga of Nostoc spp. has been used for hydrogen production and electrical energy generation. Various nutrient enrichment techniques are employed to increase the hydrogen generation efficiency of the algae. One litre free cell algal reactor attached to the fuel cell, at the anode end for hydrogen gas input, generated about 300 mV of voltage and 100 mA of current. Our present findings on the development of a low cost fuel cell with high efficiency of current output may be helpful in commercializing this technology. (author)

  13. Retinal is formed from apo-carotenoids in Nostoc sp. PCC7120: in vitro characterization of an apo-carotenoid oxygenase

    Science.gov (United States)

    Scherzinger, Daniel; Ruch, Sandra; Kloer, Daniel P.; Wilde, Annegret; Al-Babili, Salim

    2006-01-01

    The sensory rhodopsin from Anabaena (Nostoc) sp. PCC7120 is the first cyanobacterial retinylidene protein identified. Here, we report on NosACO (Nostoc apo-carotenoid oxygenase), encoded by the ORF (open reading frame) all4284, as the candidate responsible for the formation of the required chromophore, retinal. In contrast with the enzymes from animals, NosACO converts β-apo-carotenals instead of β-carotene into retinal in vitro. The identity of the enzymatic products was proven by HPLC and gas chromatography–MS. NosACO exhibits a wide substrate specificity with respect to chain lengths and functional end-groups, converting β-apo-carotenals, (3R)-3-hydroxy-β-apo-carotenals and the corresponding alcohols into retinal and (3R)-3-hydroxyretinal respectively. However, kinetic analyses revealed very divergent Km and Vmax values. On the basis of the crystal structure of SynACO (Synechocystis sp. PCC6803 apo-carotenoid oxygenase), a related enzyme showing similar enzymatic activity, we designed a homology model of the native NosACO. The deduced structure explains the absence of β-carotene-cleavage activity and indicates that NosACO is a monotopic membrane protein. Accordingly, NosACO could be readily reconstituted into liposomes. To localize SynACO in vivo, a Synechocystis knock-out strain was generated expressing SynACO as the sole carotenoid oxygenase. Western-blot analyses showed that the main portion of SynACO occurred in a membrane-bound form. PMID:16759173

  14. Impacts of diurnal variation of ultraviolet-B and photosynthetically active radiation on phycobiliproteins of the hot-spring cyanobacterium Nostoc sp. strain HKAR-2.

    Science.gov (United States)

    Kannaujiya, Vinod K; Sinha, Rajeshwar P

    2017-01-01

    The effects of diurnal variation of photosynthetically active radiation (PAR; 400-700 nm) and ultraviolet-B (UV-B; 280-315 nm) radiation on phycobiliproteins (PBPs) and photosynthetic pigments (PP) have been studied in the hot-spring cyanobacterium Nostoc sp. strain HKAR-2. The variations in PBPs and PP were monitored by alternating light and dark under PAR, UV-B, and PAR + UV-B radiations over a period of 25 h. There was a decline in the amount of Chl a and PBPs during light periods of UV-B and PAR + UV-B and an increase during dark periods showing a circadian rhythm by destruction and resynthesis of pigment-protein complex. However, a marked induction in carotenoids was recorded during light periods of the same radiations. Moreover, the ratio of Chl a/PE and Chl a/PC was increased in dark periods showing the resynthesis of bleached Chl a. The wavelength shift in emission fluorescence of PBPs toward shorter wavelengths further indicated the bleaching and destruction of PBPs during light periods. Oxidative damage upon exposure to PAR, UV-B, and PAR + UV-B was alleviated by induction of antioxidative enzymes such as superoxide dismutase (SOD), catalase (CAT), and ascorbate peroxidase (APX). The studied cyanobacterium exhibits a significant increase in the activities of SOD, CAT, and APX upon exposure to UV-B and PAR + UV-B radiations. The results indicate that pigment-protein composition of Nostoc sp. stain HKAR-2 was significantly altered during diurnal variation of light/radiation, which might play an important role in optimization for their productivity in a particular cyanobacterium.

  15. Single-cell confocal spectrometry of a filamentous cyanobacterium Nostoc at room and cryogenic temperature. Diversity and differentiation of pigment systems in 311 cells.

    Science.gov (United States)

    Sugiura, Kana; Itoh, Shigeru

    2012-08-01

    The fluorescence spectrum at 298 and 40 K and the absorption spectrum at 298 K of each cell of the filamentous cyanobacterium Nostoc sp. was measured by single-cell confocal laser spectroscopy to study the differentiation of cell pigments. The fluorescence spectra of vegetative (veg) and heterocyst (het) cells of Nostoc formed separate groups with low and high PSII to PSI ratios, respectively. The fluorescence spectra of het cells at 40 K still contained typical PSII bands. The PSII/PSI ratio estimated for the veg cells varied between 0.4 and 1.2, while that of het cells varied between 0 and 0.22 even in the same culture. The PSII/PSI ratios of veg cells resembled each other more closely in the same filament. 'pro-het' cells, which started to differentiate into het cells, were identified from the small but specific difference in the PSII/PSI ratio. The allophycocyanin (APC)/PSII ratio was almost constant in both veg and het cells, indicating their tight couplings. Phycocyanin (PC) showed higher fluorescence in most het cells, suggesting the uncoupling from PSII. Veg cells seem to vary their PSI contents to give different PSII/PSI ratios even in the same culture, and to suppress the synthesis of PSII, APC and PC to differentiate into het cells. APC and PC are gradually liberated from membranes in het cells with the uncoupling from PSII. Single-cell spectrometry will be useful to study the differentiation of intrinsic pigments of cells and chloroplasts, and to select microbes from natural environments.

  16. Crescimento mixotrófico de Nostoc sp. Glucose, sacarose e melaço de cana-de-açúcar foram testados como substratos para produção de biomassa e ficobiliproteinas - DOI: 10.4025/actascibiolsci.v29i1.121 Mixotrophic growth of Nostoc sp. on glucose, sucrose and sugarcane molasses for phycobiliprotein production

    Directory of Open Access Journals (Sweden)

    Maria Helena Pimenta Pinotti

    2007-11-01

    Full Text Available Todos os substratos aumentaram a biomassa e ficobiliproteinas em relação ao controle, meio mineral BG11. Melaço de cana-de-açúcar foi o melhor substrato tanto para a produção de biomassa como de ficobiliproteinas. A maior produção de biomassa ocorreu usando melaço de cana-de-açúcar 1,0 g L-1 sendo 5,7 vezes maior que o controle. Com glucose foi em 2,5 g L-1 e sacarose 1,5 g L-1, sendo 2,5 e 4,8 vezes maior que o controle, respectivamente. A maior produção de ficobiliproteinas ocorreu usando melaço de cana-de-açúcar 1,0 g L-1 sendo 12,5 vezes maior que o controle. Com glucose foi em 1,0 g L-1 e sacarose 0,5 g L-1, 3,0 e 4,5 vezes maior que o controle, respectivamente. Nostoc sp. testado pode crescer mixotroficamente, usando glucose, sacarose e melaço de cana-deaçúcar como substratos orgânicos, uma maior produção de biomassa e ficobiliproteinas podendo ser alcançada nessas condições quando comparadas com o crescimento autotrófico.Glucose, sacarose, and sugarcane molasses were tested as substrates for production of biomass and phycobiliproteins by Nostoc sp., varying their concentrations in relation to a mineral medium, BG11. All substrates increased the biomass and phycobiliproteins when compared with the control. Sugarcane molasses showed to be the best substrate for production of both biomass and phycobiliproteins. Greater biomass production occurred in sugarcane molasses 1.0 g L-1 and it was 5.7 times greater than the control. With glucose, it was in 2.5 g L-1 and sucrose, in 1.5 g L-1, reaching 2.5 and 4.8 times greater than the control, respectively. For phycobiliproteins, the major production was in sugarcane molasses 1.0 g L-1, 12.5 times greater than the control. With glucose, it was in 1.0 g L-1 and sucrose, in 0,5 g L-1, reaching 3.0 and 4.5 times greater than the control, respectively. The Nostoc sp. assayed can grow mixotrophically, using glucose, sucrose, and sugarcane molasses as organic substrates, and a

  17. Mixotrophic growth of Nostoc sp. on glucose, sucrose and sugarcane molasses for phycobiliprotein production = Crescimento mixotrófico de Nostoc sp. Glucose, sacarose e melaço de cana-de-açúcar foram testados como substratos para produção de biomassa e ficobiliproteinas

    Directory of Open Access Journals (Sweden)

    Maria Helena Pimenta Pinotti

    2007-01-01

    Full Text Available Glucose, sacarose, and sugarcane molasses were tested as substrates for production of biomass and phycobiliproteins by Nostoc sp., varying their concentrations in relation to a mineral medium, BG11. All substrates increased the biomass and phycobiliproteins when compared with the control. Sugarcane molasses showed to be thebest substrate for production of both biomass and phycobiliproteins. Greater biomass production occurred in sugarcane molasses 1.0 g L-1 and it was 5.7 times greater than the control. With glucose, it was in 2.5 g L-1 and sucrose, in 1.5 g L-1, reaching 2.5 and 4.8 timesgreater than the control, respectively. For phycobiliproteins, the major production was in sugarcane molasses 1.0 g L-1, 12.5 times greater than the control. With glucose, it was in 1.0 g L-1 and sucrose, in 0,5 g L-1, reaching 3.0 and 4.5 times greater than the control, respectively. The Nostoc sp. assayed can grow mixotrophically, using glucose, sucrose, and sugarcane molasses as organic substrates, and a greater production of biomass andphycobiliproteins can be reached when compared with the autotrophic growth.Todos os substratos aumentaram a biomassa e ficobiliproteinas emrelação ao controle, meio mineral BG11. Melaço de cana-de-açúcar foi o melhor substrato tanto para a produção de biomassa como de ficobiliproteinas. A maior produção de biomassa ocorreu usando melaço de cana-de-açúcar 1,0 g L-1 sendo 5,7 vezes maior que o controle. Com glucose foi em 2,5 g L-1 e sacarose 1,5 g L-1, sendo 2,5 e 4,8 vezes maior que o controle, respectivamente. A maior produção de ficobiliproteinas ocorreu usando melaço de cana-de-açúcar 1,0 g L-1 sendo 12,5 vezes maior que o controle. Com glucose foi em 1,0g L-1 e sacarose 0,5 g L-1, 3,0 e 4,5 vezes maior que o controle, respectivamente. Nostoc sp. testado pode crescer mixotroficamente, usando glucose, sacarose e melaço de cana-deaçúcar como substratos orgânicos, uma maior produção de biomassa e

  18. Hydrogen production by the engineered cyanobacterial strain Nostoc PCC 7120 ΔhupW examined in a flat panel photobioreactor system.

    Science.gov (United States)

    Nyberg, Marcus; Heidorn, Thorsten; Lindblad, Peter

    2015-12-10

    Nitrogenase based hydrogen production was examined in a ΔhupW strain of the filamentous heterocystous cyanobacterium Nostoc PCC 7120, i.e., cells lacking the last step in the maturation system of the large subunit of the uptake hydrogenase and as a consequence with a non-functional uptake hydrogenase. The cells were grown in a developed flat panel photobioreactor system with 3.0L culture volume either aerobically (air) or anaerobically (Ar or 80% N2/20% Ar) and illuminated with a mixture of red and white LED. Aerobic growth of the ΔhupW strain of Nostoc PCC 7120 at 44μmolar photons m(-2)s(-1) PAR gave the highest hydrogen production of 0.7mL H2 L(-1)h(-1), 0.53mmol H2 mg chlorophyll a(-1)h(-1), and a light energy conversion efficiency of 1.2%. Anaerobic growth using 100% argon showed a maximal hydrogen production of 1.7mLL(-1)h(-1), 0.85mmol per mg chlorophyll a(-1) h(-1), and a light energy conversion efficiency of 2.7%. Altering between argon/N2 (20/80) and 100% argon phases resulted in a maximal hydrogen production at hour 128 (100% argon phase) with 6.2mL H2L(-1)h(-1), 0.71mL H2 mg chlorophyll a(-1)h(-1), and a light energy efficiency conversion of 4.0%. The highest buildup of hydrogen gas observed was 6.89% H2 (100% argon phase) of the total photobioreactor system with a maximal production of 4.85mL H2 L(-1)h(-1). The present study clearly demonstrates the potential to use purpose design cyanobacteria in developed flat panel photobioreactor systems for the direct production of the solar fuel hydrogen. Further improvements in the strain used, environmental conditions employed, and growth, production and collection systems used, are needed before a sustainable and economical cyanobacterial based hydrogen production can be realized. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. A common transport system for methionine, L-methionine-DL-sulfoximine (MSX), and phosphinothricin (PPT) in the diazotrophic cyanobacterium Nostoc muscorum.

    Science.gov (United States)

    Singh, Arvind Kumar; Syiem, Mayashree B; Singh, Rajkumar S; Adhikari, Samrat; Rai, Amar Nath

    2008-05-01

    We present evidence, for the first time, of the occurrence of a transport system common for amino acid methionine, and methionine/glutamate analogues L-methionine-DL-sulfoximine (MSX) and phosphinothricin (PPT) in cyanobacterium Nostoc muscorum. Methionine, which is toxic to cyanobacterium, enhanced its nitrogenase activity at lower concentrations. The cyanobacterium showed a biphasic pattern of methionine uptake activity that was competitively inhibited by the amino acids alanine, isoleucine, leucine, phenylalanine, proline, valine, glutamine, and asparagine. The methionine/glutamate analogue-resistant N. muscorum strains (MSX-R and PPT-R strains) also showed methionine-resistant phenotype accompanied by a drastic decrease in 35S methionine uptake activity. Treatment of protein extracts from these mutant strains with MSX and PPT reduced biosynthetic glutamine synthetase (GS) activity only in vitro and not in vivo. This finding implicated that MSX- and PPT-R phenotypes may have arisen due to a defect in their MSX and PPT transport activity. The simultaneous decrease in methionine uptake activity and in vitro sensitivity toward MSX and PPT of GS protein in MSX- and PPT-R strains indicated that methionine, MSX, and PPT have a common transport system that is shared by other amino acids as well in N. muscorum. Such information can become useful for isolation of methionine-producing cyanobacterial strains.

  20. Complementary UV-Absorption of Mycosporine-like Amino Acids and Scytonemin is Responsible for the UV-Insensitivity of Photosynthesis in Nostoc flagelliforme

    Science.gov (United States)

    Ferroni, Lorenzo; Klisch, Manfred; Pancaldi, Simonetta; Häder, Donat-Peter

    2010-01-01

    Mycosporine-like amino acids (MAAs) and scytonemin are UV-screening compounds that have presumably appeared early in the history of life and are widespread in cyanobacteria. Natural colonies of the UV-insensitive Nostoc flagelliforme were found to be especially rich in MAAs (32.1 mg g DW−1), concentrated in the glycan sheath together with scytonemin. MAAs are present in the form of oligosaccharide-linked molecules. Photosystem II activity, measured using PAM fluorescence and oxygen evolution, was used as a most sensitive physiological parameter to analyse the effectiveness of UV-protection. Laboratory experiments were performed under controlled conditions with a simulated solar radiation specifically deprived of UV-wavebands with cut-off filters (295, 305, 320, 345 and 395 nm). The UV-insensitivity of N. flagelliforme was found to cover the whole UV-A (315–400 nm) and UV-B (280–320 nm) range and is almost certainly due to the complementary UV-absorption of MAAs and scytonemin. The experimental approach used is proposed to be suitable for the comparison of the UV-protection ability in organisms that differ in their complement of UV-sunscreen compounds. Furthermore, this study performed with a genuinely terrestrial organism points to the relevance of marine photoprotective compounds for life on Earth, especially for the colonization of terrestrial environments. PMID:20161974

  1. Complementary UV-Absorption of Mycosporine-like Amino Acids and Scytonemin is Responsible for the UV-Insensitivity of Photosynthesis in Nostoc flagelliforme

    Directory of Open Access Journals (Sweden)

    Donat-Peter Häder

    2010-01-01

    Full Text Available Mycosporine-like amino acids (MAAs and scytonemin are UV-screening compounds that have presumably appeared early in the history of life and are widespread in cyanobacteria. Natural colonies of the UV-insensitive Nostoc flagelliforme were found to be especially rich in MAAs (32.1 mg g DW-1, concentrated in the glycan sheath together with scytonemin. MAAs are present in the form of oligosaccharide-linked molecules. Photosystem II activity, measured using PAM fluorescence and oxygen evolution, was used as a most sensitive physiological parameter to analyse the effectiveness of UV-protection. Laboratory experiments were performed under controlled conditions with a simulated solar radiation specifically deprived of UV-wavebands with cut-off filters (295, 305, 320, 345 and 395 nm. The UV-insensitivity of N. flagelliforme was found to cover the whole UV-A (315–400 nm and UV-B (280–320 nm range and is almost certainly due to the complementary UV-absorption of MAAs and scytonemin. The experimental approach used is proposed to be suitable for the comparison of the UV-protection ability in organisms that differ in their complement of UV-sunscreen compounds. Furthermore, this study performed with a genuinely terrestrial organism points to the relevance of marine photoprotective compounds for life on Earth, especially for the colonization of terrestrial environments.

  2. Spectral and Temporal Properties of the Alpha and Beta Subunits and (alpha Beta) Monomer Isolated from Nostoc SP. Using Picosecond Laser Spectroscopy.

    Science.gov (United States)

    Dagen, Aaron J.

    1985-12-01

    The fluorescence decay profiles, relative quantum yield and transmission of the (alpha), (beta) and ((alpha)(beta)) complexes from phycoerythrin isolated from the photosynthetic antenna system of Nostoc sp. and measured by single picosecond laser spectroscopic techniques is studied. The fluorescence decay profiles of all three complexes are found to be intensity independent for the intensity range investigated ((TURN)4 x 10('13) to (TURN)4 x 10('15) photons-cm('-2) per pulse). The apparent decrease in the relative quantum yield of all three complexes as intensity increases is offset by a corresponding increase in the relative transmission. This evidence, along with the intensity independent fluorescence kinetics, suggests that exciton annihilation is absent in these complexes. The decay profiles are fit to models assuming energy transfer amongst fluorescing chromophores. The intraprotein transfer rate is found to be 100 ps in the (alpha) subunit, 666 ps in the (beta) subunit. Constraining these rates to be identical in the monomer results in explaining the monomer kinetics by an increase in the nonradiative rate of the f(,(beta)) chromophore, an apparent result of aggregation effects.

  3. Expression and characterization of a recombinant psychrophilic γ-carbonic anhydrase (NcoCA) identified in the genome of the Antarctic cyanobacteria belonging to the genus Nostoc.

    Science.gov (United States)

    De Luca, Viviana; Del Prete, Sonia; Vullo, Daniela; Carginale, Vincenzo; Di Fonzo, Pietro; Osman, Sameh M; AlOthman, Zeid; Supuran, Claudiu T; Capasso, Clemente

    2016-10-01

    Carbonic anhydrases (CAs, EC 4.2.1.1) catalyze the CO2 hydration/dehydration reversible reaction: CO2 + H2O ⇄ [Formula: see text] + H(+). Living organisms encode for at least six distinct genetic families of such catalyst, the α-, β-, γ-, δ-, ζ- and η-CAs. The main function of the CAs is to quickly process the CO2 derived by metabolic processes in order to regulate acid-base homeostasis, connected to the production of protons (H(+)) and bicarbonate. Few data are available in the literature on Antarctic CAs and most of the scientific information regards CAs isolated from mammals or prokaryotes (as well as other mesophilic sources). It is of great interest to study the biochemical behavior of such catalysts identified in organism living in the Antarctic sea where temperatures average -1.9 °C all year round. The enzymes isolated from Antarctic organisms represent a useful tool to study the relations among structure, stability and function of proteins in organisms adapted to living at constantly low temperatures. In the present paper, we report in detail the cloning, purification, and physico-chemical properties of NcoCA, a γ-CA isolated from the Antarctic cyanobacterium Nostoc commune. This enzyme showed a higher catalytic efficiency at lower temperatures compared to mesophilic counterparts belonging to α-, β-, γ-classes, as well as a limited stability at moderate temperatures.

  4. Determination of the toxicity level of the fluoropolymers production wastes by reaction of soil microflora and cyanobacteria Nostoc paludosum Kütz

    Directory of Open Access Journals (Sweden)

    Elkina Tatyana

    2014-03-01

    Full Text Available The environment is constantly receiving the substances that are artificially synthesized by human, hence, not inherent in nature, that are circulating in it. One of the most common wastes of fluoroelastomer SKF-26 production is the mother solution entering the environment together with the wastewater of chemical enterprises. Until now limits of allowable concentrations of these compounds have not been established, as they are considered practically safe. By determining the toxicity level of the waste of fluoropolymers production conducted by reaction of soil algae , cyanobacteria and micromycetes it was showed that the waste of fluorine rubber SKF-26 production are not safe or neutral for these groups of microorganisms. The toxicity of high concentrations of the mother solution SKF-26 was particularly evident in the damaging effects to the of the test organism Nostoc paludosum in aqueous medium. Field experiments confirmed that not only mother solutions, but also the possible products of their transformations are toxic. This fact clearly illustrates the change in the structure of mikocenoses where a progressive increase in populations with melanized mycelium takes place.

  5. The Pkn22 Ser/Thr kinase in Nostoc PCC 7120: role of FurA and NtcA regulators and transcript profiling under nitrogen starvation and oxidative stress.

    Science.gov (United States)

    Yingping, Fan; Lemeille, Sylvain; González, Andrés; Risoul, Véronique; Denis, Yann; Richaud, Pierre; Lamrabet, Otmane; Fillat, Maria F; Zhang, Cheng-Cai; Latifi, Amel

    2015-07-29

    The filamentous cyanobacterium Nostoc sp. strain PCC 7120 can fix N2 when combined nitrogen is not available. Furthermore, it has to cope with reactive oxygen species generated as byproducts of photosynthesis and respiration. We have previously demonstrated the synthesis of Ser/Thr kinase Pkn22 as an important survival response of Nostoc to oxidative damage. In this study we wished to investigate the possible involvement of this kinase in signalling peroxide stress and nitrogen deprivation. Quantitative RT-PCR experiments revealed that the pkn22 gene is induced in response to peroxide stress and to combined nitrogen starvation. Electrophoretic motility assays indicated that the pkn22 promoter is recognized by the global transcriptional regulators FurA and NtcA. Transcriptomic analysis comparing a pkn22-insertion mutant and the wild type strain indicated that this kinase regulates genes involved in important cellular functions such as photosynthesis, carbon metabolism and iron acquisition. Since metabolic changes may lead to oxidative stress, we investigated whether this is the case with nitrogen starvation. Our results rather invalidate this hypothesis thereby suggesting that the function of Pkn22 under nitrogen starvation is independent of its role in response to peroxide stress. Our analyses have permitted a more complete functional description of Ser/Thr kinase in Nostoc. We have decrypted the transcriptional regulation of the pkn22 gene, and analysed the whole set of genes under the control of this kinase in response to the two environmental changes often encountered by cyanobacteria in their natural habitat: oxidative stress and nitrogen deprivation.

  6. Differential sensitivity of five cyanobacterial strains to ammonium toxicity and its inhibitory mechanism on the photosynthesis of rice-field cyanobacterium Ge-Xian-Mi (Nostoc)

    International Nuclear Information System (INIS)

    Dai Guozheng; Deblois, Charles P.; Liu Shuwen; Juneau, Philippe; Qiu Baosheng

    2008-01-01

    Effects of two fertilizers, NH 4 Cl and KCl, on the growth of the edible cyanobacterium Ge-Xian-Mi (Nostoc) and four other cyanobacterial strains were compared at pH 8.3 ± 0.2 and 25 deg. C. Their growth was decreased by at least 65% at 10 mmol L -1 NH 4 Cl but no inhibitory effect was observed at the same level of KCl. Meanwhile, the strains exhibited a great variation of sensitivity to NH 4 + toxicity in the order: Ge-Xian-Mi > Anabaena azotica FACHB 118 > Microcystis aeruginosa FACHB 905 > M. aeruginosa FACHB 315 > Synechococcus FACHB 805. The 96-h EC 50 value for relative growth rate with regard to NH 4 + for Ge-Xian-Mi was 1.105 mmol L -1 , which was much less than the NH 4 + concentration in many agricultural soils (2-20 mmol L -1 ). This indicated that the use of ammonium as nitrogen fertilizer was responsible for the reduced resource of Ge-Xian-Mi in the paddy field. After 96 h exposure to 1 mmol L -1 NH 4 Cl, the photosynthetic rate, F v /F m value, saturating irradiance for photosynthesis and PSII activity of Ge-Xian-Mi colonies were remarkably decreased. The chlorophyll synthesis of Ge-Xian-Mi was more sensitive to NH 4 + toxicity than phycobiliproteins. Thus, the functional absorption cross section of Ge-Xian-Mi PSII was increased markedly at NH 4 Cl levels ≥1 mmol L -1 and the electron transport on the acceptor side of PSII was significantly accelerated by NH 4 Cl addition ≥3 mmol L -1 . Dark respiration of Ge-Xian-Mi was significantly increased by 246% and 384% at 5 and 10 mmol L -1 NH 4 Cl, respectively. The rapid fluorescence rise kinetics indicated that the oxygen-evolving complex of PSII was the inhibitory site of NH 4 +

  7. Cadmium uptake capacity of an indigenous cyanobacterial strain, Nostoc entophytum ISC32: new insight into metal uptake in microgravity-simulating conditions.

    Science.gov (United States)

    Alidoust, Leila; Soltani, Neda; Modiri, Sima; Haghighi, Omid; Azarivand, Aisan; Khajeh, Khosro; Shahbani Zahiri, Hossein; Vali, Hojatollah; Akbari Noghabi, Kambiz

    2016-02-01

    Among nine cyanobacterial strains isolated from oil-contaminated regions in southern Iran, an isolate with maximum cadmium uptake capacity was selected and identified on the basis of analysis of morphological criteria and 16S rRNA gene sequence similarity as Nostoc entophytum (with 99% similarity). The isolate was tentatively designated N. entophytum ISC32. The phylogenetic affiliation of the isolates was determined on the basis of their 16S rRNA gene sequence. The maximum amount of Cd(II) adsorbed by strain ISC32 was 302.91 mg g(-1) from an initial exposure to a solution with a Cd(II) concentration of 150 mg l(-1). The cadmium uptake by metabolically active cells of cyanobacterial strain N. entophytum ISC32, retained in a clinostat for 6 days to simulate microgravity conditions, was examined and compared with that of ground control samples. N. entophytum ISC32 under the influence of microgravity was able to take up cadmium at amounts up to 29% higher than those of controls. The activity of antioxidant enzymes including catalase and peroxidase was increased in strain ISC32 exposed to microgravity conditions in a clinostat for 6 days, as catalase activity of the cells was more than three times higher than that of controls. The activity of the peroxidase enzyme increased by 36% compared with that of the controls. Membrane lipid peroxidation was also increased in the cells retained under microgravity conditions, up to 2.89-fold higher than in non-treated cells. Images obtained using scanning electron microscopy showed that cyanobacterial cells form continuous filaments which are drawn at certain levels, while the cells placed in a clinostat appeared as round-shaped, accumulated together and distorted to some extent.

  8. Metabolic Adaptation, a Specialized Leaf Organ Structure and Vascular Responses to Diurnal N2 Fixation by Nostoc azollae Sustain the Astonishing Productivity of Azolla Ferns without Nitrogen Fertilizer.

    Science.gov (United States)

    Brouwer, Paul; Bräutigam, Andrea; Buijs, Valerie A; Tazelaar, Anne O E; van der Werf, Adrie; Schlüter, Urte; Reichart, Gert-Jan; Bolger, Anthony; Usadel, Björn; Weber, Andreas P M; Schluepmann, Henriette

    2017-01-01

    Sustainable agriculture demands reduced input of man-made nitrogen (N) fertilizer, yet N 2 fixation limits the productivity of crops with heterotrophic diazotrophic bacterial symbionts. We investigated floating ferns from the genus Azolla that host phototrophic diazotrophic Nostoc azollae in leaf pockets and belong to the fastest growing plants. Experimental production reported here demonstrated N-fertilizer independent production of nitrogen-rich biomass with an annual yield potential per ha of 1200 kg -1 N fixed and 35 t dry biomass. 15 N 2 fixation peaked at noon, reaching 0.4 mg N g -1 dry weight h -1 . Azolla ferns therefore merit consideration as protein crops in spite of the fact that little is known about the fern's physiology to enable domestication. To gain an understanding of their nitrogen physiology, analyses of fern diel transcript profiles under differing nitrogen fertilizer regimes were combined with microscopic observations. Results established that the ferns adapted to the phototrophic N 2 -fixing symbionts N. azollae by (1) adjusting metabolically to nightly absence of N supply using responses ancestral to ferns and seed plants; (2) developing a specialized xylem-rich vasculature surrounding the leaf-pocket organ; (3) responding to N-supply by controlling transcripts of genes mediating nutrient transport, allocation and vasculature development. Unlike other non-seed plants, the Azolla fern clock is shown to contain both the morning and evening loops; the evening loop is known to control rhythmic gene expression in the vasculature of seed plants and therefore may have evolved along with the vasculature in the ancestor of ferns and seed plants.

  9. NaCl-induced physiological and biochemical changes in two cyanobacteria Nostoc muscorum and Phormidium foveolarum acclimatized to different photosynthetically active radiation.

    Science.gov (United States)

    Kumar, Jitendra; Singh, Vijay Pratap; Prasad, Sheo Mohan

    2015-10-01

    The present study is aimed at investigating physiological and biochemical behavior of two cyanobacteria Nostoc muscorum and Phormidium foveolarum acclimatized to different levels (sub-optimum; 25 ± 0.5, optimum; 75 ± 2.5 and supra-optimum; 225 ± 3.5 μmol photons m(-2) s(-1)) of photosynthetic active radiation (PAR), and subsequently treated with two doses (30 and 90 mM) of NaCl. PAR influences growth in tested cyanobacteria being maximum in supra-optimum PAR acclimatized cells. NaCl-induced maximum percent decline in growth was observed in sub-optimum PAR acclimatized cells, which was in consonance with a decrease in chlorophyll content. Sub-optimum PAR acclimatization stimulated phycocyanin content in control cells, whereas maximum carotenoids content was observed in supra-optimum PAR acclimatized cells. Photosystem II photochemistry viz. Fv/F0, Fv/Fm, Ψ0, ϕE0, PIABS, ABS/RC, TR0/RC, ET0/RC and DI0/RC was also influenced by PAR and NaCl. Maximum percent rise in superoxide radical (SOR), hydrogen peroxide (H2O2) and lipid peroxidation was observed in sub-optimum PAR acclimatized cells exposed to NaCl, which could be correlated with lower values of enzymatic (superoxide dismutase, catalase, peroxidase and glutathione-S-transferase) and non-enzymatic (NP-SH and cysteine) antioxidants. In supra-optimum PAR acclimatized cells level of oxidative stress markers was in parallel with enhanced antioxidants. The results suggest that PAR significantly changes physiological and biochemical responses of studied cyanobacteria under NaCl stress. Besides this, this study also shows that P. foveolarum is more tolerant than N. muscorum under test conditions. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Viability of dried filaments, survivability and reproduction under water stress, and survivability following heat and UV exposure in Lyngbya martensiana, Oscillatoria agardhii, Nostoc calcicola, Hormidium fluitans, Spirogyra sp. and Vaucheria geminata

    International Nuclear Information System (INIS)

    Agrawal, S.C.; Singh, V.

    2002-01-01

    The aim of our study was to determine how long and to what extent Lyngbya martensiana, Oscillatoria agardhii, Nostoc calcicola, Hormidium fluitans and Vaucheria geminata tolerate dry storage at different temperatures, UV-light radiation and water stress imposed by growing them on media with a high agar content and/or in NaCl-containing liquid media. Dried vegetative filaments of Spirogyra sp., Vaucheria geminata and Nostoc calcicola died within 0,5, 1 and 4 h, respectively; those of Hormidium fluitans, Oscillatoria agardhii and Lyngbya martensiana retained viability for 3, 5 and 10 d, respectively. L. martensiana and O. agardhii tolerated 0.8 mol/L NaCl. The resistance to desiccation in L. martensiana and O. agardhii exhibited similar dependence as that to frost, to heat and UV light. The water stress imposed on growing algae either on high-agar solid media or in NaCl-containing liquid media reduced hormogonium formation in L. martensiana and O. agardhii; hetero-cyst and akinete formation in N. calcicola and fragmentation in H. fluitans. In all studied algae the stress reduced at various levels the survival of vegetative parts. Generally, algal body form and composition rather than habitats seem to decide primarily the level of resistance against various stress conditions

  11. Unravelling the cross-talk between iron starvation and oxidative stress responses highlights the key role of PerR (alr0957) in peroxide signalling in the cyanobacterium Nostoc PCC 7120.

    Science.gov (United States)

    Yingping, Fan; Lemeille, Sylvain; Talla, Emmanuel; Janicki, Annick; Denis, Yann; Zhang, Cheng-Cai; Latifi, Amel

    2014-10-01

    The cyanobacterial phylum includes oxygenic photosynthetic prokaryotes of a wide variety of morphologies, metabolisms and ecologies. Their adaptation to their various ecological niches is mainly achieved by sophisticated regulatory mechanisms and depends on a fine cross-talk between them. We assessed the global transcriptomic response of the filamentous cyanobacterium Nostoc PCC 7120 to iron starvation and oxidative stress. More than 20% of the differentially expressed genes in response to iron stress were also responsive to oxidative stress. These transcripts include antioxidant proteins-encoding genes that confirms that iron depletion leads to reactive oxygen accumulation. The activity of the Fe-superoxide dismutase was not significantly decreased under iron starvation, indicating that the oxidative stress generated under iron deficiency is not a consequence of (SOD) deficiency. The transcriptional data indicate that the adaptation of Nostoc to iron-depleted conditions displays important differences with what has been shown in unicellular cyanobacteria. While the FurA protein that regulates the response to iron deprivation has been well characterized in Nostoc, the regulators in charge of the oxidative stress response are unknown. Our study indicates that the alr0957 (perR) gene encodes the master regulator of the peroxide stress. PerR is a peroxide-sensor repressor that senses peroxide by metal-catalysed oxidation.

  12. The Combined Use of in Silico, in Vitro, and in Vivo Analyses to Assess Anti-cancerous Potential of a Bioactive Compound from Cyanobacterium Nostoc sp. MGL001

    Directory of Open Access Journals (Sweden)

    Niveshika

    2017-11-01

    Full Text Available Escalating incidences of cancer, especially in developed and developing countries, demand evaluation of potential unexplored natural drug resources. Here, anticancer potential of 9-Ethyliminomethyl-12-(morpholin-4-ylmethoxy-5,8,13,16-tetraaza -hexacene-2,3-dicarboxylic acid (EMTAHDCA isolated from fresh water cyanobacterium Nostoc sp. MGL001 was screened through in silico, in vitro, and in vivo studies. For in silico analysis, EMTAHDCA was selected as ligand and 11 cancer related proteins (Protein Data Bank ID: 1BIX, 1NOW, 1TE6, 2RCW, 2UVL, 2VCJ, 3CRY, 3HQU, 3NMQ, 5P21, and 4B7P which are common targets of various anticancer drugs were selected as receptors. The results obtained from in silico analysis showed that EMTAHDCA has strong binding affinity for all the 11 target protein receptors. The ability of EMTAHDCA to bind active sites of cancer protein targets indicated that it is functionally similar to commercially available anticancer drugs. For assessing cellular metabolic activities, in vitro studies were performed by using calorimetric assay viz. 3-(4,5-dimethylthiazol-2-yl-2,5 diphenyltetrazolium bromide (MTT. Results showed that EMTAHDCA induced significant cytotoxic response against Dalton's lymphoma ascites (DLA cells in a dose and time dependent manner with an inhibitory concentration (IC50 value of 372.4 ng/mL after 24 h of incubation. However, in case of normal bone marrow cells, the EMTAHDCA did not induce cytotoxicity as the IC50 value was not obtained even with higher dose of 1,000 ng/mL EMTAHDCA. Further, in vivo studies revealed that the median life span/survival days of tumor bearing mice treated with EMTAHDCA increased significantly with a fold change of ~1.9 and 1.81 corresponding to doses of 5 and 10 mg/kg body weight (B.W. of EMTAHDCA respectively, as compared to the DL group. Our results suggest that 5 mg/kg B.W. is effective since the dose of 10 mg/kg B.W. did not show any significant difference as compared to 5 mg/kg B

  13. Differential sensitivity of five cyanobacterial strains to ammonium toxicity and its inhibitory mechanism on the photosynthesis of rice-field cyanobacterium Ge-Xian-Mi (Nostoc)

    Energy Technology Data Exchange (ETDEWEB)

    Dai Guozheng [College of Life Sciences, Central China Normal University, Wuhan 430079, Hubei (China); Hubei Key Laboratory of Genetic Regulation and Integrative Biology, Central China Normal University, Wuhan 430079, Hubei (China); Deblois, Charles P. [Department des Sciences Biologiques, TOXEN, Canada Research Chair on Ecotoxicology of Aquatic Microorganisms, Universite du Quebec a Montreal, Succursale Centre-ville, C.P. 8888 Montreal, Quebec H3C 3P8 (Canada); Liu Shuwen [College of Life Sciences, Central China Normal University, Wuhan 430079, Hubei (China); Hubei Key Laboratory of Genetic Regulation and Integrative Biology, Central China Normal University, Wuhan 430079, Hubei (China); Juneau, Philippe [Department des Sciences Biologiques, TOXEN, Canada Research Chair on Ecotoxicology of Aquatic Microorganisms, Universite du Quebec a Montreal, Succursale Centre-ville, C.P. 8888 Montreal, Quebec H3C 3P8 (Canada); Qiu Baosheng [College of Life Sciences, Central China Normal University, Wuhan 430079, Hubei (China); Hubei Key Laboratory of Genetic Regulation and Integrative Biology, Central China Normal University, Wuhan 430079, Hubei (China)], E-mail: bsqiu@public.wh.hb.cn

    2008-08-29

    Effects of two fertilizers, NH{sub 4}Cl and KCl, on the growth of the edible cyanobacterium Ge-Xian-Mi (Nostoc) and four other cyanobacterial strains were compared at pH 8.3 {+-} 0.2 and 25 deg. C. Their growth was decreased by at least 65% at 10 mmol L{sup -1} NH{sub 4}Cl but no inhibitory effect was observed at the same level of KCl. Meanwhile, the strains exhibited a great variation of sensitivity to NH{sub 4}{sup +} toxicity in the order: Ge-Xian-Mi > Anabaena azotica FACHB 118 > Microcystis aeruginosa FACHB 905 > M. aeruginosa FACHB 315 > Synechococcus FACHB 805. The 96-h EC{sub 50} value for relative growth rate with regard to NH{sub 4}{sup +} for Ge-Xian-Mi was 1.105 mmol L{sup -1}, which was much less than the NH{sub 4}{sup +} concentration in many agricultural soils (2-20 mmol L{sup -1}). This indicated that the use of ammonium as nitrogen fertilizer was responsible for the reduced resource of Ge-Xian-Mi in the paddy field. After 96 h exposure to 1 mmol L{sup -1} NH{sub 4}Cl, the photosynthetic rate, F{sub v}/F{sub m} value, saturating irradiance for photosynthesis and PSII activity of Ge-Xian-Mi colonies were remarkably decreased. The chlorophyll synthesis of Ge-Xian-Mi was more sensitive to NH{sub 4}{sup +} toxicity than phycobiliproteins. Thus, the functional absorption cross section of Ge-Xian-Mi PSII was increased markedly at NH{sub 4}Cl levels {>=}1 mmol L{sup -1} and the electron transport on the acceptor side of PSII was significantly accelerated by NH{sub 4}Cl addition {>=}3 mmol L{sup -1}. Dark respiration of Ge-Xian-Mi was significantly increased by 246% and 384% at 5 and 10 mmol L{sup -1} NH{sub 4}Cl, respectively. The rapid fluorescence rise kinetics indicated that the oxygen-evolving complex of PSII was the inhibitory site of NH{sub 4}{sup +}.

  14. (1)H, (13)C, (15)N backbone and side-chain resonance assignment of Nostoc sp. C139A variant of the heme-nitric oxide/oxygen binding (H-NOX) domain.

    Science.gov (United States)

    Alexandropoulos, Ioannis I; Argyriou, Aikaterini I; Marousis, Kostas D; Topouzis, Stavros; Papapetropoulos, Andreas; Spyroulias, Georgios A

    2016-10-01

    The H-NOX (Heme-nitric oxide/oxygen binding) domain is conserved across eukaryotes and bacteria. In human soluble guanylyl cyclase (sGC) the H-NOX domain functions as a sensor for the gaseous signaling agent nitric oxide (NO). sGC contains the heme-binding H-NOX domain at its N-terminus, which regulates the catalytic site contained within the C-terminal end of the enzyme catalyzing the conversion of GTP (guanosine 5'-triphosphate) to GMP (guanylyl monophosphate). Here, we present the backbone and side-chain assignments of the (1)H, (13)C and (15)N resonances of the 183-residue H-NOX domain from Nostoc sp. through solution NMR.

  15. DNA Probes Show Genetic Variation in Cyanobacterial Symbionts of the Azolla Fern and a Closer Relationship to Free-Living Nostoc Strains than to Free-Living Anabaena Strains

    Science.gov (United States)

    Plazinski, Jacek; Zheng, Qi; Taylor, Rona; Croft, Lynn; Rolfe, Barry G.; Gunning, Brian E. S.

    1990-01-01

    Twenty-two isolates of Anabaena azollae derived from seven Azolla species from various geographic and ecological sources were characterized by DNA-DNA hybridization. Cloned DNA fragments derived from the genomic sequences of three different A. azollae isolates were used to detect restriction fragment length polymorphism among all symbiotic anabaenas. DNA clones were radiolabeled and hybridized against southern blot transfers of genomic DNAs of different isolates of A. azollae digested with restriction endonucleases. Eight DNA probes were selected to identify the Anabaena strains tested. Two were strain specific and hybridized only to A. azollae strains isolated from Azolla microphylla or Azolla caroliniana. One DNA probe was section specific (hybridized only to anabaenas isolated from Azolla ferns representing the section Euazolla), and five other probes gave finer discrimination among anabaenas representing various ecotypes of Azolla species. These cloned genomic DNA probes identified 11 different genotypes of A. azollae isolates. These included three endosymbiotic genotypes within Azolla filiculoides species and two genotypes within both A. caroliniana and Azolla pinnata endosymbionts. Although we were not able to discriminate among anabaenas extracted from different ecotypes of Azolla nilotica, Azolla mexicina, Azolla rubra and Azolla microphylla species, each of the endosymbionts was easily identified as a unique genotype. When total DNA isolated from free-living Anabaena sp. strain PCC7120 was screened, none of the genomic DNA probes gave detectable positive hybridization. Total DNA of Nostoc cycas PCC7422 hybridized with six of eight genomic DNA fragments. These data imply that the dominant symbiotic organism in association with Azolla spp. is more closely related to Nostoc spp. than to free-living Anabaena spp. Images PMID:16348182

  16. Heterologous expression of an algal hydrogenase in a heterocystous cyanobacterium

    Energy Technology Data Exchange (ETDEWEB)

    Thorsten Heidorn; Peter Lindblad [Dept. of Physiological Botany, Uppsala University, Villavogen 6, SE-752 36 Uppsala, (Sweden)

    2006-07-01

    For the expression of an active algal [FeFe] hydrogenase in the heterocystous cyanobacterium Nostoc punctiforme A TCC 29133 the Chlamydomonas reinhardtii hydrogenase gene hydA1 and the accessory genes hydEF and hydG are to be introduced into the cyanobacteria cells. The genes were amplified by PCR from EST clones, cloned into the cloning vector pBluescript SK+ and sequenced. An expression vector for multi-cistronic cloning, based on pSCR202, was constructed and for a functional test GFP was inserted as a reporter gene. The GFP construct was transformed into Nostoc punctiforme A TCC 29133 by electroporation and expression of GFP was visualized by fluorescence microscopy. (authors)

  17. Heterologous expression of an algal hydrogenase in a hetero-cystous cyanobacterium

    Energy Technology Data Exchange (ETDEWEB)

    Thorsten Heidorn; Peter Lindblad [Dept. of Physiological Botany, Uppsala University, V illavagen 6, SE-752 36 Uppsala, (Sweden)

    2006-07-01

    For the expression of an active algal [FeFe] hydrogenase in the hetero-cystous cyanobacterium Nostoc punctiforme A TCC 29133 the Chlamydomonas reinhardtii hydrogenase gene hydA1 and the accessory genes hydEF and hydG are to be introduced into the cyano-bacterial cells. The genes were amplified by PCR from EST clones, cloned into the cloning vector pBluescript SK+ and sequenced. An expression vector for multi-cistronic cloning, based on pSCR202, was constructed and for a functional test GFP was inserted as a reporter gene. The GFP construct was transformed into Nostoc punctiforme A TCC 29133 by electroporation and expression of GFP was visualized by fluorescence microscopy. (authors)

  18. Heterologous expression of an algal hydrogenase in a heterocystous cyanobacterium

    International Nuclear Information System (INIS)

    Thorsten Heidorn; Peter Lindblad

    2006-01-01

    For the expression of an active algal [FeFe] hydrogenase in the heterocystous cyanobacterium Nostoc punctiforme A TCC 29133 the Chlamydomonas reinhardtii hydrogenase gene hydA1 and the accessory genes hydEF and hydG are to be introduced into the cyanobacteria cells. The genes were amplified by PCR from EST clones, cloned into the cloning vector pBluescript SK+ and sequenced. An expression vector for multi-cistronic cloning, based on pSCR202, was constructed and for a functional test GFP was inserted as a reporter gene. The GFP construct was transformed into Nostoc punctiforme A TCC 29133 by electroporation and expression of GFP was visualized by fluorescence microscopy. (authors)

  19. Heterologous expression of an algal hydrogenase in a hetero-cystous cyanobacterium

    International Nuclear Information System (INIS)

    Thorsten Heidorn; Peter Lindblad

    2006-01-01

    For the expression of an active algal [FeFe] hydrogenase in the hetero-cystous cyanobacterium Nostoc punctiforme A TCC 29133 the Chlamydomonas reinhardtii hydrogenase gene hydA1 and the accessory genes hydEF and hydG are to be introduced into the cyano-bacterial cells. The genes were amplified by PCR from EST clones, cloned into the cloning vector pBluescript SK+ and sequenced. An expression vector for multi-cistronic cloning, based on pSCR202, was constructed and for a functional test GFP was inserted as a reporter gene. The GFP construct was transformed into Nostoc punctiforme A TCC 29133 by electroporation and expression of GFP was visualized by fluorescence microscopy. (authors)

  20. Vertical microbial community variability of carbonate-based cones may provide insight into ancient conical stromatolite formation

    Science.gov (United States)

    Bradley, James; Daille, Leslie; Trivedi, Christopher; Bojanowski, Caitlin; Nunn, Heather; Stamps, Blake; Johnson, Hope; Stevenson, Bradley; Berelson, Will; Corsetti, Frank; Spear, John

    2016-04-01

    Stromatolite morphogenesis is poorly understood, and the process by which microbial mats become mineralized is a primary question in microbialite formation. Ancient conical stromatolites are primarily carbonate-based whereas the few modern analogues in hot springs are either non-mineralized or mineralized by silica. A team from the 2015 International GeoBiology Course investigated carbonate-rich microbial cones from near Little Hot Creek (LHC), Long Valley Caldera, California, to investigate how conical stromatolites might form in a hot spring carbonate system. The cones rise up from a layered microbial mat on the east side of a 45° C pool with very low flow that is super-saturated with respect to CaCO3. Cone structures are 8-30 mm in height, are rigid and do not deform when removed from the pool. Morphological characterization through environmental scanning electronic microscopy revealed that the cone structure is maintained by a matrix of intertwining microbial filaments around carbonate grains. This matrix gives rise to cone-filaments that are arranged vertically or horizontally, and provides further stability to the cone. Preliminary 16S rRNA gene analysis indicated variability of community composition between different vertical levels of the cone. The cone tip had comparatively greater abundance of filamentous cyanobacteria including Leptolingbya, Phormidium and Isosphaera and fewer heterotrophs (e.g. Chloroflexi) compared to the cone bottom. This supports the hypothesis that cone formation may depend on the differential abundance of the microbial community and their potential functional roles. Metagenomic analyses of the cones revealed potential genes related to chemotaxis and motility. Specifically, a genomic bin identified as a member of the genus Isosphaera contained an hmp chemotaxis operon implicated in gliding motility in the cyanobacterium Nostoc punctiforme. Isosphaera is a Planctomycete shown to have phototactic capabilities, and may play a role in

  1. Genetically modified cyanobacterium Nostoc muscorum ...

    Indian Academy of Sciences (India)

    Madhu

    diazotrophic cultures of the cyanobacterium N. muscorum in quantities of 5 .... growth media and then used for estimation of their characteristics. Each reading is ..... 1224–1232. Christian J H B 1950 The influence of nutrition on the water rela-.

  2. Twelve testable hypotheses on the geobiology of weathering

    Science.gov (United States)

    S.L. Brantley; J.P. Megonigal; F.N. Scatena; Z. Balogh-Brunstad; R.T. Barnes; M.A. Bruns; P. van Cappelen; K. Dontsova; H.E. Hartnett; A.S. Hartshorn; A. Heimsath; E. Herndon; L. Jin; C.K. Keller; J.R. Leake; W.H. McDowell; F.C. Meinzer; T.J. Mozdzer; S. Petsch; J. Pett-Ridge; K.S. Pretziger; P.A. Raymond; C.S. Riebe; K. Shumaker; A. Sutton-Grier; R. Walter; K. Yoo

    2011-01-01

    Critical Zone (CZ) research investigates the chemical, physical, and biological processes that modulate the Earth's surface. Here, we advance 12 hypotheses that must be tested to improve our understanding of the CZ: (1) Solar-to-chemical conversion of energy by plants regulates flows of carbon, water, and nutrients through plant-microbe soil networks, thereby...

  3. Snowball Earth climate dynamics and Cryogenian geology-geobiology.

    Science.gov (United States)

    Hoffman, Paul F; Abbot, Dorian S; Ashkenazy, Yosef; Benn, Douglas I; Brocks, Jochen J; Cohen, Phoebe A; Cox, Grant M; Creveling, Jessica R; Donnadieu, Yannick; Erwin, Douglas H; Fairchild, Ian J; Ferreira, David; Goodman, Jason C; Halverson, Galen P; Jansen, Malte F; Le Hir, Guillaume; Love, Gordon D; Macdonald, Francis A; Maloof, Adam C; Partin, Camille A; Ramstein, Gilles; Rose, Brian E J; Rose, Catherine V; Sadler, Peter M; Tziperman, Eli; Voigt, Aiko; Warren, Stephen G

    2017-11-01

    Geological evidence indicates that grounded ice sheets reached sea level at all latitudes during two long-lived Cryogenian (58 and ≥5 My) glaciations. Combined uranium-lead and rhenium-osmium dating suggests that the older (Sturtian) glacial onset and both terminations were globally synchronous. Geochemical data imply that CO 2 was 10 2 PAL (present atmospheric level) at the younger termination, consistent with a global ice cover. Sturtian glaciation followed breakup of a tropical supercontinent, and its onset coincided with the equatorial emplacement of a large igneous province. Modeling shows that the small thermal inertia of a globally frozen surface reverses the annual mean tropical atmospheric circulation, producing an equatorial desert and net snow and frost accumulation elsewhere. Oceanic ice thickens, forming a sea glacier that flows gravitationally toward the equator, sustained by the hydrologic cycle and by basal freezing and melting. Tropical ice sheets flow faster as CO 2 rises but lose mass and become sensitive to orbital changes. Equatorial dust accumulation engenders supraglacial oligotrophic meltwater ecosystems, favorable for cyanobacteria and certain eukaryotes. Meltwater flushing through cracks enables organic burial and submarine deposition of airborne volcanic ash. The subglacial ocean is turbulent and well mixed, in response to geothermal heating and heat loss through the ice cover, increasing with latitude. Terminal carbonate deposits, unique to Cryogenian glaciations, are products of intense weathering and ocean stratification. Whole-ocean warming and collapsing peripheral bulges allow marine coastal flooding to continue long after ice-sheet disappearance. The evolutionary legacy of Snowball Earth is perceptible in fossils and living organisms.

  4. A review of phosphate mineral nucleation in biology and geobiology.

    Science.gov (United States)

    Omelon, Sidney; Ariganello, Marianne; Bonucci, Ermanno; Grynpas, Marc; Nanci, Antonio

    2013-10-01

    Relationships between geological phosphorite deposition and biological apatite nucleation have often been overlooked. However, similarities in biological apatite and phosphorite mineralogy suggest that their chemical formation mechanisms may be similar. This review serves to draw parallels between two newly described phosphorite mineralization processes, and proposes a similar novel mechanism for biologically controlled apatite mineral nucleation. This mechanism integrates polyphosphate biochemistry with crystal nucleation theory. Recently, the roles of polyphosphates in the nucleation of marine phosphorites were discovered. Marine bacteria and diatoms have been shown to store and concentrate inorganic phosphate (Pi) as amorphous, polyphosphate granules. Subsequent release of these P reserves into the local marine environment as Pi results in biologically induced phosphorite nucleation. Pi storage and release through an intracellular polyphosphate intermediate may also occur in mineralizing oral bacteria. Polyphosphates may be associated with biologically controlled apatite nucleation within vertebrates and invertebrates. Historically, biological apatite nucleation has been attributed to either a biochemical increase in local Pi concentration or matrix-mediated apatite nucleation control. This review proposes a mechanism that integrates both theories. Intracellular and extracellular amorphous granules, rich in both calcium and phosphorus, have been observed in apatite-biomineralizing vertebrates, protists, and atremate brachiopods. These granules may represent stores of calcium-polyphosphate. Not unlike phosphorite nucleation by bacteria and diatoms, polyphosphate depolymerization to Pi would be controlled by phosphatase activity. Enzymatic polyphosphate depolymerization would increase apatite saturation to the level required for mineral nucleation, while matrix proteins would simultaneously control the progression of new biological apatite formation.

  5. Produção de exopolissacarídeos pela cianobactéria Nostoc sp em diferentes concentrações de nitrogênio e glicose

    Directory of Open Access Journals (Sweden)

    Liege Abdallah Kawai

    2006-05-01

    Full Text Available Cianobactérias são microrganismos procariontes que, durante o crescimento celular, são capazes de produzir exopolissacarídeos (EPS. Devido à diversidade bioquímica destes, podem ser excelentes para vários fins biotecnológicos, tendo aplicações em indústrias alimentícias, têxteis, de tintas, cosméticos, de papel, e farmacêuticas, como floculantes, espessantes ou estabilizadores, substituindo os polissacarídeos de macroalgas e plantas. Além disso, as cianobactérias apresentam taxas maiores de crescimento e são mais fáceis de manipular do que plantas e macroalgas. Este estudo teve por objetivo otimizar a produção de EPS no meio BG11, com relação a diferentes concentrações de nitrogênio e glicose do meio de cultivo na produção de EPS e biomassa pela cianobactéria Nostoc sp.

  6. CalA, a Cyanobacterial AbrB Protein, Interacts with the Upstream Region of hypC and Acts as a Repressor of Its Transcription in the Cyanobacterium Nostoc sp. Strain PCC 7120▿ †

    Science.gov (United States)

    Agervald, Åsa; Zhang, Xiaohui; Stensjö, Karin; Devine, Ellenor; Lindblad, Peter

    2010-01-01

    The filamentous, heterocystous, nitrogen-fixing cyanobacterium Nostoc sp. strain PCC 7120 may contain, depending on growth conditions, up to two hydrogenases directly involved in hydrogen metabolism. HypC is one out of at least seven auxiliary gene products required for synthesis of a functional hydrogenase, specifically involved in the maturation of the large subunit. In this study we present a protein, CalA (Alr0946 in the genome), belonging to the transcription regulator family AbrB, which in protein-DNA assays was found to interact with the upstream region of hypC. Transcriptional investigations showed that calA is cotranscribed with the downstream gene alr0947, which encodes a putative protease from the abortive infection superfamily, Abi. CalA was shown to interact specifically not only with the upstream region of hypC but also with its own upstream region, acting as a repressor on hypC. The bidirectional hydrogenase activity was significantly downregulated when CalA was overexpressed, demonstrating a correlation with the transcription factor, either direct or indirect. In silico studies showed that homologues to both CalA and Alr0947 are highly conserved proteins within cyanobacteria with very similar physical organizations of the corresponding structural genes. Possible functions of the cotranscribed downstream protein Alr0947 are presented. In addition, we present a three-dimensional (3D) model of the DNA binding domain of CalA and putative DNA binding mechanisms are discussed. PMID:20023111

  7. Novel glycosylated mycosporine-like amino acid, 13-O-(β-galactosyl)-porphyra-334, from the edible cyanobacterium Nostoc sphaericum-protective activity on human keratinocytes from UV light.

    Science.gov (United States)

    Ishihara, Kenji; Watanabe, Ryuichi; Uchida, Hajime; Suzuki, Toshiyuki; Yamashita, Michiaki; Takenaka, Hiroyuki; Nazifi, Ehsan; Matsugo, Seiichi; Yamaba, Minami; Sakamoto, Toshio

    2017-07-01

    A UV-absorbing compound was purified and identified as a novel glycosylated mycosporine-like amino acid (MAA), 13-O-β-galactosyl-porphyra-334 (β-Gal-P334) from the edible cyanobacterium Nostoc sphaericum, known as "ge xian mi" in China and "cushuro" in Peru. Occurrence of the hexosylated derivative of shinorine (hexosyl-shinorine) was also supported by LC-MS/MS analysis. β-Gal-P334 accounted for about 86.5% of total MAA in N. sphaericum, followed by hexosyl-shinorine (13.2%) and porphyra-334 (0.2%). β-Gal-P334 had an absorption maximum at 334nm and molecular absorption coefficient was 46,700 at 334nm. Protection activity of β-Gal-P334 from UVB and UVA+8-methoxypsoralen induced cell damage on human keratinocytes (HaCaT) was assayed in comparison with other MAA (porphyra-334, shinorine, palythine and mycosporine-glycine). The UVB protection activity was highest in mycosporine-glycine, followed by palythine, β-Gal-P334, porphyra-334 and shinorine in order. β-Gal-P334 had highest protection activity from UVA+8-methoxypsoralen induced cell damage followed by porphyra-334, shinorine, mycosporine-glycine and palythine. We also found an antioxidant (radical-scavenging) activity of β-Gal-P334 by colorimetric and ESR methods. From these findings, β-Gal-P334 was suggested to play important roles in stress tolerant mechanisms such as UV and oxidative stress in N. sphaericum as a major MAA. We also consider that the newly identified MAA, β-Gal-P334 has a potential for use as an ingredient of cosmetics and toiletries. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Selective Production of 9R-Hydroxy-10E,12Z,15Z-Octadecatrienoic Acid from α-Linolenic Acid in Perilla Seed Oil Hydrolyzate by a Lipoxygenase from Nostoc Sp. SAG 25.82.

    Science.gov (United States)

    Kim, Kyoung-Rok; An, Jung-Ung; Lee, Seon-Hwa; Oh, Deok-Kun

    2015-01-01

    Hydroxy fatty acids (HFAs) derived from omega-3 polyunsaturated fatty acids have been known as versatile bioactive molecules. However, its practical production from omega-3 or omega-3 rich oil has not been well established. In the present study, the stereo-selective enzymatic production of 9R-hydroxy-10E,12Z,15Z-octadecatrienoic acid (9R-HOTE) from α-linolenic acid (ALA) in perilla seed oil (PO) hydrolyzate was achieved using purified recombinant 9R-lipoxygenase (9R-LOX) from Nostoc sp. SAG 25.82. The specific activity of the enzyme followed the order linoleic acid (LA) > ALA > γ-linolenic acid (GLA). A total of 75% fatty acids (ALA and LA) were used as a substrate for 9R-LOX from commercial PO by hydrolysis of Candida rugosa lipase. The optimal reaction conditions for the production of 9R-HOTE from ALA using 9R-LOX were pH 8.5, 15°C, 5% (v/v) acetone, 0.2% (w/v) Tween 80, 40 g/L ALA, and 1 g/L enzyme. Under these conditions, 9R-LOX produced 37.6 g/L 9R-HOTE from 40 g/L ALA for 1 h, with a conversion yield of 94% and a productivity of 37.6 g/L/h; and the enzyme produced 34 g/L 9R-HOTE from 40 g/L ALA in PO hydrolyzate for 1 h, with a conversion yields of 85% and a productivity of 34 g/L/h. The enzyme also converted 9R-hydroxy-10E,12Z-octadecadienoic acid (9R-HODE) from 40 g/L LA for 1.0 h, with a conversion yield of 95% and a productivity of 38.4 g/L. This is the highest productivity of HFA from both ALA and ALA-rich vegetable oil using LOX ever reported. Therefore, our result suggests an efficient method for the production of 9R-HFAs from LA and ALA in vegetable oil using recombinant LOX in biotechnology.

  9. Clear differences in metabolic and morphological adaptations of akinetes of two Nostocales living in different habitats.

    Science.gov (United States)

    Perez, Rebeca; Forchhammer, Karl; Salerno, Graciela; Maldener, Iris

    2016-02-01

    Akinetes are resting spore-like cells formed by some heterocyst-forming filamentous cyanobacteria for surviving long periods of unfavourable conditions. We studied the development of akinetes in two model strains of cyanobacterial cell differentiation, the planktonic freshwater Anabaena variabilis ATCC 29413 and the terrestrial or symbiotic Nostoc punctiforme ATCC 29133, in response to low light and phosphate starvation. The best trigger of akinete differentiation of Anabaena variabilis was low light; that of N. punctiforme was phosphate starvation. Light and electron microscopy revealed that akinetes of both species differed from vegetative cells by their larger size, different cell morphology and large number of intracellular granules. Anabaena variabilis akinetes had a multilayer envelope; those of N. punctiforme had a simpler envelope. During akinete development of Anabaena variabilis, the amount of the storage compounds cyanophycin and glycogen increased transiently, whereas in N. punctiforme, cyanophycin and lipid droplets increased transiently. Photosynthesis and respiration decreased during akinete differentiation in both species, and remained at a low level in mature akinetes. The clear differences in the metabolic and morphological adaptations of akinetes of the two species could be related to their different lifestyles. The results pave the way for genetic and functional studies of akinete differentiation in these species.

  10. МОРФОЛОГИЧЕСКАЯ И МОЛЕКУЛЯРНАЯ ХАРАТЕРИСТИКА ЦИАНОБАКТЕРИИ NOSTOC SP., ИЗОЛИРОВАННОЙ ИЗ ПОЧВЫ МУРМАНСКОЙ ОБЛАСТИ

    OpenAIRE

    ШАЛЫГИНА Р.Р.; ШАЛЫГИН С.С.; РЕДЬКИНА В.В.

    2016-01-01

    Штамм Nostoc sp., выделенный в чистую культуру из почв Кольского полуострова в районе Кандалакшского алюминиевого завода (КАЗ), отличается намного большим размером гетероцит и акинет по сравнению с другими видами рода Nostoc. Филогенетический анализ участка 16S рРНК показал, что данный штамм располагается точно в середине Nostoc sensu lato в кладе с Nostoc Bashkir 6A и Nostoc PCC9709. Мы предполагаем, что выделенный штамм является новым видом рода Nostoc sp., но для точного определения видово...

  11. Ecological-floristic analysis of soil algae and cyanobacteria on the Tra-Tau and Yurak-Tau Mounts, Bashkiria

    Science.gov (United States)

    Bakieva, G. R.; Khaibullina, L. S.; Gaisina, L. A.; Kabirov, R. R.

    2012-09-01

    The species composition of the soil algae and cyanobacteria in the Tra-Tau and Yurak-Tau mountains is represented by 136 species belonging to five phyla: Cyanobacteria (56 species), Chlorophyta (52 species), Xanthophyta (13 species), Bacillariophyta (12 species), and Eustigmatophyta (3 species). Hantzschia amphioxys var. amphioxys, Hantzschia amphioxys var. constricta, Klebsormidium flaccidum, Leptolyngbya foveolarum, Luticola mutica, Navicula minima var. minima, Nostoc punctiforme, Phormidium jadinianum, Phormidium autumnale, and Pinnularia borealis were identified more often than other species. The composition of the algal flora depended on the soil properties; the higher plants also had a significant influence on the species composition of the soil algae.

  12. Searching for an Acidic Aquifer in the Rio Tinto Basin: First Geobiology Results of MARTE Project

    Science.gov (United States)

    Fernandez-Remolar, D. C.; Prieto-Ballesteros, O.; Stoker, C.

    2004-01-01

    Among the conceivable modern habitats to be explored for searching life on Mars are those potentially developed underground. Subsurface habitats are currently environments that, under certain physicochemical circumstances, have high thermal and hydrochemical stability [1, 2]. In planets like Mars lacking an atmospheric shield, such systems are obviously protected against radiation, which strongly alters the structure of biological macromolecules. Low porosity but fractured aquifers currently emplaced inside ancient volcano/sedimentary and hydrothermal systems act as excellent habitats [3] due to its thermal and geochemical properties. In these aquifers the temperature is controlled by a thermal balance between conduction and advection processes, which are driven by the rock composition, geological structure, water turnover of aquifers and heat generation from geothermal processes or chemical reactions [4]. Moreover, microbial communities based on chemolithotrophy can obtain energy by the oxidation of metallic ores that are currently associated to these environments. Such a community core may sustain a trophic web composed of non-autotrophic forms like heterotrophic bacteria, fungi and protozoa.

  13. Advancing Site-Based Data Curation for Geobiology: The Yellowstone Exemplar (Invited)

    Science.gov (United States)

    Palmer, C. L.; Fouke, B. W.; Rodman, A.; Choudhury, G. S.

    2013-12-01

    While advances in the management and archiving of scientific digital data are proceeding apace, there is an urgent need for data curation services to collect and provide access to high-value data fit for reuse. The Site-Based Data Curation (SBDC) project is establishing a framework of guidelines and processes for the curation of research data generated at scientifically significant sites. The project is a collaboration among information scientists, geobiologists, data archiving experts, and resource managers at Yellowstone National Park (YNP). Based on our previous work with the Data Conservancy on indicators of value for research data, several factors made YNP an optimal site for developing the SBDC framework, including unique environmental conditions, a permitting process for data collection, and opportunities for geo-located longitudinal data and multiple data sources for triangulation and context. Stakeholder analysis is informing the SBDC requirements, through engagement with geologists, geochemists, and microbiologists conducting research at YNP and personnel from the Yellowstone Center for Resources and other YNP units. To date, results include data value indicators specific to site-based research, minimum and optimal parameters for data description and metadata, and a strategy for organizing data around sampling events. New value indicators identified by the scientists include ease of access to park locations for verification and correction of data, and stable environmental conditions important for controlling variables. Researchers see high potential for data aggregated from the many individual investigators conducting permitted research at YNP, however reuse is clearly contingent on detailed and consistent sampling records. Major applications of SBDC include identifying connections in dynamic systems, spatial temporal synthesis, analyzing variability within and across geological features, tracking site evolution, assessing anomalies, and greater awareness of complementary research and opportunities for collaboration. Moreover, making evident the range of available YNP data will inform what should be explored next, even beyond YNP. Like funding agencies and policy makers, YNP researchers and resource managers are invested in data curation for strategic purposes related to the big picture and efficiency of science. For the scientists, YNP represents an ideal, protected natural system that can serve as an indicator of world events, and SBDC provides the ability to ask and answer broader research questions and leverage an extensive store of highly applicable data. SBDC affords YNP improved coordination and transparency of data collection activities, and easier identification of trends and connections across projects. SBDC capabilities that support broader inquiry and better coordination of scientific effort have clear implications for data curation at other research intensive sites, and may also inform how data systems can provide strategic assistance to science more generally.

  14. Permian-Triassic boundary microbialites at Zuodeng Section, Guangxi Province, South China: Geobiology and palaeoceanographic implications

    Science.gov (United States)

    Fang, Yuheng; Chen, Zhong-Qiang; Kershaw, Stephen; Yang, Hao; Luo, Mao

    2017-05-01

    A previously unknown microbialite bed in the Permian-Triassic (P-Tr) boundary beds of Zuodeng section, Tiandong County, Guangxi, South China comprises a thin (5 cm maximum thickness) stromatolite in the lower part and the remaining 6 m is thrombolite. The Zuodeng microbialite has a pronounced irregular contact between the latest Permian bioclastic limestone and microbialite, as in other sites in the region. The stromatolite comprises low-relief columnar and broad domal geometries, containing faint laminations. The thrombolite displays an irregular mixture of sparitic dark coloured altered microbial fabric and light coloured interstitial sediment in polished blocks. Abundant microproblematic calcimicrobe structures identified here as Gakhumella are preserved in dark coloured laminated areas of the stromatolite and sparitic areas in thrombolites (i.e. the calcimicrobial part, not the interstitial sediment) and are orientated perpendicular to stromatolitic laminae. Each Gakhumella individual has densely arranged segments, which form a column- to fan-shaped structure. Single segments are arch-shaped and form a thin chamber between segments. Gakhumella individuals in the stromatolite and thrombolite are slightly different from each other, but are readily distinguished from the Gakhumella- and Renalcis-like fossils reported from other P-Tr boundary microbialites in having a smaller size, unbranching columns and densely arranged, arch-shaped segments. Renalcids usually possess a larger body size and branching, lobate outlines. Filament sheath aggregates are also observed in the stromatolite and they are all orientated in one direction. Both Gakhumella and filament sheath aggregates may be photosynthetic algae, which may have played an important role in constructing the Zuodeng microbialites. Other calcimicrobes in the Zuodeng microbialite are spheroids, of which a total of five morphological types are recognized from both stromatolite and thrombolite: (1) sparry calcite spheroid without outer sheaths, (2) a large sparry calcite nucleus coated with a thin sparry calcite sheath, (3) a large nucleus of micrite framboid aggregates rimmed by a thin sparry calcite sheath (bacterial clump-like spheroids), (4) a large nucleus of micrite framboid aggregates coated with a thin micritic sheath, and (5) a small sparry nuclei rimmed by coarse-grained, radiated euhedral rays. The irregular contact beneath the Zuodeng microbialites is interpreted as a subaerial exposure surface due to regional regression in South China. The demise of the Zuodeng microbialites may have been due to rapid rise in sea-level because they grew in relatively shallow marine conditions and are overlain by muddy limestones containing pelagic conodonts. Also siliciclastic content increases above the microbialite, suggesting a possible climate-related increase in weathering as the transgression progressed.

  15. The Distribution, Diversity, and Geobiology of Thermoproteales Populations in Yellowstone National Park

    Science.gov (United States)

    Jay, Z.; Beam, J.; Bailey, C.; Dohnalkova, A.; Planer-Friedrich, B.; Romine, M.; Inskeep, W. P.

    2012-12-01

    The order Thermoproteales (phylum Crenarchaeota) consists of thermophilic, rod-shaped organisms that are found globally in geothermal habitats ranging in pH from ~3-9. Nearly all isolated Thermoproteales couple the respiration of inorganic sulfur species (e.g. elemental sulfur, thiosulfate, sulfate) to the oxidation of hydrogen or complex organic carbon. Prior 16S rRNA and metagenome analysis revealed four prominent Thermoproteales-like populations in hypoxic, sulfidic hot springs In Yellowstone National Park (YNP), WY, USA (Monarch Geyser [80° C, pH 4], Cistern Spring [76° C, pH 5] and Joseph's Coat Hot Spring [JCHS; 80° C, pH 6]). The objectives of this study were to 1) characterize and compare the indigenous Thermoproteales-like de novo assemblies identified from metagenomic sequence data available for geothermal systems across YNP, 2) determine the metabolic potential of the Thermoproteales-like populations and evaluate their role in the geochemical cycling of organic and inorganic constituents, and 3) contrast both the sequenced genome and growth physiology of the first Thermoproteales isolated from YNP ("Pyrobaculum yellowstonensis" strain WP30), to the indigenous Thermoproteales-like de novo assemblies. Sequences related to either Caldivirga or Vulcanisaeta spp. (Type I Thermoproteales) were identified in both aerobic and anaerobic habitats ranging in pH ~3 - 6. Thermoproteus or Pyrobaculum spp. (Type-II Thermoproteales) were identified in anoxic habitats, but were constrained to pH values >4. Annotation of the de novo assemblies indicate that both Type-I and Type-II Thermoproteales populations are primarily heterotrophic, although key proteins of the autotrophic dicarboxylate/4-hydroxybutyrate cycle were also identified. Caldivirga/Vulcanisaeta-like populations appear to respire on elemental sulfur, sulfate, or molecular oxygen, while the Thermoproteus/Pyrobaculum-like population may also oxidize hydrogen and respire on elemental sulfur, thiosulfate, arsenate, or tetrathionate. One of the relevant Thermoproteales Type-II populations was isolated from JCHS and is an anaerobic heterotroph utilizing yeast extract as a carbon and energy source while respiring on elemental sulfur or arsenate, resulting in the production of sulfide or arsenite, respectively. The optimum growth temperature of strain WP30 (75° C) and pH range (4.5 - 7) corresponds well with characteristics of the sulfidic sediment used as the original inoculum. A draft genome of strain WP30 reveals that respiration may involve as many as four dimethylsulfoxide molybdopterin oxidoreductases including a putative sulfur reductase and an arsenate reductase. Sequences with high amino acid identity to these reductases were also identified in metagenome data sets from sites containin Type-II populations. Expression data of these terminal reductase genes during the growth of strain WP30 on either sulfur or arsenate were compared to expression results from field sites. These data provide insights regarding the diversity, distribution, and potential role of Thermoproteales-like populations in high-temperature environments of YNP.

  16. First discovery of dolomite and magnesite in living coralline algae and its geobiological implications

    Directory of Open Access Journals (Sweden)

    M. C. Nash

    2011-11-01

    Full Text Available Dolomite is a magnesium-rich carbonate mineral abundant in fossil carbonate reef platforms but surprisingly rare in modern sedimentary environments, a conundrum known as the "Dolomite Problem". Marine sedimentary dolomite has been interpreted to form by an unconfirmed, post-depositional diagenetic process, despite minimal experimental success at replicating this. Here we show that dolomite, accompanied by magnesite, forms within living crustose coralline alga, Hydrolithon onkodes, a prolific global tropical reef species. Chemical micro-analysis of the coralline skeleton reveals that not only are the cell walls calcitised, but that cell spaces are typically filled with magnesite, rimmed by dolomite, or both. Mineralogy was confirmed by X-ray Diffraction. Thus there are at least three mineral phases present (magnesium calcite, dolomite and magnesite rather than one or two (magnesium calcite and brucite as previously thought. Our results are consistent with dolomite occurrences in coralline algae rich environments in fossil reefs of the last 60 million years. We reveal that the standard method of removing organic material prior to Xray Diffraction analysis can result in a decrease in the most obvious dolomite and magnesite diffraction patterns and this may explain why the abundant protodolomite and magnesite discovered in this study has not previously been recognized. This discovery of dolomite in living coralline algae extends the range of palaeo-environments for which biologically initiated dolomite can be considered a possible source of primary dolomite.

  17. Geobiological constraints on Earth system sensitivity to CO₂ during the Cretaceous and Cenozoic.

    Science.gov (United States)

    Royer, D L; Pagani, M; Beerling, D J

    2012-07-01

    Earth system climate sensitivity (ESS) is the long-term (>10³ year) response of global surface temperature to doubled CO₂ that integrates fast and slow climate feedbacks. ESS has energy policy implications because global temperatures are not expected to decline appreciably for at least 10³ year, even if anthropogenic greenhouse gas emissions drop to zero. We report provisional ESS estimates of 3 °C or higher for some of the Cretaceous and Cenozoic based on paleo-reconstructions of CO₂ and temperature. These estimates are generally higher than climate sensitivities simulated from global climate models for the same ancient periods (approximately 3 °C). Climate models probably do not capture the full suite of positive climate feedbacks that amplify global temperatures during some globally warm periods, as well as other characteristic features of warm climates such as low meridional temperature gradients. These absent feedbacks may be related to clouds, trace greenhouse gases (GHGs), seasonal snow cover, and/or vegetation, especially in polar regions. Better characterization and quantification of these feedbacks is a priority given the current accumulation of atmospheric GHGs. © 2012 Blackwell Publishing Ltd.

  18. Deep-Time drilling in the Australian Archean: the Agouron Institute geobiological drilling project. (Invited)

    Science.gov (United States)

    Buick, R.

    2010-12-01

    The Agouron Institute has sponsored deep-time drilling across the South African Archean-Proterozoic boundary, investigating the rise of oxygen over an onshore-offshore environmental transect. It is now supporting a drilling program in the Australian Archean of the Pilbara Craton, addressing a similar theme but with the added goal of resolving controversy over the age and origin of hydrocarbon biomarker molecules in ancient kerogenous shales. As these have been claimed to provide evidence for the evolution of oxygenic photosynthesis long before the rise of atmospheric oxygen to persistently high levels during the ~2.3 Ga “Great Oxidation Event”, their syngenesis with their host shales is thus of critical importance for the interpretation of Earth’s early oxygenation history. During the first drilling season, 3 holes were drilled using techniques and equipment to minimize organic geochemical contamination (new drill-string components cleaned before drilling potentially biomarker-bearing rocks, pre-contamination of drilling fluid with a synthetic organic compound of similar geochemical characteristics to biomarkers, sterile cutting and storage of samples immediately upon retrieval from the core-barrel). The initial hole was a blank control for organic geochemistry, drilled into rocks too metamorphosed to retain biomarker molecules. These rocks, cherts, carbonates and pelites of the 3.52 Ga Coucal Formation, Coonterunah Group, have been metamorphosed to upper greenschist facies at temperatures near 500°C and so should have had any ancient soluble hydrocarbons destroyed. However, because they contain both carbonate and organic carbon, these rocks can instead provide isotopic information about the earliest evolution of biological metabolism as they possess residues of both the reactant and product sides of the carbon-fixation reaction. The second hole sampled an on-shore section of carbonates and kerogenous shales in the ~2.65 Ga Carawine Dolomite and Lewin Shale of the Hamersley Group near Yilgalong Creek. This location had been previously drilled by a mining company in the 1980’s and the core provided the highest biomarker yields of any Archean rocks thus far sampled. As it has been suggested that these biomarkers are non-indigenous contaminants, one possibility is that they were introduced into the drill-core at some time between drilling and sampling, so this hole tests that hypothesis. If biomarker concentrations and ratios differ significantly between the two adjacent holes with differing exposures to post-drilling contaminants, then clearly contamination has affected one or other of the cores. The third hole sampled an off-shore equivalent, through banded irons and kerogenous shales of the ~2.65 Ga Marra Mamba and Jeerinah Formations of the Hamersley Group near Cowcumba Creek. Another opportunity for contamination may arise during post-depositional but pre-drilling hydrocarbon migration, when biomarkers can potentially be introduced into previously barren rocks by younger oils, so this hole tests that possibility. As it was drilled through the same stratigraphic interval and structural domain as the second hole but in a different environment, biomarker ratios should be similar if contaminated but different if indigenous.

  19. Note: A flexible light emitting diode-based broadband transient-absorption spectrometer

    Science.gov (United States)

    Gottlieb, Sean M.; Corley, Scott C.; Madsen, Dorte; Larsen, Delmar S.

    2012-05-01

    This Note presents a simple and flexible ns-to-ms transient absorption spectrometer based on pulsed light emitting diode (LED) technology that can be incorporated into existing ultrafast transient absorption spectrometers or operate as a stand-alone instrument with fixed-wavelength laser sources. The LED probe pulses from this instrument exhibit excellent stability (˜0.5%) and are capable of producing high signal-to-noise long-time (>100 ns) transient absorption signals either in a broadband multiplexed (spanning 250 nm) or in tunable narrowband (20 ns) operation. The utility of the instrument is demonstrated by measuring the photoinduced ns-to-ms photodynamics of the red/green absorbing fourth GMP phosphodiesterase/adenylyl cyclase/FhlA domain of the NpR6012 locus of the nitrogen-fixing cyanobacterium Nostoc punctiforme.

  20. A gene expression study on strains of Nostoc (Cyanobacteria ...

    African Journals Online (AJOL)

    Cyanobacteria are well known for their production of a multitude of highly allelopathic compounds. These products have features such as incorporation of non-proteinogenic amino acids which are characteristics of peptides biosynthesized by non-ribosomal peptide synthetases (NRPSs). Some of these peptides have ...

  1. Geology and stable isotope geochemistry of Paleoarchean sulfur. Formation, preservation and geobiology of ancient pyrite and barite

    NARCIS (Netherlands)

    Roerdink, D.L.|info:eu-repo/dai/nl/318834340

    2013-01-01

    Sulfur isotopes in ancient sulfate and sulfide minerals provide a comprehensive record of microbial processes involved in the early sulfur cycle on Earth. However, the interpretation of these isotopic signatures requires information on the geological context of such samples, because abiotic

  2. Decoupling of body-plan diversification and ecological structuring during the Ediacaran-Cambrian transition: evolutionary and geobiological feedbacks.

    Science.gov (United States)

    Mángano, M Gabriela; Buatois, Luis A

    2014-04-07

    The rapid appearance of bilaterian clades at the beginning of the Phanerozoic is one of the most intriguing topics in macroevolution. However, the complex feedbacks between diversification and ecological interactions are still poorly understood. Here, we show that a systematic and comprehensive analysis of the trace-fossil record of the Ediacaran-Cambrian transition indicates that body-plan diversification and ecological structuring were decoupled. The appearance of a wide repertoire of behavioural strategies and body plans occurred by the Fortunian. However, a major shift in benthic ecological structure, recording the establishment of a suspension-feeder infauna, increased complexity of the trophic web, and coupling of benthos and plankton took place during Cambrian Stage 2. Both phases were accompanied by different styles of ecosystem engineering, but only the second one resulted in the establishment of the Phanerozoic-style ecology. In turn, the suspension-feeding infauna may have been the ecological drivers of a further diversification of deposit-feeding strategies by Cambrian Stage 3, favouring an ecological spillover scenario. Trace-fossil information strongly supports the Cambrian explosion, but allows for a short time of phylogenetic fuse during the terminal Ediacaran-Fortunian.

  3. The biological soil crusts of the San Nicolas Island: Enigmatic algae from a geographically isolated ecosystem

    Science.gov (United States)

    Flechtner, V.R.; Johansen, J.R.; Belnap, J.

    2008-01-01

    Composite soil samples from 7 sites on San Nicolas Island were evaluated quantitatively and qualitatively for the presence of cyanobacteria and eukaryotic microalgae. Combined data demonstrated a rich algal flora with 19 cyanobacterial and 19 eukaryotic microalgal genera being identified, for a total of 56 species. Nine new species were identified and described among the cyanobacteria and the eukaryotic microalgae that were isolated: Leibleinia edaphica, Aphanothece maritima, Chroococcidiopsis edaphica, Cyanosarcina atroveneta, Hassallia californica, Hassallia pseudoramosissima, Microchaete terrestre, Palmellopsis californiens, and Pseudotetracystis compactis. Distinct distributional patterns of algal taxa existed among sites on the island and among soil algal floras of western North America. Some algal taxa appeared to be widely distributed across many desert regions, including Microcoleus vaginatus, Nostoc punctiforme, Nostoc paludosum, and Tolypothrix distorta, Chlorella vulgaris, Diplosphaera cf. chodatii, Myrmecia astigmatica, Myrmecia biatorellae, Hantzschia amphioxys, and Luticola mutica. Some taxa share a distinctly southern distribution with soil algae from southern Arizona, southern California, and Baja California (e.g., Scenedesmus deserticola and Eustigmatos magnus). The data presented herein support the view that the cyanobacterial and microalgal floras of soil crusts possess significant biodiversity, much of it previously undescribed.

  4. A comparative genomics approach to understanding the biosynthesis of the sunscreen scytonemin in cyanobacteria

    Directory of Open Access Journals (Sweden)

    Potrafka Ruth M

    2009-07-01

    Full Text Available Abstract Background The extracellular sunscreen scytonemin is the most common and widespread indole-alkaloid among cyanobacteria. Previous research using the cyanobacterium Nostoc punctiforme ATCC 29133 revealed a unique 18-gene cluster (NpR1276 to NpR1259 in the N. punctiforme genome involved in the biosynthesis of scytonemin. We provide further genomic characterization of these genes in N. punctiforme and extend it to homologous regions in other cyanobacteria. Results Six putative genes in the scytonemin gene cluster (NpR1276 to NpR1271 in the N. punctiforme genome, with no previously known protein function and annotated in this study as scyA to scyF, are likely involved in the assembly of scytonemin from central metabolites, based on genetic, biochemical, and sequence similarity evidence. Also in this cluster are redundant copies of genes encoding for aromatic amino acid biosynthetic enzymes. These can theoretically lead to tryptophan and the tyrosine precursor, p-hydroxyphenylpyruvate, (expected biosynthetic precursors of scytonemin from end products of the shikimic acid pathway. Redundant copies of the genes coding for the key regulatory and rate-limiting enzymes of the shikimic acid pathway are found there as well. We identified four other cyanobacterial strains containing orthologues of all of these genes, three of them by database searches (Lyngbya PCC 8106, Anabaena PCC 7120, and Nodularia CCY 9414 and one by targeted sequencing (Chlorogloeopsis sp. strain Cgs-089; CCMEE 5094. Genomic comparisons revealed that most scytonemin-related genes were highly conserved among strains and that two additional conserved clusters, NpF5232 to NpF5236 and a putative two-component regulatory system (NpF1278 and NpF1277, are likely involved in scytonemin biosynthesis and regulation, respectively, on the basis of conservation and location. Since many of the protein product sequences for the newly described genes, including ScyD, ScyE, and ScyF, have

  5. Screening and selection of most potent diazotrophic cyanobacterial isolate exhibiting natural tolerance to rice field herbicides for exploitation as biofertilizer.

    Science.gov (United States)

    Singh, Surendra; Datta, Pallavi

    2006-01-01

    Periodic applications of heavy dosages of herbicides in modern rice-agriculture are a necessary evil for obtaining high crop productivity. Such herbicides are not only detrimental to weeds but biofertilizer strains of diazotrophic cyanobacteria also. It is therefore, essential to screen and select such biofertilizer strains of diazotrophic cyanobacteria exhibiting natural tolerance to common rice-field herbicides that can be further improved by mutational techniques to make biofertilizer technology a viable one. Therefore, efforts have been made to screen five dominant diazotrophic cyanobacterial forms e.g. filamentous heterocystous Nostoc punctiforme , Nostoc calcicola , Anabaena variabilis and unicellular Gloeocapsa sp. and Aphanocapsa sp. along with standard laboratory strain Nostoc muscorum ISU against increasing concentrations (0-100 mg l(-1) of four commercial grade common rice-field herbicides i.e. Arozin, Butachlor, Alachlor and 2,4-D under diazotrophic growth conditions. The lethal and IGC(50) concentrations for all four herbicides tested were found highest for A. variabilis as compared to other test cyanobacteria. The lowest reduction in chlorophyll a content, photosynthetic oxygen evolution, and N(2)-fixation was found in A. variabilis as compared to other rice field isolates and standard laboratory strain N. muscorum ISU. On the basis of prolong survival potential and lowest reductions in vital metabolic activities tested at IGC(50) concentration of four herbicides, it is concluded that A. variabilis is the most potent and promising cyanobacterial isolate as compared with other forms. This could be further improved by mutational techniques for exploitation as most potential and viable biofertilizer strain.

  6. ORF Sequence: NC_003240 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Nostoc sp. PCC 7120] MEYPQINIKLLSEEDRELVKQAKQRAEDLRLTFKEFVLDCIRNALFEESPDDADSATAAEIEALKAQIAALSEKVNIPSASKTEVHTLQERLNQLRVGISNEIKKDREQLASLALALSRLESQIEQLVPSLNLQVDGEVNSNSDGDWLFGEDSGAELPLT

  7. Protein (Cyanobacteria): 427708671 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available H endonuclease Nostoc sp. PCC 7107 MSSLYINAELRRLVARRADYICEYCLVSESDRSSGCQVDHIISVKHGGATTADNLCYACIFCNLQKGTDLGSINWQTGELVRFFNPRRDFWGEHFRLGEGVIQPLTDIGEVTARIFDFNCDERVIERQALILSGQYPSKSALKRINK

  8. Laboratory tools to quantify biogenic dissolution of rocks and minerals: a model rock biofilm growing in percolation columns

    Directory of Open Access Journals (Sweden)

    Franz eSeiffert

    2016-04-01

    Full Text Available Sub-aerial biofilms (SAB are ubiquitous, self-sufficient microbial ecosystems found on mineral surfaces at all altitudes and latitudes. SABs, which are the principal causes of weathering on exposed terrestrial surfaces, are characterised by patchy growth dominated by associations of algae, cyanobacteria, fungi and heterotrophic bacteria. A recently developed in vitro system to study colonisation of rocks exposed to air included two key SAB participants - the rock-inhabiting ascomycete Knufia petricola (CBS 123872 and the phototrophic cyanobacterium Nostoc punctiforme ATCC29133. Both partners are genetically tractable and we used them here to study weathering of granite, K-feldspar and plagioclase. Small fragments of the various rocks or minerals (1 to 6 mm were packed into flow-through columns and incubated with 0.1% glucose and 10 µM thiamine-hydrochloride (90 µL.min-1 to compare weathering with and without biofilms. Dissolution of the minerals was followed by: analysing (i the degradation products in the effluent from the columns via Inductively Coupled Plasma Spectroscopy and (ii by studying polished sections of the incubated mineral fragment/grains using scanning electron microscopy, transmission electron microscopy and energy dispersive X-ray analyses. K. petricola/N. punctiforme stimulated release of Ca, Na, Mg and Mn. Analyses of the polished sections confirmed depletion of Ca, Na and K near the surface of the fragments. The abrupt decrease in Ca concentration observed in peripheral areas of plagioclase fragments favoured a dissolution-reprecipitation mechanism. Percolation columns in combination with a model biofilm can thus be used to study weathering in closed systems. Columns can easily be filled with different minerals and biofilms, the effluent as well as grains can be collected after long-term exposure under axenic conditions and easily analysed.

  9. Role of Two Cell Wall Amidases in Septal Junction and Nanopore Formation in the Multicellular Cyanobacterium Anabaena sp. PCC 7120

    Directory of Open Access Journals (Sweden)

    Jan Bornikoel

    2017-09-01

    Full Text Available Filamentous cyanobacteria have developed a strategy to perform incompatible processes in one filament by differentiating specialized cell types, N2-fixing heterocysts and CO2-fixing, photosynthetic, vegetative cells. These bacteria can be considered true multicellular organisms with cells exchanging metabolites and signaling molecules via septal junctions, involving the SepJ and FraCD proteins. Previously, it was shown that the cell wall lytic N-acetylmuramyl-L-alanine amidase, AmiC2, is essential for cell–cell communication in Nostoc punctiforme. This enzyme perforates the septal peptidoglycan creating an array of nanopores, which may be the framework for septal junction complexes. In Anabaena sp. PCC 7120, two homologs of AmiC2, encoded by amiC1 and amiC2, were identified and investigated in two different studies. Here, we compare the function of both AmiC proteins by characterizing different Anabaena amiC mutants, which was not possible in N. punctiforme, because there the amiC1 gene could not be inactivated. This study shows the different impact of each protein on nanopore array formation, the process of cell–cell communication, septal protein localization, and heterocyst differentiation. Inactivation of either amidase resulted in significant reduction in nanopore count and in the rate of fluorescent tracer exchange between neighboring cells measured by FRAP analysis. In an amiC1 amiC2 double mutant, filament morphology was affected and heterocyst differentiation was abolished. Furthermore, the inactivation of amiC1 influenced SepJ localization and prevented the filament-fragmentation phenotype that is characteristic of sepJ or fraC fraD mutants. Our findings suggest that both amidases are to some extent redundant in their function, and describe a functional relationship of AmiC1 and septal proteins SepJ and FraCD.

  10. Laboratory tools to quantify biogenic dissolution of rocks and minerals: a model rock biofilm growing in percolation columns

    Science.gov (United States)

    Seiffert, Franz; Bandow, Nicole; Kalbe, Ute; Milke, Ralf; Gorbushina, Anna

    2016-04-01

    Sub-aerial biofilms (SAB) are ubiquitous, self-sufficient microbial ecosystems found on mineral surfaces at all altitudes and latitudes. SABs, which are the principal causes of weathering on exposed terrestrial surfaces, are characterised by patchy growth dominated by associations of algae, cyanobacteria, fungi and heterotrophic bacteria. A recently developed in vitro system to study colonisation of rocks exposed to air included two key SAB participants - the rock-inhabiting ascomycete Knufia petricola (CBS 123872) and the phototrophic cyanobacterium Nostoc punctiforme ATCC29133. Both partners are genetically tractable and we used them here to study weathering of granite, K-feldspar and plagioclase. Small fragments of the various rocks or minerals (1 to 6 mm) were packed into flow-through columns and incubated with 0.1% glucose and 10 µM thiamine-hydrochloride (90 µL.min-1) to compare weathering with and without biofilms. Dissolution of the minerals was followed by: analysing (i) the degradation products in the effluent from the columns via Inductively Coupled Plasma Spectroscopy and (ii) by studying polished sections of the incubated mineral fragment/grains using scanning electron microscopy, transmission electron microscopy and energy dispersive X-ray analyses. K. petricola/N. punctiforme stimulated release of Ca, Na, Mg and Mn. Analyses of the polished sections confirmed depletion of Ca, Na and K near the surface of the fragments. The abrupt decrease in Ca concentration observed in peripheral areas of plagioclase fragments favoured a dissolution-reprecipitation mechanism. Percolation columns in combination with a model biofilm can thus be used to study weathering in closed systems. Columns can easily be filled with different minerals and biofilms, the effluent as well as grains can be collected after long-term exposure under axenic conditions and easily analysed.

  11. Heterologous Production of Cyanobacterial Mycosporine-Like Amino Acids Mycosporine-Ornithine and Mycosporine-Lysine in Escherichia coli

    Science.gov (United States)

    Katoch, Meenu; Mazmouz, Rabia; Chau, Rocky; Pearson, Leanne A.; Pickford, Russell

    2016-01-01

    ABSTRACT Mycosporine-like amino acids (MAAs) are an important class of secondary metabolites known for their protection against UV radiation and other stress factors. Cyanobacteria produce a variety of MAAs, including shinorine, the active ingredient in many sunscreen creams. Bioinformatic analysis of the genome of the soil-dwelling cyanobacterium Cylindrospermum stagnale PCC 7417 revealed a new gene cluster with homology to MAA synthase from Nostoc punctiforme. This newly identified gene cluster is unusual because it has five biosynthesis genes (mylA to mylE), compared to the four found in other MAA gene clusters. Heterologous expression of mylA to mylE in Escherichia coli resulted in the production of mycosporine-lysine and the novel compound mycosporine-ornithine. To our knowledge, this is the first time these compounds have been heterologously produced in E. coli and structurally characterized via direct spectral guidance. This study offers insight into the diversity, biosynthesis, and structure of cyanobacterial MAAs and highlights their amenability to heterologous production methods. IMPORTANCE Mycosporine-like amino acids (MAAs) are significant from an environmental microbiological perspective as they offer microbes protection against a variety of stress factors, including UV radiation. The heterologous expression of MAAs in E. coli is also significant from a biotechnological perspective as MAAs are the active ingredient in next-generation sunscreens. PMID:27520810

  12. Analysis of current and alternative phenol based RNA extraction methodologies for cyanobacteria

    Directory of Open Access Journals (Sweden)

    Lindblad Peter

    2009-08-01

    Full Text Available Abstract Background The validity and reproducibility of gene expression studies depend on the quality of extracted RNA and the degree of genomic DNA contamination. Cyanobacteria are gram-negative prokaryotes that synthesize chlorophyll a and carry out photosynthetic water oxidation. These organisms possess an extended array of secondary metabolites that impair cell lysis, presenting particular challenges when it comes to nucleic acid isolation. Therefore, we used the NHM5 strain of Nostoc punctiforme ATCC 29133 to compare and improve existing phenol based chemistry and procedures for RNA extraction. Results With this work we identify and explore strategies for improved and lower cost high quality RNA isolation from cyanobacteria. All the methods studied are suitable for RNA isolation and its use for downstream applications. We analyse different Trizol based protocols, introduce procedural changes and describe an alternative RNA extraction solution. Conclusion It was possible to improve purity of isolated RNA by modifying protocol procedures. Further improvements, both in RNA purity and experimental cost, were achieved by using a new extraction solution, PGTX.

  13. Subcellular trace element distribution in Geosiphon pyriforme

    International Nuclear Information System (INIS)

    Maetz, Mischa; Schuessler, Arthur; Wallianos, Alexandros; Traxel, Kurt

    1999-01-01

    Geosiphon pyriforme is a unique endosymbiotic consortium consisting of a soil dwelling fungus and the cyanobacterium Nostoc punctiforme. At present this symbiosis becomes very interesting because of its phylogenetic relationship to the arbuscular mycorrhizal (AM) fungi. Geosiphon pyriforme could be an important model system for these obligate symbiotic fungi, which supply 80-90% of all land plant species with nutrients, in particular phosphorous and trace elements. Combined PIXE and STIM analyses of the various compartments of Geosiphon give hints for the matter exchange between the symbiotic partners and their environment and the kind of nutrient storage and acquisition, in particular related to nitrogen fixation and metabolism. To determine the quality of our PIXE results we analysed several geological and biological standards over a time period of three years. This led to an overall precision of about 6% and an accuracy of 5-10% for nearly all detectable elements. In combination with the correction model for the occurring mass loss during the analyses this holds true even for biological targets

  14. Subcellular trace element distribution in Geosiphon pyriforme

    Energy Technology Data Exchange (ETDEWEB)

    Maetz, Mischa E-mail: mischa.maetz@mpi-hd.mpg.de; Schuessler, Arthur; Wallianos, Alexandros; Traxel, Kurt

    1999-04-02

    Geosiphon pyriforme is a unique endosymbiotic consortium consisting of a soil dwelling fungus and the cyanobacterium Nostoc punctiforme. At present this symbiosis becomes very interesting because of its phylogenetic relationship to the arbuscular mycorrhizal (AM) fungi. Geosiphon pyriforme could be an important model system for these obligate symbiotic fungi, which supply 80-90% of all land plant species with nutrients, in particular phosphorous and trace elements. Combined PIXE and STIM analyses of the various compartments of Geosiphon give hints for the matter exchange between the symbiotic partners and their environment and the kind of nutrient storage and acquisition, in particular related to nitrogen fixation and metabolism. To determine the quality of our PIXE results we analysed several geological and biological standards over a time period of three years. This led to an overall precision of about 6% and an accuracy of 5-10% for nearly all detectable elements. In combination with the correction model for the occurring mass loss during the analyses this holds true even for biological targets.

  15. Role of cysteine residues in the structure, stability, and alkane producing activity of cyanobacterial aldehyde deformylating oxygenase.

    Directory of Open Access Journals (Sweden)

    Yuuki Hayashi

    Full Text Available Aldehyde deformylating oxygenase (AD is a key enzyme for alkane biosynthesis in cyanobacteria, and it can be used as a catalyst for alkane production in vitro and in vivo. However, three free Cys residues in AD may impair its catalytic activity by undesired disulfide bond formation and oxidation. To develop Cys-deficient mutants of AD, we examined the roles of the Cys residues in the structure, stability, and alkane producing activity of AD from Nostoc punctiforme PCC 73102 by systematic Cys-to-Ala/Ser mutagenesis. The C71A/S mutations reduced the hydrocarbon producing activity of AD and facilitated the formation of a dimer, indicating that the conserved Cys71, which is located in close proximity to the substrate-binding site, plays crucial roles in maintaining the activity, structure, and stability of AD. On the other hand, mutations at Cys107 and Cys117 did not affect the hydrocarbon producing activity of AD. Therefore, we propose that the C107A/C117A double mutant is preferable to wild type AD for alkane production and that the double mutant may be used as a pseudo-wild type protein for further improvement of the alkane producing activity of AD.

  16. Elevated Atmospheric CO2 and Warming Stimulates Growth and Nitrogen Fixation in a Common Forest Floor Cyanobacterium under Axenic Conditions

    Directory of Open Access Journals (Sweden)

    Zoë Lindo

    2017-03-01

    Full Text Available The predominant input of available nitrogen (N in boreal forest ecosystems originates from moss-associated cyanobacteria, which fix unavailable atmospheric N2, contribute to the soil N pool, and thereby support forest productivity. Alongside climate warming, increases in atmospheric CO2 concentrations are expected in Canada’s boreal region over the next century, yet little is known about the combined effects of these factors on N fixation by forest floor cyanobacteria. Here we assess changes in N fixation in a common forest floor, moss-associated cyanobacterium, Nostoc punctiforme Hariot, under elevated CO2 conditions over 30 days and warming combined with elevated CO2 over 90 days. We measured rates of growth and changes in the number of specialized N2 fixing heterocyst cells, as well as the overall N fixing activity of the cultures. Elevated CO2 stimulated growth and N fixation overall, but this result was influenced by the growth stage of the cyanobacteria, which in turn was influenced by our temperature treatments. Taken together, climate change factors of warming and elevated CO2 are expected to stimulate N2 fixation by moss-associated cyanobacteria in boreal forest systems.

  17. Light structures phototroph, bacterial and fungal communities at the soil surface.

    Directory of Open Access Journals (Sweden)

    Lawrence O Davies

    Full Text Available The upper few millimeters of soil harbour photosynthetic microbial communities that are structurally distinct from those of underlying bulk soil due to the presence of light. Previous studies in arid zones have demonstrated functional importance of these communities in reducing soil erosion, and enhancing carbon and nitrogen fixation. Despite being widely distributed, comparative understanding of the biodiversity of the soil surface and underlying soil is lacking, particularly in temperate zones. We investigated the establishment of soil surface communities on pasture soil in microcosms exposed to light or dark conditions, focusing on changes in phototroph, bacterial and fungal communities at the soil surface (0-3 mm and bulk soil (3-12 mm using ribosomal marker gene analyses. Microbial community structure changed with time and structurally similar phototrophic communities were found at the soil surface and in bulk soil in the light exposed microcosms suggesting that light can influence phototroph community structure even in the underlying bulk soil. 454 pyrosequencing showed a significant selection for diazotrophic cyanobacteria such as Nostoc punctiforme and Anabaena spp., in addition to the green alga Scenedesmus obliquus. The soil surface also harboured distinct heterotrophic bacterial and fungal communities in the presence of light, in particular, the selection for the phylum Firmicutes. However, these light driven changes in bacterial community structure did not extend to the underlying soil suggesting a discrete zone of influence, analogous to the rhizosphere.

  18. In vivo and in vitro protein ligation by naturally occurring and engineered split DnaE inteins.

    Directory of Open Access Journals (Sweden)

    A Sesilja Aranko

    Full Text Available BACKGROUND: Protein trans-splicing by naturally occurring split DnaE inteins is used for protein ligation of foreign peptide fragments. In order to widen biotechnological applications of protein trans-splicing, it is highly desirable to have split inteins with shorter C-terminal fragments, which can be chemically synthesized. PRINCIPAL FINDINGS: We report the identification of new functional split sites in DnaE inteins from Synechocystis sp. PCC6803 and from Nostoc punctiforme. One of the newly engineered split intein bearing C-terminal 15 residues showed more robust protein trans-splicing activity than naturally occurring split DnaE inteins in a foreign context. During the course of our experiments, we found that protein ligation by protein trans-splicing depended not only on the splicing junction sequences, but also on the foreign extein sequences. Furthermore, we could classify the protein trans-splicing reactions in foreign contexts with a simple kinetic model into three groups according to their kinetic parameters in the presence of various reducing agents. CONCLUSION: The shorter C-intein of the newly engineered split intein could be a useful tool for biotechnological applications including protein modification, incorporation of chemical probes, and segmental isotopic labelling. Based on kinetic analysis of the protein splicing reactions, we propose a general strategy to improve ligation yields by protein trans-splicing, which could significantly enhance the applications of protein ligation by protein trans-splicing.

  19. Screening for biohydrogen production by cyanobacteria isolated from the Baltic Sea and Finnish lakes

    Energy Technology Data Exchange (ETDEWEB)

    Allahverdiyeva, Yagut; Leino, Hannu; Shunmugam, Sumathy; Aro, Eva-Mari [Department of Biochemistry and Food Chemistry, Plant Physiology and Molecular Biology, University of Turku, Tykistokatu 6 A, FIN-20014 Turku (Finland); Saari, Lyudmila; Fewer, David P.; Sivonen, Kaarina [Department of Applied Chemistry and Microbiology, University of Helsinki, P.O. Box 56, FI-00014 (Finland)

    2010-02-15

    Cyanobacteria are the only bacteria capable of performing oxygenic photosynthesis in which they harness solar energy and convert it into chemical energy stored in carbohydrates. Under specific conditions, cyanobacteria can use solar energy to produce also molecular hydrogen. Biodiversity among cyanobacteria for H{sub 2} production has not been efficiently studied. Here we report the screening of 400 cyanobacterial strains isolated from the Baltic Sea and Finnish lakes for efficient H{sub 2} producers. Approximately 50% of these strains produced detectable amounts of H{sub 2}. Ten strains produced similar or up to 4 times as much of H{sub 2} as the hydrogenase mutants of Anabaena PCC 7120 and Nostoc punctiforme ATCC 29133 specifically engineered in different laboratories to produce higher amounts of H{sub 2}. All ten H{sub 2} producers are N{sub 2}-fixing filamentous, heterocystous strains, seven of them are benthic and three are planktonic strains. Different culturing parameters, such as light intensity, cell density, pH and temperature had a pronounced effect on the H{sub 2} production rates of the two good H{sub 2} producers, Calothrix 336/3 and XPORK 5E strains. Notably, the culture conditions for optimal H{sub 2} production varied between different cyanobacterial strains. (author)

  20. Physico Chemical Characteristics of Lakhna Devi Temple Water Tank, Lakhna, Bakewar, Etawah, U.P. with reference to Cyanobacterial Diversity

    Directory of Open Access Journals (Sweden)

    Omesh Bajpai

    2013-08-01

    Full Text Available Fresh water bodies in populated plains of tropical countries face various disturbances in the form of pollutant and nutrient inflow, heavy metal and elemental precipitation (wet or dry and constant silt inflow (natural or anthropogenic. The physico-chemical characteristics are very much important for any water body. In lentic water bodies these characteristics shows very much variation because in summer they have less and in rains large amount of water. These adverse constrain effectively influence the algal assemblage and can be a good indicator of overall health of the water body. In the study different Physico-chemical characteristics and algal diversity were monthly observed for one year duration (Jun. 2008 to May 2009. Some of 31 species of Cyanobacteria recorded from the study site viz. Microcystis aerughinosa, M. flos-aquae, M. robusta, Chroococcus minor, C.minutes, Gloeocapsa magma, Aphanocapsa littoralis, Aphanothece microscopis, Coelosphaerium kuetzingianum, Merismopedia glauca, M. tenuissima, Arthrospira spriulinoides, Spirulina gigantean, S. major, Oscillatoria formosa, O. subuliformis, O. princeps, Phormidium ambiguum, P. fragile, P. lucidum, Lyngbya contorta, O. epiphytica, O.majuscule, Cylindrospermum minutissimum, Nostoc commune, N. punctiforme, Anabaena oscillarioides, A. oryzae, Calothrix gloeocola, Rivularia aquatic and Gloeotrichia pisum.

  1. An Engineered Split Intein for Photoactivated Protein Trans-Splicing.

    Directory of Open Access Journals (Sweden)

    Stanley Wong

    Full Text Available Protein splicing is mediated by inteins that auto-catalytically join two separated protein fragments with a peptide bond. Here we engineered a genetically encoded synthetic photoactivatable intein (named LOVInC, by using the light-sensitive LOV2 domain from Avena sativa as a switch to modulate the splicing activity of the split DnaE intein from Nostoc punctiforme. Periodic blue light illumination of LOVInC induced protein splicing activity in mammalian cells. To demonstrate the broad applicability of LOVInC, synthetic protein systems were engineered for the light-induced reassembly of several target proteins such as fluorescent protein markers, a dominant positive mutant of RhoA, caspase-7, and the genetically encoded Ca2+ indicator GCaMP2. Spatial precision of LOVInC was demonstrated by targeting activity to specific mammalian cells. Thus, LOVInC can serve as a general platform for engineering light-based control for modulating the activity of many different proteins.

  2. Limnology and cyanobacterial diversity of high altitude lakes of Lahaul-Spiti in Himachal Pradesh, India.

    Science.gov (United States)

    Singh, Y; Khattar, Jis; Singh, D P; Rahi, P; Gulati, A

    2014-09-01

    Limnological data of four high altitude lakes from the cold desert region of Himachal Pradesh, India, has been correlated with cyanobacterial diversity. Physico-chemical characteristics and nutrient contents of the studied lakes revealed that Sissu Lake is mesotrophic while Chandra Tal, Suraj Tal and Deepak Tal are ultra-oligotrophic. Based on morphology and 16S rRNA gene sequence, a total of 20 cyanobacterial species belonging to 11 genera were identified. Canonical correspondence analysis distinguished three groups of species with respect to their occurrence and nutrient/physical environment demand. The first group, which included Nostoc linckia, N. punctiforme, Nodularia sphaerocarpa, Geitlerinema acutissimum, Limnothrix redekii, Planktothrix agardhii and Plank. clathrata, was characteristic of water with high nutrient content and high temperature. The second group, including Gloeocapsopsis pleurocapsoides, Leptolyngbya antarctica, L. frigida, Pseudanabaena frigida and N. spongiaeforme, occurred in oligotrophic water with high pH and low temperature. The distribution of third group of Cyanobium parvum, Synechocystis pevalekii, L. benthonica, L. foveolarum, L. lurida, L. valderiana, Phormidium autumnale and P. chalybeum could not be associated with a particular environmental condition because of their presence in all sampling sites.

  3. Reactive ground-state pathways are not ubiquitous in red/green cyanobacteriochromes.

    Science.gov (United States)

    Chang, Che-Wei; Gottlieb, Sean M; Kim, Peter W; Rockwell, Nathan C; Lagarias, J Clark; Larsen, Delmar S

    2013-09-26

    Recent characterization of the red/green cyanobacteriochrome (CBCR) NpR6012g4 revealed a high quantum yield for its forward photoreaction [J. Am. Chem. Soc. 2012, 134, 130-133] that was ascribed to the activity of hidden, productive ground-state intermediates. The dynamics of the pathways involving these ground-state intermediates was resolved with femtosecond dispersed pump-dump-probe spectroscopy, the first such study reported for any CBCR. To address the ubiquity of such second-chance initiation dynamics (SCID) in CBCRs, we examined the closely related red/green CBCR NpF2164g6 from Nostoc punctiforme. Both NpF2164g6 and NpR6012g4 use phycocyanobilin as the chromophore precursor and exhibit similar excited-state dynamics. However, NpF2164g6 exhibits a lower quantum yield of 32% for the generation of the isomerized Lumi-R primary photoproduct, compared to 40% for NpR6012g4. This difference arises from significantly different ground-state dynamics between the two proteins, with the SCID mechanism deactivated in NpF2164g6. We present an integrated inhomogeneous target model that self-consistently fits the pump-probe and pump-dump-probe signals for both forward and reverse photoreactions in both proteins. This work demonstrates that reactive ground-state intermediates are not ubiquitous phenomena in CBCRs.

  4. Novel Photodynamics in Phytochrome & Cyanobacteriochrome Photosensory Proteins

    Science.gov (United States)

    Larsen, Delmar

    2015-03-01

    The photodynamics of recently characterized phytochrome and cyanobacteriochrome photoreceptors are discussed. Phytochromes are red/far-red photosensory proteins that utilize the photoisomerization of a linear tetrapyrrole (bilin) chromophore to detect the red to far-red light ratio. Cyanobacteriochromes (CBCRs) are distantly related cyanobacterial photosensors with homologous bilin-binding GAF domains, but exhibit greater spectral diversity. The excited-state mechanisms underlying the initial photoisomerization in the forward reactions of the cyanobacterial photoreceptor Cph1 from Synechocystis, the RcaE CBCR from Fremyella diplosiphon, and Npr6012g4 CBCR from Nostoc punctiforme were contrasted via multipulse pump-dump-probe transient spectroscopy. A rich excited-state dynamics are resolved involving a complex interplay of excited-state proton transfer, photoisomerization, multilayered inhomogeneity, and reactive intermediates, and Le Chatelier redistribution. NpR6012g4 exhibits a high quantum yield for its forward photoreaction (40%) that was ascribed to the activity of hidden, productive ground-state intermediates via a ``second chance initiation dynamics'' (SCID) mechanism. This work was supported by a grant from the Chemical Sciences, Geosciences, and Biosciences Division, Office of Basic Energy Sciences, Office of Science, United States Department of Energy (DOE DE-FG02-09ER16117).

  5. Inducible hydrogenase in cyanobacteria enhances N/sub 2/ fixation. [Nostoc, anabaena

    Energy Technology Data Exchange (ETDEWEB)

    Tel-Or, E.; Luijk, L.W.; Packer, L.

    1977-06-01

    Whether hydrogenase is activated or induced, we found no evidence for activation of either consumption or production of H/sub 2/ in aerobically-grown cultures but both of these activities increased 5--20-fold when cultures are grown under H/sub 2/ gas. On the other hand, hydrogenase-catalyzed consumption of H/sub 2/ is stimulated by light and/or light plus CO/sub 2/ in hydrogenase-induced cultures. Nitrogenase activity appears to be induced in cultures grown under H/sub 2/. Studies unambiguously establish that in H/sub 2/-induced cultures hydrogenase manifests a cooperativity with nitrogenase. In the presence of H/sub 2/ the activity of nitrogenase is stimulated 3--5-fold such that rates of about 3 ..mu..mol N/sub 2/ fixed/mg chlorophyll/h are obtained if the method of Peterson and Burris is used to convert acetylene reduction data to equivalents of /sup 15/N/sub 2/ fixation to ammonia.

  6. Biochemical characterization of putative adenylate dimethylallyltransferase and cytokinin dehydrogenase from Nostoc sp. PCC 7120

    NARCIS (Netherlands)

    Frébortová, Jitka; Greplová, Marta; Seidl, Michael F.; Heyl, Alexander; Frébort, Ivo

    2015-01-01

    Cytokinins, a class of phytohormones, are adenine derivatives common to many different organisms. In plants, these play a crucial role as regulators of plant development and the reaction to abiotic and biotic stress. Key enzymes in the cytokinin synthesis and degradation in modern land plants are

  7. Screening for acetylcholinesterase inhibitory activity in cyanobacteria of the genus Nostoc

    Czech Academy of Sciences Publication Activity Database

    Zelík, Petr; Lukešová, Alena; Voloshko, L. N.; Štys, D.; Kopecký, Jiří

    2009-01-01

    Roč. 24, č. 2 (2009), s. 531-536 ISSN 1475-6366 R&D Projects: GA MŠk ME 874 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z60660521 Keywords : acetylcholinesterase * bioactivity * inhibitors Subject RIV: EE - Microbiology, Virology Impact factor: 1.496, year: 2009

  8. Protein (Cyanobacteria): 130081 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available n all1672 Nostoc sp. PCC 7120 MFKILFDSDLILDAVMNRTELAEDVRTLLENLHPSIRLYLTDVGLQKVSTYTYCLKNSQIPEIIVDWLQEQIQICPIDQGLLQKARYSPLRDFESAVELACINHYQLNAIVTNKPEDFIVTAHPLCVWSFADLWLRVNLESQLQATIHS ...

  9. Protein (Cyanobacteria): 298492611 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 551115:2260 ... 50S ribosomal protein L20 'Nostoc azollae' 0708 MTRVKRGNVARKRRNKILKLAKGFRGSHSTLFRTAHQQVMKALRSAYRDRKKKKRDFRRLWITRINAASRQNGLSYSQLIGNLKKANVELNRKMLAQLAVLDPASFAKVAELANSVKA

  10. Protein (Cyanobacteria): 464885 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available tein Nos7524_5075 Nostoc sp. PCC 7524 MSLSYDISSILNLLRSLPSTELRTVKEEIDSILKERGTTIRIPDPFKIVPAQVVLKDSNLEESTSEVKLEEEYQQINEDISEPSGVLNLSSIKDATDNKAEKKEAIQEIPRPLGIWKGKVEISEDFYETTNDILSEFGIEE ...

  11. ORF Sequence: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein [Nostoc sp. PCC 7120] MALMGATGSGKSTLLENLIGIKQPQSGKIWINDISLEPQTLPQVRRYIGFGFQDANDQLFMPTILEDITFGPLNYGVPAAIARDQARQLLADFGLEAYANRSAH...ELSGGQRRLAALAAILALEPAILILDEPTTGLDPAWRRHLARVLFNLPVQVMLIASHELHWLGKVTQRALVLSNGRIQLDNEIQPLLQNGEILEQLGLPIDW

  12. Protein (Cyanobacteria): 175822 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available agen triple helix repeat-containing protein 'Nostoc azollae' 0708 MRLIEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGGEIFLMPYALCPMPYALCPMPYALCPMPYALCPMPYALCPMPYAQNQDFSHPNRESSVKLFSSVAPKP ...

  13. Enhanced biohydrogen production by the N{sub 2}-fixing cyanobacterium Anabaena siamensis strain TISTR 8012

    Energy Technology Data Exchange (ETDEWEB)

    Khetkorn, Wanthanee [Program of Biotechnology, Faculty of Science, Chulalongkorn University, Bangkok, 10330 (Thailand); Laboratory of Cyanobacterial Biotechnology, Department of Biochemistry, Faculty of Science, Chulalongkorn University, Phayathai Road, Bangkok, 10330 (Thailand); Department of Photochemistry and Molecular Science, Uppsala University, Box 523, SE-75120, Uppsala (Sweden); Lindblad, Peter [Department of Photochemistry and Molecular Science, Uppsala University, Box 523, SE-75120, Uppsala (Sweden); Incharoensakdi, Aran [Laboratory of Cyanobacterial Biotechnology, Department of Biochemistry, Faculty of Science, Chulalongkorn University, Phayathai Road, Bangkok, 10330 (Thailand)

    2010-12-15

    The efficiency of hydrogen production depends on several factors. We focused on external conditions leading to enhanced hydrogen production when using the N{sub 2}-fixing cyanobacterium Anabaena siamensis TISTR 8012, a novel strain isolated from a rice paddy field in Thailand. In this study, we controlled key factors affecting hydrogen production such as cell age, light intensity, time of light incubation and source of carbon. Our results showed an enhanced hydrogen production when cells, at log phase, were adapted under N{sub 2}-fixing condition using 0.5% fructose as carbon source and a continuous illumination of 200 {mu}E m{sup -2} s{sup -1} for 12 h under anaerobic incubation. The maximum hydrogen production rate was 32 {mu}mol H{sub 2} mg chl a{sup -1} h{sup -1}. This rate was higher than that observed in the model organisms Anabaena PCC 7120, Nostoc punctiforme ATCC 29133 and Synechocystis PCC 6803. This higher production was likely caused by a higher nitrogenase activity since we observed an upregulation of nifD. The production did not increase after 12 h which was probably due to an increased activity of the uptake hydrogenase as evidenced by an increased hupL transcript level. Interestingly, a proper adjustment of light conditions such as intensity and duration is important to minimize both the photodamage of the cells and the uptake hydrogenase activity. Our results indicate that A. siamensis TISTR 8012 has a high potential for hydrogen production with the ability to utilize sugars as substrate to produce hydrogen. (author)

  14. Cell wall amidase AmiC1 is required for cellular communication and heterocyst development in the cyanobacterium Anabaena PCC 7120 but not for filament integrity.

    Science.gov (United States)

    Berendt, Susanne; Lehner, Josef; Zhang, Yao Vincent; Rasse, Tobias M; Forchhammer, Karl; Maldener, Iris

    2012-10-01

    Filamentous cyanobacteria of the order Nostocales display typical properties of multicellular organisms. In response to nitrogen starvation, some vegetative cells differentiate into heterocysts, where fixation of N(2) takes place. Heterocysts provide a micro-oxic compartment to protect nitrogenase from the oxygen produced by the vegetative cells. Differentiation involves fundamental remodeling of the gram-negative cell wall by deposition of a thick envelope and by formation of a neck-like structure at the contact site to the vegetative cells. Cell wall-hydrolyzing enzymes, like cell wall amidases, are involved in peptidoglycan maturation and turnover in unicellular bacteria. Recently, we showed that mutation of the amidase homologue amiC2 gene in Nostoc punctiforme ATCC 29133 distorts filament morphology and function. Here, we present the functional characterization of two amiC paralogues from Anabaena sp. strain PCC 7120. The amiC1 (alr0092) mutant was not able to differentiate heterocysts or to grow diazotrophically, whereas the amiC2 (alr0093) mutant did not show an altered phenotype under standard growth conditions. In agreement, fluorescence recovery after photobleaching (FRAP) studies showed a lack of cell-cell communication only in the AmiC1 mutant. Green fluorescent protein (GFP)-tagged AmiC1 was able to complement the mutant phenotype to wild-type properties. The protein localized in the septal regions of newly dividing cells and at the neck region of differentiating heterocysts. Upon nitrogen step-down, no mature heterocysts were developed in spite of ongoing heterocyst-specific gene expression. These results show the dependence of heterocyst development on amidase function and highlight a pivotal but so far underestimated cellular process, the remodeling of peptidoglycan, for the biology of filamentous cyanobacteria.

  15. Separation of Aeruginosin-865 from Cultivated Soil Cyanobacterium (Nostoc sp.) by Centrifugal Partition Chromatography combined with Gel Permeation Chromatography.

    Science.gov (United States)

    Cheel, José; Minceva, Mirjana; Urajová, Petra; Aslam, Rabya; Hrouzek, Pavel; Kopecký, Jiří

    2015-10-01

    Aeruginosin-865 was isolated from cultivated soil cyanobacteria using a combination of centrifugal partition chromatography (CPC) and gel permeation chromatography. The solubility of Aer-865 in different solvents was evaluated using the conductor-like screening model for real solvents (COSMO-RS). The CPC separation was performed in descending mode with a biphasic solvent system composed of water-n-BuOH-acetic acid (5:4:1, v/v/v). The upper phase was used as a stationary phase, whereas the lower phase was employed as a mobile phase at a flow rate of 10 mL/min. The revolution speed and temperature of the separation column were 1700 rpm and 25 degrees C, respectively. Preparative CPC separation followed by gel permeation chromatography was performed on 50 mg of crude extract yielding Aer-865 (3.5 mg), with a purity over 95% as determined by HPLC. The chemical identity of the isolated compound was confirmed by comparing its spectroscopic data (UV, HRESI-MS, HRESI-MS/MS) with those of an authentic standard and data available in the literature.

  16. Two-Step Separation of Nostotrebin 6 from Cultivated Soil Cyanobacterium (Nostoc sp. by High Performance Countercurrent Chromatography

    Directory of Open Access Journals (Sweden)

    José Cheel

    2014-06-01

    Full Text Available High performance countercurrent chromatography (HPCCC was successfully applied for the separation of nostotrebin 6 from cultivated soil cyanobacteria in a two-step operation. A two-phase solvent system composed of n-hexane–ethyl acetate–methanol–water (4:5:4:5, v/v/v/v was employed for the HPCCC separation. In the first-step operation, its neutral upper phase was used as stationary phase and its basic lower phase (1% NH3 in lower phase was employed as mobile phase at a flow rate of 1 mL/min. In the second operation step, its neutral upper phase was used as stationary phase, whereas both its neutral lower phase and basic lower phase were employed as mobile phase with a linear gradient elution at a flow rate of 0.8 mL/min. The revolution speed and temperature of the separation column were 1,000 rpm and 30 °C, respectively. Using HPCCC followed by clean-up on Sephadex LH-20 gel, 4 mg of nostotrebin 6 with a purity of 99% as determined by HPLC/DAD-ESI-HRMS was obtained from 100 mg of crude extract. The chemical identity of the isolated compound was confirmed by comparing its spectroscopic data (UV, ESI-HRMS, ESI-HRMS2 with those of an authentic standard and data available in the literature.

  17. N2-fixation by freshly isolated Nostoc from coralloid roots of the cycad Macrozamia riedlei (Fisch. ex Gaud.) Gardn

    International Nuclear Information System (INIS)

    Lindblad, P.; Atkins, C.A.; Pate, J.S.

    1991-01-01

    Nitrogenase (EC 1.7.99.2) activity (acetylene reduction) and nitrogen fixation ( 15 N 2 fixation) were measured in cyanobacteria freshly isolated from the coralloid roots of Macrozamia riedlei (Fisch. ex Gaud.) Gardn. The data indicate that cyanobacteria within cycad coralloid roots are differentiated specifically for symbiotic functioning in a microaerobic environment. Specializations include a high heterocyst frequency, enhanced permeability to O 2 , and a direct dependence on the cycad for substrates to support nitrogenase activity

  18. Comparison of plasmids from the cyanobacterium Nostoc PCC 7524 with two mutant strains unable to form heterocysts

    NARCIS (Netherlands)

    Reaston, J.; Hondel, C.A.M.J.J. van den; Ende, A. van der; Arkel, G.A. van; Stewart, W.D.P.; Herdman, M.

    1980-01-01

    Cyanobacteria (bluegreen bacteria) are O₂-evolving photosynthetic prokaryotes some species of which fix N₂ in air because the nitrogenase is protected from O₂ inactivation by being localized in differentiated cells called heterocysts. Recently much attention has been paid to the possible role

  19. In situ response of Nostoc commune s.l. colonies to desiccation in Central Svalbard, Norwegian High Arctic

    Czech Academy of Sciences Publication Activity Database

    Kvíderová, Jana; Elster, Josef; Šimek, Miloslav

    2011-01-01

    Roč. 11, č. 1 (2011), s. 87-97 ISSN 1802-5439 R&D Projects: GA MŠk ME 934; GA MŠk LA341; GA MŠk LC06066; GA AV ČR IAA600660605 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60660521 Keywords : desiccation * cyanobacteria * Arctic Subject RIV: EF - Botanics Impact factor: 1.327, year: 2011

  20. Separation of Aeruginosin-865 from Cultivated Soil Cyanobacterium (Nostoc sp.) by Centrifugal Partition Chromatography combined with Gel Permeation Chromatography

    Czech Academy of Sciences Publication Activity Database

    Cheel, José; Minceva, M.; Urajová, Petra; Aslam, R.; Hrouzek, Pavel; Kopecký, Jiří

    2015-01-01

    Roč. 10, č. 10 (2015), s. 1719-1722 ISSN 1934-578X R&D Projects: GA MŠk EE2.3.30.0059; GA MŠk ED2.1.00/03.0110; GA MŠk LO1416 Institutional support: RVO:61388971 Keywords : Cyanobacteria * Aeruginosin-865 * Centrifugal partition chromatography Subject RIV: EE - Microbiology, Virology Impact factor: 0.884, year: 2015

  1. Presence and expression of hydrogenase specific C-terminal endopeptidases in cyanobacteria

    Directory of Open Access Journals (Sweden)

    Lindblad Peter

    2003-05-01

    Full Text Available Abstract Background Hydrogenases catalyze the simplest of all chemical reactions: the reduction of protons to molecular hydrogen or vice versa. Cyanobacteria can express an uptake, a bidirectional or both NiFe-hydrogenases. Maturation of those depends on accessory proteins encoded by hyp-genes. The last maturation step involves the cleavage of a ca. 30 amino acid long peptide from the large subunit by a C-terminal endopeptidase. Until know, nothing is known about the maturation of cyanobacterial NiFe-hydrogenases. The availability of three complete cyanobacterial genome sequences from strains with either only the uptake (Nostoc punctiforme ATCC 29133/PCC 73102, only the bidirectional (Synechocystis PCC 6803 or both NiFe-hydrogenases (Anabaena PCC 7120 prompted us to mine these genomes for hydrogenase maturation related genes. In this communication we focus on the presence and the expression of the NiFe-hydrogenases and the corresponding C-terminal endopeptidases, in the three strains mentioned above. Results We identified genes encoding putative cyanobacterial hydrogenase specific C-terminal endopeptidases in all analyzed cyanobacterial genomes. The genes are not part of any known hydrogenase related gene cluster. The derived amino acid sequences show only low similarity (28–41% to the well-analyzed hydrogenase specific C-terminal endopeptidase HybD from Escherichia coli, the crystal structure of which is known. However, computational secondary and tertiary structure modeling revealed the presence of conserved structural patterns around the highly conserved active site. Gene expression analysis shows that the endopeptidase encoding genes are expressed under both nitrogen-fixing and non-nitrogen-fixing conditions. Conclusion Anabaena PCC 7120 possesses two NiFe-hydrogenases and two hydrogenase specific C-terminal endopeptidases but only one set of hyp-genes. Thus, in contrast to the Hyp-proteins, the C-terminal endopeptidases are the only known

  2. Comparison of orthologous cyanobacterial aldehyde deformylating oxygenases in the production of volatile C3-C7 alkanes in engineered E. coli

    Directory of Open Access Journals (Sweden)

    Pekka Patrikainen

    2017-12-01

    Full Text Available Aldehyde deformylating oxygenase (ADO is a unique enzyme found exclusively in photosynthetic cyanobacteria, which natively converts acyl aldehyde precursors into hydrocarbon products embedded in cellular lipid bilayers. This capacity has opened doors for potential biotechnological applications aiming at biological production of diesel-range alkanes and alkenes, which are compatible with the nonrenewable petroleum-derived end-products in current use. The development of production platforms, however, has been limited by the relative inefficiency of ADO enzyme, promoting research towards finding new strategies and information to be used for rational design of enhanced pathways for hydrocarbon over-expression. In this work we present an optimized approach to study different ADO orthologs derived from different cyanobacterial species in an in vivo set-up in Escherichia coli. The system enabled comparison of alternative ADOs for the production efficiency of short-chain volatile C3-C7 alkanes, propane, pentane and heptane, and provided insight on the differences in substrate preference, catalytic efficiency and limitations associated with the enzymes. The work concentrated on five ADO orthologs which represent the most extensively studied cyanobacterial species in the field, and revealed distinct differences between the enzymes. In most cases the ADO from Nostoc punctiforme PCC 73102 performed the best in respect to yields and initial rates for the production of the volatile hydrocarbons. At the other extreme, the system harboring the ADO form Synechococcus sp. RS9917 produced very low amounts of the short-chain alkanes, primarily due to poor accumulation of the enzyme in E. coli. The ADOs from Synechocystis sp. PCC 6803 and Prochlorococcus marinus MIT9313, and the corresponding variant A134F displayed less divergence, although variation between chain-length preferences could be observed. The results confirmed the general trend of ADOs having

  3. Engineering of a plasmid-free Escherichia coli strain for improved in vivo biosynthesis of astaxanthin

    Directory of Open Access Journals (Sweden)

    Steuer Kristin

    2011-04-01

    Full Text Available Abstract Background The xanthophyll astaxanthin is a high-value compound with applications in the nutraceutical, cosmetic, food, and animal feed industries. Besides chemical synthesis and extraction from naturally producing organisms like Haematococcus pluvialis, heterologous biosynthesis in non-carotenogenic microorganisms like Escherichia coli, is a promising alternative for sustainable production of natural astaxanthin. Recent achievements in the metabolic engineering of E. coli strains have led to a significant increase in the productivity of carotenoids like lycopene or β-carotene by increasing the metabolic flux towards the isoprenoid precursors. For the heterologous biosynthesis of astaxanthin in E. coli, however, the conversion of β-carotene to astaxanthin is obviously the most critical step towards an efficient biosynthesis of astaxanthin. Results Here we report the construction of the first plasmid-free E. coli strain that produces astaxanthin as the sole carotenoid compound with a yield of 1.4 mg/g cdw (E. coli BW-ASTA. This engineered E. coli strain harbors xanthophyll biosynthetic genes from Pantoea ananatis and Nostoc punctiforme as individual expression cassettes on the chromosome and is based on a β-carotene-producing strain (E. coli BW-CARO recently developed in our lab. E. coli BW-CARO has an enhanced biosynthesis of the isoprenoid precursor isopentenyl diphosphate (IPP and produces β-carotene in a concentration of 6.2 mg/g cdw. The expression of crtEBIY along with the β-carotene-ketolase gene crtW148 (NpF4798 and the β-carotene-hydroxylase gene (crtZ under controlled expression conditions in E. coli BW-ASTA directed the pathway exclusively towards the desired product astaxanthin (1.4 mg/g cdw. Conclusions By using the λ-Red recombineering technique, genes encoding for the astaxanthin biosynthesis pathway were stably integrated into the chromosome of E. coli. The expression levels of chromosomal integrated recombinant

  4. Photoconversion changes bilin chromophore conjugation and protein secondary structure in the violet/orange cyanobacteriochrome NpF2164g3' [corrected].

    Science.gov (United States)

    Lim, Sunghyuk; Rockwell, Nathan C; Martin, Shelley S; Dallas, Jerry L; Lagarias, J Clark; Ames, James B

    2014-06-01

    Cyanobacteriochromes (CBCRs) are cyanobacterial photoreceptors distantly related to phytochromes. All CBCRs examined to date utilize a conserved Cys residue to form a covalent thioether linkage to the bilin chromophore. In the insert-Cys CBCR subfamily, a second conserved Cys can covalently link to the bilin C10 methine bridge, allowing detection of near-UV to blue light. The best understood insert-Cys CBCR is the violet/orange CBCR NpF2164g3 from Nostoc punctiforme, which has a stable second linkage in the violet-absorbing dark state. Photoconversion of NpF2164g3 leads to elimination of the second linkage and formation of an orange-absorbing photoproduct. We recently reported NMR chemical shift assignments for the orange-absorbing photoproduct state of NpF2164g3. We here present equivalent information for its violet-absorbing dark state. In both photostates, NpF2164g3 is monomeric in solution and regions containing the two conserved Cys residues essential for photoconversion are structurally disordered. In contrast to blue light receptors such as phototropin, NpF2164g3 is less structurally ordered in the dark state than in the photoproduct. The insert-Cys insertion loop and C-terminal helix exhibit light-dependent structural changes. Moreover, a motif containing an Asp residue also found in other CBCRs and in phytochromes adopts a random-coil structure in the dark state but a stable α-helix structure in the photoproduct. NMR analysis of the chromophore is consistent with a less ordered dark state, with A-ring resonances only resolved in the photoproduct. The C10 atom of the bilin chromophore exhibits a drastic change in chemical shift upon photoconversion, changing from 34.5 ppm (methylene) in the dark state to 115 ppm (methine) in the light-activated state. Our results provide structural insight into the two-Cys photocycle of NpF2164g3 and the structurally diverse mechanisms used for light perception by the larger phytochrome superfamily.

  5. Description of the cyanobacterial genus Desmonostoc gen. nov. including D. muscorum comb. nov. as a distinct, phylogenetically coherent taxon related to the genus Nostoc

    Czech Academy of Sciences Publication Activity Database

    Hrouzek, Pavel; Lukešová, Alena; Mareš, Jan; Ventura, S.

    2013-01-01

    Roč. 13, č. 2 (2013), s. 201-213 ISSN 1802-5439 R&D Projects: GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 ; RVO:67985939 ; RVO:60077344 Keywords : Cyanobacteria * Desmonostoc * Ecology Subject RIV: EE - Microbiology, Virology; EF - Botanics (BU-J) Impact factor: 1.627, year: 2013 http://fottea.czechphycology.cz/_contents/F13-2-2013-08.pdf

  6. Phylogenetic and morphological evaluation of the genera .i.Anabaena./i., .i.Aphanizomenon./i., .i.Trichormus./i. and .i.Nostoc./i. (Nostocales, Cyanobacteria)

    Czech Academy of Sciences Publication Activity Database

    Rajaniemi, P.; Hrouzek, P.; Kaštovská, Klára; Willame, R.; Rantala, A.; Hoffmann, L.; Komárek, Jiří; Sivonen, K.

    2005-01-01

    Roč. 55, č. 1 (2005), s. 11-26 ISSN 1466-5026 Grant - others:Academy of Finland(FI) 201576; EU(XE) MIDI-CHIP EKV2-CT-1999-00026 Institutional research plan: CEZ:AV0Z6005908; CEZ:AV0Z6017912 Keywords : Nostocales * phylogenetic analyses * morphology Subject RIV: EE - Microbiology , Virology Impact factor: 2.744, year: 2005

  7. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available bosomal protein L22 ... [Nostoc sp. PCC 7120] ... Length = 111 ... Query: 7 ... EVKAIARFIRMS...PYKVRRVLDQIRGLSYREALIILEFMPYRATEPVLTLLRSAAANAEHN 66 ... EVKAIARFIRMSPYKVRRVLDQIRG...LSYREALIILEFMPYRATEPVLTLLRSAAANAEHN Sbjct: 1 ... EVKAIARFIRMSPYKVRRVLDQIRGLSYREALIILEFMPYRATEPVLTLLRSAAANAEHN 60 ...

  8. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available stidine kinase ... [Nostoc sp. PCC 7120] ... Length = 73 ... Query: 410 ADLIQLNRLKDEFLACISH...ELKTPLTAVLGLSRLLVDQQLGELNERQARYAGLIHQSGRH 469 ... ADLIQLNRLKDEFLACISHELKTPLTAVLG...LSRLLVDQQLGELNERQARYAGLIHQSGRH Sbjct: 1 ... ADLIQLNRLKDEFLACISHELKTPLTAVLGLSRLLVDQQLGELNERQARYAGLIHQSGRH 60 ...

  9. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... family [Nostoc sp. PCC 7120] ... Length = 102 ... Query: 48 ... IGIDLEYLRPTSD...LESLAKRFFLPREYELLRSLPDEQKQKIFFRYWTCKEAYLKATGDGI 107 ... IGIDLEYLRPTSDLESLAKRFFLPREYELLRSLPDEQ...KQKIFFRYWTCKEAYLKATGDGI Sbjct: 1 ... IGIDLEYLRPTSDLESLAKRFFLPREYELLRSLPDEQKQKIFFRYWTCKEAYLKATGDGI 60 ...

  10. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... - Nostoc sp. (strain PCC 7120) ... Length = 66 ... Query: 5 ... ESQTPVTLSDRELQIIDLVAAGLTNQEIAAKLEISKRTVDNHIS...NILDKTRTENRVALVR 64 ... ESQTPVTLSDRELQIIDLVAAGLTNQEIAAKLEISKRTVDNHISNILDKTRTENRVALVR Sbjct: 1 ... ESQTPVTLSDRELQIIDLVAAGLTNQEIAAKLEISKRTVDNHISNILDKTRTENRVALVR 60 ...

  11. Inoculation effects of two South African cyanobacteria strains on ...

    African Journals Online (AJOL)

    Two South African cyanobacteria strains (coded 3g and 7e) of the genus Nostoc were evaluated for improvement of the aggregate stability of a silty loam soil with low organic C content and compared with Nostoc strain 9v isolated from a Tanzanian soil. The soil was either cropped with maize or non-cropped and inoculated ...

  12. USE OF WASTE WATER OF LIVESTOCK IN ORDER TO OBTAIN BIOMASS FODDER CHEAP

    Directory of Open Access Journals (Sweden)

    MELNICIUC CRISTINA

    2009-12-01

    Full Text Available The aim of this work was the combination of two directions for use of algae: algae biomass obtaining fodder minor and wastewater purification. Subject research have served cianofite species of algae: Nostoc gelatinosum, N. flagelliforme and Anabaena propinqua. As nutrient medium were used wastewater from livestock complexes (poultry and pigs with a rich content of organic substances. Investigations carried out indicate that the largest quantity of biomass of Nostoc flageliforme is achieved in the cultivation with wastewater by 1% from pig complexes -13.2 g / l, Nostoc gelatinosum-1% -68 g / l. and Anabaena propinqua-5%-8.8g/l.

  13. Hawaii Energy Resource Overviews. Volume 3. Hawaiian ecosystem and its environmental determinants with particular emphasis on promising areas for geothermal development

    Energy Technology Data Exchange (ETDEWEB)

    Siegel, S.M.

    1980-06-01

    A brief geobiological history of the Hawaiian Islands is presented. Climatology, physiography, and environmental degradation are discussed. Soil types and associations, land use patterns and ratings, and vegetation ecology are covered. The fauna discussed include: ancient and recent vertebrate life, land mollusca, marine fauma, and insect fauna. (MHR)

  14. Scour hole ('wielen') sediments as historical archive of floods, vegetation, and air and water quality in lowlands

    NARCIS (Netherlands)

    Cremer, Holger; van Hoof, Thomas; Bunnik, Frans; Donders, Timme

    2010-01-01

    The sediment record from a maximum 18 m deep scour hole lake (Haarsteegse Wiel) near the embanked Meuse River in the Netherlands was studied for past changes in flooding frequency, water quality, and landscape change using a combined geochemical, geobiological and historical approach. The results

  15. Ferimento puntiforme em tórax produzindo lesão cardíaca

    OpenAIRE

    Spencer Netto,Fernando Antônio Campelo; Vasconcelos,Paulo Ricardo Camelo; Pinto,Joma Magaly Cintra

    2001-01-01

    We report a case of a 17-year-old man with punctiforms thoracic and abdominal wounds. Clinical examination showed signs of cardiac tamponade. Roentgenogram demonstrated widened mediastinum and thoracotomy confirmed cardiac wound. We analyse the unusual trauma agent and prognostic factors in cardiac trauma. Wounds with "innocent" aspect can cause fatal lesions.

  16. Dicty_cDB: Contig-U12564-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 498178_1( DQ498178 |pid:none) Human rotavirus A isolate rj5323/0... 35 8.9 BA000043_332( BA000043 |pid:none)...stoc punctiforme PCC 73102, c... 35 8.9 DQ498183_1( DQ498183 |pid:none) Human rotavirus A isolate rj5619/0..

  17. Protein (Cyanobacteria): 285307 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ith PAS/PAC and Chase2 sensors Nostoc sp. PCC 7107 MSKQLGKSFVSSNLNLNLKQLLDRKYRQLVVAFSVAVCIILLRSVGMFQSLELAGLD...YP_007048593.1 1117:4890 1161:684 1162:948 1177:381 317936:58 diguanylate cyclase w

  18. Is there foul play in the leaf pocket? The metagenome of floating fern

    NARCIS (Netherlands)

    Dijkhuizen, L.W.; Brouwer, P.; Bolhuis, H.; Reichart, G.-J.; Koppers, N.; Huettel, B.; Bolger, A.M.; Li, F.-W.; Cheng, S.; Liu, X.; Wong, G.K.-S.; Pryer, K.; Weber, A.; Bräutigam, A.; Schluepmann, H.

    2018-01-01

    Dinitrogen fixation by Nostoc azollae residing in specialized leaf pockets supports prolific growth of the floating fern Azolla filiculoides. To evaluate contributions by further microorganisms, the A. filiculoides microbiome and nitrogen metabolism in bacteria persistently associated with Azolla

  19. Is there foul play in the leaf pocket? The metagenome of floating fern Azolla reveals endophytes that do not fix N2but may denitrify

    NARCIS (Netherlands)

    Dijkhuizen, Laura W.; Brouwer, Paul; Bolhuis, Henk; Reichart, Gert Jan; Koppers, Nils; Huettel, Bruno; Bolger, Anthony M.; Li, Fay Wei; Cheng, Shifeng; Liu, Xin; Wong, Gane Ka Shu; Pryer, Kathleen; Weber, Andreas P.M.; Bräutigam, Andrea; Schluepmann, Henriette

    2018-01-01

    Dinitrogen fixation by Nostoc azollae residing in specialized leaf pockets supports prolific growth of the floating fern Azolla filiculoides. To evaluate contributions by further microorganisms, the A. filiculoides microbiome and nitrogen metabolism in bacteria persistently associated with Azolla

  20. Protein (Cyanobacteria): 504928995 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_015116097.1 ... 1117:4682 ... 1161:4218 ... 1162:3122 1177:1104 317936:3404 ... NADPH-d...ependent 7-cyano-7-deazaguanine reductase Nostoc sp. PCC 7107 MTQDTSEVKYGERNIAEGNLITFPNPRVGRRYDINITLPEFTCKCP

  1. Soil algae

    African Journals Online (AJOL)

    Timothy Ademakinwa

    Also, the importance of algae in soil formation and soil fertility improvement cannot be over ... The presence of nitrogen fixing microalgae (Nostoc azollae) in the top soil of both vegetable ..... dung, fish food and dirty water from fish ponds on.

  2. Effect of Cyanobacteria Isolates on Rice Seeds Germination in Saline Soil

    Directory of Open Access Journals (Sweden)

    Mostafa M. El -Sheekh

    2018-03-01

    Full Text Available Cyanobacteria are prokaryotic photosynthetic communities which are used in biofertilization of many plants especially rice plant. Cyanobacteria play a vital role to increase the plant's ability for salinity tolerance. Salinity is a worldwide problem which affects the growth and productivity of crops. In this work three cyanobacteria strains (Nostoc calcicola, Anabaena variabilis, and Nostoc linkia were isolated from saline soil at Kafr El-Sheikh Governorate; North Egypt. The propagated cyanobacteria strains were used to withstand salinity of the soil and increase rice plant growth (Giza 178. The length of roots and shoot seedlings was measured for seven and forty days of cultivation, respectively. The results of this investigation showed that the inoculation with Nostoc calcicola, Anabaena variabilis, and Nostoc linkia increased root length by 27.0, 4.0, 3.0 % and 39, 20, 19 % in EC5 and 10 (ds/m, respectively. Similarly, they increased shoot length by 121, 70, 55 %, 116, 88, 82 % in EC5 and 10 (ds/m, respectively. In EC15and more concentrations, control rice plants could not grow while those to which cyanobacteria were inoculated could withstand only EC15 but not other elevated concentrations. These results encourage using Nostoc calcicola,Anabaena variabilis, and Nostoc linkia as biofertilizer for rice plant in the saline soil for increasing growth and decrease soil electrical conductivity.

  3. Cytotoxicity and Pro-Apoptotic Activity of 2,2´-Bis[4,5-bis(4-hydroxybenzyl-2-(4-hydroxyphenylcyclopent-4-en-1,3-dione], a Phenolic Cyclopentenedione Isolated from the Cyanobacterium Strain Nostoc sp. str. Lukešová 27/97

    Directory of Open Access Journals (Sweden)

    Jan Vacek

    2011-05-01

    Full Text Available The cytotoxicity of the polyphenol 2,2´-bis[4,5-bis(4-hydroxybenzyl-2-(4-hydroxyphenylcyclopent-4-en-1,3-dione], nostotrebin 6 (NOS-6, was tested under in vitro conditions using mouse fibroblasts (BALB/c cells. Identification of NOS-6 and its uptake into fibroblasts was examined by multi-stage mass spectrometry analysis with the following fragmentation pattern: MS (m/z [M+H]+ 799.1 → MS2 399.1 → MS3 305.1 → MS4 277.1. Using several cell viability assays, the IC50 of NOS-6 after 24 h incubation was found to be 8.48 ± 0.16/12.15 ± 1.96 µM (neutral red/MTT assay which was higher than that of doxorubicin. It was found that NOS-6 is capable of inducing both types of cell death, apoptosis and necrosis in a dose-dependent manner. The biological activities of the cyclopentenediones and preliminary data on NOS-6 cytotoxicity are discussed.

  4. Dynamin-Related Protein 1 Translocates from the Cytosol to Mitochondria during UV-Induced Apoptosis

    Science.gov (United States)

    Zhang, Zhenzhen; Wu, Shengnan; Feng, Jie

    2011-01-01

    Mitochondria are dynamic structures that frequently divide and fuse with one another to form interconnecting network. This network disintegrates into punctiform organelles during apoptosis. However, the mechanisms involved in these processes are still not well characterized. In this study, we investigate the role of dynamin-related protein 1 (Drp1), a large GTPase that mediates outer mitochondrial membrane fission, in mitochondrial dynamics in response to UV irradiation in human lung adenocarcinoma cells (ASTC-α-1) and HeLa cells. Using time-lapse fluorescent imaging, we find that Drp1 primarily distributes in cytosol under physiological conditions. After UV treatment, Drp1 translocates from cytosol to mitochondria, indicating the enhancement of Drp1 mitochondrial accumulation. Our results suggest that Drp1 is involved in the regulation of transition from an interconnecting network to a punctiform mitochondrial phenotype during UV-induced apoptosis.

  5. Characterization of the cyanobacteria and associated bacterial community from an ephemeral wetland in New Zealand.

    Science.gov (United States)

    Secker, Nick H; Chua, Jocelyn P S; Laurie, Rebecca E; McNoe, Les; Guy, Paul L; Orlovich, David A; Summerfield, Tina C

    2016-10-01

    New Zealand ephemeral wetlands are ecologically important, containing up to 12% of threatened native plant species and frequently exhibiting conspicuous cyanobacterial growth. In such environments, cyanobacteria and associated heterotrophs can influence primary production and nutrient cycling. Wetland communities, including bacteria, can be altered by increased nitrate and phosphate due to agricultural practices. We have characterized cyanobacteria from the Wairepo Kettleholes Conservation Area and their associated bacteria. Use of 16S rRNA amplicon sequencing identified several operational taxonomic units (OTUs) representing filamentous heterocystous and non-heterocystous cyanobacterial taxa. One Nostoc OTU that formed macroscopic colonies dominated the cyanobacterial community. A diverse bacterial community was associated with the Nostoc colonies, including a core microbiome of 39 OTUs. Identity of the core microbiome associated with macroscopic Nostoc colonies was not changed by the addition of nutrients. One OTU was highly represented in all Nostoc colonies (27.6%-42.6% of reads) and phylogenetic analyses identified this OTU as belonging to the genus Sphingomonas. Scanning electron microscopy showed the absence of heterotrophic bacteria within the Nostoc colony but revealed a diverse community associated with the colonies on the external surface. © 2016 Phycological Society of America.

  6. In-situ determination of the mechanical properties of gliding or non-motile bacteria by atomic force microscopy under physiological conditions without immobilization.

    Directory of Open Access Journals (Sweden)

    Samia Dhahri

    Full Text Available We present a study about AFM imaging of living, moving or self-immobilized bacteria in their genuine physiological liquid medium. No external immobilization protocol, neither chemical nor mechanical, was needed. For the first time, the native gliding movements of Gram-negative Nostoc cyanobacteria upon the surface, at speeds up to 900 µm/h, were studied by AFM. This was possible thanks to an improved combination of a gentle sample preparation process and an AFM procedure based on fast and complete force-distance curves made at every pixel, drastically reducing lateral forces. No limitation in spatial resolution or imaging rate was detected. Gram-positive and non-motile Rhodococcus wratislaviensis bacteria were studied as well. From the approach curves, Young modulus and turgor pressure were measured for both strains at different gliding speeds and are ranging from 20±3 to 105±5 MPa and 40±5 to 310±30 kPa depending on the bacterium and the gliding speed. For Nostoc, spatially limited zones with higher values of stiffness were observed. The related spatial period is much higher than the mean length of Nostoc nodules. This was explained by an inhomogeneous mechanical activation of nodules in the cyanobacterium. We also observed the presence of a soft extra cellular matrix (ECM around the Nostoc bacterium. Both strains left a track of polymeric slime with variable thicknesses. For Rhodococcus, it is equal to few hundreds of nanometers, likely to promote its adhesion to the sample. While gliding, the Nostoc secretes a slime layer the thickness of which is in the nanometer range and increases with the gliding speed. This result reinforces the hypothesis of a propulsion mechanism based, for Nostoc cyanobacteria, on ejection of slime. These results open a large window on new studies of both dynamical phenomena of practical and fundamental interests such as the formation of biofilms and dynamic properties of bacteria in real physiological conditions.

  7. In-Situ Determination of the Mechanical Properties of Gliding or Non-Motile Bacteria by Atomic Force Microscopy under Physiological Conditions without Immobilization

    Science.gov (United States)

    Dhahri, Samia; Ramonda, Michel; Marlière, Christian

    2013-01-01

    We present a study about AFM imaging of living, moving or self-immobilized bacteria in their genuine physiological liquid medium. No external immobilization protocol, neither chemical nor mechanical, was needed. For the first time, the native gliding movements of Gram-negative Nostoc cyanobacteria upon the surface, at speeds up to 900 µm/h, were studied by AFM. This was possible thanks to an improved combination of a gentle sample preparation process and an AFM procedure based on fast and complete force-distance curves made at every pixel, drastically reducing lateral forces. No limitation in spatial resolution or imaging rate was detected. Gram-positive and non-motile Rhodococcus wratislaviensis bacteria were studied as well. From the approach curves, Young modulus and turgor pressure were measured for both strains at different gliding speeds and are ranging from 20±3 to 105±5 MPa and 40±5 to 310±30 kPa depending on the bacterium and the gliding speed. For Nostoc, spatially limited zones with higher values of stiffness were observed. The related spatial period is much higher than the mean length of Nostoc nodules. This was explained by an inhomogeneous mechanical activation of nodules in the cyanobacterium. We also observed the presence of a soft extra cellular matrix (ECM) around the Nostoc bacterium. Both strains left a track of polymeric slime with variable thicknesses. For Rhodococcus, it is equal to few hundreds of nanometers, likely to promote its adhesion to the sample. While gliding, the Nostoc secretes a slime layer the thickness of which is in the nanometer range and increases with the gliding speed. This result reinforces the hypothesis of a propulsion mechanism based, for Nostoc cyanobacteria, on ejection of slime. These results open a large window on new studies of both dynamical phenomena of practical and fundamental interests such as the formation of biofilms and dynamic properties of bacteria in real physiological conditions. PMID:23593493

  8. Expression of organophosphorus-degradation gene ( opd) in aggregating and non-aggregating filamentous nitrogen-fixing cyanobacteria

    Science.gov (United States)

    Li, Qiong; Tang, Qing; Xu, Xudong; Gao, Hong

    2010-11-01

    Genetic engineering in filamentous N2-fixing cyanobacteria usually involves Anabaena sp. PCC 7120 and several other non-aggregating species. Mass culture and harvest of such species are more energy consuming relative to aggregating species. To establish a gene transfer system for aggregating species, we tested many species of Anabaena and Nostoc, and identified Nostoc muscorum FACHB244 as a species that can be genetically manipulated using the conjugative gene transfer system. To promote biodegradation of organophosphorus pollutants in aquatic environments, we introduced a plasmid containing the organophosphorus-degradation gene ( opd) into Anabaena sp. PCC 7120 and Nostoc muscorum FACHB244 by conjugation. The opd gene was driven by a strong promoter, P psbA . From both species, we obtained transgenic strains having organophosphorus-degradation activities. At 25°C, the whole-cell activities of the transgenic Anabaena and Nostoc strains were 0.163±0.001 and 0.289±0.042 unit/μg Chl a, respectively. However, most colonies resulting from the gene transfer showed no activity. PCR and DNA sequencing revealed deletions or rearrangements in the plasmid in some of the colonies. Expression of the green fluorescent protein gene from the same promoter in Anabaena sp. PCC 7120 showed similar results. These results suggest that there is the potential to promote the degradation of organophosphorus pollutants with transgenic cyanobacteria and that selection of high-expression transgenic colonies is important for genetic engineering of Anabaena and Nostoc species. For the first time, we established a gene transfer and expression system in an aggregating filamentous N2-fixing cyanobacterium. The genetic manipulation system of Nostoc muscorum FACHB244 could be utilized in the elimination of pollutants and large-scale production of valuable proteins or metabolites.

  9. Nitrogen fixation on a coral reef

    Energy Technology Data Exchange (ETDEWEB)

    Mague, T.H.; Holm-Hansen, O.

    1975-06-01

    Benthic, heterocystous blue-green algae (genera Calothrix, Hormothamnion and Nostoc) from Eniwetok Atoll were found to reduce acetylene at rapid rates. Slight acetylene reduction was associated with samples of Rhizoclonium (Chlorophyceae) and Oscillatoria (a cyanophyte lacking heterocysts), but this may have been due to contamination by epiphytes. There was virtually no acetylene reduction by phytoplankton, and nutrient enrichment experiments failed to selectively increase the numbers or activity of N/sub 2/-fixing algae in surface water samples. The Nostoc required light for acetylene reduction. Nitrogen fixation by this species could have supplied up to 11 ..mu..g N/cm/sup 2//day to the ecosystem. (auth)

  10. Bioremediation of copper stressed Trigonella foenum graecum

    Directory of Open Access Journals (Sweden)

    Awatif A. Mohsen

    2013-11-01

    Full Text Available Copper is one of the heavy metals, although it is an essential microelement through interference with numerous physiological processes, when it absorbed in excess amounts, it can be toxic and induce a number of deleterious effects. A pot experiment was conducted in order to assess the possible effects of Nostoc muscorum (2 g/ kg soil fresh pellets on the growth and some metabolic activities of Trigonella foenum gracum at 30 and 60 days of growth growing under copper stress. This experimental plant was grown in clay-sandy soil (2:1 W/W amended either with different concentrations of CuSO4 (0.4, 0.6, 0.8 and 1.0 g/kg soil or Nostoc mixed with Cu (0.6, 0.8 and 1.0 g/kg soil. Application of Nostoc in a mixture with Cu significantly increased fresh and dry weight of root and shoot, photosynthetic pigments and ctivity at 30 and 60 days of growth when compared with their counterparts of Cu treatment. In addition, the content of K+, Ca2+, P3+ and iron were increased with the exception of a decrease in Cu level at 60 days of growth. On the other hand, the content of starch was significantly decreased at 30 and 60 days of growth. Moreover, the activity of both peroxidase (POD and superoxide dismutase (SOD were reduced by applying Nostoc to the soil having different concentrations of Cu.

  11. +91 1662 263153, Fax

    African Journals Online (AJOL)

    Michael Horsfall

    Chromium Tolerance and Bioremoval by Cyanobacteria Isolated from Textile Mill Oxidation Pond in. Pure and .... photosyntheticpigments of cyanobacteria (CI - Nostoc calcicola, CII - Chroococcus minutus, CI + II - Consortium) at the peak growth stage .... with high EPS production by the cyanobacterial cells resulting in loss ...

  12. Chromium Tolerance and Bioremoval by Cyanobacteria Isolated ...

    African Journals Online (AJOL)

    Two cyanobacterial species Nostoc calcicola HH-12 and Chroococcus minutus HH-11 isolated from a textile mill oxidation pond were examined individually and as consortium for their chromium(VI) tolerance and bioremoval from aqueous solutions. Both species were tolerant to the metal and showed significant increase ...

  13. Antibacterial activities of the extracts of cyanobacteria and green ...

    African Journals Online (AJOL)

    In compliance to the recent surveys on algal species and their potentials to produce biologically active compounds, seven algal species belonging to cyanobacteria such as Spirulina platensis, Nostoc linckia, Phormidium autumnale, Tolypothrix distorta and Microcystis aeruginosa and green algae such as Chlorella vulgaris, ...

  14. Nitrogen availability for nitrogen fixing cyanobacteria upon growth ...

    African Journals Online (AJOL)

    The filamentous cyanobacterium Nostoc PCC 7120 is able to convert dinitrogen to ammonia in the absence of combined nitrogen. The expression of 20% of coding sequences from all major metabolic categories was examined in nitrogen fixing and non-nitrogen fixing growth conditions. The expression data were correlated ...

  15. Characterization of blue green algae isolated from Egyptian rice ...

    African Journals Online (AJOL)

    Several species of cyanobacteria has been recognized for its therapeutic value that can be used for treatment of malnutrition, cancer and viral infection. Many natural occurring cyanobacteria are known to produce toxins, for example, species of the genera Microcystis, Nodularia, Nostoc, Anabaena, Aphanizomenon, ...

  16. Characterization of rhizo-cyanobacteria and their associations with ...

    African Journals Online (AJOL)

    Four heterocystous cyanobacteria, belonging to the genera Anabaena and Nostoc isolated from the rhizosphere of wheat, were tested for their ability to form associations with the roots of wheat seedlings under light and dark conditions using hydroponics. The cyanobacterial strains formed close associations with wheat ...

  17. Effects of UV-B irradiation on growth, survival, pigmentation and nitrogen metabolism enzymes in Cyanobacteria

    Energy Technology Data Exchange (ETDEWEB)

    Sinha, R.P.; Hader, D.P. [Institut fuer Botanik und Pharmazeutische Biologie, Friedrich-Alexander Universitaet, Erlangen (Germany); Kumar, H.D.; Kumar, A. [Banaras Hindu University, Varanasi (India)

    1995-12-31

    The effects of artificial UV-B irradiation on growth, survival, pigmentation, nitrate reductase (NR), glutamine synthetase (GS) and total protein profile have been studied in a number of N{sub 2}-fixing cyanobacterial strains isolated from rice (paddy) fields in India. Different organisms show different effects in terms of growth and survival. Complete killing of Anabaena sp. and Nostoc carmium occurs after 120 min of UV-B exposure, whereas the same occurs only after 150 min of exposure in the case of Nostoc commune and Scytonema sp. Growth patterns of the cells treated with UV-B revealed that Nostoc commune and Scytonema sp. are comparatively more tolerant than Anabaena sp. and Nostoc carmium. Pigment content, particularly phycocyanin, was severely decreased following UV-B irradiation in all strains tested so far. In vivo NR activity was found to increase, while in vivo GS activity was decreased following exposure to UV-B for different durations in all test organisms; although complete inhibition of GS activity did not occur even after 120 min of UV-B exposure. (author). 37 refs, 6 figs.

  18. Temperature induced changes in the heterocyst glycolipid composition of N

    NARCIS (Netherlands)

    Bauersachs, T.; Stal, L.J.; Grego, M.; Schwark, L.; Schwark, L.

    2014-01-01

    We investigated the effect of temperature on the heterocyst glycolipid (HG) composition of the diazotrophic heterocystous cyanobacteria Anabaena sp. strain CCY9613 and Nostoc sp. strain CCY9926 grown at 9, 12, 16, 20 and 24 degrees C. Both strains contained an overall similar composition of

  19. Cyanobacterial lactate oxidases serve as essential partners in N2-fixation and evolved into photorespiratory glycolate oxidases in plants.

    NARCIS (Netherlands)

    Hackenberg, C.; Kern, R.; Hüge, J; Stal, L.J.; Tsuji, Y.; Kopka, J.; Shiraiwa, Y.; Bauwe, H.; Hagemann, M.

    2011-01-01

    Glycolate oxidase (GOX) is an essential enzyme involved in photorespiratory metabolism in plants. In cyanobacteria and green algae, the corresponding reaction is catalyzed by glycolate dehydrogenases (GlcD). The genomes of N2-fixing cyanobacteria, such as Nostoc PCC 7120 and green algae, appear to

  20. Cyanobacterial Lactate Oxidases Serve as Essential Partners in N2 Fixation and Evolved into Photorespiratory Glycolate Oxidases in Plants[w

    Science.gov (United States)

    Hackenberg, Claudia; Kern, Ramona; Hüge, Jan; Stal, Lucas J.; Tsuji, Yoshinori; Kopka, Joachim; Shiraiwa, Yoshihiro; Bauwe, Hermann; Hagemann, Martin

    2011-01-01

    Glycolate oxidase (GOX) is an essential enzyme involved in photorespiratory metabolism in plants. In cyanobacteria and green algae, the corresponding reaction is catalyzed by glycolate dehydrogenases (GlcD). The genomes of N2-fixing cyanobacteria, such as Nostoc PCC 7120 and green algae, appear to harbor genes for both GlcD and GOX proteins. The GOX-like proteins from Nostoc (No-LOX) and from Chlamydomonas reinhardtii showed high l-lactate oxidase (LOX) and low GOX activities, whereas glycolate was the preferred substrate of the phylogenetically related At-GOX2 from Arabidopsis thaliana. Changing the active site of No-LOX to that of At-GOX2 by site-specific mutagenesis reversed the LOX/GOX activity ratio of No-LOX. Despite its low GOX activity, No-LOX overexpression decreased the accumulation of toxic glycolate in a cyanobacterial photorespiratory mutant and restored its ability to grow in air. A LOX-deficient Nostoc mutant grew normally in nitrate-containing medium but died under N2-fixing conditions. Cultivation under low oxygen rescued this lethal phenotype, indicating that N2 fixation was more sensitive to O2 in the Δlox Nostoc mutant than in the wild type. We propose that LOX primarily serves as an O2-scavenging enzyme to protect nitrogenase in extant N2-fixing cyanobacteria, whereas in plants it has evolved into GOX, responsible for glycolate oxidation during photorespiration. PMID:21828292

  1. Biochemical and Molecular Phylogenetic Study of Agriculturally Useful Association of a Nitrogen-Fixing Cyanobacterium and Nodule Sinorhizobium with Medicago sativa L.

    Directory of Open Access Journals (Sweden)

    E. V. Karaushu

    2015-01-01

    Full Text Available Seed inoculation with bacterial consortium was found to increase legume yield, providing a higher growth than the standard nitrogen treatment methods. Alfalfa plants were inoculated by mono- and binary compositions of nitrogen-fixing microorganisms. Their physiological and biochemical properties were estimated. Inoculation by microbial consortium of Sinorhizobium meliloti T17 together with a new cyanobacterial isolate Nostoc PTV was more efficient than the single-rhizobium strain inoculation. This treatment provides an intensification of the processes of biological nitrogen fixation by rhizobia bacteria in the root nodules and an intensification of plant photosynthesis. Inoculation by bacterial consortium stimulates growth of plant mass and rhizogenesis and leads to increased productivity of alfalfa and to improving the amino acid composition of plant leaves. The full nucleotide sequence of the rRNA gene cluster and partial sequence of the dinitrogenase reductase (nifH gene of Nostoc PTV were deposited to GenBank (JQ259185.1, JQ259186.1. Comparison of these gene sequences of Nostoc PTV with all sequences present at the GenBank shows that this cyanobacterial strain does not have 100% identity with any organisms investigated previously. Phylogenetic analysis showed that this cyanobacterium clustered with high credibility values with Nostoc muscorum.

  2. Metabolic adaptation, a specialized leaf organ structure and vascular responses to diurnal N

    NARCIS (Netherlands)

    Brouwer, Paul; Bräutigam, Andrea; Buijs, Valerie A.; Tazelaar, Anne O.E.; Werf, van der Adrie; Schlüter, Urte; Reichart, Gert Jan; Bolger, Anthony; Usadel, Björn; Weber, Andreas P.M.; Schluepmann, Henriette

    2017-01-01

    Sustainable agriculture demands reduced input of man-made nitrogen (N) fertilizer, yet N2 fixation limits the productivity of crops with heterotrophic diazotrophic bacterial symbionts. We investigated floating ferns from the genus Azolla that host phototrophic diazotrophic Nostoc azollae in leaf

  3. Cyanobacterial lactate oxidases serve as essential partners of N2-fixation and evolved to photorespiratory glycolate oxidases in plants

    NARCIS (Netherlands)

    Hackenberg, C.; Kern, R.; Hüge, J.; Stal, L.J.; Tsuji, Y.; Kopka, J.; Shiraiwa, Y.; Bauwe, H.; Hagemann, M.

    2011-01-01

    Glycolate oxidase (GOX) is an essential enzyme involved in photorespiratory metabolism in plants. In cyanobacteria and green algae, the corresponding reaction is catalyzed by glycolate dehydrogenases (GlcD). The genomes of N2-fixing cyanobacteria, such as Nostoc PCC 7120 and green algae, appear to

  4. Effects of UV-B irradiation on growth, survival, pigmentation and nitrogen metabolism enzymes in Cyanobacteria

    International Nuclear Information System (INIS)

    Sinha, R.P.; Hader, D.P.; Kumar, H.D.; Kumar, A.

    1995-01-01

    The effects of artificial UV-B irradiation on growth, survival, pigmentation, nitrate reductase (NR), glutamine synthetase (GS) and total protein profile have been studied in a number of N 2 -fixing cyanobacterial strains isolated from rice (paddy) fields in India. Different organisms show different effects in terms of growth and survival. Complete killing of Anabaena sp. and Nostoc carmium occurs after 120 min of UV-B exposure, whereas the same occurs only after 150 min of exposure in the case of Nostoc commune and Scytonema sp. Growth patterns of the cells treated with UV-B revealed that Nostoc commune and Scytonema sp. are comparatively more tolerant than Anabaena sp. and Nostoc carmium. Pigment content, particularly phycocyanin, was severely decreased following UV-B irradiation in all strains tested so far. In vivo NR activity was found to increase, while in vivo GS activity was decreased following exposure to UV-B for different durations in all test organisms; although complete inhibition of GS activity did not occur even after 120 min of UV-B exposure. (author)

  5. Temperature induced changes in the heterocyst glycolipid composition of N2-fixing heterocystous cyanobacteria

    NARCIS (Netherlands)

    Bauersachs, T.; Stal, L.J.; Grego, M.; Schwark, L.

    2014-01-01

    We investigated the effect of temperature on the heterocyst glycolipid (HG) composition of the diazotrophic heterocystous cyanobacteria Anabaena sp. strain CCY9613 and Nostoc sp. strain CCY9926 grown at 9, 12, 16, 20 and 24 °C. Both strains contained an overall similar composition of heterocyst

  6. Recuperation of uranyl ions from effluents by means of microbiological collectors

    International Nuclear Information System (INIS)

    Cecal, A.; Palamaru, I.; Humelnicu, D.; Goanta, M.; Rudic, V.; Salaru, V.V.; Gulea, A.

    1997-01-01

    This paper deals with the study of bioaccumulation of uranyl ions (UO 2 2+ ) from industrial effluents, using microbiological collectors: Nostoc linkia sp., Tolipotrix sp., Spirulina sp., Porphyridium cruentum and also the glucide extract of P. cruentum. The values of retaining degree of UO 2 2+ on the biomass, for several experimental conditions, were established between 14.22 and 91.99%

  7. Influence of osmotic and metal stresses on nitrogenase activity of ...

    African Journals Online (AJOL)

    SERVER

    2007-08-06

    Aug 6, 2007 ... metal requirements often absent in other bacteria; copper ... Table 1. The effect of salt concentrations on nitrogenase activity in nitrogen-fixing Anabaena, Nostoc and Nodularia spp. ... as a detoxification mechanism. ..... the critical iron toxicity contents of paddy are above 500 .... Isolation of nickel dependent.

  8. Differential patterns of evolution and distribution of the symbiotic behaviour in nostocacean cyanobacteria

    Czech Academy of Sciences Publication Activity Database

    Papaefthimiou, D.; Hrouzek, Pavel; Mugnai, M. A.; Rasmussen, U.; Lukešová, Alena; Turicchia, S.; Ventura, S.

    2008-01-01

    Roč. 58, - (2008), s. 553-564 ISSN 1466-5026 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z60660521 Keywords : nostoc strains * ardra * azolla Subject RIV: EE - Microbiology, Virology Impact factor: 2.222, year: 2008

  9. Genetic diversity among and within cultured cyanobionts of diverse species of Azolla.

    Science.gov (United States)

    Sood, A; Prasanna, R; Prasanna, B M; Singh, P K

    2008-01-01

    The cyanobionts isolated from 10 Azolla accessions belonging to 6 species (Azolla mexicana, A. microphylla, A. rubra, A. caroliniana, A. filiculoides, A. pinnata) were cultured under laboratory conditions and analyzed on the basis of whole cell protein profiles and molecular marker dataset generated using repeat sequence primers (STRR(mod) and HipTG). The biochemical and molecular marker profiles of the cyanobionts were compared with those of the free-living cyanobacteria and symbiotic Nostoc strains from Anthoceros sp., Cycas sp. and Gunnera monoika. Cluster analysis revealed the genetic diversity among the selected strains, and identified 3 distinct clusters. Group 1 included cyanobionts from all the 10 accessions of Azolla, group 2 comprised all the symbiotic Nostoc strains, while group 3 included the free-living cyanobacteria belonging to the genera Nostoc and Anabaena. The interrelationships among the Azolla cyanobionts were further revealed by principal component analysis. Cyanobionts from A. caroliniana-A. microphylla grouped together while cyanobionts associated with A. mexicana-A. filiculoides along with A. pinnata formed another group. A. rubra cyanobionts had intermediate relationship with both the subgroups. This is the first study analyzing the diversity existing among the cultured cyanobionts of diverse Azolla species through the use of biochemical and molecular profiles and also the genetic distinctness of these free-living cyanobionts as compared to cyanobacterial strains of the genera Anabaena and Nostoc.

  10. Biodegradation of used motor oil by single and mixed cultures of ...

    African Journals Online (AJOL)

    This study was carried out to evaluate the potential of single and mixed cultures of Nostoc hatei and Synechocystis aquatilis in the biodegradation of 10% used motor oil. The rates of biodegradation of the oil were studied for a period of 21 days under laboratory conditions. Single cultures of N. hatei performed best in the ...

  11. Morphological and molecular characterization of selected desert soil cyanobacteria: Three species new to science including Mojavia pulchra gen. et sp. nov

    Czech Academy of Sciences Publication Activity Database

    Řeháková, Klára; Johansen, J. R.; Casamatta, D.A.; Xuesong, L.; Vincent, J.

    2007-01-01

    Roč. 46, č. 5 (2007), s. 481-502 ISSN 0031-8884 R&D Projects: GA ČR GP206/03/P024 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z60170517 Keywords : Nostoc * desert * taxonomy Subject RIV: EF - Botanics Impact factor: 1.358, year: 2007

  12. Morphological and molecular characterization of selected desert soil cyanobacteria: Three species new to science including .i.Mojavia pulchra./i. gen. et sp. nov

    Czech Academy of Sciences Publication Activity Database

    Řeháková, Klára; Johansen, J. R.; Casamatta, D.A.; Xuesong, L.; Vincent, J.

    2007-01-01

    Roč. 46, č. 5 (2007), s. 481-502 ISSN 0031-8884 R&D Projects: GA ČR(CZ) GP206/03/P024 Institutional research plan: CEZ:AV0Z60170517 Keywords : Mojavia * microbiotic soil crusts * Nostoc Subject RIV: EF - Botanics Impact factor: 1.358, year: 2007

  13. Deep-water anoxygenic photosythesis in a ferruginous chemocline

    DEFF Research Database (Denmark)

    Crowe, Sean; Maresca, J. A.; Jones, CarriAyne

    2014-01-01

    information suggests that deep-water GSB can be supported by a S-cycle, even under ferruginous conditions. The constraints we place on the metabolic capacity and physiology of GSB have important geobiological implications. Biomarkers diagnostic of GSB would be a good proxy for anoxic conditions but could...... not discriminate between euxinic and ferruginous states, and though GSB biomarkers could indicate a substantial GSB community, such a community may exist with very little metabolic activity. The light requirements of GSB indicate that at light levels comparable to those in the OAB of Lake Matano or the Black Sea...

  14. BMR 83 - yearbook of the Bureau of Mineral Resources, Geology and Geophysics

    Energy Technology Data Exchange (ETDEWEB)

    1984-01-01

    BMR 83 has four main sections: Overviews the director, the Chiefs of Divisions, the Supervising Scientist, (Baas Becking Geobiological Laboratory) and the Assistant Director (Special Projects and Geoscience Services Branch); recounts important developments and indicates likely future directions. These are followed by the major section containing summaries of progress of BMR's continuing projects, and a section consisting of more detailed accounts of investigations concluded during the year. The full list of publications is supplemented by the collected abstracts of all papers and monographs that contained abstracts and were published during the year.

  15. Arsenic distribution and valence state variation studied by fast hierarchical length-scale morphological, compositional, and speciation imaging at the Nanoscopium, Synchrotron Soleil

    Science.gov (United States)

    Somogyi, Andrea; Medjoubi, Kadda; Sancho-Tomas, Maria; Visscher, P. T.; Baranton, Gil; Philippot, Pascal

    2017-09-01

    The understanding of real complex geological, environmental and geo-biological processes depends increasingly on in-depth non-invasive study of chemical composition and morphology. In this paper we used scanning hard X-ray nanoprobe techniques in order to study the elemental composition, morphology and As speciation in complex highly heterogeneous geological samples. Multivariate statistical analytical techniques, such as principal component analysis and clustering were used for data interpretation. These measurements revealed the quantitative and valance state inhomogeneity of As and its relation to the total compositional and morphological variation of the sample at sub-μm scales.

  16. Roles of dynamin-related protein 1 in the regulation of mitochondrial fission and apoptosis in response to UV stimuli

    Science.gov (United States)

    Zhang, Zhenzhen; Feng, Jie; Wu, Shengnan

    2011-03-01

    Mitochondria are dynamic structures that frequently divide and fuse with one another to form interconnecting network. This network disintegrates into punctiform organelles during apoptosis. However, it remains unclear whether this event has a significant impact on the rate of cell death or only accompanies apoptosis as an epiphenomenon. In this study, we investigate the role of dynamin-related protein 1 (Drp1), a large GTPase that mediates outer mitochondrial membrane fission, in mitochondrial morphology and apoptosis in response to UV irradiation in human lung adenocarcinoma cells (ASTC-a-1) and HeLa cells. Using time-lapse fluorescent imaging, we find that Drp1 primarily distributes in cytosol under physiological conditions. After UV treatment, Drp1 translocates from cytosol to mitochondria, indicating the enhancement of Drp1 mitochondrial accumulation. Down-regulation of Drp1 by shRNA inhibits UV-induced apoptosis. Our results suggest that Drp1 is involved in the regulation of transition from a reticulo-tubular to a punctiform mitochondrial phenotype and mitochondrial fission plays an important role in UV-induced apoptosis.

  17. Exploring microbial succession and diversity during solid-state fermentation of Tianjin duliu mature vinegar.

    Science.gov (United States)

    Nie, Zhiqiang; Zheng, Yu; Wang, Min; Han, Yue; Wang, Yuenan; Luo, Jianmei; Niu, Dandan

    2013-11-01

    Tianjin duliu mature vinegar was one of famous Chinese traditional vinegars. The unique flavor and taste of vinegar are mainly generated by the multitudinous microorganisms during fermentation. In this research, the composition and succession of microbial communities in the entire solid-state fermentation were investigated, including starter daqu and acetic acid fermentation (AAF). Molds and yeasts in daqu, including Aspergillus, Saccharomycopsis and Pichia, decreased in AAF. The bacterial compositions increased from four genera in daqu to more than 13 genera in AAF. Principal component analysis showed that Acetobacter, Gluconacetobacter, Lactobacillus and Nostoc were dominant bacteria that were correlated well with AAF process. In the early fermentation period, lactic acid bacteria (LAB) decreased while acetic acid bacteria and Nostoc increased rapidly with the accumulation of total acids. Then, the abundance and diversity of LAB increased (more than 80%), indicating that LAB had important influences on the flavor and taste of vinegar. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. Nezha, a novel active miniature inverted-repeat transposable element in cyanobacteria

    International Nuclear Information System (INIS)

    Zhou Fengfeng; Tran Thao; Xu Ying

    2008-01-01

    Miniature inverted-repeat transposable elements (MITEs) were first identified in plants and exerted extensive proliferations throughout eukaryotic and archaeal genomes. But very few MITEs have been characterized in bacteria. We identified a novel MITE, called Nezha, in cyanobacteria Anabaena variabilis ATCC 29413 and Nostoc sp. PCC 7120. Nezha, like most previously known MITEs in other organisms, is small in size, non-coding, carrying TIR and DR signals, and of potential to form a stable RNA secondary structure, and it tends to insert into A+T-rich regions. Recent transpositions of Nezha were observed in A. variabilis ATCC 29413 and Nostoc sp. PCC 7120, respectively. Nezha might have proliferated recently with aid from the transposase encoded by ISNpu3-like elements. A possible horizontal transfer event of Nezha from cyanobacteria to Polaromonas JS666 is also observed

  19. Evaluation of functional substances in the selected food materials for space agriculture

    Science.gov (United States)

    Tomita-Yokotani, Kaori; Kimura, Yasuko; Yamashita, Masamichi; Kimura, Shunta; Sato, Seigo; Katoh, Hiroshi; Abe, Yusuke; Ajioka, Reiko

    We have been studying the useful life-support system in closed bio-ecosystem for space agriculture. We have already proposed the several species as food material, such as Nostoc sp. HK-01 and Prunnus sp., cyanobacterium and Japanese cherry tree, respectively. The cyanobacterium, Nostoc sp Hk-01, has high tolerances to several space environment. Furthermore, the woody plant materials have useful utilization elements in our habitation environment. The studies of woody plants under a space-environment in the vegetable kingdom have a high contribution to the study of various and exotic environmental responses, too. We have already found that they can produce the important functional substances for human. Here, we will show the evaluation of functional substances in the selected food materials under the possible conditions for space agriculture after cooking.

  20. Extraction and In Vitro Antimalarial Activity Phycocyanin from Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Diah Anggraini

    2016-04-01

    Full Text Available Phycocyanin is biopigment found only in a conductor such as Spirulina platensis. Phycocyanin from Nostoc can inhibit Plasmodium falciparum with IC50 8.4 μg/mL so that phycocyanin from S. platensis also can inhibit P. falciparum like Nostoc. The aim of this study was to determine the best method for phycocyanin extraction using three solvents. They were phosphate buffer, water, and aseton. Spirulina were cultured in the conditions intensity of light 3000 Lux, salinity 15 ppt, dark-light 8-16 hours. The response parameters of this study were C-phycocyanin (C-PC content, yield, and protein content. Yield biomass of Spirulina which cultivated using toplest was higher than the aquarium. The best solvent for phycocyanin extraction was a phosphate buffer with C-PC content, yield, and protein content 8 mg/mL, 202.26 mg/g, and 1.88%.

  1. Effects of UV-B and heavy metals on nitrogen and phosphorus metabolism in three cyanobacteria.

    Science.gov (United States)

    Yadav, Shivam; Prajapati, Rajesh; Atri, Neelam

    2016-01-01

    Cyanobacteria sp. (diazotrophic and planktonic) hold a major position in ecosystem, former one due to their intrinsic capability of N2-fixation and later because of mineralization of organic matter. Unfortunately, their exposure to variety of abiotic stresses is unavoidable. Comparative analysis of interactive effect of UV-B and heavy metals (Cd/Zn) on nitrogen and phosphorus metabolism of three cyanobacteria (Anabaena, Microcystis, Nostoc) revealed additive inhibition (χ(2) significant p cyanobacteria suggests UV-B-induced structural change(s) in the enzyme/carriers. Metals seem to compete for the binding sites of the enzymes and carriers; as noticed for Anabaena and Microcystis showing change in Km while no change in the Km value of Nostoc suggests non-competitive nutrient uptake. Higher accumulation and more adverse effect on Na(+) and K(+) efflux proposes Cd as more toxic compared to Zn. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. METHANE INCORPORATION BY PROCARYOTIC PHOTOSYNTHETICMICROORGANISMS

    Energy Technology Data Exchange (ETDEWEB)

    Norton, Charles J.; Kirk, Martha; Calvin, Melvin

    1970-08-01

    The procaryotic photosynthetic microorganisms Anacystis nidulans, Nostoc and Rhodospirillum rubrum have cell walls and membranes that are resistant to the solution of methane in their lipid components and intracellular fluids. But Anacystis nidulans, possesses a limited bioxidant system, a portion of which may be extracellularly secreted, which rapidly oxidizes methane to carbon dioxide. Small C{sup 14} activities derived from CH{sub 4} in excess of experimental error are detected in all the major biochemical fractions of Anacystis nidulans and Nostoc. This limited capacity to metabolize methane appears to be a vestigial potentiality that originated over two billion years ago in the early evolution of photosynthetic bacteria and blue-green algae.

  3. Polysaccharide-producing microalgae

    Energy Technology Data Exchange (ETDEWEB)

    Braud, J.P.; Chaumont, D.; Gudin, C.; Thepenier, C.; Chassin, P.; Lemaire, C.

    1982-11-01

    The production of extracellular polysaccharides is studied with Nostoc sp (cyanophycus), Porphiridium cruentum, Rhodosorus marinus, Rhodella maculata (rhodophyci) and Chlamydomonas mexicana (chlorophycus). The polysaccharides produced are separated by centrifugation of the culture then precipitation with alcohol. Their chemical structure was studied by infrared spectrometry and acid hydrolysis. By their rheological properties and especially their insensitivity to temperatrure and pH variations the polysaccharides produced by Porphryridium cruentum and Rhodella maculata appear as suitable candidates for industrial applications.

  4. Uranium mobilization from low-grade ore by cyanobacteria

    International Nuclear Information System (INIS)

    Lorenz, M.G.; Krumbein, W.E.

    1985-01-01

    Three cyanobacterial isolates (two LPP-B forms and one Anabaena or Nostoc species) from different environments could mobilize uranium from low-grade ores. After 80 days, up to 18% uranium had been extracted from coal and 51% from a carbonate rock by the filamentous cyanobacterium OL3, a LPP-B form. Low growth requirements with regard to light and temperature optima make this strain a possible candidate for leaching neutral and alkaline low-grade uranium ores. (orig.)

  5. Cyanophytes on limestone rocks in the Szopczański Gorge (Pieniny Mountains – their ecomorphology and ultrastructure

    Directory of Open Access Journals (Sweden)

    Joanna Czerwik-Marcinkowska

    2011-08-01

    Full Text Available This study is devoted to the ecomorphology and ultrastructure of cyanophytes on limestone rocks collected in the Szopczański Gorge (Pieniny Mountains during the years 2006-2008. There were selected cyanophyte species for examination such as following: Nostoc microscopicum, Phormidium favosum, Leptolyngbya foveolarum, Tolypothrix distorta var. penicillatum, Pseudanabaena catenata. The ultrastructural analysis (TEM confirmed that the structure and placement of the thylakoids is genus/species specific.

  6. Uranium mobilization from low-grade ore by cyanobacteria

    Energy Technology Data Exchange (ETDEWEB)

    Lorenz, M.G.; Krumbein, W.E.

    1985-04-01

    Three cyanobacterial isolates (two LPP-B forms and one Anabaena or Nostoc species) from different environments could mobilize uranium from low-grade ores. After 80 days, up to 18% uranium had been extracted from coal and 51% from a carbonate rock by the filamentous cyanobacterium OL3, a LPP-B form. Low growth requirements with regard to light and temperature optima make this strain a possible candidate for leaching neutral and alkaline low-grade uranium ores.

  7. Do Photobiont Switch and Cephalodia Emancipation Act as Evolutionary Drivers in the Lichen Symbiosis? A Case Study in the Pannariaceae (Peltigerales)

    Science.gov (United States)

    Magain, Nicolas; Sérusiaux, Emmanuël

    2014-01-01

    Lichen symbioses in the Pannariaceae associate an ascomycete and either cyanobacteria alone (usually Nostoc; bipartite thalli) or green algae and cyanobacteria (cyanobacteria being located in dedicated structures called cephalodia; tripartite thalli) as photosynthetic partners (photobionts). In bipartite thalli, cyanobacteria can either be restricted to a well-delimited layer within the thallus (‘pannarioid’ thalli) or spread over the thallus that becomes gelatinous when wet (‘collematoid’ thalli). We studied the collematoid genera Kroswia and Physma and an undescribed tripartite species along with representatives of the pannarioid genera Fuscopannaria, Pannaria and Parmeliella. Molecular inferences from 4 loci for the fungus and 1 locus for the photobiont and statistical analyses within a phylogenetic framework support the following: (a) several switches from pannarioid to collematoid thalli occured and are correlated with photobiont switches; the collematoid genus Kroswia is nested within the pannarioid genus Fuscopannaria and the collematoid genus Physma is sister to the pannarioid Parmeliella mariana group; (b) Nostoc associated with collematoid thalli in the Pannariaceae are related to that of the Collemataceae (which contains only collematoid thalli), and never associated with pannarioid thalli; Nostoc associated with pannarioid thalli also associate in other families with similar morphology; (c) ancestors of several lineages in the Pannariaceae developed tripartite thalli, bipartite thalli probably resulting from cephalodia emancipation from tripartite thalli which eventually evolved and diverged, as suggested by the same Nostoc present in the collematoid genus Physma and in the cephalodia of a closely related tripartite species; Photobiont switches and cephalodia emancipation followed by divergence are thus suspected to act as evolutionary drivers in the family Pannariaceae. PMID:24587091

  8. Do photobiont switch and cephalodia emancipation act as evolutionary drivers in the lichen symbiosis? A case study in the Pannariaceae (Peltigerales.

    Directory of Open Access Journals (Sweden)

    Nicolas Magain

    Full Text Available Lichen symbioses in the Pannariaceae associate an ascomycete and either cyanobacteria alone (usually Nostoc; bipartite thalli or green algae and cyanobacteria (cyanobacteria being located in dedicated structures called cephalodia; tripartite thalli as photosynthetic partners (photobionts. In bipartite thalli, cyanobacteria can either be restricted to a well-delimited layer within the thallus ('pannarioid' thalli or spread over the thallus that becomes gelatinous when wet ('collematoid' thalli. We studied the collematoid genera Kroswia and Physma and an undescribed tripartite species along with representatives of the pannarioid genera Fuscopannaria, Pannaria and Parmeliella. Molecular inferences from 4 loci for the fungus and 1 locus for the photobiont and statistical analyses within a phylogenetic framework support the following: (a several switches from pannarioid to collematoid thalli occured and are correlated with photobiont switches; the collematoid genus Kroswia is nested within the pannarioid genus Fuscopannaria and the collematoid genus Physma is sister to the pannarioid Parmeliella mariana group; (b Nostoc associated with collematoid thalli in the Pannariaceae are related to that of the Collemataceae (which contains only collematoid thalli, and never associated with pannarioid thalli; Nostoc associated with pannarioid thalli also associate in other families with similar morphology; (c ancestors of several lineages in the Pannariaceae developed tripartite thalli, bipartite thalli probably resulting from cephalodia emancipation from tripartite thalli which eventually evolved and diverged, as suggested by the same Nostoc present in the collematoid genus Physma and in the cephalodia of a closely related tripartite species; Photobiont switches and cephalodia emancipation followed by divergence are thus suspected to act as evolutionary drivers in the family Pannariaceae.

  9. Antifungal compounds from cyanobacteria.

    Science.gov (United States)

    Shishido, Tânia K; Humisto, Anu; Jokela, Jouni; Liu, Liwei; Wahlsten, Matti; Tamrakar, Anisha; Fewer, David P; Permi, Perttu; Andreote, Ana P D; Fiore, Marli F; Sivonen, Kaarina

    2015-04-13

    Cyanobacteria are photosynthetic prokaryotes found in a range of environments. They are infamous for the production of toxins, as well as bioactive compounds, which exhibit anticancer, antimicrobial and protease inhibition activities. Cyanobacteria produce a broad range of antifungals belonging to structural classes, such as peptides, polyketides and alkaloids. Here, we tested cyanobacteria from a wide variety of environments for antifungal activity. The potent antifungal macrolide scytophycin was detected in Anabaena sp. HAN21/1, Anabaena cf. cylindrica PH133, Nostoc sp. HAN11/1 and Scytonema sp. HAN3/2. To our knowledge, this is the first description of Anabaena strains that produce scytophycins. We detected antifungal glycolipopeptide hassallidin production in Anabaena spp. BIR JV1 and HAN7/1 and in Nostoc spp. 6sf Calc and CENA 219. These strains were isolated from brackish and freshwater samples collected in Brazil, the Czech Republic and Finland. In addition, three cyanobacterial strains, Fischerella sp. CENA 298, Scytonema hofmanni PCC 7110 and Nostoc sp. N107.3, produced unidentified antifungal compounds that warrant further characterization. Interestingly, all of the strains shown to produce antifungal compounds in this study belong to Nostocales or Stigonematales cyanobacterial orders.

  10. Growth of cyanobacteria on Martian Regolith Simulant after exposure to vacuum

    Science.gov (United States)

    Arai, Mayumi; Sato, Seigo; Ohmori, Masayuki; Tomita-Yokotani, Kaori; Hashimoto, Hirofumi; Yamashita, Masamichi

    Habitation on Mars is one of our challenges in this century. The growth of cyanobacteria on Martian Regolith Simulant (MRS) was studied with two species of terrestrial cyanobacteria, Nostoc, and one species of other cyanobacterium, Synechosystis. Their vacuum tolerances was examined in order to judge feasibility of the use of cyanobacteria to creat habitable environment on a distant planet. The viability of cyanobacteria tested was evaluated by the microscopic observation after staining by FDA (fluorescein diacetate). A part of them were also re-incubated again in a liquid culture medium, and viability and the chlorophyll production were examined in detail. Nostoc was found to grow for over 140 days with their having normal function of chlorophyll synthesis on the MRS. After the exposure to high vacuum environment (10-5 Pa) for a year, Nostoc sp. started growth. Chlorophyll was produced after this vacuum exposure as well. The A'MED (Arai's Mars Ecosystem Dome, A'MED) is designed to install on Mars for conducting agricultural production in it. We performed the fundamental experiment with MRS. These results show a possibility that cyanobacteria could adapt to MRS, and grow under the low pressure environment expected on Mars.

  11. Production of the Neurotoxin BMAA by a Marine Cyanobacterium

    Directory of Open Access Journals (Sweden)

    Paul Alan Cox

    2007-12-01

    Full Text Available Diverse species of cyanobacteria have recently been discovered to produce theneurotoxic non-protein amino acid β-methylamino-L-alanine (BMAA. In Guam, BMAAhas been studied as a possible environmental toxin in the diets of indigenous Chamorropeople known to have high levels of Amyotrophic Lateral Sclerosis/ ParkinsonismDementia Complex (ALS/PDC. BMAA has been found to accumulate in brain tissues ofpatients with progressive neurodegenerative illness in North America. In Guam, BMAAwas found to be produced by endosymbiotic cyanobacteria of the genus Nostoc which livein specialized cycad roots. We here report detection of BMAA in laboratory cultures of afree-living marine species of Nostoc. We successfully detected BMAA in this marinespecies of Nostoc with five different methods: HPLC-FD, UPLC-UV, Amino AcidAnalyzer, LC/MS, and Triple Quadrupole LC/MS/MS. This consensus of five differentanalytical methods unequivocally demonstrates the presence of BMAA in this marinecyanobacterium. Since protein-associated BMAA can accumulate in increasing levelswithin food chains, it is possible that biomagnification of BMAA could occur in marineecosystems similar to the biomagnification of BMAA in terrestrial ecosystems. Productionof BMAA by marine cyanobacteria may represent another route of human exposure toBMAA. Since BMAA at low concentrations causes the death of motor neurons, low levelsof BMAA exposure may trigger motor neuron disease in genetically vulnerableindividuals.

  12. Antifungal Compounds from Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Tânia K. Shishido

    2015-04-01

    Full Text Available Cyanobacteria are photosynthetic prokaryotes found in a range of environments. They are infamous for the production of toxins, as well as bioactive compounds, which exhibit anticancer, antimicrobial and protease inhibition activities. Cyanobacteria produce a broad range of antifungals belonging to structural classes, such as peptides, polyketides and alkaloids. Here, we tested cyanobacteria from a wide variety of environments for antifungal activity. The potent antifungal macrolide scytophycin was detected in Anabaena sp. HAN21/1, Anabaena cf. cylindrica PH133, Nostoc sp. HAN11/1 and Scytonema sp. HAN3/2. To our knowledge, this is the first description of Anabaena strains that produce scytophycins. We detected antifungal glycolipopeptide hassallidin production in Anabaena spp. BIR JV1 and HAN7/1 and in Nostoc spp. 6sf Calc and CENA 219. These strains were isolated from brackish and freshwater samples collected in Brazil, the Czech Republic and Finland. In addition, three cyanobacterial strains, Fischerella sp. CENA 298, Scytonema hofmanni PCC 7110 and Nostoc sp. N107.3, produced unidentified antifungal compounds that warrant further characterization. Interestingly, all of the strains shown to produce antifungal compounds in this study belong to Nostocales or Stigonematales cyanobacterial orders.

  13. From Fossils to Astrobiology Records of Life on Earth and Search for Extraterrestrial Biosignatures

    CERN Document Server

    Seckbach, Joseph

    2008-01-01

    From Fossils to Astrobiology reviews developments in paleontology and geobiology that relate to the rapidly-developing field of Astrobiology, the study of life in the Universe. Many traditional areas of scientific study, including astronomy, chemistry and planetary science, contribute to Astrobiology, but the study of the record of life on planet Earth is critical in guiding investigations in the rest of the cosmos. In this varied book, expert scientists from 15 countries present peer-reviewed, stimulating reviews of paleontological and astrobiological studies. The overviews of established and emerging techniques for studying modern and ancient microorganisms on Earth and beyond, will be valuable guides to evaluating biosignatures which could be found in the extraterrestrial surface or subsurface within the Solar System and beyond. This volume also provides discussion on the controversial reports of "nanobacteria" in the Martian meteorite ALH84001. It is a unique volume among Astrobiology monographs in focusi...

  14. Dietary Selenium and Human Health

    Directory of Open Access Journals (Sweden)

    Lutz Schomburg

    2016-12-01

    Full Text Available Next year (2017, the micronutrient Selenium (Se is celebrating its birthday—i.e., 200 years after first being identified by the Swedish chemist Jöns Jakob Berzelius. Despite its impressive age, research into the functions of this essential trace element is very alive and reaching out for new horizons. This special issue presents some recent fascinating, exciting, and promising developments in Se research in the form of eight original contributions and seven review articles. Collectively, aspects of Se supply, biochemical, physiological, and chemotherapeutic effects, and geobiological interactions are covered by leading scientists in the areas of nutritional, basic, and clinical research. It is obvious from the contributions that the bicentennial anniversary will celebrate a micronutrient still in its infancy with respect to being understood in terms of its biomedical importance.

  15. Challenge theme 5: Current and future needs of energy and mineral resources in the Borderlands and the effects of their development: Chapter 7 in United States-Mexican Borderlands: Facing tomorrow's challenges through USGS science

    Science.gov (United States)

    Updike, Randall G.; Ellis, Eugene G.; Page, William R.; Parker, Melanie J.; Hestbeck, Jay B.; Horak, William F.

    2013-01-01

    Exploration and extraction activities related to energy and mineral resources in the Borderlands—such as coal-fired power plants, offshore drilling, and mining—can create issues that have potentially major economic and environmental implications. Resource assessments and development projects, environmental studies, and other related evaluations help to understand some of these issues, such as power plant emissions and the erosion/denudation of abandoned mine lands. Information from predictive modeling, monitoring, and environmental assessments are necessary to understand the full effects of energy and mineral exploration, development, and utilization. The exploitation of these resources can negatively affect human health and the environment, its natural resources, and its ecological services (air, water, soil, recreation, wildlife, etc.). This chapter describes the major energy and mineral issues of the Borderlands and how geologic frameworks, integrated interdisciplinary (geobiologic) investigations, and other related studies can address the anticipated increases in demands on natural resources in the region.

  16. Geophysical and geochemical techniques for exploration of hydrocarbons and minerals

    International Nuclear Information System (INIS)

    Sittig, M.

    1980-01-01

    The detailed descriptive information in this book is based on 389 US patents that deal with geophysical and geochemical techniques useful for the exploration of hydrocarbons and minerals. Where it was necessary to round out the complete technological picture, a few paragraphs from cited government reports have been included. These techniques are used in prospecting for oil, coal, oil shale, tar sand and minerals. The patents are grouped under the following chapters: geochemical prospecting; geobiological prospecting; geophysical exploration; magnetic geophysical prospecting; gravitational geophysical prospecting; electrical geophysical prospecting; nuclear geophysical prospecting; seismic geophysical prospecting; and exploratory well drilling. This book serves a double purpose in that it supplies detailed technical information and can be used as a guide to the US patent literature in this field. By indicating all the information that is significant, and eliminating legal jargon and juristic phraseology, this book presents an advanced, industrially oriented review of modern methods of geophysical and geochemical exploration techniques

  17. Evaluation of portable Raman spectrometer with 1064 nm excitation for geological and forensic applications.

    Science.gov (United States)

    Vítek, Petr; Ali, Esam M A; Edwards, Howell G M; Jehlička, Jan; Cox, Rick; Page, Kristian

    2012-02-01

    The development of miniaturized Raman instrumentation is in demand for applications relevant to forensic, pharmaceutical and art analyses, as well as geosciences, and planetary exploration. In this study we report on evaluation of a portable dispersive Raman spectrometer equipped with 1064 nm laser excitation. Selected samples from geological, geobiological and forensic areas of interest have been studied from which the advantages, disadvantages and the analytical potential of the instrument are assessed based on a comparison with bench instrumentation and other portable Raman spectrometers using 785 nm excitation. It is demonstrated that the instrument operating with 1064 nm excitation has potential for expanding the number and types of samples that can be measured by miniaturized Raman spectroscopy without interfering fluorescence background emission. It includes inorganic and organic minerals, biomolecules within living lichen and endolithic cyanobacteria as well as drugs of abuse and explosives. Copyright © 2011 Elsevier B.V. All rights reserved.

  18. Libretexts: a flexible online open system for disseminating educational materials relevant to geophysics at all levels

    Science.gov (United States)

    Halpern, J. B.

    2017-12-01

    Libretexts is an online open system for distributing educational materials with over 5 million page views per month. Covering geophysics, chemistry, physics and more it offers a platform for authors and users including faculty and students to access curated educational materials. Currently there are on line texts covering geology, geobiology, natural hazards and understanding the refusal to accept climate change as well as relevant materials in other sections on aquatic and atmospheric chemistry. In addition to "written" materials Libretexts provides access to simulations and demonstrations that are relevant. Most importantly the Libretext project welcomes new contributors. Faculty can use available materials to construct their own texts or supplementary materials in relatively short order. Since all material is covered by a Creative Commons Copyright, material can be added to as needed for teaching.

  19. Computed tomography of the adrenals in patients with tuberculosis; Emprego da tomografia computadorizada na deteccao de alteracoes das adrenais em doentes com tuberculose

    Energy Technology Data Exchange (ETDEWEB)

    Yamashita, Seizo; Machado, Jussara Marcondes; Morceli, Jose [UNESP, Botucatu, SP (Brazil). Faculdade de Medicina. Dept. de Doencas Tropicais e Diagnostico por Imagem]. E-mail: seizo_eid@uol.com.br

    2004-06-01

    We evaluated the adrenals of individuals without tuberculosis (group 1 - G1) and with tuberculosis (group 2 - G2) using computed tomography. The antero-posterior length, the thickness, and the longitudinal length of the adrenals were compared in G1 and G2. The duration of the disease, the occurrence of morphologic abnormalities in G2, the distribution according to sex, age and skin color were also studied. There was difference in the antero-posterior length and thickness of right adrenal between G1 and G2. A higher prevalence of white skin male individuals was observed in G2. There was no association between duration of the disease and the occurrence of morphologic abnormalities in G2. A higher occurrence of adrenal enlargement was observed in G2. The main computed tomography findings in patients with tuberculosis were enlargement of the adrenal without calcification, enlargement of the adrenal with punctiform calcifications, and residual calcification of the adrenal. (author)

  20. Computed tomography of the adrenals in patients with tuberculosis

    International Nuclear Information System (INIS)

    Yamashita, Seizo; Machado, Jussara Marcondes; Morceli, Jose

    2004-01-01

    We evaluated the adrenals of individuals without tuberculosis (group 1 - G1) and with tuberculosis (group 2 - G2) using computed tomography. The antero-posterior length, the thickness, and the longitudinal length of the adrenals were compared in G1 and G2. The duration of the disease, the occurrence of morphologic abnormalities in G2, the distribution according to sex, age and skin color were also studied. There was difference in the antero-posterior length and thickness of right adrenal between G1 and G2. A higher prevalence of white skin male individuals was observed in G2. There was no association between duration of the disease and the occurrence of morphologic abnormalities in G2. A higher occurrence of adrenal enlargement was observed in G2. The main computed tomography findings in patients with tuberculosis were enlargement of the adrenal without calcification, enlargement of the adrenal with punctiform calcifications, and residual calcification of the adrenal. (author)

  1. Cryotherapy of the primary glaucoma; Kryotherapie des primaeren Glaukoms

    Energy Technology Data Exchange (ETDEWEB)

    Anders, M. [Abt. Augenheilkunde und Kryomedizin, Medizinische Akademie Dresden (Germany)

    1994-12-31

    Cryotherapy is an effective and conservative method of treatment for the primary glaucoma. The principal procedure of this one-time treatment consists in the application of 8-12 punctiform transconjunctival cold nuclei on circle approximately 2mm away from the cornea by means of a cryoapplicator (diameter approx. 2mm) cooled down to approx. -140 C. If all parameters involved in this treatment are accurately observed, the cryotherapy leads to compensation of the pathognomonic increased intraocular pressure in 90% of cases. (orig.) [Deutsch] Die Kryotherapie stellt beim primaeren Glaukom ein effektives und schonendes Behandlungsverfahren dar. Dieses besteht im Prinzip darin, dass mit einem auf ca. -140 C abgekuehlten Kryoapplikator (Durchmesser ca. 2 mm) einmalig 8-12 punktfoermige, transkonjunktivale Kaelteherde zirkulaer 2 mm von der Hornhaut entfernt gesetzt werden. Die so durchgefuehrte Kryotherapie fuehrt bei exakter Einhaltung aller borgegebenen Therapieparameter in 90% der Faelle zur Kompensation des bei dieser Krankeit erhoehten intraokularen Druckes. (orig.)

  2. Cryotherapy of the primary glaucoma; Kryotheraphie des primaeren Glaukoms

    Energy Technology Data Exchange (ETDEWEB)

    Anders, M. [Medizinische Akademie, Dresden (Germany). Abt. Augenheilkunde und Kryomedizin

    1994-12-31

    Cryotherapy is an effective and conservative method of treatment for the primary glaucoma. The principal procedure of this one-time treatment consists in the application of 8-12 punctiform transconjunctional cold nuclei on a circle approximately 2 mm away from the cornea by means of a cryoapplicator (diameter approx. 2 mm) cooled down to approx. -140 C. If all parameters involved in this treatment are accurately observed, the cryotherapy leads to compensation of the pathognomonic increased intraocular pressure in 90% of cases. (orig.) [Deutsch] Die Kryotherapie stellt beim primaeren Glaukom ein effektives und schonendes Behandlungsverfahren dar. Dieses besteht im Prinzip darin, dass mit einem auf ca. -140 C abgekuehlten Kryoapplikator (Durchmesser ca. 2 mm) einmalig 8 - 12 punktfoermige transkonjunktivale Kaelteherde zirkulaer 2 mm von der Hornhaut entfernt gesetzt werden. Die so durchgefuehrte Kryotherapie fuehrt bei exakter Einhaltung aller vorgegebenen Therapieparameter in 90% der Faelle zur Kompensation des bei dieser Krankheit erhoehten intraokularen Druckes. (orig.)

  3. Current data on pneumoconiosis in Lorraine coal miners

    Energy Technology Data Exchange (ETDEWEB)

    Dechoux, J

    1975-01-01

    Despite great efforts at technical prevention, pneumoconiosis is still common among miners of the Lorraine (France) region. Radiological anomalies are seen much more frequently in coal mining than rock mining areas. The radiological picture has been modified in that grossly nodular forms have almost completely disappeared and are increasingly replaced by punctiform patterns characteristic of mixed-dust pneumoconiosis. Tuberculosis, which in 1953 was the cause of death of some half of silicotic patients, was observed in only about 15% of Lorraine pneumoconiotic subjects in 1973. Changes in the nature of pneumoconiosis, at least as much as therapeutic advances, have increased the mean age at death of Lorraine pneumoconiotic workers from 56.9 in 1953 to 68.8 in 1973.

  4. Crystalline Subtype of Pre-Descemetic Corneal Dystrophy

    Directory of Open Access Journals (Sweden)

    Rosa Dolz-Marco

    2014-01-01

    Full Text Available Purpose: To report corneal findings in a familial case of the crystalline subtype of pre- Descemetic corneal dystrophy. Case Report: A 19-year-old girl and her 44-year-old mother were found to have asymptomatic, bilateral, punctiform and multi-colored crystalline opacities across the whole posterior layer of the corneas. Endothelial specular microscopy revealed the presence of white round flecks located at different levels anterior to the endothelium. No systemic abnormalities or medications could be related to account for these findings. Conclusion: To the best of our knowledge, this is the third familial report of this rare corneal disorder. Differential diagnosis may include Schnyder corneal dystrophy, cystinosis, Bietti΄s dystrophy and monoclonal gammopathy.

  5. Crystalline Subtype of Pre-Descemetic Corneal Dystrophy

    Science.gov (United States)

    Dolz-Marco, Rosa; Gallego-Pinazo, Roberto; Pinazo-Durán, María Dolores; Díaz-Llopis, Manuel

    2014-01-01

    Purpose To report corneal findings in a familial case of the crystalline subtype of pre-Descemetic corneal dystrophy. Case Report A 19-year-old girl and her 44-year-old mother were found to have asymptomatic, bilateral, punctiform and multi-colored crystalline opacities across the whole posterior layer of the corneas. Endothelial specular microscopy revealed the presence of white round flecks located at different levels anterior to the endothelium. No systemic abnormalities or medications could be related to account for these findings. Conclusion To the best of our knowledge, this is the third familial report of this rare corneal disorder. Differential diagnosis may include Schnyder corneal dystrophy, cystinosis, Bietti´s dystrophy and monoclonal gammopathy. PMID:25279130

  6. La prise en charge des morsures de chien chez les enfants

    Science.gov (United States)

    Sabhaney, Vikram; Goldman, Ran D.

    2012-01-01

    Résumé Question Une fillette de 4 ans jouait avec le chien de ses voisins. Le chien s’est excité et a mordu la jeune fille à l’avant-bras, y laissant une plaie punctiforme. À cause cette blessure, elle s’est présentée à mon bureau. Devrais-je la traiter avec des antibiotiques? Quel antibiotique faut-il utiliser et pendant combien de temps? Réponse L’administration d’antibiotiques prophylactiques est indiquée lorsqu’on a procédé à une suture primitive de la morsure, que la plaie est de gravité modérée à sévère, qu’elle est punctiforme (particulièrement s’il y a eu pénétration de l’os, de la gaine tendineuse ou de l’articulation), pour les morsures au visage, aux mains, aux pieds ou aux parties génitales ou lorsque les victimes sont immunodéprimées ou souffrent d’asplénisme. L’antibiotique de première intention est l’amoxicilline-clavulanate. La prophylaxie appropriée antitétanique et contre la rage devrait faire partie des soins chez un patient qui a été mordu par un chien, tout comme le débridement local et le nettoyage complet de la plaie.

  7. Retinal peripheral changes after laser in situ keratomileusis in patients with high myopia.

    Science.gov (United States)

    Suzuki, Cássia R; Farah, Michel E

    2004-02-01

    Retinal detachment has been reported after laser in situ keratomileusis (LASIK) in myopic eyes. This complication may be related to the risk from myopia before surgery or may be induced by LASIK surgery itself. We performed a study to evaluate retinal peripheral changes after LASIK in patients with high myopia and to correlate symptoms on presentation and vitreoretinal anatomic changes. The study was carried out at a university-affiliated hospital in São Paulo between November 1997 and February 1999. Patients scheduled to undergo LASIK were included if their spherical equivalent was greater than 6.00 dioptres. The exclusion criteria were previous retinal treatment and myopic macular degenerations. We performed binocular indirect ophthalmoscopy with scleral indentation and fundus biomicroscopy with Goldmann lens before LASIK and 1, 3 and 6 months after surgery. We examined 198 eyes preoperatively. Of the 198, 50 did not undergo LASIK surgery owing to refractive criteria, and 79 were lost to follow-up. We thus studied 69 eyes. The mean spherical equivalent preoperatively was -8.00 D (standard deviation 1.95 D). Twenty-four eyes had normal retinal periphery preoperatively; all 24 remained without alterations after LASIK. Forty-five eyes had peripheral alterations: 17 (24.6%) had cystic degeneration, 14 (20.3%) had lattice degeneration, 11 (15.9%) had white-without-pressure, 5 (7.2%) had cystic tufts, 3 (4.3%) had pavingstone degeneration, 2 (2.9%) had pigmentary alteration, 1 (1.4%) had holes with free operculum, and 1 (1.4%) had punctiform holes. The only alteration after surgery was almost punctiform holes around the previous cystic tuft 1 month after surgery in one patient. Retinal detachment did not develop in any of the eyes. In this group of patients it appears that LASIK did not lead to progressive peripheral retinal lesions in asymptomatic patients during the period studied.

  8. Biocatalytic synthesis of flavones and hydroxyl-small molecules by recombinant Escherichia coli cells expressing the cyanobacterial CYP110E1 gene

    Directory of Open Access Journals (Sweden)

    Makino Takuya

    2012-07-01

    Full Text Available Abstract Background Cyanobacteria possess several cytochrome P450s, but very little is known about their catalytic functions. CYP110 genes unique to cyanaobacteria are widely distributed in heterocyst-forming cyanobacteria including nitrogen-fixing genera Nostoc and Anabaena. We screened the biocatalytic functions of all P450s from three cyanobacterial strains of genus Nostoc or Anabaena using a series of small molecules that contain flavonoids, sesquiterpenes, low-molecular-weight drugs, and other aromatic compounds. Results Escherichia coli cells carrying each P450 gene that was inserted into the pRED vector, containing the RhFRed reductase domain sequence from Rhodococcus sp. NCIMB 9784 P450RhF (CYP116B2, were co-cultured with substrates and products were identified when bioconversion reactions proceeded. Consequently, CYP110E1 of Nostoc sp. strain PCC 7120, located in close proximity to the first branch point in the phylogenetic tree of the CYP110 family, was found to be promiscuous for the substrate range mediating the biotransformation of various small molecules. Naringenin and (hydroxyl flavanones were respectively converted to apigenin and (hydroxyl flavones, by functioning as a flavone synthase. Such an activity is reported for the first time in prokaryotic P450s. Additionally, CYP110E1 biotransformed the notable sesquiterpene zerumbone, anti-inflammatory drugs ibuprofen and flurbiprofen (methylester forms, and some aryl compounds such as 1-methoxy and 1-ethoxy naphthalene to produce hydroxylated compounds that are difficult to synthesize chemically, including novel compounds. Conclusion We elucidated that the CYP110E1 gene, C-terminally fused to the P450RhF RhFRed reductase domain sequence, is functionally expressed in E. coli to synthesize a robust monooxygenase, which shows promiscuous substrate specificity (affinity for various small molecules, allowing the biosynthesis of not only flavones (from flavanones but also a variety of

  9. Cianobactérias e algas reduzem os sintomas causados por Tobacco vosaic virus (tmv em plantas de fumo

    Directory of Open Access Journals (Sweden)

    André B. Beltrame

    2011-06-01

    Full Text Available As algas e as cianobactérias produzem uma grande diversidade de compostos com atividade biológica direta sobre microrganismos ou agem como ativadores de mecanismos de resistência em plantas. Em vista disso, foi investigada a manifestação dos sintomas causados pelo Tobacco mosaic virus (TMV em plantas de fumo previamente tratadas com cianobactérias ou algas. Quando as folhas plantas de fumo foram tratadas dois dias antes da inoculação, foi verificado que suspensões de células dos isolados de cianobactérias 004/02, 008/02, Anabaena sp. e Nostoc sp. 61; e do isolado de alga 061/02, bem como as preparações do conteúdo intracelular do isolado 004/02 (4 C e do filtrado do meio de cultivo do isolado 061/02 (61 M apresentaram efeito na redução do número de lesões locais provocadas por TMV em folhas de plantas fumo, cultivar TNN. Além disso, foi observado que os isolados Anabaena sp., Nostoc sp. 21 (cianobactéria, Nostoc sp. 61 e 090/02 (alga mostraram efeito direto sobre o vírus semi-purificado. Em vista disso, pode-se sugerir que os isolados estudados sintetizam compostos que agem diretamente sobre o TMV e/ou ativam o mecanismo de defesa de plantas contra fitopatógenos.

  10. Removal of some radionuclides from water by bioaccumulation

    International Nuclear Information System (INIS)

    Miskovic, D.; Conkic, L.; Dalmacija, B.; Gantar, M.

    1992-01-01

    First objective of this study was to investigate the application of biologically activated carbon (BAC) as well as its comparison to adsorption, with the aim of removing some radionuclides from water. The isotopes Cs 134 and Cs 137 were bioaccumulated by BAC up to 50%, while the I 131 isotope was only physicochemically adsorbed (about 40%). Also, the process of radionuclides (Cs 137 , Ce 139 , Co 57 , Co 60 ) fixation on blue-green algae (Nostoc sp.) was investigated. The kinetics of the removal of these radionuclides from water was recorded. It was found that after a contact period of about half an hour 40-70% of the activity was removed. (Author)

  11. Bioleaching of UO22+ ions from poor uranium ores by means of cyanobacteria

    International Nuclear Information System (INIS)

    Cecal, A.; Humelnicu, D.; Popa, K.; Palamaru, I.; Nemtoi, G.; Rudic, V.; Gulea, A.

    2000-01-01

    Uranium (VI) leaching, as uranyl ions, from ores with a poor content in util minerals, using some algae as: Porphyridium cruentum (Smith and Soerly) Naegeli, Spirulina platensis CNM-CB-02 and Nostoc linkia (Roth) Born and Flah was studied. The basic composition of these ores allowed the self-maintenance and self-development of these microorganisms, which have facilitated then the leaching of the uranium (VI) as UO 2 2+ ions. The microbial leaching degree was comprised between 40-90%, depending on the used alga and experimental conditions. (author)

  12. STRUCTURA TAXONOMICĂ ŞI ECOLOGICĂ A ALGOFLOREI EDAFICE DIN SERELE SATULUI CHIŞTELNIŢA, RAIONUL TELENEŞTI

    Directory of Open Access Journals (Sweden)

    Alina TROFIM

    2016-02-01

    Full Text Available În articol sunt redate particularităţile structurale ale algoflorei edafice din serele s. Chiştelniţa. Structura taxonomică este constituită din 53 de specii şi varietăţi intraspecifice de alge, care aparţin la 31 genuri, 22 familii, 16 ordine şi 7 clase, dintre care cea mai înaltă diversitate au clasele Hormogoniophyceae – cu 16 specii şi Xanthophyceae – cu 14 specii. Carac­te­ristica ecologică a algoflorei demonstrează predominarea ecobiomorfelor P, care sunt lipsite de heterocisteşi răspân­dite printre particulele de sol sau se dezvoltă la suprafaţa lui. În algoflora solurilor au fost depistate 4 specii ce aparţin ecobio­morfei CF şi sunt azotfixatoare: Anabaena sp., Cylindrospermum licheniforme (Bory. Kütz., Nostoc linckia (Roth. Born. et Flah. şi Nostoc sp., care, în conformitate cu datele din literatura de specialitate, reprezintă tulpini de perspectivă pentru promovarea agriculturii ecologice. TAXONOMIC AND ECOLOGICAL STRUCTURE OF EDAPHICAL ALGAL FLORA FROM GREENHOUSE OF VILLAGE CHISTELNITA, DISTRICT TELENESTIIn this article are presented structural features of edaphical algal flora of greenhouses from village Chistelnita. Taxonomic structure consists of 53 species and varieties of algae belonging to 31 genera, 22 families, 16 orders and 7 classes, of which the highest diversity have Hormogoniophyceae and Xanthophyceae classes, with 16 and 14 species. Ecological characteristics of algal flora demonstrates the predominance of P ecobiomorphic, which are devoid of heterocyst and spread through the particles of ground or on the surface of it. In soils algal flora were discovered four species belonging to CF ecobiomorphic and they are nitrogen fixing: Anabaena sp., Cylindrospermum licheniforme (Bory. Kutz., Nostoc linckia (Roth. Born. et Flah. and Nostoc sp., which according to data from the literature, is promising strains for promoting organic farming. 

  13. Use of microphytoalgae for purification of radioactive waste water

    International Nuclear Information System (INIS)

    Cecal, Al.; Palamaru, Ileana; Humelnicu, Doina; Popa, K.; Rudic, V.; Cepoi, Liliana; Gulea, A.

    1999-01-01

    This work deals with a study on the purification of some radioactive waters, simulating radioactive waste waters, by some microbial collectors. For a given ion the retaining degree varies as 134 Cs - > 60 Co 2- > 51 Cr 3- > 55-59 Fe 3- , but for same algae types, this parameter decreases as follows: Scenedesmus quadricauda > Cylindrospermum major > Nostoc microscopicum. Furthermore, using the radioactive 60 Co 2- ions, the biochemical mechanism of retaining for such cations by different separated components of living cells was established. More retention is observed in proteins, pigments and polysaccharides, but the glycides are not able to keep such cations. (authors)

  14. P-32 uptake in lentic algae

    International Nuclear Information System (INIS)

    Strange, J.R.; Williamson, G.D.; Fletcher, D.J.

    1975-01-01

    A study of the Flat Creek Embayment of Lake Sidney Lanier near Gainesville, Georgia revealed three genera of algae, Chlorococcum, Fragillaria and Nostoc, to be prominent in this eutrophic region of the lake. The algae was grown in phosphate-rich media and subsequently labelled with P-32. All species incorporated luxury amounts of phosphorus as determined by the uptake of P-32. The results indicate that the P-32 uptake is proportional to the surface-per-volume ratio. The higher surface-per-volume ratio resulted in greater uptake of P-32

  15. Effects of some inorganic elements on nitrogen-fixation in blue-green algae and some ecological aspects of pollution

    Energy Technology Data Exchange (ETDEWEB)

    Henriksson, L.E.; DaSilva, E.J.

    1978-01-01

    Nitrogen-fixation by two species of Nostoc, one of them a lichen phycobiont, was generally stimulated by low concentrations of arsenic, cadmium, nickel, lead, palladium, and zinc. Higher concentrations (0.025 to 0.125 ppM) of arsenic, nickel, and palladium were also stimulatory; however, higher concentrations of cadmium, lead, and zinc tended to inhibit fixation. With the exception of palladium and zinc at low concentrations these six tested elements tended to inhibit nitrogen-fixation in Chlorogloea fritschii and Westiellopsis sp.

  16. Determination of the elemental composition of cyanobacteria cells and cell fractions by atomic emission and atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Sedykh, Eh.M.; Lyabusheva, O.A.; Bannykh, L.N.; Tambiev, A.Kh.

    2005-01-01

    An approach to studying the elemental composition of cyanobacteria Spirulina platensis and Nostoc commune using a set of complementary analytical methods (ICP-AES, PAAS, and ETAAS) was proposed . The procedures were adapted for the determination of macro- and microelements (Na, K, Mg, Ca, Fe, Mn, Cu, Mo, Zn, B, and Se) in the biomass of cyanobacteria and separated cell fractions (chloroform and water-methanol extracts and precipitates). The conditions for the mineralization of biological materials were optimized for autoclave and microwave sample preparation procedures. The evaporation and atomization of Se and Mo in a graphite furnace in the presence of chloroform and methanol were studied [ru

  17. The use of the 2-aminobenzoic acid tag for oligosaccharide gel electrophoresis.

    Science.gov (United States)

    Huang, Z; Prickett, T; Potts, M; Helm, R F

    2000-08-18

    Gel electrophoresis of fluorophore labeled saccharides provides a rapid and reliable method to screen enzymatic and/or chemical treatments of polysaccharides and glycoconjugates, as well as a sensitive and efficient microscale method to separate and purify oligosaccharides for further analysis. A simple and inexpensive method of derivatization and analysis using 2-aminobenzoic acid (anthranilic acid, AA) is described and applied to the extracellular polysaccharide released by the desiccation tolerant cyanobacterium Nostoc commune DRH-1. The results of these analyses suggest a possible protective functionality of two pendent groups, as well as a potential relationship between these groups and the desiccation tolerance of the organism.

  18. Cyanotoxins in arctic lakes of southwestern Greenland and the potential for toxin transfer within-lake and across the aquatic-terrestrial boundary

    Science.gov (United States)

    Trout-Haney, J. V.; Cottingham, K. L.

    2015-12-01

    Arctic lakes are often characterized as low-resource environments in which the autotrophic community is limited by factors such as nutrients, temperature, and light. Studies of cyanotoxins have traditionally focused on nutrient-rich lakes with conspicuous blooms, however toxigenic cyanobacteria are confined to neither high nutrient environments nor planktonic taxa. We quantified the occurrence of cyanotoxins across 19 arctic lakes of varying size and depth in the Kangerlussuaq region of southwestern Greenland. Whole lake water microcystins (MC) were detected in all lakes and ranged from low (100 ng/L) concentrations. Benthic colonial cyanobacteria of the genus Nostoc are a prominent feature of certain lakes in this region, with estimated densities ranging between 500 and >500,000 colonies per lake. MC were present in the tissue of Nostoc colonies (95% CI, 1638.9 - 3237.6 pg MC (g wet weight)-1) and were actively released by colonies into surrounding water in laboratory trials. These results highlight the potential importance of toxic benthic cyanobacteria in lake ecosystems. Further, we investigated the transfer of these cyanotoxins to other organisms in the lake as well as several mechanisms (i.e., emerging insects, aerosols) that may influence the movement of toxins into the terrestrial ecosystem. The presence and movement of cyanotoxins in the coupled terrestrial-aquatic ecosystem demonstrate that high-latitude lakes can support toxigenic cyanobacteria, and that we may be underestimating the potential for these systems to develop high levels of toxicity in the future.

  19. Determination of Volatile Organic Compounds in Selected Strains of Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Ivan Milovanović

    2015-01-01

    Full Text Available Microalgal biomass can be used in creating various functional food and feed products, but certain species of microalgae and cyanobacteria are known to produce various compounds causing off-flavour. In this work, we investigated selected cyanobacterial strains of Spirulina, Anabaena, and Nostoc genera originating from Serbia, with the aim of determining the chemical profile of volatile organic compounds produced by these organisms. Additionally, the influence of nitrogen level during growth on the production of volatile compounds was investigated for Nostoc and Anabaena strains. In addition, multivariate techniques, namely, principal component analysis (PCA and hierarchical cluster analysis (HCA, were used for making distinction among different microalgal strains. The results show that the main volatile compounds in these species are medium chain length alkanes, but other odorous compounds such as 2-methylisoborneol (0.51–4.48%, 2-pentylfuran (0.72–8.98%, β-cyclocitral (0.00–1.17%, and β-ionone (1.15–2.72% were also detected in the samples. Addition of nitrogen to growth medium was shown to negatively affect the production of 2-methylisoborneol, while geosmin was not detected in any of the analyzed samples, which indicates that the manipulation of growth conditions may be useful in reducing levels of some unwanted odor-causing components.

  20. UVB shielding role of FeCl{sub 3} and certain cyanobacterial pigments

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, A.; Tyagi, M.B.; Srinivas, G.; Singh, N.; Kumar, H.D. [Banaras Hindu Univ., Varanasi (India). Dept. of Botany; Sinha, R.P. [Banaras Hindu Univ., Varanasi (India). Dept. of Botany]|[Friedrich-Alexander-Universitaet, Erlangen (Germany). Institut fuer Botanik und Pharmazeutische Biologie; Haeder, D.P. [Friedrich-Alexander-Universitaet, Erlangen (Germany). Institut fuer Botanik und Pharmazeutische Biologie

    1996-08-01

    The shielding role of ferric iron (FeCl{sub 3}) and certain cyanobacterial pigments (a brown-colored pigment from Scytonema hofmanii culture filtrate and a pink extract from Nostoc spongiaeforme) against UVB-induced damage in the filamentous, nitrogen-fixing cyanobacterium Nostoc muscorum has been demonstrated. Addition of these colored compounds to agarose gels (1-3 mm thick) resulted in a considerable decrease in UVB transmittance through the gels. The lowest UVB transmittance (15%) occurred through a 3 mm gel containing 0.01% FeCl{sub 3}, followed by S. hofmanii culture filtrate (40%) and N. spongiaeforme extract (50%). These substances appear to act as very efficient UVB-absorbing screens. Percent survival and {sup 14}CO{sub 2} uptake of N. muscorum increased significantly if UVB exposure was given on gels containing FeCl{sub 3} or other UVB-shielding substances. The highest protection of N. muscorum was recorded with FeCl{sub 3}, followed by S. hofmanii culture filtrate and N. spongiaeforme extract. Such UV-shielding substances if present in required concentration range may enhance the survival of cyanobacteria exposed to high levels of UVB. (author).

  1. The importance of extremophile cyanobacteria in the production of biologically active compounds

    Directory of Open Access Journals (Sweden)

    Drobac-Čik Aleksandra V.

    2007-01-01

    Full Text Available Due to their ability to endure extreme conditions, terrestrial cyanobacteria belong to a group of organisms known as "extremophiles". Research so far has shown that these organisms posses a great capacity for producing biologically active compounds (BAC. The antibacterial and antifungal activities of methanol extracts of 21 cyanobacterial strains belonging to Anabaena and Nostoc genera, previously isolated from different soil types and water resources in Serbia, were evaluated. In general, larger number of cyanobacterial strains showed antifungal activity. In contrast to Nostoc, Anabaena strains showed greater diversity of antibacterial activity (mean value of percentages of sensitive targeted bacterial strains 3% and 25.9% respectively. Larger number of targeted fungi was sensitive to cultural liquid extract (CL, while crude cell extract (CE affected more bacterial strains. According to this investigation, the higher biological activity of terrestrial strains as representatives of extremophiles may present them as significant BAC producers. This kind of investigation creates very general view of cyanobacterial possibility to produce biologically active compounds but it points out the necessity of exploring terrestrial cyanobacterial extremophiles as potentially excellent sources of these substances and reveals the most prospective strains for further investigations.

  2. UVB shielding role of FeCl3 and certain cyanobacterial pigments

    International Nuclear Information System (INIS)

    Kumar, A.; Tyagi, M.B.; Srinivas, G.; Singh, N.; Kumar, H.D.; Sinha, R.P.; Friedrich-Alexander-Universitaet, Erlangen; Haeder, D.P.

    1996-01-01

    The shielding role of ferric iron (FeCl 3 ) and certain cyanobacterial pigments (a brown-colored pigment from Scytonema hofmanii culture filtrate and a pink extract from Nostoc spongiaeforme) against UVB-induced damage in the filamentous, nitrogen-fixing cyanobacterium Nostoc muscorum has been demonstrated. Addition of these colored compounds to agarose gels (1-3 mm thick) resulted in a considerable decrease in UVB transmittance through the gels. The lowest UVB transmittance (15%) occurred through a 3 mm gel containing 0.01% FeCl 3 , followed by S. hofmanii culture filtrate (40%) and N. spongiaeforme extract (50%). These substances appear to act as very efficient UVB-absorbing screens. Percent survival and 14 CO 2 uptake of N. muscorum increased significantly if UVB exposure was given on gels containing FeCl 3 or other UVB-shielding substances. The highest protection of N. muscorum was recorded with FeCl 3 , followed by S. hofmanii culture filtrate and N. spongiaeforme extract. Such UV-shielding substances if present in required concentration range may enhance the survival of cyanobacteria exposed to high levels of UVB. (author)

  3. Fluorescence Spectral Properties of All4261 Binding with Phycocyanobilin in E.Coli

    Science.gov (United States)

    Ma, Q.; Zheng, X. J.; Zhou, Z.; Zhou, N.; Zhao, K. H.; Zhou, M.

    2014-07-01

    Cyanobacteriochromes (CBCRs) are chromophorylated proteins that acting as sensory photoreceptors in cyanobacteria. Based on the bioinformatics of All4261 in Nostoc sp. PCC7120, All4261 is a CBCR apoprotein composed of GAF domains in the N-terminal region. Via polymerase chain reaction with specific primers, All4261 was amplified with genome DNA of Nostoc sp. PCC7120 as template and then subcloned into the expression vector pET30(a+). To survey the fluorescence spectral properties, All4261 was coexpressed with the plasmid that catalyzes phycocyanobilin (PCB) biosynthesis, pACYC-ho1-pcyA, in E.coli BL21. Fluorescence emission spectra and excitation spectra showed that chromophorylated cells containing All4261-PCB had a fluorescence emission peak at 645 nm and a fluorescence excitation peak at 550 nm, but no reversible photoconversion. In order to identify the binding site of PCB in All4261, we obtained three variants All4261(C296L), All4261(C328A), and All4261(C339L), via sitedirected mutagenesis. The binding site was identified as C339 based on the lack of PCB binding of All4261(C339L).

  4. Growth of soil algae and cyanobacteria on gold mine tailings material

    Directory of Open Access Journals (Sweden)

    Tanya Seiderer

    2017-11-01

    Full Text Available The goal of revegetation of gold mine tailings storage facilities is to reduce aeolian pollution, nutrient leaching and erosion caused by exposure to wind and water. The establishment of biological soil crusts may prove to be a more cost-effective way to reach the same goal and the aim of this study was therefore to determine if it is possible to establish algae and cyanobacteria on gold mine tailings. Different treatments of Chlamydomonas, Microcoleus and Nostoc were inoculated on gold mine tailings in controlled conditions and algal growth was measured on all of the treatments after 6 weeks. Nostoc treatments had the highest chlorophyll-a concentrations and produced a surface crust, while Chlamydomonas treatments penetrated the tailings material and provided the strongest crust. The results were promising but more research is necessary to determine the best organism, or combination of organisms, to colonise mine tailings and to eventually produce biological crusts. Significance: Determination of the best organisms to colonise mine tailings and to produce biological crusts for the revegetation of gold mine tailings storage facilities.

  5. Benthic cyanobacteria: A source of cylindrospermopsin and microcystin in Australian drinking water reservoirs.

    Science.gov (United States)

    Gaget, Virginie; Humpage, Andrew R; Huang, Qiong; Monis, Paul; Brookes, Justin D

    2017-11-01

    Cyanobacteria represent a health hazard worldwide due to their production of a range of highly potent toxins in diverse aquatic environments. While planktonic species have been the subject of many investigations in terms of risk assessment, little is known about benthic forms and their impact on water quality or human and animal health. This study aimed to purify isolates from environmental benthic biofilms sampled from three different drinking water reservoirs and to assess their toxin production by using the following methods: Enzyme-Linked Immunosorbent Assay (ELISA), High-Performance Liquid Chromatography (HPLC), Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS) and quantitative PCR (qPCR). Microscopic observation of the isolates allowed the identification of various filamentous cyanobacterial genera: Anabaena (benthic form), Calothrix and Nostoc from the Nostocales and Geitlerinema, Leptolyngbya, Limnothrix, Lyngbya, Oxynema, Phormidium and Pseudanabaena representing non-heterocystous filamentous cyanobacteria. The Phormidium ambiguum strain AWQC-PHO021 was found to produce 739 ng/mg of dry weight (d/w) of cylindrospermopsin and 107 ng/mg (d/w) of deoxy-cylindrospermopsin. The Nostoc linckia strain AWQC-NOS001 produced 400 ng/mg (d/w) of a microcystin analogue. This is the first report of hepatotoxin production by benthic cyanobacteria in temperate Australian drinking water reservoirs. These findings indicate that water quality monitoring programs need to consider benthic cyanobacteria as a potential source of toxins. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Substrates of Peltigera Lichens as a Potential Source of Cyanobionts.

    Science.gov (United States)

    Zúñiga, Catalina; Leiva, Diego; Carú, Margarita; Orlando, Julieta

    2017-10-01

    Photobiont availability is one of the main factors determining the success of the lichenization process. Although multiple sources of photobionts have been proposed, there is no substantial evidence confirming that the substrates on which lichens grow are one of them. In this work, we obtained cyanobacterial 16S ribosomal RNA gene sequences from the substrates underlying 186 terricolous Peltigera cyanolichens from localities in Southern Chile and maritime Antarctica and compared them with the sequences of the cyanobionts of these lichens, in order to determine if cyanobacteria potentially available for lichenization were present in the substrates. A phylogenetic analysis of the sequences showed that Nostoc phylotypes dominated the cyanobacterial communities of the substrates in all sites. Among them, an overlap was observed between the phylotypes of the lichen cyanobionts and those of the cyanobacteria present in their substrates, suggesting that they could be a possible source of lichen photobionts. Also, in most cases, higher Nostoc diversity was observed in the lichens than in the substrates from each site. A better understanding of cyanobacterial diversity in lichen substrates and their relatives in the lichens would bring insights into mycobiont selection and the distribution patterns of lichens, providing a background for hypothesis testing and theory development for future studies of the lichenization process.

  7. Dartmouth College Earth Sciences Mobile Field Program

    Science.gov (United States)

    Meyer, E. E.; Osterberg, E. C.; Dade, W. B.; Sonder, L. J.; Renshaw, C. E.; Kelly, M. A.; Hawley, R. L.; Chipman, J. W.; Mikucki, J.; Posmentier, E. S.; Moore, J. R.

    2011-12-01

    For the last 50 years the Department of Earth Sciences at Dartmouth College has offered a term-long, undergraduate field program, informally called "the Stretch". A student typically enrolls during fall quarter of his or her junior year soon after choosing a major or minor. The program thus provides valuable field context for courses that a student will take during the remainder of his or her undergraduate career. Unlike many traditional field camps that focus on one particular region, the Stretch is a mobile program that currently travels through Western North America, from the Canadian Rockies to the Grand Canyon. The program spans two and a half months, during which time undergraduates, graduate TAs, and faculty live, work, and learn collaboratively. Dartmouth College faculty members sequentially teach individual 1- to 2-week segments that focus on their interests and expertise; currently, there are a total of eight segments led by eleven faculty members. Consequently, topics are diverse and include economic geology, geobiology, geomorphology, glaciology, glacial geology, geophysics, hydrogeology, paleontology, stratigraphy, structure and tectonics, and volcanology. The field localities are equally varied, including the alpine glaciers of western Alberta, the national parks of Montana, Wyoming and Utah, the eastern Sierra Nevada, the southern Great Basin, and highlight such classic geological field locales as Sheep Mountain in Wyoming's Bighorn Basin, Death Valley, and the Grand Canyon. Overall, the program aims to: 1) give students a broad perspective on the timing and nature of the processes that resulted in the landscape and underlying geology of western North America; and 2) introduce students to a wide variety of geological environments, field techniques, and research equipment. Students emerge from the program with wide-ranging exposure to active research questions as well as a working knowledge of core field skills in the earth sciences. Stretch students

  8. Recovery Act: Understanding the Impact of CO2 Injection on the Subsurface Microbial Community in an Illinois Basin CCS Reservoir: Integrated Student Training in Geoscience and Geomicrobiology

    Energy Technology Data Exchange (ETDEWEB)

    Fouke, Bruce [Univ. of Illinois, Champaign, IL (United States)

    2013-03-31

    An integrated research and teaching program was developed to provide cross--disciplinary training opportunities in the emerging field of carbon capture and storage (CCS) for geobiology students attending the University of Illinois Urbana-­Champaign (UIUC). Students from across the UIUC campus participated, including those from the departments of Geology, Microbiology, Biochemistry, Civil and Environmental Engineering, Animal Sciences and the Institute for Genomic Biology. The project took advantage of the unique opportunity provided by the drilling and sampling of the large-­scale Phase III CCS demonstration Illinois Basin - Decatur Project (IBDP) in the central Illinois Basin at nearby Decatur, Illinois. The IBPD is under the direction of the Illinois State Geological Survey (ISGS, located on the UIUC campus) and the Midwest Geological Sequestration Consortium (MGSC). The research component of this project focused on the subsurface sampling and identification of microbes inhabiting the subsurface Cambrian-­age Mt. Simon Sandstone. In addition to formation water collected from the injection and monitoring wells, sidewall rock cores were collected and analyzed to characterize the cements and diagenetic features of the host Mt. Simon Sandstone. This established a dynamic geobiological framework, as well as a comparative baseline, for future studies of how CO2 injection might affect the deep microbial biosphere at other CCS sites. Three manuscripts have been prepared as a result of these activities, which are now being finalized for submission to top-­tier international peer-­reviewed research journals. The training component of this project was structured to ensure that a broad group of UIUC students, faculty and staff gained insight into CCS issues. An essential part of this training was that the UIUC faculty mentored and involved undergraduate and graduate students, as well as postdocs and research scientists, at all stages of the project in order

  9. Strength Through Options: Providing Choices for Undergraduate Education in the Geosciences

    Science.gov (United States)

    Furman, T.; Freeman, K. H.; Faculty, D.

    2003-12-01

    Undergraduate major enrollments in the Department of Geosciences at Penn State have held steady over the past 5 years despite generally declining national trends. We have successfully recruited and retained new students through intensive advising coupled with innovative curricular revision aimed to meet an array of students' educational and career goals. Our focus is on degree programs that reflect emerging interdisciplinary trends in both employment and student interest, and are designed to attract individuals from underrepresented groups. In addition to a traditional Geosciences BS program we offer a rigorous integrated Earth Sciences BS and a Geosciences BA tailored to students with interests in education and environmental law. The Earth Sciences BS incorporates course work from Geosciences, Geography and Meterology, and requires completion of an interdisciplinary minor (e.g., Climatology, Marine Sciences, Global Business Strategies). A new Geobiology BS program will attract majors with interests at the intersection of the earth and life sciences. The curriculum includes both paleontological and biogeochemical coursework, and is also tailored to accommodate pre-medicine students. We are working actively to recruit African-American students. A new minor in Science and Technology in Africa crosses disciplinary boundaries to educate students from the humanities as well as sciences. Longitudinal recruitment programs include summer research group experiences for high school students, summer research mentorships for college students, and dual undergraduate degree programs with HBCUs. Research is a fundamental component of every student's degree program. We require a capstone independent thesis as well as a field program for Geosciences and Geobiology BS students, and we encourage all students to pursue research as early as the freshman year. A new 5-year combined BS-MS program will enable outstanding students to carry their undergraduate research further before

  10. Deep questions about the nature of early-life signals: a commentary on Lister (1673) ‘A description of certain stones figured like plants’

    Science.gov (United States)

    Brasier, Martin

    2015-01-01

    In 1673, Martin Lister explored the preservation of ‘St Cuthbert's beads’ plus other fossil crinoid remains from approximately 350 Ma Carboniferous limestone in northern England. He used taphonomic evidence (transport, disarticulation, burial and cementation) to infer an origin as petrified plant remains, in contrast with his views expressed elsewhere that fossil mollusc shells could have formed abiogenically, by ‘plastic forces’ within rock. Lister also observed pentagonal symmetry, now seen as characteristic of living echinoderm skeletons. A postscript from John Ray supports Lister's ‘taphonomic’ observations and accepts the biogenicity of these fossil ‘vegetables’. Ray then concluded with a prophecy, predicting the discovery of comparable living fossils in remote ocean waters. These early discussions compare with current debates about the character of candidate microfossils from the early Earth and Mars. Interesting biomorphs are now tested against the abiogenic null hypotheses, making use of features such as those pioneered by Lister, including evidence for geological context, rules for growth and taphonomy. Advanced techniques now allow us to extend this list of criteria to include the nanoscale mapping of biology-like behaviour patterns plus metabolic pathways. Whereas the science of palaeobiology once began with tests for biogenicity, the same is now true for geobiology and astrobiology. This commentary was written to celebrate the 350th anniversary of the journal Philosophical Transactions of the Royal Society. PMID:25750150

  11. Productivity Contribution of Paleozoic Woodlands to the Formation of Shale-Hosted Massive Sulfide Deposits in the Iberian Pyrite Belt (Tharsis, Spain)

    Science.gov (United States)

    Fernández-Remolar, David C.; Harir, Mourad; Carrizo, Daniel; Schmitt-Kopplin, Philippe; Amils, Ricardo

    2018-03-01

    The geological materials produced during catastrophic and destructive events are an essential source of paleobiological knowledge. The paleobiological information recorded by such events can be rich in information on the size, diversity, and structure of paleocommunities. In this regard, the geobiological study of late Devonian organic matter sampled in Tharsis (Iberian Pyrite Belt) provided some new insights into a Paleozoic woodland community, which was recorded as massive sulfides and black shale deposits affected by a catastrophic event. Sample analysis using TOF-SIMS (Time of Flight Secondary Ion Mass Spectrometer), and complemented by GC/MS (Gas Chromatrograph/Mass Spectrometer) identified organic compounds showing a very distinct distribution in the rock. While phytochemical compounds occur homogeneously in the sample matrix that is composed of black shale, the microbial-derived organics are more abundant in the sulfide nodules. The cooccurrence of sulfur bacteria compounds and the overwhelming presence of phytochemicals provide support for the hypothesis that the formation of the massive sulfides resulted from a high rate of vegetal debris production and its oxidation through sulfate reduction under suboxic to anoxic conditions. A continuous supply of iron from hydrothermal activity coupled with microbial activity was strictly necessary to produce this massive orebody. A rough estimate of the woodland biomass was made possible by accounting for the microbial sulfur production activity recorded in the metallic sulfide. As a result, the biomass size of the late Devonian woodland community was comparable to modern woodlands like the Amazon or Congo rainforests.

  12. A Modeling Comparison of Methanogenesis from Noncompetitive vs Competitive Substrates in a Simulated Hypersaline Microbial Mat

    Science.gov (United States)

    Decker, K. L.; Potter, C.; Hoehler, T.

    2005-12-01

    The well-documented assumption about methanogens that co-occur in hypersaline mat communities with sulfate-reducing bacteria (SRB) is that they rely entirely on non-competitive substrates for methanogenesis. The reason for this is that during sulfate reduction, sulfur-reducing bacteria efficiently utilize H2, leaving a concentration too low for methanogenesis. Early results from recent work on a hypersaline microbial mat from salt evaporation ponds of Guerrero Negro, Baja, Mexico cast doubt that methanogenesis only occurs via non-competitive substrates, because it shows an excess of H2 in the mat rather than a paucity. We explore the use of our simulation model of the microbial biogeochemistry of a hypersaline mat (named MBGC) to compare methane production rates in a 1 cm thick mat when the methanogens use competitive substrates versus noncompetitive substrates. In the `non-competitive substrate' version of the model, methanogens rely exclusively on methylated amines that are accumulated as compatible solutes in cyanobacteria and released after lysis. In contrast, the `competitive substrate' models examine methanogen use of substrates (such as H2 + acetate) with different SRB population sizes (from absent to low). The comparison of these models of methane and sulfide biogeochemistry of a hypersaline mat has both ecological and geobiological significance, as one hypothesis of Archean microbial mats is that they existed in a low sulfate environment.

  13. MMX-I: A data-processing software for multi-modal X-ray imaging and tomography

    International Nuclear Information System (INIS)

    Bergamaschi, A; Medjoubi, K; Somogyi, A; Messaoudi, C; Marco, S

    2017-01-01

    Scanning hard X-ray imaging allows simultaneous acquisition of multimodal information, including X-ray fluorescence, absorption, phase and dark-field contrasts, providing structural and chemical details of the samples. Combining these scanning techniques with the infrastructure developed for fast data acquisition at Synchrotron Soleil permits to perform multimodal imaging and tomography during routine user experiments at the Nanoscopium beamline. A main challenge of such imaging techniques is the online processing and analysis of the generated very large volume (several hundreds of Giga Bytes) multimodal data-sets. This is especially important for the wide user community foreseen at the user oriented Nanoscopium beamline (e.g. from the fields of Biology, Life Sciences, Geology, Geobiology), having no experience in such data-handling. MMX-I is a new multi-platform open-source freeware for the processing and reconstruction of scanning multi-technique X-ray imaging and tomographic datasets. The MMX-I project aims to offer, both expert users and beginners, the possibility of processing and analysing raw data, either on-site or off-site. Therefore we have developed a multi-platform (Mac, Windows and Linux 64bit) data processing tool, which is easy to install, comprehensive, intuitive, extendable and user-friendly. MMX-I is now routinely used by the Nanoscopium user community and has demonstrated its performance in treating big data. (paper)

  14. Molecular characterization and geological microenvironment of a microbial community inhabiting weathered receding shale cliffs.

    Science.gov (United States)

    Cockell, Charles S; Pybus, David; Olsson-Francis, Karen; Kelly, Laura; Petley, David; Rosser, Nick; Howard, Kieren; Mosselmans, Fred

    2011-01-01

    Shales play an important role in many earth system processes including coastal erosion, and they form the foundations of many engineering structures. The geobiology of the interior of pyrite-containing receding shale cliffs on the coast of northeast England was examined. The surface of the weathered shales was characterised by a thin layer of disordered authigenic iron oxyhydroxides and localised acicular, platy and aggregated gypsum, which was characterised by Raman spectroscopy, XAS and SEM. These chemical changes are likely to play an important role in causing rock weakening along fractures at the micron scale, which ultimately lead to coastal retreat at the larger scale. The surface of the shale hosts a novel, low-diversity microbial community. The bacterial community was dominated by Proteobacteria, with phylotypes closely associating with Methylocella and other members of the γ-subdivision. The second largest phylogenetic group corresponded to Nitrospira. The archaeal 16S rRNA phylotypes were dominated by a single group of sequences that matched phylotypes reported from South African gold mines and possessed ammonia monooxygenase (amoA) genes. Both the phylogenetic and the mineral data show that acidic microenvironments play an important role in shale weathering, but the shale has a higher microbial diversity than previously described pyritic acid mine drainage sites. The presence of a potentially biogeochemically active microbial population on the rock surface suggests that microorganisms may contribute to early events of shale degradation and coastal erosion.

  15. Lunar and Planetary Science XXXV: Astrobiology: Analogs and Applications to the Search for Life

    Science.gov (United States)

    2004-01-01

    The session "Astrobiology: Analogs and Applications to the Search for Life" included the folowing reports:The Search for Life on Mars Using Macroscopically Visible Microbial Mats (Stromatolites) in 3.5/3.3 Ga Cherts from the Pilbara in Australia and Barberton in South Africa as Analogues; Life in a Mars Analog: Microbial Activity Associated with Carbonate Cemented Lava Breccias from NW Spitsbergen; Groundwater-fed Iron-rich Microbial Mats in a Freshwater Creek: Growth Cycles and Fossilization Potential of Microbial Features; Episodic Fossilization of Microorganisms on an Annual Timescale in an Anthropogenically Modified Natural Environment: Geochemical Controls and Implications for Astrobiology; Proterozoic Microfossils and Their Implications for Recognizing Life on Mars; Microbial Alteration of Volcanic Glass in Modern and Ancient Oceanic Crust as a Proxy for Studies of Extraterrestrial Material ; Olivine Alteration on Earth and Mars; Searching for an Acidic Aquifer in the R!o Tinto Basin. First Geobiology Results of MARTE Project; In-Field Testing of Life Detection Instruments and Protocols in a Mars Analogue Arctic Environment; Habitability of the Shallow Subsurface on Mars: Clues from the Meteorites; Mars Analog Rio Tinto Experiment (MARTE): 2003 Drilling Campaign to Search for a Subsurface Biosphere at Rio Tinto Spain; Characterization of the Organic Matter in an Archean Chert (Warrawoona, Australia); and The Solfatara Crater, Italy: Characterization of Hydrothermal Deposits, Biosignatures and Their Astrobiological Implication.

  16. Tracing Biosignature Preservation of Geothermally Silicified Microbial Textures into the Geological Record.

    Science.gov (United States)

    Campbell, Kathleen A; Lynne, Bridget Y; Handley, Kim M; Jordan, Sacha; Farmer, Jack D; Guido, Diego M; Foucher, Frédéric; Turner, Susan; Perry, Randall S

    2015-10-01

    New Zealand and Argentine (Late Jurassic-Recent) siliceous hot-spring deposits (sinter) reveal preservation pathways of environmentally controlled, microbe-dominated sedimentary facies over geological time scales. Texturally distinctive, laminated to thinly layered, dense and vertically oriented, microtubular "palisade" fabric is common in low-temperature (geological events. A systematic approach was used to characterize palisade fabric in sinters of different ages to refine tools for recognizing biosignatures in extreme environments and to track their long-term preservation pathways into the geological record. Molecular techniques, scanning electron microscopy, Raman spectrometry, X-ray powder diffraction, petrography, and lipid biomarker analyses were applied. Results indicate that microbial communities vary at the micron scale and that early and rapid silicification is paramount to long-term preservation, especially where minimal postdepositional disturbance follows fossilization. Overall, it appears that the most robust biomarkers of fossil microbial activity in hot-spring deposits are their characteristic macro- and microtextures and laser micro-Raman identified carbon. Studies of Phanerozoic geothermal deposits with mineralized microbial components are relevant analogs for Precambrian geobiology because early life is commonly preserved as microbial microfossils and biofilms in silica, some of it hydrothermal in origin. Yet the diagenetic "movie" has already been run. Hence, studying younger sinters of a range of ages provides an opportunity to "play it again" and follow the varied influences on biosignatures into the deep-time geological record.

  17. Transport and transformation of genetic information in the critical zone: The case of antibiotic resistance genes

    Science.gov (United States)

    Zhu, Y. G.

    2015-12-01

    In addition to material and energy flows, the dynamics and functions of the Earth's critical zone are intensively mediated by biological actions performed by diverse organisms. These biological actions are modulated by the expression of functional genes and their translation into enzymes that catalyze geochemical reactions, such as nutrient turnover and pollutant biodegradation. Although geobiology, as an interdisciplinary research area, is playing and vital role in linking biological and geochemical processes at different temporal and spatial scales, the distribution and transport of functional genes have rarely been investigated from the Earth's critical zone perspectives. To illustrate the framework of studies on the transport and transformation of genetic information in the critical zone, antibiotic resistance is taken as an example. Antibiotic resistance genes are considered as a group of emerging contaminants, and their emergence and spread within the critical zone on one hand are induced by anthropogenic activities, and on other hand are threatening human health worldwide. The transport and transformation of antibiotic resistance genes are controlled by both horizontal gene transfer between bacterial cells and the movement of bacteria harboring antibiotic resistance genes. In this paper, the fate and behavior of antibiotic resistance genes will be discussed in the following aspects: 1) general overview of environmental antibiotic resistance; 2) high through quantification of the resistome in various environmental media; 3) pathways of resistance gene flow within the critical zone; and 4) potential strategies in mitigating antibiotic resistance, particularly from the critical zone perspectives.

  18. The Case of the Lacking Carbonates and the Emergence of Early Life on Mars

    Directory of Open Access Journals (Sweden)

    Ricardo Amils

    2010-08-01

    Full Text Available The mineralogical characterization of Mars by different exploration missions, provides a new image of the earliest conditions that prevailed on the planet surface. The detection of extensive deposits of phyllosillicates has been considered to be as a result of the production of hydrated silicates through alteration and precipitation under neutral to sub-alkaline conditions. Although extensive deposits of carbonates should precipitate beneath a thick CO2-bearing atmosphere, only a few outcrops of Mg-rich carbonates have been detected on Mars. Paradoxically those carbonates occur in association with geological units exposed to acidic paleoenvironments. Given such geochemical conditions on Earth, the carbon cycle is intimately associated with life, then, we can assume that the presence or absence of microbial communities should have impacted the distribution of those carbonate compounds on Mars. In this paper, we suggest three potential geobiological scenarios to explain how the emergence of life on Mars would have impacted the carbon cycle and, hence, the formation of carbonates on a planetary scale.

  19. Synthesis of arborane triterpenols by a bacterial oxidosqualene cyclase

    Science.gov (United States)

    Banta, Amy B.; Wei, Jeremy H.; Gill, Clare C. C.; Giner, José-Luis; Welander, Paula V.

    2017-01-01

    Cyclic triterpenoids are a broad class of polycyclic lipids produced by bacteria and eukaryotes. They are biologically relevant for their roles in cellular physiology, including membrane structure and function, and biochemically relevant for their exquisite enzymatic cyclization mechanism. Cyclic triterpenoids are also geobiologically significant as they are readily preserved in sediments and are used as biomarkers for ancient life throughout Earth's history. Isoarborinol is one such triterpenoid whose only known biological sources are certain angiosperms and whose diagenetic derivatives (arboranes) are often used as indicators of terrestrial input into aquatic environments. However, the occurrence of arborane biomarkers in Permian and Triassic sediments, which predates the accepted origin of angiosperms, suggests that microbial sources of these lipids may also exist. In this study, we identify two isoarborinol-like lipids, eudoraenol and adriaticol, produced by the aerobic marine heterotrophic bacterium Eudoraea adriatica. Phylogenetic analysis demonstrates that the E. adriatica eudoraenol synthase is an oxidosqualene cyclase homologous to bacterial lanosterol synthases and distinct from plant triterpenoid synthases. Using an Escherichia coli heterologous sterol expression system, we demonstrate that substitution of four amino acid residues in a bacterial lanosterol synthase enabled synthesis of pentacyclic arborinols in addition to tetracyclic sterols. This variant provides valuable mechanistic insight into triterpenoid synthesis and reveals diagnostic amino acid residues to differentiate between sterol and arborinol synthases in genomic and metagenomic datasets. Our data suggest that there may be additional bacterial arborinol producers in marine and freshwater environments that could expand our understanding of these geologically informative lipids.

  20. An Integrated Strategy for Promoting Geoscience Education and Research in Developing Countries through International Cooperation

    Science.gov (United States)

    Aswathanarayana, U.

    2007-12-01

    Geoscience education and research in Developing countries should aim at achieving food, water and environmental security, and disaster preparedness, based on the synergetic application of earth (including atmospheric and oceanic realms), space and information sciences through economically-viable, ecologically- sustainable and people-participatory management of natural resources. The proposed strategy involves the integration of the following three principal elements: (i) What needs to be taught: Geoscience needs to be taught as earth system science incorporating geophysical, geochemical and geobiological approaches, with focus (say, 80 % of time) on surficial processes (e.g. dynamics of water, wind and waves, surface and groundwater, soil moisture, geomorphology, landuse, crops), and surficial materials (e.g. soils, water, industrial minerals, sediments, biota). Subjects such as the origin, structure and evolution of the earth, and deep-seated processes (e.g. dynamics of the crust-mantle interaction, plate tectonics) could be taught by way of background knowledge (say, 20 % of the time), (ii) How jobs are to be created: Jobs are to be created by merging geoscience knowledge with economic instruments (say, micro enterprises), and management structures at different levels (Policy level, Technology Transfer level and Implementation level), customized to the local biophysical and socioeconomic situations, and (iii) International cooperation: Web-based instruction (e.g. education portals, virtual laboratories) through South - South and North - South cooperation, customized to the local biophysical and socioeconomic situations, with the help of (say) UNDP, UNESCO, World Bank, etc.

  1. Deep-biosphere consortium of fungi and prokaryotes in Eocene subseafloor basalts.

    Science.gov (United States)

    Bengtson, S; Ivarsson, M; Astolfo, A; Belivanova, V; Broman, C; Marone, F; Stampanoni, M

    2014-11-01

    The deep biosphere of the subseafloor crust is believed to contain a significant part of Earth's biomass, but because of the difficulties of directly observing the living organisms, its composition and ecology are poorly known. We report here a consortium of fossilized prokaryotic and eukaryotic micro-organisms, occupying cavities in deep-drilled vesicular basalt from the Emperor Seamounts, Pacific Ocean, 67.5 m below seafloor (mbsf). Fungal hyphae provide the framework on which prokaryote-like organisms are suspended like cobwebs and iron-oxidizing bacteria form microstromatolites (Frutexites). The spatial inter-relationships show that the organisms were living at the same time in an integrated fashion, suggesting symbiotic interdependence. The community is contemporaneous with secondary mineralizations of calcite partly filling the cavities. The fungal hyphae frequently extend into the calcite, indicating that they were able to bore into the substrate through mineral dissolution. A symbiotic relationship with chemoautotrophs, as inferred for the observed consortium, may be a pre-requisite for the eukaryotic colonization of crustal rocks. Fossils thus open a window to the extant as well as the ancient deep biosphere. © 2014 The Authors. Geobiology Published by John Wiley & Sons Ltd.

  2. Potential and limits of Raman spectroscopy for carotenoid detection in microorganisms: implications for astrobiology

    Science.gov (United States)

    Jehlička, Jan; Edwards, Howell G. M.; Osterrothová, Kateřina; Novotná, Julie; Nedbalová, Linda; Kopecký, Jiří; Němec, Ivan; Oren, Aharon

    2014-01-01

    In this paper, it is demonstrated how Raman spectroscopy can be used to detect different carotenoids as possible biomarkers in various groups of microorganisms. The question which arose from previous studies concerns the level of unambiguity of discriminating carotenoids using common Raman microspectrometers. A series of laboratory-grown microorganisms of different taxonomic affiliation was investigated, such as halophilic heterotrophic bacteria, cyanobacteria, the anoxygenic phototrophs, the non-halophilic heterotrophs as well as eukaryotes (Ochrophyta, Rhodophyta and Chlorophyta). The data presented show that Raman spectroscopy is a suitable tool to assess the presence of carotenoids of these organisms in cultures. Comparison is made with the high-performance liquid chromatography approach of analysing pigments in extracts. Direct measurements on cultures provide fast and reliable identification of the pigments. Some of the carotenoids studied are proposed as tracers for halophiles, in contrast with others which can be considered as biomarkers of other genera. The limits of application of Raman spectroscopy are discussed for a few cases where the current Raman spectroscopic approach does not allow discriminating structurally very similar carotenoids. The database reported can be used for applications in geobiology and exobiology for the detection of pigment signals in natural settings. PMID:25368348

  3. Novel archaeal tetraether lipids with a cyclohexyl ring identified in Fayetteville Green Lake, NY, and other sulfidic lacustrine settings.

    Science.gov (United States)

    Liu, Xiao-Lei; De Santiago Torio, Ana; Bosak, Tanja; Summons, Roger Everett

    2016-05-30

    The meromictic Fayetteville Green Lake (FGL) is of significant geobiological interest because of microbial cycling of sulfur within and below the permanent chemocline and in the euxinic deep waters. Studies of glycerol dibiphytanyl glycerol tetraethers (GDGTs) may help shed light on understanding the activity of archaeal communities in these habitats. Normal-phase and reversed-phase liquid chromatography/mass spectrometry (LC/MS) analysis on total lipid extracts of environmental samples revealed series of GDGTs with different biphytane structures. Comparison of the mass spectrum of biphytane obtained from separated novel GDGTs with that of a synthetic C 40 biphytane confirms our structural assignments. A unique cyclohexyl ring configured in the middle of a C 40 biphytane chain was identified in these novel GDGTs. We suggest the trivial name S-GDGTs for these compounds, where 'S' stands for 'sulfidic' and 'six-membered ring'. S-GDGT derivatives composed of biphytanes modified with double bonds and cyclopentane rings were also detected in the samples we analyzed. Intact polar lipid precursors of S-GDGT include compounds with mono- and diglycosyl head groups. The carbon isotopic composition of S-GDGTs and their occurrence in FGL, Messel Shale as well as Salt Pond and salt marshes on Cape Cod suggest that S-GDGTs may be produced by chemoautotrophic archaea that prefer sulfidic conditions. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  4. MMX-I: A data-processing software for multi-modal X-ray imaging and tomography

    Science.gov (United States)

    Bergamaschi, A.; Medjoubi, K.; Messaoudi, C.; Marco, S.; Somogyi, A.

    2017-06-01

    Scanning hard X-ray imaging allows simultaneous acquisition of multimodal information, including X-ray fluorescence, absorption, phase and dark-field contrasts, providing structural and chemical details of the samples. Combining these scanning techniques with the infrastructure developed for fast data acquisition at Synchrotron Soleil permits to perform multimodal imaging and tomography during routine user experiments at the Nanoscopium beamline. A main challenge of such imaging techniques is the online processing and analysis of the generated very large volume (several hundreds of Giga Bytes) multimodal data-sets. This is especially important for the wide user community foreseen at the user oriented Nanoscopium beamline (e.g. from the fields of Biology, Life Sciences, Geology, Geobiology), having no experience in such data-handling. MMX-I is a new multi-platform open-source freeware for the processing and reconstruction of scanning multi-technique X-ray imaging and tomographic datasets. The MMX-I project aims to offer, both expert users and beginners, the possibility of processing and analysing raw data, either on-site or off-site. Therefore we have developed a multi-platform (Mac, Windows and Linux 64bit) data processing tool, which is easy to install, comprehensive, intuitive, extendable and user-friendly. MMX-I is now routinely used by the Nanoscopium user community and has demonstrated its performance in treating big data.

  5. Determination of burnup for IEAR-1 fuel elements by non destructive method of gamma spectrometry

    International Nuclear Information System (INIS)

    Madi Filho, T.; Holland, L.

    1982-01-01

    Burnup determination, by non-destructive gamma spectrometry of spent fuel with high and low activity of IEAR-1 reactor, using Cs-137 as burnup monitor, were done. To measure the Cs-137 distribution in these elements a Ge(Li) detector, with volume equal to 73,7 cm 3 , in two measurement systems with defined geometry and good colimation, was used. The IEA-14 taken from the core about 20 years ago, presents a gamma spectra due to Cs-137. The IEA-80, with cooling time approximately to 5 years, shows a more complex gamma spectrum due to other fission products still found in significant quantities. The IEA-14 measures were done in a measurement system used outside the reactor pool (S.I.), being the global efficiency of this system obtained by using a plane, calibrated and extense Ag-110 m source. Detailed measures of gamma transmission, using Cs-137 as a calibrated and punctiforme source, showed the high homogenity of the fuel plates. (E.G.) [pt

  6. A new device for vein localization and effect of application of disinfectant spray on its efficiency

    Directory of Open Access Journals (Sweden)

    Dreyer Jan

    2017-09-01

    Full Text Available A functional device was developed to immediately show the localization of veins by detecting a temperature increase on the skin directly above them. Our new idea, compared to other developments, is the comparison of temperatures between a small, ideally punctiform, skin area, and a larger circularly surrounding area. This is realized by two infrared temperature sensors, one with a small field of view, and the other one with a larger field of view. The position of the vein is indicated by two laser modules, which beams cross in one spot, when the device is held in a defined distance to the skin. If the device is held over a vein, the laser spot lightens up. The device was tested in ten study participants. Cooling of the skin by disinfectant spray prior to the measurements increases the temperature gradient and thereby improves the efficiency of the device. Temperature profiles of four skin areas of each study participant were measured before and one minute after application of disinfectant spray. After application of disinfectant spray, a temperature difference of more than 0.3 K between a measuring point above a vein and points 15 mm next to this could be found in 36 out of 40 measurements (90%, compared to 26 out of 40 (65% before disinfection. The mean temperature gradient could be increased from 0.476 K to 1.03 K (p < 0.001.

  7. Endovascular optical coherence tomography ex vivo: venous wall anatomy and tissue alterations after endovenous therapy

    International Nuclear Information System (INIS)

    Meissner, Oliver A.; Schmedt, Claus-Georg; Steckmeier, Bernd M.; Hunger, Kathrin; Reiser, Maximilian; Mueller-Lisse, Ullrich; Hetterich, Holger; Rieber, Johannes; Sroka, Ronald; Babaryka, Gregor; Siebert, Uwe

    2007-01-01

    Endovascular optical coherence tomography (OCT) is a new imaging modality providing histology-like information of the venous wall. Radiofrequency ablation (RFA) and laser therapy (ELT) are accepted alternatives to surgery. This study evaluated OCT for qualitative assessment of venous wall anatomy and tissue alterations after RFA and ELT in bovine venous specimens. One hundred and thirty-four venous segments were obtained from ten ex-vivo bovine hind limbs. OCT signal characteristics for different wall layers were assessed in 180/216 (83%) quadrants from 54 normal venous cross-sections. Kappa statistics (κ) were used to calculate intra- and inter-observer agreement. Qualitative changes after RFA (VNUS-Closure) and ELT (diode laser 980 nm, energy densities 15 Joules (J)/cm, 25 J/cm, 35 J/cm) were described in 80 venous cross-sections. Normal veins were characterized by a three-layered appearance. After RFA, loss of three-layered appearance and wall thickening at OCT corresponded with circular destruction of tissue structures at histology. Wall defects after ELT ranged from non-transmural punctiform damage to complete perforation, depending on the energy density applied. Intra- and inter-observer agreement for reading OCT images was very high (0.90 and 0.88, respectively). OCT allows for reproducible evaluation of normal venous wall and alterations after endovenous therapy. OCT could prove to be valuable for optimizing endovenous therapy in vivo. (orig.)

  8. Self-expanding stent-assisted middle cerebral artery recanalization: technical note

    International Nuclear Information System (INIS)

    Sauvageau, Eric; Levy, Elad I.

    2006-01-01

    Investigation into pharmacological and mechanical means of improving recanalization rates by intraarterial therapy has led to technological development. Angiographic recanalization has been associated with improvement in clinical outcome. A clot retriever has recently joined an imperfect armamentarium for intraarterial stroke therapy. In this report, we describe successful recanalization of an acute thrombotic occlusion of the inferior division of the middle cerebral artery (MCA) achieved with a self-expanding stent. An 82-year-old woman with a history of coronary atherosclerosis and previous cerebellar hemorrhage presented with a National Institutes of Health Stroke Scale (NIHSS) score of 11. Perfusion computed tomography imaging showed a left MCA territory deficit. Diffusion-weighted magnetic resonance (MR) imaging revealed a small punctiform insular hyperintensity. Angiography documented occlusion of the inferior division of the left MCA (Thrombolysis in Myocardial Infarction or Thrombolysis in Cerebral Infarction, TIMI/TICI, grade 0). Intraarterial delivery of eptifibatide to the occlusion site failed to recanalize the vessel. Deployment of a self-expanding stent in the occluded segment resulted in complete revascularization of the distal vascular bed. Angiography performed on the next day confirmed patency of the stented vessel segment (TIMI/TICI 3). The patient was discharged 3 days after the procedure (NIHSS 3). MR angiography obtained 3 months after the procedure documented left MCA patency. This technique may have a role worthy of further investigation in acute stroke therapy. (orig.)

  9. Species diversity and qualitative assessment of ground beetles (Coleoptera: Carabidae) in three riparian habitats.

    Science.gov (United States)

    Michels, G J; Carney, V A; Jones, E N; Pollock, D A

    2010-06-01

    In a 3-yr study involving saltcedar-free, saltcedar-infested, and burned habitats in a riparian area at Lake Meredith, TX, the number of carabid species collected, diversity indices, and indicator species varied significantly among habitats. A 3-yr average of 15, 14, and 24 carabid species were collected from the saltcedar-free, saltcedar-infested, and burned habitats, respectively. Values for species richness, Shannon's and Simpson's diversity indices, and evenness index for pooled data collected from 2005 to 2007 were higher in the burned habitat followed by the saltcedar-free habitat and the saltcedar-infested habitat. Within-year parameters across the three habitats generally followed the pooled data results with some variation. Nonmetric multidimensional scaling analyses clearly indicated groups of carabid species preferred specific habitats. Five species in the burned area had indicator species percentage values >50% (Agonum punctiforme, Agonum texanum, Brachinus alternans, Harpalus pensylvanicus, and Poecilus chalcites). In the saltcedar-infested and saltcedar-free habitats, only one species in each habitat had indicator species percentage values that exceeded 50%: Calathus opaculus and Cicindela punctulata punctulata, respectively.

  10. History of Science and Conceptual Change: The Formation of Shadows by Extended Light Sources

    Science.gov (United States)

    Dedes, Christos; Ravanis, Konstantinos

    2009-09-01

    This study investigates the effectiveness of a teaching conflict procedure whose purpose was the transformation of the representations of 12-16-year-old pupils in Greece concerning light emission and shadow formation by extended light sources. The changes observed during the children’s effort to destabilize and reorganise their representations towards a model that was compatible with the respective scientific model were studied using three groups of pupils belonging to different age groups. The methodological plan implemented was based on input from the History of Science, while the parameters of the geometrical optics model were derived from Kepler’s relevant historic experiment. The effectiveness of the teaching procedure was evaluated 2 weeks after the intervention. The results showed that the majority of the subjects accepted the model of geometrical optics, i.e. the pupils were able to correctly predict and adequately justify the experimental results based on the principle of punctiform light emission. Educational and research implications are discussed.

  11. Isolation and Pathogenicity of Streptococcus iniae in Cultured Red Hybrid Tilapia in Malaysia.

    Science.gov (United States)

    Rahmatullah, M; Ariff, M; Kahieshesfandiari, M; Daud, H M; Zamri-Saad, M; Sabri, M Y; Amal, M N A; Ina-Salwany, M Y

    2017-12-01

    This study describes the isolation and pathogenicity of Streptococcus iniae in cultured red hybrid tilapia (Nile Tilapia Oreochromis niloticus × Mozambique Tilapia O. mossambicus) in Malaysia. The isolated gram-positive S. iniae appeared punctiform, transparently white, catalase and oxidase negative and produced complete β-hemolysis on blood agar, while a PCR assay resulted in the amplification of the 16 S rRNA gene and lactate oxidase encoded genes. The isolate was sensitive to tetracycline, vancomycin, and bacitracin but was resistant to streptomycin, ampicillin, penicillin, and erythromycin. Pathogenicity trials conducted in local red hybrid tilapia (mean ± SE = 20.00 ± 0.45 g) showed 90.0, 96.7, and 100.0% mortality within 14 d postinfection following intraperitoneal exposure to 10 4 , 10 6 , and 10 8 CFU/mL of the pathogen, respectively. The clinical signs included erratic swimming, lethargy, and inappetance at 6 h postinfection, while mortality was recorded at less than 24 h postinfection in all infected groups. The LD 50-336 h of S. iniae against the red hybrid tilapia was 10 2 CFU/mL. The post mortem examinations revealed congested livers, kidneys, and spleens of the infected fish. This is the first report of S. iniae experimental infection in cultured red hybrid tilapia in Malaysia. Received January 20, 2017; accepted July 16, 2017.

  12. Cribellate thread production in spiders: Complex processing of nano-fibres into a functional capture thread.

    Science.gov (United States)

    Joel, Anna-Christin; Kappel, Peter; Adamova, Hana; Baumgartner, Werner; Scholz, Ingo

    2015-11-01

    Spider silk production has been studied intensively in the last years. However, capture threads of cribellate spiders employ an until now often unnoticed alternative of thread production. This thread in general is highly interesting, as it not only involves a controlled arrangement of three types of threads with one being nano-scale fibres (cribellate fibres), but also a special comb-like structure on the metatarsus of the fourth leg (calamistrum) for its production. We found the cribellate fibres organized as a mat, enclosing two parallel larger fibres (axial fibres) and forming the typical puffy structure of cribellate threads. Mat and axial fibres are punctiform connected to each other between two puffs, presumably by the action of the median spinnerets. However, this connection alone does not lead to the typical puffy shape of a cribellate thread. Removing the calamistrum, we found a functional capture thread still being produced, but the puffy shape of the thread was lost. Therefore, the calamistrum is not necessary for the extraction or combination of fibres, but for further processing of the nano-scale cribellate fibres. Using data from Uloborus plumipes we were able to develop a model of the cribellate thread production, probably universally valid for cribellate spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. Controlled thermonuclear fusion: research on magnetic fusion

    International Nuclear Information System (INIS)

    Paris, P.J.

    1988-12-01

    Recent progress in thermonuclear fusion research indicates that the scientists' schedule for the demonstration of the scientific feasibility will be kept and that break-even will be attained in the course of the next decade. To see the implementation of ignition, however, the generation of future experiments must be awaited. These projects are currently under study. With technological research going on in parallel, they should at the same time contribute to the design of a reactor. Fusion reactors will be quite different from the fission nuclear reactors we know, and the waste of the plants will also be of a different nature. It is still too early to define the precise design of a fusion reactor. On the basis of a toric machine concept like that of the tokamak, we can, however, envisage that the problems with which we are confronted will be solved one after the other. As we have just seen, these will be the objectives of the future experimental installations where ignition will be possible and where the flux of fast neutrons will be so strong that they will allow the study of low-activation materials which will be used in the structure of the reactor. But this is also a task in which from now onwards numerous laboratories in Europe and in the world participate. The works are in fact punctiform, and often the mutual incidences can only be determined by an approach simulated by numerical codes. (author) 19 figs., 6 tabs., 8 refs

  14. Clinical value of the assistant interventional embolization in treatment of juvenile nasopharyngeal angiofibroma

    International Nuclear Information System (INIS)

    Xu Guobin; Zhou Shi; Liu Junfang; Hu Jinxiang; Long Qingyun

    2007-01-01

    Objective: To study the application of the assistant digital subtraction angiography (DSA) with selective intra-arterial embolization in comprehensive treatment of juvenile nasopharyngeal angiofibroma. Methods: Among 17 patients with juvenile nasopharyngeal angiofibroma confirmed by surgery and biopsy from February 2000 to June 2005, 13 cases underwent DSA examination and selective intra-arterial embolization on 1-4 days before surgical operation, and 4 cases with uncontrollable epistaxis through conventional therapy were carried out urgent DSA and embolization as well as surgical operation on a scheduled day. Angiographic manifestations and hemostatic effects and impacts in surgical operation were observed. Results: The extent and blood supply of lesions and the features of feeding artery were clearly demonstrated by DSA. Supplying vessel was mainly maxillary artery originating from external caroted artery in 16 cases, and double supplying vessels from ramus of internal and external carotid arteries in 1 case. In general, the higher the nasopharyngeal angiofibroma grade was the more supplying branches would exist. As for epistaxis patients, the number of the presence of irregular distal vessels and the punctiform extravasation of contrast media were displayed in positive proportion. No severe complications occurred and active bleeding was stopped after embolization and furthermore with less blood loss during surgical operation statistically about 280-1600 ml (460±255.5). Conclusions: DSA examination and selective arterial embolization can not only present more accurate important clinical imaging features but also in favour of stop bleeding and enhance surgical outcomes for patients with nasopharyngeal angiogibroma. (authors)

  15. Antarctic new particle formation from continental biogenic precursors

    Directory of Open Access Journals (Sweden)

    E.-M. Kyrö

    2013-04-01

    Full Text Available Over Antarctica, aerosol particles originate almost entirely from marine areas, with minor contribution from long-range transported dust or anthropogenic material. The Antarctic continent itself, unlike all other continental areas, has been thought to be practically free of aerosol sources. Here we present evidence of local aerosol production associated with melt-water ponds in continental Antarctica. We show that in air masses passing such ponds, new aerosol particles are efficiently formed and these particles grow up to sizes where they may act as cloud condensation nuclei (CCN. The precursor vapours responsible for aerosol formation and growth originate very likely from highly abundant cyanobacteria Nostoc commune (Vaucher communities of local ponds. This is the first time freshwater vegetation has been identified as an aerosol precursor source. The influence of the new source on clouds and climate may increase in future Antarctica, and possibly elsewhere undergoing accelerating summer melting of semi-permanent snow cover.

  16. Antarctic new particle formation from continental biogenic precursors

    Science.gov (United States)

    Kyrö, E.-M.; Kerminen, V.-M.; Virkkula, A.; Dal Maso, M.; Parshintsev, J.; Ruíz-Jimenez, J.; Forsström, L.; Manninen, H. E.; Riekkola, M.-L.; Heinonen, P.; Kulmala, M.

    2013-04-01

    Over Antarctica, aerosol particles originate almost entirely from marine areas, with minor contribution from long-range transported dust or anthropogenic material. The Antarctic continent itself, unlike all other continental areas, has been thought to be practically free of aerosol sources. Here we present evidence of local aerosol production associated with melt-water ponds in continental Antarctica. We show that in air masses passing such ponds, new aerosol particles are efficiently formed and these particles grow up to sizes where they may act as cloud condensation nuclei (CCN). The precursor vapours responsible for aerosol formation and growth originate very likely from highly abundant cyanobacteria Nostoc commune (Vaucher) communities of local ponds. This is the first time freshwater vegetation has been identified as an aerosol precursor source. The influence of the new source on clouds and climate may increase in future Antarctica, and possibly elsewhere undergoing accelerating summer melting of semi-permanent snow cover.

  17. EPS composition and calcification potential of tufa-dominating cyanobacteria investigated by Scanning Transmission X-ray Microscopy (STXM) and Laser Scanning Microscopy (LSM)

    Science.gov (United States)

    Zippel, Barbara; Dynes, James J.; Obst, Martin; Lawrence, John R.; Neu, Thomas R.

    2010-05-01

    Tufa deposits in freshwater habitats are the result of calcium carbonate precipitation within interfacial microbial ecosystems. Calcite precipitation is influenced by the saturation index and the occurrence of extracellular polymeric substances (EPS) which are produced by a variety of microorganisms. In theory, the first important step of biologically induced calcification processes is the adsorption of calcium ions by extracellular polymeric substances (EPS) produced by cyanobacteria. In the present study we take advantage of Laser Scanning Microscopy (LSM) and combine it with Synchrotron imaging using Scanning Transmission X-ray Microscopy (STXM). STXM represents a technique that allows simultaneous analysis of inorganic and organic constituents as a scale of 50 nm. By means of STXM it is possible to differentiate between calcium carbonate phases at the Ca L-edge. Furthermore, STXM has also been used at the C K-edge to map the major biomolecules (proteins, lipids, and polysaccharides). The purpose of this study is to find out if there are differences in calcium adsorption depending on specific composition of the EPS produced by filamentous cyanobacteria isolated from a German hard water creek (Westerhöfer Bach, Harz Mountains). The goal was to elucidate the potential of biofilms constituents, including microbial cell surfaces as well as extracellular polymeric substances, in triggering the formation of calcium carbonate in tufa systems. For this purpose three filamentous cyanobacteria (Pseudanabaena sp., Leptolyngbya sp. and Nostoc sp.) were cultivated in creek-adapted as well as standard media (BG11) on polycarbonate slides. In situ EPS composition was detected by means of fluorescence lectin-binding approach (FLBA) using 23 commercially available lectins with different specificities for mono- and disaccharides and amino sugars. For CaCO3 nucleation experiments cyanobacterial biofilms grown on polycarbonate slides were deposited in NaHCO3/CaCl2 solutions

  18. Removal of some radionuclides from water by bioaccumulation

    Energy Technology Data Exchange (ETDEWEB)

    Miskovic, D.; Conkic, L.; Dalmacija, B.; Gantar, M. (Trg D. Obradvica 3, Novi Sad (Yugoslavia). Faculty of Sciences)

    1992-01-01

    First objective of this study was to investigate the application of biologically activated carbon (BAC) as well as its comparison to adsorption, with the aim of removing some radionuclides from water. The isotopes Cs[sup 134] and Cs[sup 137] were bioaccumulated by BAC up to 50%, while the I[sup 131] isotope was only physicochemically adsorbed (about 40%). Also, the process of radionuclides (Cs[sup 137], Ce[sup 139], Co[sup 57], Co[sup 60]) fixation on blue-green algae (Nostoc sp.) was investigated. The kinetics of the removal of these radionuclides from water was recorded. It was found that after a contact period of about half an hour 40-70% of the activity was removed. (Author).

  19. Cadmium-mediated resistance to metals and antibiotics in a cyanobacterium

    Energy Technology Data Exchange (ETDEWEB)

    Singh, S.P.; Pandey, A.K.

    1982-01-01

    Cadmium-resistant strains of the cyanobacterium Nostoc calcicola were isolated through the step-wise transfer of the organism to higher levels of the metal. One of the Cd-resistant strains (CDsup(r)-10) showed cross-resistance to antibiotics like neomycin (1 ..mu..g/ml), chloramphenicol (3 ..mu..g/ml) but not to streptomycin. The Cd-resistant strain also tolerated elevated levels of metals such as zinc 20 ppm) and mercury (1 ppm). The stability of the metal-resistance required the presence of Cd/sup 2 +/ ions in the growth medium. It is suggested that metal resistance may also be determined by gene(s) on the antibiotic resistance plasmids in cyanobacteria.

  20. Hydrogen production by several cyanobacteria

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Dhruv; Kumar, H.D. (Banaras Hindu Univ., Varanasi (India). Dept. of Botany)

    1992-11-01

    Twenty species belonging to eleven genera of nitrogen-fixing and non-nitrogen-fixing cyanobacteria were screened for production of hydrogen. Only one species each of Nostoc and Anabaena showed light-and nitrogenase-dependent aerobic hydrogen production. The highest rate of aerobic hydrogen production was recorded in Anabaena sp. strain CA. When incubated anaerobically under 99% Ar + 1% CO[sub 2], all the tested strains produced hydrogen. Nickel supplementation completely abolished hydrogen production both under aerobic and anaerobic conditions, except in Anabaena sp. strain CA, where only the rate of production was decreased. Species of Plectonema, Oscillatoria and Spirulina showed methyl viologen-dependent (hydrogenase-dependent) hydrogen production. Other physiological activities were also studied with a view to selecting a suitable organism for large-scale production of hydrogen. (author)

  1. Biodegradation and Utilization of Organophosphorus Pesticide Malathion by Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Wael M. Ibrahim

    2014-01-01

    Full Text Available Three strains of filamentous Cyanobacteria were used to study their growth and utilization of organophosphorus pesticide malathion. A sharp decrease in the growth of the algal strains was observed by increasing the concentration of malathion. Amongst them Nostoc muscorum tolerated different concentrations and was recorded as the highest efficient strain for biodegradation (91% of this compound. Moreover, carbohydrate and protein content of their cells overtopped the other strains especially at higher concentrations. The algal strains were further subjected to grow under P-limitation in absence and presence of malathion. Although, the algal growth under P-limitation recorded a very poor level, a massive enhanced growth and phosphorous content of cells were obtained when the P-limited medium was amended with malathion. This study clarified that N. muscorum with its capability to utilize malathion as a sole phosphorous source is considered as an inexpensive and efficient biotechnology for remediation of organophosphorus pesticide from contaminated wastewater.

  2. Observations on aerophytic cyanobacteria and algae from ten caves in the Ojców National Park

    Directory of Open Access Journals (Sweden)

    Joanna Czerwik-Marcinkowska

    2013-04-01

    Full Text Available This study, carried out in 2010–11, focuses on species composition and distribution of cyanobacterial and algal communities colonizing ten caves (Biała, Ciemna, Koziarnia, Krakowska, Łokietka, Okopy Wielka Dolna, Sąspowska, Sypialnia, Zbójecka and Złodziejska Caves in the Ojców National Park (South Poland. A total of 85 taxa were identified, 35 of them belonging to cyanobacteria, 30 chlorophytes, and 20 belonging to other groups of algae. Aerophytic cyanobacteria dominated in these calcareous habitats. Nine species, Gloeocapsa alpina, Nostoc commune, Chlorella vulgaris, Dilabifilum arthopyreniae, Klebsormidium flaccidum, Muriella decolor, Neocystis subglobosa, and Orthoseira roseana, were the most abundant taxa in all the caves. The investigated microhabitats offer relatively stable microclimatic conditions and are likely to be responsible for the observed vertical distribution of aerophytic cyanobacteria and algae.

  3. Capillary Electrophoresis Single-Strand Conformational Polymorphisms as a Method to Differentiate Algal Species

    Directory of Open Access Journals (Sweden)

    Alice Jernigan

    2015-01-01

    Full Text Available Capillary electrophoresis single-strand conformational polymorphism (CE-SSCP was explored as a fast and inexpensive method to differentiate both prokaryotic (blue-green and eukaryotic (green and brown algae. A selection of two blue-green algae (Nostoc muscorum and Anabaena inaequalis, five green algae (Chlorella vulgaris, Oedogonium foveolatum, Mougeotia sp., Scenedesmus quadricauda, and Ulothrix fimbriata, and one brown algae (Ectocarpus sp. were examined and CE-SSCP electropherogram “fingerprints” were compared to each other for two variable regions of either the 16S or 18S rDNA gene. The electropherogram patterns were remarkably stable and consistent for each particular species. The patterns were unique to each species, although some common features were observed between the different types of algae. CE-SSCP could be a useful method for monitoring changes in an algae species over time as potential shifts in species occurred.

  4. Fluorescent minerals - A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments

    Science.gov (United States)

    Omairi, Tareq; Wainwright, Milton

    2015-07-01

    We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark.

  5. Antibacterial Property of a Coral-Associated Bacterium Pseudoalteromonas luteoviolacea Against Shrimp Pathogenic Vibrio harveyi (In Vitro Study

    Directory of Open Access Journals (Sweden)

    OCKY KARNA RADJASA

    2005-06-01

    Full Text Available A coral-associated bacterium was successfully screened for secondary metabolites production based on PCR amplification of the nonribosomal peptide synthetase gene and was identified as closely related to Pseudoalteromonas luteoviolacea based on its 16S rDNA. The bacterium was found to inhibit the growth of shrimp pathogenic bacterium tested, Vibrio harveyi. To characterize the inhibiting metabolite, a 279 bp long DNA fragment was obtained and the deduced amino acid sequence showed conserved signature regions for peptide synthetases and revealed a high similarity to NosD (40% identity, a multifunctional peptide synthetase from Nostoc sp. GSV224, and NdaB (44% identity, a peptide synthetase module of Nodularia spumigena

  6. Aquatic weeds: their implications in Indian nuclear industry

    International Nuclear Information System (INIS)

    Rao, T.S.; Anup Kumar, B.; Aruna Jyothi, K.; Satpathy, K.K.

    2000-01-01

    The aquatic weed infestation of KAPS cooling water system, MAPS open reservoir, and the growth of filamentous algae and bacteria in the feed water unit of HWP (Kota), was investigated. The aquatic weeds identified were: Ceratophyllum, Elodea, Hydrilla verticillata, Najas and Vallisneria species. However, at HWP (Kota) filamentous alga (Nostoc punchiformis) and bacteria (Sphaerotilus natans) were found in plenty. The metabolic products when assayed in the form of total carbohydrate content released by weeds was 3.7 mg gm -1 biomass. The metabolic products adsorb on to the resin matrix and impaired its performance at HWP (K), enhanced bacterial growth on the resin beads and furthered resin deterioration. Besides, the growth of aquatic weeds also influenced the pH of the cooling water, thereby vitiating the water treatment programme. (author)

  7. Utilization of the terrestrial cyanobacteria

    Science.gov (United States)

    Katoh, Hiroshi; Tomita-Yokotani, Kaori; Furukawa, Jun; Kimura, Shunta; Yokoshima, Mika; Yamaguchi, Yuji; Takenaka, Hiroyuki

    The terrestrial, N _{2}-fixing cyanobacterium, Nostoc commune has expected to utilize for agriculture, food and terraforming cause of its extracellular polysaccharide, desiccation tolerance and nitrogen fixation. Previously, the first author indicated that desiccation related genes were analyzed and the suggested that the genes were related to nitrogen fixation and metabolisms. In this report, we suggest possibility of agriculture, using the cyanobacterium. Further, we also found radioactive compounds accumulated N. commune (cyanobacterium) in Fukushima, Japan after nuclear accident. Thus, it is investigated to decontaminate radioactive compounds from the surface soil by the cyanobacterium and showed to accumulate radioactive compounds using the cyanobacterium. We will discuss utilization of terrestrial cyanobacteria under closed environment. Keyword: Desiccation, terrestrial cyanobacteria, bioremediation, agriculture

  8. Total Synthesis and Stereochemical Assignment of Nostosin B

    Directory of Open Access Journals (Sweden)

    Xiaoji Wang

    2017-02-01

    Full Text Available Nostosins A and B were isolated from a hydrophilic extract of Nostoc sp. strain from Iran, which exhibits excellent tryps inhibitory activity. Nostosin A was the most potent natural tripeptide aldehyde as trypsin inhibitor up to now. Both R‐ and S‐2‐hydroxy‐4‐(4‐hydroxy‐phenyl butanoic acid (Hhpba were prepared and incorporated into the total synthesis of nostosin B, respectively. Careful comparison of the NMR spectra and optical rotation data of synthetic nostosin B (1a and 1b with the natural product led to the unambiguous identification of the R‐configuration of the Hhpba fragment, which was further confirmed by co‐injection with the authentic sample on HPLC using both reversed phase column and the chiral AD‐RH column.

  9. Recent developments in therapeutic applications of Cyanobacteria.

    Science.gov (United States)

    Raja, Rathinam; Hemaiswarya, Shanmugam; Ganesan, Venkatesan; Carvalho, Isabel S

    2016-05-01

    The cyanobacteria (blue-green algae) are photosynthetic prokaryotes having applications in human health with numerous biological activities and as a dietary supplement. It is used as a food supplement because of its richness in nutrients and digestibility. Many cyanobacteria (Microcystis sp, Anabaena sp, Nostoc sp, Oscillatoria sp., etc.) produce a great variety of secondary metabolites with potent biological activities. Cyanobacteria produce biologically active and chemically diverse compounds belonging to cyclic peptides, lipopeptides, fatty acid amides, alkaloids and saccharides. More than 50% of the marine cyanobacteria are potentially exploitable for extracting bioactive substances which are effective in killing cancer cells by inducing apoptotic death. Their role as anti-viral, anti-tumor, antimicrobial, anti-HIV and a food additive have also been well established. However, such products are at different stages of clinical trials and only a few compounds have reached to the market.

  10. Comunidad de cianobacterias durante el ciclo de cultivo de arroz: Oriza sativa L. Cyanobacteria during a rice (Oriza sativa L. crop cycle

    Directory of Open Access Journals (Sweden)

    Cecilia Isabel Sánchez

    2007-07-01

    Full Text Available El desarrollo de las cianobacterias en el cultivo de arroz se ve afectado por diferentes factores abióticos entre ellos la temperatura. El objetivo de nuestro trabajo fue analizar la evolución de la comunidad de cianobacterias durante el ciclo del cultivo de arroz en sitios con diferentes temperaturas del agua de inundación. El cultivo fue regado con agua subterránea. Se compararon dos ubicaciones respecto de la entrada del agua al lote. En macollaje, a los tres días desde la inundación, los recuentos de cianobacterias totales fueron similares en los dos sitios, pero difirieron en los muestreos de panoja embuchada y madurez fisiológica. Los géneros encontrados durante todo el ciclo fueron: Chroococcus, Aphanocapsa y Gloeocapsa (unicelulares, Oscillatoria, Lyngbya y Arthrospira (filamentosas no heterocísticas, Anabaena, Nostoc,Cylindrospermunm y Gloeotrichia (filamentosas heterocísticas. Las cianobacterias filamentosas heterocísticas no superaron el 45% y, en la mayoría de los muestreos, osciló alrededor del 25%. En la zona de mayor temperatura, la proporción de cianobacterias unicelulares fue mayor, y menor la de filamentosas no heterocísticas, la cual fue menor al 2% durante todo el ciclo. Los valores de diversidad de Simpson fueron mayores en la zona de mayor temperatura en cada uno de los momentos de muestreo. Los géneros dominantes fueron unicelulares (Chroococcus y Gloeocapsa en cinco de los seis muestreos. En ambos sitios, el género Chroococcus siempre estuvo presente. Gloeocapsa y Nostoc aparecieron a partir de panoja embuchada y los géneros Cylindrospermum y Gloeotrichia en madurez fisiológica.Abiotic factors as temperature affect cyanobacterial growth in rice crop fields. The aim of our study was to evaluate cyanobacteria during rice crop development in two crop areas with different water temperature. We worked in a rice crop flooded with subterraneous water. We sampled two sites that differed in the distance from the

  11. Antibacterial Property of a Coral-Associated Bacterium Pseudoalteromonas luteoviolacea Against Shrimp Pathogenic Vibrio harveyi (In Vitro Study

    Directory of Open Access Journals (Sweden)

    OCKY KARNA RADJASA

    2005-06-01

    Full Text Available A coral-associated bacterium was successfully screened for secondary metabolites production based on PCR amplification of the nonribosomal peptide synthetase gene and was identified as closely related to Pseudoalteromonas luteoviolacea based on its 16S rDNA.The bacterium was found to inhibit the growth of shrimp pathogenic bacterium tested, Vibrio harveyi. To characterize the inhibiting metabolite, a 279 bp long DNA fragment was obtained and the deduced amino acid sequence showed conserved signature regions for peptide synthetases and revealed a high similarity to NosD (40% identity, a multifunctional peptide synthetase from Nostoc sp. GSV224, and NdaB (44% identity, a peptide synthetase module of Nodularia spumigena.

  12. Phylogeny of culturable cyanobacteria from Brazilian mangroves.

    Science.gov (United States)

    Silva, Caroline Souza Pamplona; Genuário, Diego Bonaldo; Vaz, Marcelo Gomes Marçal Vieira; Fiore, Marli Fátima

    2014-03-01

    The cyanobacterial community from Brazilian mangrove ecosystems was examined using a culture-dependent method. Fifty cyanobacterial strains were isolated from soil, water and periphytic samples collected from Cardoso Island and Bertioga mangroves using specific cyanobacterial culture media. Unicellular, homocytous and heterocytous morphotypes were recovered, representing five orders, seven families and eight genera (Synechococcus, Cyanobium, Cyanobacterium, Chlorogloea, Leptolyngbya, Phormidium, Nostoc and Microchaete). All of these novel mangrove strains had their 16S rRNA gene sequenced and BLAST analysis revealed sequence identities ranging from 92.5 to 99.7% when they were compared with other strains available in GenBank. The results showed a high variability of the 16S rRNA gene sequences among the genotypes that was not associated with the morphologies observed. Phylogenetic analyses showed several branches formed exclusively by some of these novel 16S rRNA gene sequences. BLAST and phylogeny analyses allowed for the identification of Nodosilinea and Oxynema strains, genera already known to exhibit poor morphological diacritic traits. In addition, several Nostoc and Leptolyngbya morphotypes of the mangrove strains may represent new generic entities, as they were distantly affiliated with true genera clades. The presence of non-ribosomal peptide synthetase, polyketide synthase, microcystin and saxitoxin genes were detected in 20.5%, 100%, 37.5% and 33.3%, respectively, of the 44 tested isolates. A total of 134 organic extracts obtained from 44 strains were tested against microorganisms, and 26% of the extracts showed some antimicrobial activity. This is the first polyphasic study of cultured cyanobacteria from Brazilian mangrove ecosystems using morphological, genetic and biological approaches. Copyright © 2014 Elsevier GmbH. All rights reserved.

  13. Identification of Conserved and Potentially Regulatory Small RNAs in Heterocystous Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Manuel eBrenes-Álvarez

    2016-02-01

    Full Text Available Small RNAs (sRNAs are a growing class of non-protein-coding transcripts that participate in the regulation of virtually every aspect of bacterial physiology. Heterocystous cyanobacteria are a group of photosynthetic organisms that exhibit multicellular behaviour and developmental alternatives involving specific transcriptomes exclusive of a given physiological condition or even a cell type. In the context of our ongoing effort to understand developmental decisions in these organisms we have undertaken an approach to the global identification of sRNAs. Using differential RNA-Seq we have previously identified transcriptional start sites for the model heterocystous cyanobacterium Nostoc sp. PCC 7120. Here we combine this dataset with a prediction of Rho-independent transcriptional terminators and an analysis of phylogenetic conservation of potential sRNAs among 89 available cyanobacterial genomes. In contrast to predictive genome-wide approaches, the use of an experimental dataset comprising all active transcriptional start sites (differential RNA-Seq facilitates the identification of bona fide sRNAs. The output of our approach is a dataset of predicted potential sRNAs in Nostoc sp. PCC 7120, with different degrees of phylogenetic conservation across the 89 cyanobacterial genomes analyzed. Previously described sRNAs appear among the predicted sRNAs, demonstrating the performance of the algorithm. In addition, new predicted sRNAs are now identified that can be involved in regulation of different aspects of cyanobacterial physiology, including adaptation to nitrogen stress, the condition that triggers differentiation of heterocysts (specialized nitrogen-fixing cells. Transcription of several predicted sRNAs that appear exclusively in the genomes of heterocystous cyanobacteria is experimentally verified by Northern blot. Cell-specific transcription of one of these sRNAs, NsiR8 (nitrogen stress-induced RNA 8, in developing heterocysts is also

  14. Effect of algal biofertilizer on yield and protein content of rice

    Energy Technology Data Exchange (ETDEWEB)

    Antarikanonda, P.; Amarit, P.; Chetsumon; Tancharoenrat, P.

    Four strains of nitrogen fixing blue-green algae, namely Anabaena siamensis, Anabaena lutea, Nostoc sp. 46 and Nostoc sp. 79. Mixed cultures were applied as biofertilizers to four paddy soil samples, taken from Rangsit, Khok Sumrong, Sakhon Nakorn and Surin areas. Pots which were arranged in completely randomized design consisted of 3 replications and 2 treatment in each replication. These treatments comprise an unbiofertilizer and a biofertilizer which biofertilizer rate was applied equally at 4 grams of blue green algae per 10 kilograms of soil sample. The results showed that algal biofertilizer enhanced the growth and yield of the rice significantly, which was noticeable in the dry weight of the straw and grain of rice, for all sources of soil. Grain yield of rice in these soils increased form the check of 32.07, 34.87, 8.86 and 21.49 to 53.14, 49.53, 20.02, and 49.60 grams per pot, respectively. The responsiveness of rice which received algal biofertilizer was different. The percentage increase in yield ranged from 42% in Khok Sumrong soil and 66% in Rangsit soil, to 126 and 131% in Sakhon Nakorn and Surin soil, respectively. Significant increase in protein content of rice with the application of algal biofertilizer was from the check of 5.03, 5.14, 6.75 and 5.25 to 6.45, 6.53, 7.80 and 7.11 percent respectively. The difference in plant N-uptake level, after the application algal biofertilizer gave 383.50, 310.00, 222.20 and 480.70 milligrams per pot, respectively.

  15. Algas alimenticias para mejorar la calidad nutritiva de los productos cárnicos

    Directory of Open Access Journals (Sweden)

    Brita Anaya González

    2014-12-01

    Full Text Available Objetivos: Mejorar la calidad nutritiva de los productos cárnicos a través de algas alimenticias. Métodos: Investigación básica experimental, con un diseño aleatorizado. La población estuvo constituida por diversos tipos de carne: res, cordero, cerdo y alpaca; y algas: Nostoc sp. conocido como nostoc, Gigartina chamissoi (qochayuyo y Ulva sp. (yuyo que llegan al mercado Nery García de la ciudad de Huamanga, capital del departamento de Ayacucho. La muestra comprendió 2 kg de cada tipo de carne y algas. La determinación de nutrientes fue sobre la base de los métodos de la AOAC (Official Methods of Analysis. Resultados: Al ser comparadas 5 mezclas de diferentes proporciones de carnes y algas, la diferencia encontrada fue significativa entre el contenido de valor calórico (P=0,000 y nutritivo (P=0,000. La mezcla A fue la ideal con un porcentaje de proteínas de 31,87 g%, las grasas con un valor de 12,95 g%, inferior a lo existente en las carnes lo que es favorable para una disminución de riesgos de enfermedades. El porcentaje de carbohidratos reportó 7,10 g% cantidad baja, pero con buen tenor de fibra 16,00 g% sumamente importante para el peristaltismo y buen funcionamiento del sistema digestivo. La cantidad de cenizas de 4,02 g%, significa que existe un buen aporte de minerales indispensables para el organismo. Conclusiones: Se mejoró la calidad nutritiva de los productos cárnicos al adicionar algas, con un valor calórico de 272,43 kcal/100g satisfactorio, y el valor nutritivo de 2,41 lo identifica como altamente nutritivo.

  16. Detection of phosphatase activity in aquatic and terrestrial cyanobacterial strains

    Directory of Open Access Journals (Sweden)

    Babić Olivera B.

    2013-01-01

    Full Text Available Cyanobacteria, as highly adaptable microorganisms, are characterized by an ability to survive in different environmental conditions, in which a significant role belongs to their enzymes. Phosphatases are enzymes produced by algae in relatively large quantities in response to a low orthophosphate concentration and their activity is significantly correlated with their primary production. The activity of these enzymes was investigated in 11 cyanobacterial strains in order to determine enzyme synthesis depending on taxonomic and ecological group of cyanobacteria. The study was conducted with 4 terrestrial cyanobacterial strains, which belong to Nostoc and Anabaena genera, and 7 filamentous water cyanobacteria of Nostoc, Oscillatoria, Phormidium and Microcystis genera. The obtained results showed that the activity of acid and alkaline phosphatases strongly depended on cyanobacterial strain and the environment from which the strain originated. Higher activity of alkaline phosphatases, ranging from 3.64 to 85.14 μmolpNP/s/dm3, was recorded in terrestrial strains compared to the studied water strains (1.11-5.96 μmolpNP/s/dm3. The activity of acid phosphatases was higher in most tested water strains (1.67-6.28 μmolpNP/s/dm3 compared to the activity of alkaline phosphatases (1.11-5.96 μmolpNP/s/dm3. Comparing enzyme activity of nitrogen fixing and non-nitrogen fixing cyanobacteria, it was found that most nitrogen fixing strains had a higher activity of alkaline phosphatases. The data obtained in this work indicate that activity of phosphatases is a strain specific property. The results further suggest that synthesis and activity of phosphatases depended on eco-physiological characteristics of the examined cyanobacterial strains. This can be of great importance for the further study of enzymes and mechanisms of their activity as a part of cyanobacterial survival strategy in environments with extreme conditions. [Projekat Ministarstva nauke Republike

  17. Flexibility-Rigidity Coordination of the Dense Exopolysaccharide Matrix in Terrestrial Cyanobacteria Acclimated to Periodic Desiccation.

    Science.gov (United States)

    Liu, Wen; Cui, Lijuan; Xu, Haiyan; Zhu, Zhaoxia; Gao, Xiang

    2017-11-15

    A dense exopolysaccharide (EPS) matrix is crucial for cyanobacterial survival in terrestrial xeric environments, in which cyanobacteria undergo frequent expansion and shrinkage processes during environmental desiccation-rehydration cycles. However, it is unclear how terrestrial cyanobacteria coordinate the structural dynamics of the EPS matrix upon expansion and shrinkage to avoid potential mechanical stress while benefiting from the matrix. In the present study, we sought to answer this question by investigating the gene expression, protein dynamics, enzymatic characteristics, and biological roles of WspA, an abundantly secreted protein, in the representative terrestrial cyanobacterium Nostoc flagelliforme The results demonstrated that WspA is a novel β-galactosidase that facilitates softening of the EPS matrix by breaking the polysaccharide backbone under substantial moisture or facilitates the thickening and relinkage of the broken matrix during the drying process, and thus these regulations are well correlated with moisture availability or desiccation-rehydration cycles. This coordination of flexibility and rigidity of the cyanobacterial extracellular matrix may contribute to a favorable balance of cell growth and stress resistance in xeric environments. IMPORTANCE How the exopolysaccharide matrix is dynamically coordinated by exoproteins to cope with frequent expansion and shrinkage processes in terrestrial colonial cyanobacteria remains unclear. Here we elucidated the biochemical identity and biological roles of a dominant exoprotein in these regulation processes. Our study thus gained insight into this regulative mechanism in cyanobacteria to combat periodic desiccation. In addition, the filamentous drought-adapted cyanobacterium Nostoc flagelliforme serves as an ideal model for us to explore this issue in this study. Copyright © 2017 American Society for Microbiology.

  18. Temporal variation in community composition, pigmentation, and Fv/Fm of desert cyanobacterial soil crusts

    Science.gov (United States)

    Bowker, M.A.; Reed, S.C.; Belnap, J.; Phillips, S.L.

    2002-01-01

    Summers on the Colorado Plateau (USA) are typified by harsh conditions such as high temperatures, brief soil hydration periods, and high UV and visible radiation. We investigated whether community composition, physiological status, and pigmentation might vary in biological soil crusts as a result of such conditions. Representative surface cores were sampled at the ENE, WSW, and top microaspects of 20 individual soil crust pedicels at a single site in Canyonlands National Park, Utah, in spring and fall of 1999. Frequency of cyanobacterial taxa, pigment concentrations, and dark adapted quantum yield (Fv/Fm) were measured for each core. The frequency of major cyanobacterial taxa was lower in the fall compared to spring. The less-pigmented cyanobacterium Microcoleus vaginatus showed significant mortality when not in the presence of Nostoc spp. and Scytonema myochrous (Dillw.) Agardh. (both synthesizers of UV radiation-linked pigments) but had little or no mortality when these species were abundant. We hypothesize that the sunscreen pigments produced by Nostoc and Scytonema in the surface of crusts protect other, less-pigmented taxa. When fall and spring samples were compared, overall cyanobacterial frequency was lower in fall, while sunscreen pigment concentrations, chlorophyll a concentration, and Fv/Fm were higher in fall. The ratio of cyanobacterial frequency/chlorophyll a concentrations was 2-3 times lower in fall than spring. Because chlorophyll a is commonly used as a surrogate measure of soil cyanobacterial biomass, these results indicate that seasonality needs to be taken into consideration. In the fall sample, most pigments associated with UV radiation protection or repair were at their highest concentrations on pedicel tops and WSW microaspects, and at their lowest concentrations on ENE microaspects. We suggest that differential pigment concentrations between microaspects are induced by varying UV radiation dosage at the soil surface on these different

  19. Cyanobacterial Polyhydroxybutyrate (PHB): Screening, Optimization and Characterization.

    Science.gov (United States)

    Ansari, Sabbir; Fatma, Tasneem

    2016-01-01

    In modern life petroleum-based plastic has become indispensable due to its frequent use as an easily available and a low cost packaging and moulding material. However, its rapidly growing use is causing aquatic and terrestrial pollution. Under these circumstances, research and development for biodegradable plastic (bioplastics) is inevitable. Polyhydroxybutyrate (PHB), a type of microbial polyester that accumulates as a carbon/energy storage material in various microorganisms can be a good alternative. In this study, 23 cyanobacterial strains (15 heterocystous and 8 non-heterocystous) were screened for PHB production. The highest PHB (6.44% w/w of dry cells) was detected in Nostoc muscorum NCCU- 442 and the lowest in Spirulina platensis NCCU-S5 (0.51% w/w of dry cells), whereas no PHB was found in Cylindrospermum sp., Oscillatoria sp. and Plectonema sp. Presence of PHB granules in Nostoc muscorum NCCU- 442 was confirmed microscopically with Sudan black B and Nile red A staining. Pretreatment of biomass with methanol: acetone: water: dimethylformamide [40: 40: 18: 2 (MAD-I)] with 2 h magnetic bar stirring followed by 30 h continuous chloroform soxhlet extraction acted as optimal extraction conditions. Optimized physicochemical conditions viz. 7.5 pH, 30°C temperature, 10:14 h light:dark periods with 0.4% glucose (as additional carbon source), 1.0 gl-1 sodium chloride and phosphorus deficiency yielded 26.37% PHB on 7th day instead of 21st day. Using FTIR, 1H NMR and GC-MS, extracted polymer was identified as PHB. Thermal properties (melting temperature, decomposition temperatures etc.) of the extracted polymer were determined by TGA and DSC. Further, the polymer showed good tensile strength and young's modulus with a low extension to break ratio comparable to petrochemical plastic. Biodegradability potential tested as weight loss percentage showed efficient degradation (24.58%) of PHB within 60 days by mixed microbial culture in comparison to petrochemical plastic.

  20. Methane as a Climate Driver During the Precambrian Eon (Invited)

    Science.gov (United States)

    Kasting, J. F.

    2013-12-01

    around 600-800 Ma could have caused a decrease in both these gases, possibly triggering the Neoproterozoic Snowball Earth glaciations (12). Future carbon isotope studies could shed light on this hypothesis. References:[1] Pavlov, A. A., Kasting, J. F., & Brown, L. L. (2001) J. Geophys. Res. 106, 23,267-223,287. [2] Kharecha, P., Kasting, J. F., & Siefert, J. L. (2005) Geobiology 3, 53-76. [3] Haqq-Misra, J. D., Domagal-Goldman, S. D., Kasting, P. J., & Kasting, J. F. (2008) Astrobiol. 8, 1127-1137. [4] Wolf, E. T. & Toon, O. B. (2013) Astrobiology 13, 656-673. [5] Driese, S. G., Jirsa, M. A., Ren, M., Brantley, S. L., Sheldon, N. D., Parker, D., & Schmitz, M. (2011) Precambrian Research 189, 1-17. [6] Evans, D. A., Beukes, N. J., & Kirshvink, J. L. (1997) Nature 386, 262-266. [7] Domagal-Goldman, S. D., Kasting, J. F., Johnston, D. T., & Farquhar, J. (2008) Earth and Planetary Science Letters 269, 29-40. [8] Wordsworth, R. & Pierrehumbert, R. (2013) Science 339, 64-67. [9] Lovelock, J. (1988) The Ages of Gaia (W.W. Norton, New York). [10] Canfield, D. E. (1998) Nature 396, 450-453. [11] Pavlov, A. A., Hurtgen, M. T., Kasting, J. F., & Arthur, M. A. (2003) Geology 31, 87-90. [12] Roberson, A. L., Roadt, J., Halevy, I., & Kasting, J. F. (2011) Geobiology 9, 313-320.

  1. Microbial diversity and biomarker analysis of modern freshwater microbialites from Laguna Bacalar, Mexico.

    Science.gov (United States)

    Johnson, D B; Beddows, P A; Flynn, T M; Osburn, M R

    2018-05-01

    Laguna Bacalar is a sulfate-rich freshwater lake on the Yucatan Peninsula that hosts large microbialites. High sulfate concentrations distinguish Laguna Bacalar from other freshwater microbialite sites such as Pavilion Lake and Alchichica, Mexico, as well as from other aqueous features on the Yucatan Peninsula. While cyanobacterial populations have been described here previously, this study offers a more complete characterization of the microbial populations and corresponding biogeochemical cycling using a three-pronged geobiological approach of microscopy, high-throughput DNA sequencing, and lipid biomarker analyses. We identify and compare diverse microbial communities of Alphaproteobacteria, Deltaproteobacteria, and Gammaproteobacteria that vary with location along a bank-to-bank transect across the lake, within microbialites, and within a neighboring mangrove root agglomeration. In particular, sulfate-reducing bacteria are extremely common and diverse, constituting 7%-19% of phylogenetic diversity within the microbialites, and are hypothesized to significantly influence carbonate precipitation. In contrast, Cyanobacteria account for less than 1% of phylogenetic diversity. The distribution of lipid biomarkers reflects these changes in microbial ecology, providing meaningful biosignatures for the microbes in this system. Polysaturated short-chain fatty acids characteristic of cyanobacteria account for Bacalar microbialites. By contrast, even short-chain and monounsaturated short-chain fatty acids attributable to both Cyanobacteria and many other organisms including types of Alphaproteobacteria and Gammaproteobacteria constitute 43%-69% and 17%-25%, respectively, of total abundance in microbialites. While cyanobacteria are the largest and most visible microbes within these microbialites and dominate the mangrove root agglomeration, it is clear that their smaller, metabolically diverse associates are responsible for significant biogeochemical cycling in this

  2. Spies and Bloggers: New Synthetic Biology Tools to Understand Microbial Processes in Soils and Sediments

    Science.gov (United States)

    Masiello, C. A.; Silberg, J. J.; Cheng, H. Y.; Del Valle, I.; Fulk, E. M.; Gao, X.; Bennett, G. N.

    2017-12-01

    Microbes can be programmed through synthetic biology to report on their behavior, informing researchers when their environment has triggered changes in their gene expression (e.g. in response to shifts in O2 or H2O), or when they have participated in a specific step of an elemental cycle (e.g. denitrification). This use of synthetic biology has the potential to significantly improve our understanding of microbes' roles in elemental and water cycling, because it allows reporting on the environment from the perspective of a microbe, matching the measurement scale exactly to the scale that a microbe experiences. However, synthetic microbes have not yet seen wide use in soil and sediment laboratory experiments because synthetic organisms typically report by fluorescing, making their signals difficult to detect outside the petri dish. We are developing a new suite of microbial programs that report instead by releasing easily-detected gases, allowing the real-time, noninvasive monitoring of behaviors in sediments and soils. Microbial biosensors can, in theory, be programmed to detect dynamic processes that contribute to a wide range of geobiological processes, including C cycling (biofilm production, methanogenesis, and synthesis of extracellular enzymes that degrade organic matter), N cycling (expression of enzymes that underlie different steps of the N cycle) and potentially S cycling. We will provide an overview of the potential uses of gas-reporting biosensors in soil and sediment lab experiments, and will report the development of the systematics of these sensors. Successful development of gas biosensors for laboratory use will require addressing issues including: engineering the intensity and selectivity of microbial gas production to maximize the signal to noise ratio; normalizing the gas reporter signal to cell population size, managing gas diffusion effects on signal shape; and developing multiple gases that can be used in parallel.

  3. Post-speleogenetic biogenic modification of Gomantong Caves, Sabah, Borneo

    Science.gov (United States)

    Lundberg, Joyce; McFarlane, Donald A.

    2012-07-01

    The Gomantong cave system of eastern Sabah, Malaysia, is well-known as an important site for harvesting edible bird-nests and, more recently, as a tourist attraction. Although the biology of the Gomantong system has been repeatedly studied, very little attention has been given to the geomorphology. Here, we report on the impact of geobiological modification in the development of the modern aspect of the cave, an important but little recognized feature of tropical caves. Basic modeling of the metabolic outputs from bats and birds (CO2, H2O, heat) reveals that post-speleogenetic biogenic corrosion can erode bedrock by between ~ 3.0 mm/ka (1 m/~300 ka) and ~ 4.6 mm/ka (1 m/~200 ka). Modeling at high densities of bats yields rates of corrosion of ~ 34 mm/ka (or 1 m/~30 ka). Sub-aerial corrosion creates a previously undescribed speleological feature, the apse-flute, which is semicircular in cross-section and ~ 80 cm wide. It is vertical regardless of rock properties, developing in parallel but apparently completely independently, and often unbroken from roof to floor. They end at a blind hemi-spherical top with no extraneous water source. Half-dome ceiling conch pockets are remnants of previous apse-fluting. Sub-cutaneous corrosion creates the floor-level guano notch formed by organic acid dissolution of bedrock in contact with guano. Speleogenetic assessment suggests that as much as 70-95% of the total volume of the modern cave may have been opened by direct subaerial biogenic dissolution and biogenically-induced collapse, and by sub-cutaneous removal of limestone, over a timescale of 1-2 Ma.

  4. Thallium isotopes track fluctuations in global manganese oxide burial during the Ediacaran Period

    Science.gov (United States)

    Ostrander, C. M.; Nielsen, S.; Owens, J. D.; Jiang, G.; Planavsky, N.; Sahoo, S. K.; Zhang, F.; Lyons, T. W.; Anbar, A. D.

    2017-12-01

    Complex marine ecosystems appear in the geologic record for the first time during the Ediacaran (635 - 541 Ma), after the Marinoan Glaciation but before the Cambrian Explosion. Much debate surrounds the redox-state of global oceans during this diversification, with some arguing for pervasive anoxic conditions and others for increased oxygenation, including the possibility of episodic oxygen increases. Here, we use thallium (Tl) isotopes preserved in organic-rich shales from a deep-water section at Wuhe, South China, to track large-scale perturbations in Mn oxide burial during the Ediacaran. Changes to the Tl isotope composition of seawater over geologic timescales are driven dominantly by fluctuations in global Mn oxide burial, which require persistent O2 at the sediment-water interface. Importantly, the suite of sedimentary rocks analyzed is thought to have been deposited beneath persistent localized euxinia, which is an environment shown to effectively capture the Tl isotope composition of seawater. Within samples previously suggested to host oceanic oxygenation episodes (OOEs) because of high redox-sensitive element (RSE) enrichments (Sahoo et al. 2016, Geobiology), we find Tl isotope values as light as -5 epsilon units, which are indicative of removal of heavy Tl by Mn oxides elsewhere in the Ediacaran ocean and in-line with the presence of deep-marine O2. Intriguingly, between these events, during periods previously viewed as dominantly anoxic, we find Tl isotope excursions to values that are even lighter than during the OOEs (less than -10 epsilon units). To first order, these results imply that an even larger Mn oxide sink was present between the OOEs, which would require pervasive oceanic oxygenation. This interpretation is in direct conflict with interpretations of low RSE enrichments in these same samples, which invoke reservoir drawdown due to widespread anoxia—as well as many other data that suggest dominantly anoxic deep marine conditions through the

  5. Cyanobacterial life at low O(2): community genomics and function reveal metabolic versatility and extremely low diversity in a Great Lakes sinkhole mat.

    Science.gov (United States)

    Voorhies, A A; Biddanda, B A; Kendall, S T; Jain, S; Marcus, D N; Nold, S C; Sheldon, N D; Dick, G J

    2012-05-01

    Cyanobacteria are renowned as the mediators of Earth's oxygenation. However, little is known about the cyanobacterial communities that flourished under the low-O(2) conditions that characterized most of their evolutionary history. Microbial mats in the submerged Middle Island Sinkhole of Lake Huron provide opportunities to investigate cyanobacteria under such persistent low-O(2) conditions. Here, venting groundwater rich in sulfate and low in O(2) supports a unique benthic ecosystem of purple-colored cyanobacterial mats. Beneath the mat is a layer of carbonate that is enriched in calcite and to a lesser extent dolomite. In situ benthic metabolism chambers revealed that the mats are net sinks for O(2), suggesting primary production mechanisms other than oxygenic photosynthesis. Indeed, (14)C-bicarbonate uptake studies of autotrophic production show variable contributions from oxygenic and anoxygenic photosynthesis and chemosynthesis, presumably because of supply of sulfide. These results suggest the presence of either facultatively anoxygenic cyanobacteria or a mix of oxygenic/anoxygenic types of cyanobacteria. Shotgun metagenomic sequencing revealed a remarkably low-diversity mat community dominated by just one genotype most closely related to the cyanobacterium Phormidium autumnale, for which an essentially complete genome was reconstructed. Also recovered were partial genomes from a second genotype of Phormidium and several Oscillatoria. Despite the taxonomic simplicity, diverse cyanobacterial genes putatively involved in sulfur oxidation were identified, suggesting a diversity of sulfide physiologies. The dominant Phormidium genome reflects versatile metabolism and physiology that is specialized for a communal lifestyle under fluctuating redox conditions and light availability. Overall, this study provides genomic and physiologic insights into low-O(2) cyanobacterial mat ecosystems that played crucial geobiological roles over long stretches of Earth history.

  6. Microbial communities and organic biomarkers in a Proterozoic-analog sinkhole.

    Science.gov (United States)

    Hamilton, T L; Welander, P V; Albrecht, H L; Fulton, J M; Schaperdoth, I; Bird, L R; Summons, R E; Freeman, K H; Macalady, J L

    2017-11-01

    Little Salt Spring (Sarasota County, FL, USA) is a sinkhole with groundwater vents at ~77 m depth. The entire water column experiences sulfidic (~50 μM) conditions seasonally, resulting in a system poised between oxic and sulfidic conditions. Red pinnacle mats occupy the sediment-water interface in the sunlit upper basin of the sinkhole, and yielded 16S rRNA gene clones affiliated with Cyanobacteria, Chlorobi, and sulfate-reducing clades of Deltaproteobacteria. Nine bacteriochlorophyll e homologues and isorenieratene indicate contributions from Chlorobi, and abundant chlorophyll a and pheophytin a are consistent with the presence of Cyanobacteria. The red pinnacle mat contains hopanoids, including 2-methyl structures that have been interpreted as biomarkers for Cyanobacteria. A single sequence of hpnP, the gene required for methylation of hopanoids at the C-2 position, was recovered in both DNA and cDNA libraries from the red pinnacle mat. The hpnP sequence was most closely related to cyanobacterial hpnP sequences, implying that Cyanobacteria are a source of 2-methyl hopanoids present in the mat. The mats are capable of light-dependent primary productivity as evidenced by 13 C-bicarbonate photoassimilation. We also observed 13 C-bicarbonate photoassimilation in the presence of DCMU, an inhibitor of electron transfer to Photosystem II. Our results indicate that the mats carry out light-driven primary production in the absence of oxygen production-a mechanism that may have delayed the oxygenation of the Earth's oceans and atmosphere during the Proterozoic Eon. Furthermore, our observations of the production of 2-methyl hopanoids by Cyanobacteria under conditions of low oxygen and low light are consistent with the recovery of these structures from ancient black shales as well as their paucity in modern marine environments. © 2017 The Authors. Geobiology Published by John Wiley & Sons Ltd.

  7. Subseafloor basalts as fungal habitats

    Science.gov (United States)

    Ivarsson, M.; Bengtson, S.

    2013-12-01

    The oceanic crust makes up the largest potential habitat for life on Earth, yet next to nothing is known about the abundance, diversity and ecology of its biosphere. Our understanding of the deep biosphere of subseafloor crust is, with a few exceptions, based on a fossil record. Surprisingly, a majority of the fossilized microorganisms have been interpreted or recently re-interpreted as remnants of fungi rather than prokaryotes. Even though this might be due to a bias in fossilization the presence of fungi in these settings can not be neglected. We have examined fossilized microorganisms in drilled basalt samples collected at the Emperor Seamounts in the Pacific Ocean. Synchrotron-radiation X-ray tomography microscopy (SRXTM) studies has revealed a complex morphology and internal structure that corresponds to characteristic fungal morphology. Chitin was detected in the fossilized hyphae, which is another strong argument in favour of a fungal interpretation. Chitin is absent in prokaryotes but a substantial constituent in fungal cell walls. The fungal colonies consist of both hyphae and yeast-like growth states as well as resting structures and possible fruit bodies, thus, the fungi exist in vital colonies in subseafloor basalts. The fungi have also been involved in extensive weathering of secondary mineralisations. In terrestrial environments fungi are known as an important geobiological agent that promotes mineral weathering and decomposition of organic matter, and they occur in vital symbiosis with other microorganisms. It is probable to assume that fungi would play a similar role in subseafloor basalts and have great impact on the ecology and on biogeochemical cycles in such environments.

  8. Understanding of crop phenology using satellite-based retrievals and climate factors - a case study on spring maize in Northeast China plain

    Science.gov (United States)

    Shuai, Yanmin; Xie, Donghui; Wang, Peijuan; Wu, Menxin

    2014-03-01

    Land surface phenology is an efficient bio-indicator for monitoring terrestrial ecosystem variation in response to climate change. Numerous studies point out climate change plays an important role in modulating vegetation phenological events, especially in agriculture. In turn, surface changes caused by geo-biological processes can affect climate transition regionally and perhaps globally, as concluded by Intergovernmental Panel on Climate Change (IPCC) in 2001. Large amounts of research concluded that crops, as one of the most sensitive bio-indicators for climate change, can be strongly influenced by local weather such as temperature, moisture and radiation. Thus, investigating the details of weather impact and the feedback from crops can help improve our understanding of the interaction between crops and climate change at satellite scale. Our efforts start from this point, via case studies over the famous agriculture region in the Northeast China's plain to examine the response of spring maize under temperature and moisture stress. MODIS-based daily green vegetation information together with frequent field specification of the surface phenology as well as continuous measurements of the routine climatic factors during seven years (2003-2009) is used in this paper. Despite the obvious difference in scale between satellite estimations and field observations, the inter- and intra-annual variation of maize in seven-years' growth was captured successfully over three typical spring maize regions (Fuyu, Changling, and Hailun) in Northeast China. The results demonstrate that weather conditions such as changes of temperature and moisture stress provide considerable contribution to the year-to-year variations in the timing of spring maize phenological events.

  9. Expanding the role of reactive transport models in critical zone processes

    Science.gov (United States)

    Li, Li; Maher, Kate; Navarre-Sitchler, Alexis; Druhan, Jennifer; Meile, Christof; Lawrence, Corey; Moore, Joel; Perdrial, Julia; Sullivan, Pamela; Thompson, Aaron; Jin, Lixin; Bolton, Edward W.; Brantley, Susan L.; Dietrich, William E.; Mayer, K. Ulrich; Steefel, Carl; Valocchi, Albert J.; Zachara, John M.; Kocar, Benjamin D.; McIntosh, Jennifer; Tutolo, Benjamin M.; Kumar, Mukesh; Sonnenthal, Eric; Bao, Chen; Beisman, Joe

    2017-01-01

    Models test our understanding of processes and can reach beyond the spatial and temporal scales of measurements. Multi-component Reactive Transport Models (RTMs), initially developed more than three decades ago, have been used extensively to explore the interactions of geothermal, hydrologic, geochemical, and geobiological processes in subsurface systems. Driven by extensive data sets now available from intensive measurement efforts, there is a pressing need to couple RTMs with other community models to explore non-linear interactions among the atmosphere, hydrosphere, biosphere, and geosphere. Here we briefly review the history of RTM development, summarize the current state of RTM approaches, and identify new research directions, opportunities, and infrastructure needs to broaden the use of RTMs. In particular, we envision the expanded use of RTMs in advancing process understanding in the Critical Zone, the veneer of the Earth that extends from the top of vegetation to the bottom of groundwater. We argue that, although parsimonious models are essential at larger scales, process-based models offer tools to explore the highly nonlinear coupling that characterizes natural systems. We present seven testable hypotheses that emphasize the unique capabilities of process-based RTMs for (1) elucidating chemical weathering and its physical and biogeochemical drivers; (2) understanding the interactions among roots, micro-organisms, carbon, water, and minerals in the rhizosphere; (3) assessing the effects of heterogeneity across spatial and temporal scales; and (4) integrating the vast quantity of novel data, including “omics” data (genomics, transcriptomics, proteomics, metabolomics), elemental concentration and speciation data, and isotope data into our understanding of complex earth surface systems. With strong support from data-driven sciences, we are now in an exciting era where integration of RTM framework into other community models will facilitate process

  10. Understanding of crop phenology using satellite-based retrievals and climate factors – a case study on spring maize in Northeast China plain

    International Nuclear Information System (INIS)

    Shuai, Yanmin; Xie, Donghui; Wang, Peijuan; Wu, Menxin

    2014-01-01

    Land surface phenology is an efficient bio-indicator for monitoring terrestrial ecosystem variation in response to climate change. Numerous studies point out climate change plays an important role in modulating vegetation phenological events, especially in agriculture. In turn, surface changes caused by geo-biological processes can affect climate transition regionally and perhaps globally, as concluded by Intergovernmental Panel on Climate Change (IPCC) in 2001. Large amounts of research concluded that crops, as one of the most sensitive bio-indicators for climate change, can be strongly influenced by local weather such as temperature, moisture and radiation. Thus, investigating the details of weather impact and the feedback from crops can help improve our understanding of the interaction between crops and climate change at satellite scale. Our efforts start from this point, via case studies over the famous agriculture region in the Northeast China's plain to examine the response of spring maize under temperature and moisture stress. MODIS-based daily green vegetation information together with frequent field specification of the surface phenology as well as continuous measurements of the routine climatic factors during seven years (2003-2009) is used in this paper. Despite the obvious difference in scale between satellite estimations and field observations, the inter- and intra-annual variation of maize in seven-years' growth was captured successfully over three typical spring maize regions (Fuyu, Changling, and Hailun) in Northeast China. The results demonstrate that weather conditions such as changes of temperature and moisture stress provide considerable contribution to the year-to-year variations in the timing of spring maize phenological events

  11. VarB Plus: An Integrated Tool for Visualization of Genome Variation Datasets

    KAUST Repository

    Hidayah, Lailatul

    2012-07-01

    Research on genomic sequences has been improving significantly as more advanced technology for sequencing has been developed. This opens enormous opportunities for sequence analysis. Various analytical tools have been built for purposes such as sequence assembly, read alignments, genome browsing, comparative genomics, and visualization. From the visualization perspective, there is an increasing trend towards use of large-scale computation. However, more than power is required to produce an informative image. This is a challenge that we address by providing several ways of representing biological data in order to advance the inference endeavors of biologists. This thesis focuses on visualization of variations found in genomic sequences. We develop several visualization functions and embed them in an existing variation visualization tool as extensions. The tool we improved is named VarB, hence the nomenclature for our enhancement is VarB Plus. To the best of our knowledge, besides VarB, there is no tool that provides the capability of dynamic visualization of genome variation datasets as well as statistical analysis. Dynamic visualization allows users to toggle different parameters on and off and see the results on the fly. The statistical analysis includes Fixation Index, Relative Variant Density, and Tajima’s D. Hence we focused our efforts on this tool. The scope of our work includes plots of per-base genome coverage, Principal Coordinate Analysis (PCoA), integration with a read alignment viewer named LookSeq, and visualization of geo-biological data. In addition to description of embedded functionalities, significance, and limitations, future improvements are discussed. The result is four extensions embedded successfully in the original tool, which is built on the Qt framework in C++. Hence it is portable to numerous platforms. Our extensions have shown acceptable execution time in a beta testing with various high-volume published datasets, as well as positive

  12. Functional ecology of an Antarctic Dry Valley

    Science.gov (United States)

    Chan, Yuki; Van Nostrand, Joy D.; Zhou, Jizhong; Pointing, Stephen B.

    2013-01-01

    The McMurdo Dry Valleys are the largest ice-free region in Antarctica and are critically at risk from climate change. The terrestrial landscape is dominated by oligotrophic mineral soils and extensive exposed rocky surfaces where biota are largely restricted to microbial communities, although their ability to perform the majority of geobiological processes has remained largely uncharacterized. Here, we identified functional traits that drive microbial survival and community assembly, using a metagenomic approach with GeoChip-based functional gene arrays to establish metabolic capabilities in communities inhabiting soil and rock surface niches in McKelvey Valley. Major pathways in primary metabolism were identified, indicating significant plasticity in autotrophic, heterotrophic, and diazotrophic strategies supporting microbial communities. This represents a major advance beyond biodiversity surveys in that we have now identified how putative functional ecology drives microbial community assembly. Significant differences were apparent between open soil, hypolithic, chasmoendolithic, and cryptoendolithic communities. A suite of previously unappreciated Antarctic microbial stress response pathways, thermal, osmotic, and nutrient limitation responses were identified and related to environmental stressors, offering tangible clues to the mechanisms behind the enduring success of microorganisms in this seemingly inhospitable terrain. Rocky substrates exposed to larger fluctuations in environmental stress supported greater functional diversity in stress-response pathways than soils. Soils comprised a unique reservoir of genes involved in transformation of organic hydrocarbons and lignin-like degradative pathways. This has major implications for the evolutionary origin of the organisms, turnover of recalcitrant substrates in Antarctic soils, and predicting future responses to anthropogenic pollution. PMID:23671121

  13. Soft-contact-lenses-induced complications

    Directory of Open Access Journals (Sweden)

    Suvajac Gordana

    2008-01-01

    Full Text Available Background/Aim. Soft contact lenses occupy significant place in ophthalmology, both in the correction of refraction anomalies and in the treatment of many eye diseases. The number of patients that wear soft contact lenses for the purpose of correcting ametropia is constantly increasing. Due to the increasing number of wearers, the percentage of complications that can lead to serious eye damage and serious vision loss is also increasing. The aim of this study was to point out the most common complications related to soft contact lens use. Methods. In the period from 1995−2004 this prospective study included 510 patients wearing soft contact lenses for correcting ametropia. None of the patients wore contact lenses before and none suffered from any system or local diseases that could affected the development of eventual complications. The study took seven years with the patients who wore conventional lenses and three years with those who wore replacement contact lenses. All the necessary ophthalmologic examinations were done (visual acuity, refractokeratometry, the quantity of tear film, biomicroscopic examination of anterior eye segment. All the complications were filmed by video camera. Results. Of all the patients, 19 had blepharitis, 73 suffered from “dry eye”, 57 had conjunctival hyperemia, 12 had conjunctivitis, 34 had gigantopapillary conjunctivitis (GPC, 93 had punctiform epitheliopathy, 20 had corneal infiltration, one patient had keratitis, 91 had corneal vascularisation, and 95 patients had corneal deposits. Conclusion. Both the type and frequency of complications related to soft contact lens use in our group of patients, proved to be significant. Some of this complications (keratitis can significantly damage vision and lead to loss of vision and sometimes can require operative treatment.

  14. [The occupational radiation-induced cataract in five industrial radiographers].

    Science.gov (United States)

    Benzarti Mezni, A; Loukil, I; Hriz, N; Kallel, K; Mlaiki, N; Ben Jemaâ, A

    2012-04-01

    The industrial uses of ionizing radiation in Tunisia are expanding, especially in industry and most particularly in the nondestructive testing of welds. Thus workers operating in the non-destructive testing of welds may develop a radiation-induced cataract varying in time to onset depending on the dose. To describe the characteristics of the radiation-induced cataract in patients exposed to ionizing radiation, determine the risk factors of radiation-induced cataracts. This was an anamnestic, clinical, and environmental study of five cases of radiation-induced cataract in workers employed in non-destructive testing of welds. This series of five cases had a mean age of 30.2 years and 5.53 years of work experience, ranging from 14 months to 15 years. All the patients were male and industrial radiographers specialized in nondestructive testing of welds. The average duration of exposure to ionizing radiation was 5.53 years. None of the patients had worn protective gear such as eye goggles. The ophthalmic check-up for the five special industrial radiographers showed punctuate opacities in three cases, punctiform opacities in one eye in one case, and phacosclerosis with bilateral lens multiple crystalline stromal opacities in a case of micro-lens opacities in both eyes with opalescence of both eyes in one case. These cataracts had been declared as occupational diseases. The value of a specialized ophthalmologic surveillance among these workers and the early diagnosis of lens opacities must be emphasized. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  15. Imaging features of intracranial solitary fibrous tumors

    International Nuclear Information System (INIS)

    Yu Shuilian; Man Yuping; Ma Longbai; Liu Ying; Wei Qiang; Zhu Youkai

    2012-01-01

    Objective: To summarize the imaging features of intracranial solitary fibrous tumors (ISFT). Methods: Ten patients with ISFT proven histopathologically were collected. Four cases had CT data and all cases had MR data. The imaging features and pathological results were retrospectively analyzed. Results: All cases were misdiagnosed as meningioma at pre-operation. All lesions arose from intracranial meninges including 5 lesions above the tentorium, 4 lesions beneath the tentorium and 1 lesion growing around the tentorium. The margins of all the masses were well defined, and 8 lesions presented multilobular shape. CT demonstrated hyerattenuated masses in all 4 lesions, smooth erosion of the basicranial skull in 1 lesion, and punctiform calcification of the capsule in 1 lesion. T 1 WI showed most lesions with isointense or slight hyperintense signals including homogeneous in 4 lesions and heterogeneous in 6 lesions. T 2 WI demonstrated isointense or slight hyperintense in 2 lesions, mixed hypointense and hyperintense signals in 4, cystic portion in 2, and two distinct portion of hyperintense and hypointense signal, so called 'yin-yang' pattern, in 2. Strong enhanced was found in all lesions, especially in 8 lesion with heterogeneous with the low T 2 signal. 'Dural tail' was found in 4 lesions. Conclusions: ISFI has some specific CT and MR features including heterogeneous signal intensity on T 2 WI, strong enhancement of areas with low T 2 signal intensity, slight or no 'dural tail', without skull thickening, and the typical 'yin-yang' pattern. (authors)

  16. Microscopical characterization of carbon materials derived from coal and petroleum and their interaction phenomena in making steel electrodes, anodes and cathode blocks for the Microscopy of Carbon Materials Working Group of the ICCP

    Science.gov (United States)

    Predeanu, G.; Panaitescu, C.; Bălănescu, M.; Bieg, G.; Borrego, A.G.; Diez, M. A.; Hackley, Paul C.; Kwiecińska, B.; Marques, M.; Mastalerz, Maria; Misz-Kennan, M.; Pusz, S.; Suarez-Ruiz, I.; Rodrigues, S.; Singh, A. K.; Varma, A. K.; Zdravkov, A.; Zivotić, D.

    2015-01-01

    This paper describes the evaluation of petrographic textures representing the structural organization of the organic matter derived from coal and petroleum and their interaction phenomena in the making of steel electrodes, anodes and cathode blocks.This work represents the results of the Microscopy of Carbon Materials Working Group in Commission III of the International Committee for Coal and Organic Petrology between the years 2009 and 2013. The round robin exercises were run on photomicrograph samples. For textural characterization of carbon materials the existing ASTM classification system for metallurgical coke was applied.These round robin exercises involved 15 active participants from 12 laboratories who were asked to assess the coal and petroleum based carbons and to identify the morphological differences, as optical texture (isotropic/anisotropic), optical type (punctiform, mosaic, fibre, ribbon, domain), and size. Four sets of digital black and white microphotographs comprising 151 photos containing 372 fields of different types of organic matter were examined. Based on the unique ability of carbon to form a wide range of textures, the results showed an increased number of carbon occurrences which have crucial role in the chosen industrial applications.The statistical method used to evaluate the results was based on the “raw agreement indices”. It gave a new and original view on the analysts' opinion by not only counting the correct answers, but also all of the knowledge and experience of the participants. Comparative analyses of the average values of the level of overall agreement performed by each analyst in the exercises during 2009–2013 showed a great homogeneity in the results, the mean value being 90.36%, with a minimum value of 83% and a maximum value of 95%.

  17. MORFOLOGIA DO FRUTO E DA SEMENTE DE TRÊS ESPÉCIES DE Senna Mill. (LEGUMINOSAE - CAESALPINIOIDEAE

    Directory of Open Access Journals (Sweden)

    Ely Simone Cajueiro Gurgel

    2014-08-01

    Full Text Available O fruto característico de Leguminosae é o legume, entretanto há uma variabilidade de tipos na família. Este estudo objetivou descrever a morfologia dos frutos e das sementes de Senna obtusifolia (L. H.S.Irwin & Barneby, S. occidentalis (L. Link. e S. tapajozensis (Ducke H.S.Irwin & Barneby. Retirou-se, aleatoriamente, uma amostra constituída de 25 frutos e 25 sementes para a descrição. Dos frutos, registrou-se a morfologia geral, a classificação, a coloração, a textura, a consistência e o indumento do pericarpo. Os caracteres morfológicos das sementes analisadas foram: a externos: consistência, cor e textura da testa, forma das sementes, posição e forma do hilo e da micrópila; b internos: testa; endosperma; embrião quanto ao tipo; forma e cor. As espécies estudadas apresentaram frutos do tipo legume ou folículo, de forma linear e largamente linear, pericarpo seco, cartáceo e sublenhoso, glabro a olho nu, em tons castanhos. Semente obovada, suborbicular, elipsoidal com um lado reto ou irregularmente rômbico, testa em tons castanhos ou acinzentados, pleurograma completo, quando presente, hilo punctiforme e orbicular, embrião axial, foliáceo, eixo embrionário reto e oblíquo, plúmula rudimentar. As características do indumento do pericarpo e pleurograma possibilitaram a separação das espécies estudadas. Palavras-chave: Senna obtusifolia, S. occidentalis, S. tapajozensis, Cassieae, Cassiinae. DOI: http://dx.doi.org/10.18561/2179-5746/biotaamazonia.v4n2p80-86

  18. CARBON DIOXIDE MITIGATION THROUGH CONTROLLED PHOTOSYNTHESIS; FINAL

    International Nuclear Information System (INIS)

    Unknown

    2000-01-01

    This research was undertaken to meet the need for a robust portfolio of carbon management options to ensure continued use of coal in electrical power generation. In response to this need, the Ohio Coal Research Center at Ohio University developed a novel technique to control the emissions of CO(sub 2) from fossil-fired power plants by growing organisms capable of converting CO(sub 2) to complex sugars through the process of photosynthesis. Once harvested, the organisms could be used in the production of fertilizer, as a biomass fuel, or fermented to produce alcohols. In this work, a mesophilic organism, Nostoc 86-3, was examined with respect to the use of thermophilic algae to recycle CO(sub 2) from scrubbed stack gases. The organisms were grown on stationary surfaces to facilitate algal stability and promote light distribution. The testing done throughout the year examined properties of CO(sub 2) concentration, temperature, light intensity, and light duration on process viability and the growth of the Nostoc. The results indicate that the Nostoc species is suitable only in a temperature range below 125 F, which may be practical given flue gas cooling. Further, results indicate that high lighting levels are not suitable for this organism, as bleaching occurs and growth rates are inhibited. Similarly, the organisms do not respond well to extended lighting durations, requiring a significant (greater than eight hour) dark cycle on a consistent basis. Other results indicate a relative insensitivity to CO(sub 2) levels between 7-12% and CO levels as high as 800 ppm. Other significant results alluded to previously, relate to the development of the overall process. Two processes developed during the year offer tremendous potential to enhance process viability. First, integration of solar collection and distribution technology from Oak Ridge laboratories could provide a significant space savings and enhanced use of solar energy. Second, the use of translating slug flow

  19. CARBON DIOXIDE MITIGATION THROUGH CONTROLLED PHOTOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    Unknown

    2000-10-01

    This research was undertaken to meet the need for a robust portfolio of carbon management options to ensure continued use of coal in electrical power generation. In response to this need, the Ohio Coal Research Center at Ohio University developed a novel technique to control the emissions of CO{sub 2} from fossil-fired power plants by growing organisms capable of converting CO{sub 2} to complex sugars through the process of photosynthesis. Once harvested, the organisms could be used in the production of fertilizer, as a biomass fuel, or fermented to produce alcohols. In this work, a mesophilic organism, Nostoc 86-3, was examined with respect to the use of thermophilic algae to recycle CO{sub 2} from scrubbed stack gases. The organisms were grown on stationary surfaces to facilitate algal stability and promote light distribution. The testing done throughout the year examined properties of CO{sub 2} concentration, temperature, light intensity, and light duration on process viability and the growth of the Nostoc. The results indicate that the Nostoc species is suitable only in a temperature range below 125 F, which may be practical given flue gas cooling. Further, results indicate that high lighting levels are not suitable for this organism, as bleaching occurs and growth rates are inhibited. Similarly, the organisms do not respond well to extended lighting durations, requiring a significant (greater than eight hour) dark cycle on a consistent basis. Other results indicate a relative insensitivity to CO{sub 2} levels between 7-12% and CO levels as high as 800 ppm. Other significant results alluded to previously, relate to the development of the overall process. Two processes developed during the year offer tremendous potential to enhance process viability. First, integration of solar collection and distribution technology from Oak Ridge laboratories could provide a significant space savings and enhanced use of solar energy. Second, the use of translating slug flow

  20. Cyanobacterial Polyhydroxybutyrate (PHB: Screening, Optimization and Characterization.

    Directory of Open Access Journals (Sweden)

    Sabbir Ansari

    Full Text Available In modern life petroleum-based plastic has become indispensable due to its frequent use as an easily available and a low cost packaging and moulding material. However, its rapidly growing use is causing aquatic and terrestrial pollution. Under these circumstances, research and development for biodegradable plastic (bioplastics is inevitable. Polyhydroxybutyrate (PHB, a type of microbial polyester that accumulates as a carbon/energy storage material in various microorganisms can be a good alternative. In this study, 23 cyanobacterial strains (15 heterocystous and 8 non-heterocystous were screened for PHB production. The highest PHB (6.44% w/w of dry cells was detected in Nostoc muscorum NCCU- 442 and the lowest in Spirulina platensis NCCU-S5 (0.51% w/w of dry cells, whereas no PHB was found in Cylindrospermum sp., Oscillatoria sp. and Plectonema sp. Presence of PHB granules in Nostoc muscorum NCCU- 442 was confirmed microscopically with Sudan black B and Nile red A staining. Pretreatment of biomass with methanol: acetone: water: dimethylformamide [40: 40: 18: 2 (MAD-I] with 2 h magnetic bar stirring followed by 30 h continuous chloroform soxhlet extraction acted as optimal extraction conditions. Optimized physicochemical conditions viz. 7.5 pH, 30°C temperature, 10:14 h light:dark periods with 0.4% glucose (as additional carbon source, 1.0 gl-1 sodium chloride and phosphorus deficiency yielded 26.37% PHB on 7th day instead of 21st day. Using FTIR, 1H NMR and GC-MS, extracted polymer was identified as PHB. Thermal properties (melting temperature, decomposition temperatures etc. of the extracted polymer were determined by TGA and DSC. Further, the polymer showed good tensile strength and young's modulus with a low extension to break ratio comparable to petrochemical plastic. Biodegradability potential tested as weight loss percentage showed efficient degradation (24.58% of PHB within 60 days by mixed microbial culture in comparison to