Manganese induced immune suppression of the lobster, Nephrops norvegicus

Energy Technology Data Exchange (ETDEWEB)

Hernroth, Bodil [Department of Marine Ecology, Goeteborg University, Kristineberg Marine Research Station, SE-450 34 Fiskebaeckskil (Sweden)]. E-mail: bodil.hernroth@kmf.gu.se; Baden, Susanne P. [Department of Marine Ecology, Goeteborg University, Kristineberg Marine Research Station, SE-450 34 Fiskebaeckskil (Sweden); Holm, Kristina [Department of Marine Ecology, Goeteborg University, Kristineberg Marine Research Station, SE-450 34 Fiskebaeckskil (Sweden); Andre, Tove [Department of Comparative Physiology, Evolutionary Biology Centre, Uppsala University, Norbyvaegen 18A, SE-752 36 Uppsala (Sweden); Soederhaell, Irene [Department of Comparative Physiology, Evolutionary Biology Centre, Uppsala University, Norbyvaegen 18A, SE-752 36 Uppsala (Sweden)

2004-12-10

Manganese (Mn) is one of the most abundant elements on earth, particularly in the soft bottom sediments of the oceans. As a micronutrient Mn is essential in the metabolic processes of organisms. However, at high concentrations the metal becomes a neurotoxin with well-documented effects. As a consequence of euthrophication, manganese is released from bottom sediments of coastal areas and the Norway lobsters, Nephrops norvegicus, can experience high levels of bioavailable Mn{sup 2+}. Here, we present the first report showing that Mn also affects several fundamental processes in the mobilisation and activation of immunoactive haemocytes. When N. norvegicus was exposed to a realistic [Mn{sup 2+}] of 20 mg l{sup -1} for 10 days 24.1 {mu}g ml{sup -1} was recorded in the haemolymph. At this concentration the total haemocyte count was reduced by ca. 60%. By using BrdU as a tracer for cell division, it was shown that the proliferation rate in the haematopoietic tissue did not increase, despite the haemocytepenia. A gene coding for a Runt-domain protein, known to be involved in maturation of immune active haemocytes in a variety of organisms, was identified also in haemocytes of N. norvegicus. The expression of this gene was >40% lower in the Mn-exposed lobsters as judged by using a cDNA probe and the in situ hybridisation technique. In response to non-self molecules, like lipopolysaccharide (LPS), the granular haemocytes of arthropods are known to degranulate and thereby release and activate the prophenoloxidase system, necessary for their immune defence. A degranulation assay, tested on isolated granular haemocytes, showed about 75% lower activity in the Mn-exposed lobsters than that for the unexposed. Furthermore, using an enzymatic assay, the activation per se of prophenoloxidase by LPS was found blocked in the Mn-exposed lobsters. Taken together, these results show that Mn exposure suppressed fundamental immune mechanisms of Norway lobsters. This identifies a potential

Effect of All-Trans Retinoic Acid (ATRA against expression of Matrix Metalloproteinase-2 (MMP-2 in model mice (Rattus norvegicus periodontitis

Directory of Open Access Journals (Sweden)

Ilma Soraya

2017-08-01

Full Text Available Introduction: Periodontitis is a condition of inflammation of the tooth supporting tissues generally caused by bacteria Phorphyromonas gingivalis (Pg. and is usually characterized by the occurrence of the alveolar bone resorption. Matrix metalloproteinase-2 (MMP-2 is an enzyme that plays an important role in inflammatory conditions. All-trans retinoic acid (ATRA is a metabolite of vitamin A which plays a role in healing the inflamed tissue and maintain the immune system. The purpose of this study was to determine the effect of ATRA on the expression of MMP-2 in mouse models Rattus norvegicus of periodontitis. Methods: Experimental laboratory by using post test only with control group design. This study used 25 male Wistar mice (Rattus norvegicus that divided into 5 groups. Group 1 (G1 is a group of healthy mice, group 2 (G2 is a group of sick mice as induced periodontitis without treatment, group 3 (G3 is a group of periodontitis mice treated with 5 mg/kg dose of ATRA, group 4 (G4 is a group of periodontitis mice treated with 10 mg/kg dose of ATRA, group 5 (G5 is a group of periodontitis mice treated with 20 mg/kg dose of ATRA. Periodontitis induction was induced by Pg. bacteria every 3 days for 28 days and followed by administration of ATRA for 7 days. Expression of MMP-2 from gingival tissues and periodontal ligament was obtained by immunohistochemical methods. Results were analyzed using the Shapiro-Wilk Test and Mann-Whitney Test. Results: The results showed there were significant differences in the positive area of MMP-2 and MMP-2 color intensity (p < 0.05 between groups. Conclusion: ATRA dose of 20 mg/kg is the most effective dose in inhibiting the expression of MMP-2 in mice models of periodontitis when compared with the dose on other groups.

SHELF LIFE OF THAWED CRUSTACEANS TREATED WITH SULPHITES

Directory of Open Access Journals (Sweden)

G. Smaldone

2011-04-01

Full Text Available The quality of fish and fish products is closely related to their freshness. Aim of this research was to evaluate the shelf life of thawed crustaceans (Aristeomorpha foliacea and Nefrops norvegicus which had been treated with sulphites and frozen on board. Organoleptic characteristics and microbiological and chemical parameters were judged favourably up to day 6 and 7 for the shrimps and Norway lobsters, respectively.

Nicotine supplementation blocks oocyte maturation in Rattus norvegicus

Directory of Open Access Journals (Sweden)

Meitria Syahadatina Noor

2013-08-01

Full Text Available Background Indonesia has the third largest tobacco consumption in the world after China and India. Nicotine as the main component of cigarette smoke has negative effects on the reproductive system, such as oocyte maturation, ovulation, and fertilization, and increasing the diploidy of oocytes. The goal of this research was to evaluate the effect of nicotine on oocyte maturation in Rattus norvegicus. Methods This was an experimental study with post test only control group design. The subjects were 40 rats selected homogenously and randomly. They were divided into a control group (receiving carboxy-methyl-cellulose sodium and 3 treatment groups (I-III receiving nicotine subcutaneously for 7 days at dosages of 21 mg/kgBW, 41 kg/kgBW and 84/kgBW, respectively. The observations comprised oocyte maturation stage, viz. germinal vesicle (GV, germinal vesicle breakdown (GVBD, metaphase I and metaphase II. Data were analyzed by one-way Anova with á=0.05, followed by Tukey’s HSD test. Results One-way Anova showed significant differences in oocyte maturation in all groups. Tukey’s HSD test showed that for GV, the differing groups were control and I, control and II, I and III. For GVBD, the differing groups were control and I, I and II, I and III. For metaphase I, the differing groups were control with I, II, and III, I and II, I and III. For metaphase II, the differing groups were control versus I, II, and III, I and II, I and III. Conclusion Low dose of nicotine is capable of affecting oocyte maturation in Rattus norvegicus.

Survival, food consumption and growth of Norway lobster (Nephrops norvegicus) kept in laboratory conditions.

Science.gov (United States)

Mente, Elena

2010-09-01

Successful commercial aquaculture of crustacean species is dependent on satisfying their nutritional requirements and on producing rapidly growing and healthy animals. The results of the present study provide valuable information for feeding habits and growth of Nephrops norvegicus L., 1758) under laboratory conditions. The aim of the present study was to examine food consumption, growth and physiology of the Norway lobster N. norvegicus under laboratory conditions. N. norvegicus (15 g wet weight) were distributed into 1001 tanks consisting of five numbered compartments each. They were fed the experimental diets (frozen mussels and pellets) for a period of 6 months. A group of starved Nephrops was stocked and fasted for 8 months. Although Nephrops grew well when fed the frozen mussels diet, feeding on a dry pellet feed was unsatisfactory. The starvation group, despite the fact that showed the highest mortality (50%), exhibited a remarkable tolerance to the lack of food supply. The study offers further insight by correlating the amino acid profiles of Nephrops tail muscle with the two diets. The deviations from the mussel's diet for asparagine, alanine and glutamic acid suggest a deficiency of these amino acids in this diet. The results of the present study showed that the concentrations of free amino acids are lower in relative amount than those of protein-bound amino acids, except for arginine, proline and glycine. The present study contributes to the improvement of our knowledge on nutritional requirements of the above species. © 2010 ISZS, Blackwell Publishing and IOZ/CAS.

The use of at‐sea‐sampling data to dissociate environmental variability in Norway lobster (Nephrops norvegicus) catches to improve resource exploitation efficiency within the Skagerrak/Kattegat trawl fishery

DEFF Research Database (Denmark)

Feekings, Jordan P.; Christensen, Asbjørn; Jonsson, Patrik

2015-01-01

Research into the influence of environmental variables on the behaviour of Norway lobster (Nephrops norvegicus), and hence catch rates, dates back to the 1960s (e.g., Höglund and Dybern, Diurnal and seasonal variations in the catch‐composition of Nephrops norvegicus (L.) at the Swedish west coast...... on commercial trawl catches of Nephrops norvegicus (L.). ICES J. Mar. Sci. 58:1318). Here, we aimed to dissociate environmental variability in Norway lobster catches to improve resource exploitation efficiency within the Skagerrak and Kattegat trawl fisheries by utilising data collected as part of an extensive...

Completion of the life cycle of Sarcocystis zuoi , a parasite from the Norway rat, Rattus norvegicus.

Science.gov (United States)

Hu, Jun-Jie; Meng, Yu; Guo, Yan-Mei; Liao, Jie-Ying; Song, Jing-Ling

2012-06-01

Transmission experiments were performed to elucidate the life cycle of Sarcocystis zuoi found in Norway rats ( Rattus norvegicus ) in China. Two king rat snakes ( Elaphe carinata ) fed sarcocysts from the muscles of 4 naturally infected Norway rats shed sporocysts measuring 10.8 ± 0.7 × 8.0 ± 0.7 µm, with a prepatent period of 8-9 days. Sporocysts from the intestine of 2 experimentally infected king rat snakes were given to the laboratory Sprague-Dawley (SD) rats ( R. norvegicus ) and Kunming (KM) mice ( Mus musculus ). Microscopic sarcocysts developed in the skeletal muscles of SD rats. No sarcocysts were observed in KM mice. Characters of ultrastructure and molecule of sarcocysts from SD rats were confirmed as S. zuoi . Our results indicate that king rat snake is the definitive host of S. zuoi .

Suspension feeding in adult Nephrops norvegicus (L.) and Homarus gammarus (L.) (decapoda)

Science.gov (United States)

Loo, Lars-Ove; Pihl Baden, Susanne; Ulmestrand, Mats

Suspension feeding in adults of the Norway lobster Nephrops norvegicus (40-74 g) and the European lobster Homarus gammarus (280-350 g) was tested in experiments offering planktonic food items of different sizes from 200 to 600 μm and measuring the clearing capacity. Both lobster species were found to effectively clear water of food particles comprising nauplii of the brine shrimp Artemia salina of about 600 μm in size. These were reduced to 50% of the initial concentration within 5 h and to 90% within 12 h. When N. norvegicus was offered food particles averaging 200 μm, a significant reduction in average size occurred, indicating that the minimum retention size is around 200 μm. Fluorescently dyed Artemia salina were recovered in the stomach and intestine of lobsters proving that the filtered particles are passed to the digestive tract. Results from other experiments, using the blood pigment (haemocyanin) concentration as an index of nutritional state, indicated that the lobsters can get some nutritional advantage from suspension feeding. Suspension feeding in larger decapods has not been described previously, so the significance of this finding is discussed with respect to changes in behavioural and ecological role.

A translation of Bishop Gunnerus' description of the species Hydroides norvegicus with comments on his Serpula triqvetra

Directory of Open Access Journals (Sweden)

Toril Loennechen Moen

2006-12-01

Full Text Available In 1768 J.E. Gunnerus first described the species Hydroides norvegicus (Polychaeta, Serpulidae, the type of the genus Hydroides which today includes close to 90 species worldwide and is the largest serpulid genus. This description has therefore great value as a type description, but as it is written in an old-fashioned Danish/Norwegian language with a font which is hard to interpret, the description is rather inaccessible to most polychaetologists. This paper presents a translation of Gunnerus’ description of H. norvegicus and a brief review of the present day status of the species. Comments on Gunnerus’ description of Serpula triqvetra are also included, as well as references to his correspondence with Swedish naturalist Carolus Linnæus regarding the species in question.

Urban population genetics of slum-dwelling rats (Rattus norvegicus) in Salvador, Brazil

Science.gov (United States)

Kajdacsi, Brittney; Costa, Federico; Hyseni, Chaz; Porter, Fleur; Brown, Julia; Rodrigues, Gorete; Farias, Helena; Reis, Mitermeyer G.; Childs, James E.; Ko, Albert I.; Caccone, Adalgisa

2013-01-01

Throughout the developing world, urban centers with sprawling slum settlements are rapidly expanding and invading previously forested ecosystems. Slum communities are characterized by untended refuse, open sewers, and overgrown vegetation, which promote rodent infestation. Norway rats (Rattus norvegicus), are reservoirs for epidemic transmission of many zoonotic pathogens of public health importance. Understanding the population ecology of R. norvegicus is essential to formulate effective rodent control strategies, as this knowledge aids estimation of the temporal stability and spatial connectivity of populations. We screened for genetic variation, characterized the population genetic structure, and evaluated the extent and patterns of gene flow in the urban landscape using 17 microsatellite loci in 146 rats from 9 sites in the city of Salvador, Brazil. These sites were divided between three neighborhoods within the city spaced an average of 2.7 km apart. Surprisingly, we detected very little relatedness among animals trapped at the same site and found high levels of genetic diversity, as well as structuring across small geographic distances. Most FST comparisons among sites were statistically significant, including sites Salvador, linked to the heterogeneous urban landscape. Future rodent control measures need to take into account the spatial and temporal linkage of rat populations in Salvador, as revealed by genetic data, to develop informed eradication strategies. PMID:24118116

Rattus norvegicus (Rodentia: Muridae Infected by Leishmania (Leishmania infantum (syn. Le. chagasi in Brazil

Directory of Open Access Journals (Sweden)

Fabiana de Oliveira Lara-Silva

2014-01-01

Full Text Available In the present study we surveyed the fauna of phlebotomine sand flies and small mammals in peridomestic areas from a Brazilian municipality where the American cutaneous leishmaniasis (ACL is endemic. A total of 608 female phlebotomine sand flies were captured during nine months in 2009 and 2010. Seven different species were represented with 60% of them being Lutzomyia intermedia and Lu. whitmani, both incriminated vectors of ACL. Lu. longipalpis, a proven vector of visceral leishmaniasis (VL was also captured at high proportion (12.8%. Genomic DNA analysis of 136 species-specific pools of female sand flies followed by molecular genotyping showed the presence of Leishmania infantum DNA in two pools of Lu. longipalpis. The same Leishmania species was found in one blood sample from Rattus norvegicus among 119 blood and tissue samples analysed. This is the first report of Le. infantum in R. norvegicus in the Americas and suggests a possible role for this rodent species in the zoonotic cycle of VL. Our study coincided with the reemergence of VL in Governador Valadares.

Effect of VCO and olive oil on HDL, LDL, and cholesterol level of hyperglycemic Rattus Rattus Norvegicus

Science.gov (United States)

Yusuf Wachidah Yuiwarti, Enny; Rini Saraswati, Tyas; Kusdiyantini, Endang

2018-05-01

Virgin coconut oil (VCO) and olive oil are edible oil containing an antioxidant that can prevent free radicals in Rattus rattus norvegicus hypoglycemic due to the damage of pancreatic beta cell after alloxan injection. Virgin coconut oil and olive oil are fatty acids when being consumed will affect lipid metabolism particularly HDL, LDL and cholesterol in serum. This research aims to determine the effect of VCO and Olive oil on cholesterol levels in hyperglycemic rats. Research materials were twenty male Rattus rattus norvegicus. Randomized Factorial Design was used in four treatment groups including P1(control), P2 (mice injected with alloxan), P3 (mice injected with alloxan plus 0.1 ml/BW of each VCO and vitamin E) and P4 (mice injected with alloxan plus 0.1 ml/BW of each olive oil and vitamin E. Each treatment was replicated 5 times. Feed and water were provided adlibitum for four weeks. The result showed that there was no significant difference in the level of HDL serum across the treatments, but P4 had a significantly higher LDL than the other treatments. Moreover, total cholesterol was significantly increased in P4 compared to the other groups. It can be concluded that olive oil could increase the level of cholesterol and LDL in serum, while VCO did not increase the level of cholesterol and LDL so VCO more potential to maintain cholesterol in hyperglycemic Rattus rattus norvegicus.

PENGARUH PEMBERIAN MONOSODIUM GLUTAMAT TERHADAP KADAR HORMON ESTRADIOL DAN KADAR HORMON PROGESTERON PADA TIKUS PUTIH BETINA (Rattus norvegicus

Directory of Open Access Journals (Sweden)

andri ani

2018-03-01

Full Text Available Perubahan pola demografi di negara maju dan negara berkembang, angka kejadian infertilitas di negara maju dilaporkan sekitar 5%-8% dan di negara berkembang sekitar 30%.WHO memperkirakan sekitar 8%-10% atau sekitar 50-80 juta pasangan suami istri di seluruh dunia mengalami masalah infertilitas, sehingga membuat infertilitas menjadi masalah mendesak. Untuk itu diperlukan pengendalian infertilitas, salah satunya adalah kewaspadaan perubahan gaya hidup, perubahan ini juga mempengaruhi pola konsumsi makanan dengan lebih banyak mengkonsumsi jenis makanan cepat saji yang banyak mengandung zat aditif (penyedap rasa. Penelitian ini bertujuan untuk mengetahui pengaruh pemberian monosodium glutamate terhadap kadar hormon estradiol dan kadar hormon progesteron pada tikus putih betina ( Rattus norvegicus .Penelitian ini menggunakan metode pendekatan post test only control group design, terhadap tikus putih betina dengan berat 200 – 250 gr. Sampel terdiri dari 24 ekor tikus yang dibagi 4 kelompok yaitu kelompok kontrol ( K , perlakuan I, II dan III . Kelompok perlakuan diberikan monosodium glutamat dengan dosis masing-masing : 45 mg, 54 mg dan 63 mg setiap hari diberikan peroral yang dilarutkan dengan aquabides 2 ml selama 20 hari yang dimulai pada awal fase proestrus. Setelah 20 hari perlakuan tikus di korbankan dan diambil darahnya. Pemeriksaan kadar hormone estradiol dan progesteron menggunakan Elisa Spectrophotometer.  Kemudian hasilnya dianalisa dengan menggunakan One Way ANOVA dan dilanjutkan dengan uji Multiple Comparison jenis Bonferroni.Hasil penelitian pemberian  monosodium glutamat dengan dosis 45 mg/ ekor/ hari, 54 mg/ekor/ hari dan 63 mg/ ekor /hari dapat menurunkan kadar hormon estradiol tikus putih betina (Rattus norvegicus secara signifikan. Dan pemberian monosodium glutamate dengan dosis 45 mg/ ekor/ hari dapat menurunkan kadar hormon progesteron tikus putih betina (Rattus norvegicus walaupun tidak berpengaruh secara signifikan , dan pada

High prevalence of Leptospira spp. in sewer rats (Rattus norvegicus)

DEFF Research Database (Denmark)

Krøjgaard, L H; Villumsen, S; Markussen, M D K

2009-01-01

Earlier studies on the ecology of leptospirosis in temperate regions focused mainly on free-ranging rats in rural areas. Here we report on the occurrence of Leptospira spp. in Rattus norvegicus living in sewers in a suburban area in Copenhagen, Denmark. In 2006-2007, about 30 rats were captured...... in sewers at each of six different locations. Rat kidneys were screened by PCR for pathogenic Leptospira spp. In one location no infected rats were found, whereas the prevalence in the remaining five locations ranged between 48% and 89%. Micro-agglutination tests showed that serogroup Pomona, Sejroe...

BIRD’S NEST EXTRACT CREAM: TREATMENT FOR PERINEAL WOUND IN RATTUS NORVEGICUS

OpenAIRE

Herlina Ofiwijayanti; Syarief Thaufik Hidayat; Nur Khafidhoh

2017-01-01

Background: Perineal rupture occurs almost in all the first labor and not infrequently in the next labor. Complex perineal wounds are at risk for non healing and infection. Objective: This study aims to determine the effect of bird’s nest extract on perineal wound healing on rattus norvegicus. Methods: This was a randomised posttest only group design conducted in October 2016 at Animal Laboratory Unit of Diponegoro University, Semarang. There were 30 samples recruited in this study, div...

PREDICTORS OF TRYPANOSOMA LEWISI IN RATTUS NORVEGICUS FROM DURBAN, SOUTH AFRICA.

Science.gov (United States)

Archer, Colleen Edith; Schoeman, M Corrie; Appleton, Christopher Charles; Mukaratirwa, Samson; Hope, Karen J; Matthews, Glenda Beverly

2018-03-16

This study investigated associations between Trypanosoma lewisi; Xenopsylla cheopis, a common cyclical vector of T. lewisi; Polyplax spinulosa, a reported mechanical vector; and Laelaps ecidnina and L. lamborni, two rodent mites of Rattus norvegicus in Durban. Three hundred and seventy nine R. norvegicus were live-trapped at 48 sites in 4 locality types of Durban during a one year period. Rats were euthanized, cardiac blood was taken to check for hemoparasites and ectoparasites were removed for identification. Parasite species richness was higher in pups (2.11) and juveniles (1.02) than adults (0.87). Most rats in the study harbored 1 or 2 of the 5 parasites examined. Rats with trypanosomes and fleas were more prevalent in the city center and harbor, and juveniles were most affected. Rats with lice were more prevalent in informal settlements and urban/peri-urban areas and pups had the highest infestations. There was a significant positive association between rats with fleas and trypanosomes and a negative association between rats with lice and trypanosomes. Location and rat age were significant predictors of T. lewisi, X. cheopis and P. spinulosa. Mites showed no strong associations with trypanosomes. Ectoparasite associations are possibly habitat and life-cycle related. We conclude that Durban's city center, which offers rats harborage, an unsanitary environment and availability of food, is a high transmission area for fleas and trypanosomes, and consequently, a potential public health risk.

Study of expression of genes cIAP and cMET, in liver tissue with and without neoplasia of Rattus norvegicus

International Nuclear Information System (INIS)

Coto Valverde, Daniel Esteban

2010-01-01

The expression levels of cIAP genes and cMET were determined in liver tissues with and without neoplasm of the organism Rattus norvegicus, for prevention, diagnosis and treatment of hepatocellular carcinoma. The technique of reaction Polymerase Chain in real time (qPCR), is used to obtain the expression, of both genes cIAP and cMET, and this has decreased in neoplastic samples compared to samples not affected. The expression of these genes has been analyzed in samples with neoplastic formations, but treated with an anti-tumor agent. The expression has presented an increase of the cMET gene, unlike the cIAP gene, which has decreased its expression. Perform statistical analysis has been impossible because the number of samples used has been reduced. The results obtained differ with those expected theoretically. (author) [es

Perbedaan Pengaruh Pemberian Insulin dan Ekstrak Zingiber officinale Terhadap Berat Badan Lahir Anak Rattus Norvegicus Model Diabetes Melitus Pragestasional

Directory of Open Access Journals (Sweden)

Ratih Mega Septiasari

2018-01-01

Full Text Available Diabetes during pregnancy can be divided into pregestational diabetes and gestational diabetes. The risk of fetal Diabetes Mellitus pregestational (DMpG patients can be either macrosomia or low birth weight. The purpose of this study was to investigate the differences in the administration effect of insulin and Zingiber officinale extract on birth weight of Rattus norvegicus pregestational diabetes mellitus model. This research is an experimental research using post test only control group design. Samples contained 30 pregnant Rattus norvegicus and divided into 5 groups, where K0 (negative control group and K1 (positive control group given aquadest 1cc, K2 given insulin 1IU, K3 given ginger extract 500mg/ kg BW, K4 given insulin 1IU and ginger extract 500mg/ kg BW. Treatment was administered during the first 16 days of pregnancy. On the 17th day, the rats were terminated and then the birth weight was measured with the scale. Data analysis using One-way ANOVA test followed by Tamhane test. The results showed that there was a difference of birth weight in the insulin treatment group and ginger extract treatment group (p-value = 0,037 < α =0,05. The conclusion of this study was Zingiber officinale can be used as a single therapy or combination with insulin of Rattus norvegicus pregestational diabetes mellitus model.

Behavioral changes in Rattus norvegicus coinfected by Toxocara canis and Toxoplasma gondii

Directory of Open Access Journals (Sweden)

Maisa Leite de Queiroz

2013-02-01

Full Text Available Using an elevated plus maze apparatus and an activity cage, behavioral changes in Rattus norvegicus concomitantly infected by Toxocara canis and Toxoplasma gondii were studied, during a period of 120 days. Rats infected by Toxocara canis or Toxoplasma gondii showed significant behavioral changes; however, in the group coinfected by both parasites a behavioral pattern similar to that found in the group not infected was observed thirty days after infection, suggesting the occurrence of modulation in the behavioral response.

Hypolipidemic effect of aqueous extract from the leaves of Artocarpus altilis "breadfruit" in Rattus norvegicus induced hyperlipidemia

Directory of Open Access Journals (Sweden)

Julio Campos Florián

2013-12-01

Full Text Available The present study aimed to demonstrate the hypolipidemic activity of aqueous extract of leaves of breadfruit, Artocarpus altilis, in a model of acute hyperlipidemia induced with triton X-305, using Rattus norvegicus specimens males, mean weight 204.5 g, who were orally administered 0.05 g/100g and 0.2 g/100 g of aqueous extract of A. altilis; included a negative control group received physiological saline and hyperlipidemic positive control group. After 24 hours of administering the treatments were made measurements of the concentrations of serum cholesterol and triglycerides. Found significant reductions (p < 0.01 in both cholesterol and triglyceride levels relative to the positive control group. We also found a significant difference (p < 0.01 between triglyceride concentrations of the animals treated with both doses of the aqueous extract of A. altilis. Conclude that the aqueous extract from the leaves of A. altilis has hypolipidemic effect at the doses tested for the model of hyperlipidemia induced with triton X-305.

Influence of twin and multi-rig trawl systems on CPUE in the Danish Norway lobster (Nephrops norvegicus) fishery

DEFF Research Database (Denmark)

Feekings, Jordan P.; Berg, Casper Willestofte; Krag, Ludvig Ahm

2016-01-01

analyse catchrates of four target species, Norway lobster (Nephrops norvegicus), cod (Gadus morhua), plaice (Pleuronectesplatessa) and haddock (Melanogrammus aeglefinus), to try and understand how the use of multi-rig trawlshave altered catch rates within the Danish demersal trawl fishery over the last 16...

Helminth parasites in black rats (Rattus rattus) and brown rats (Rattus norvegicus) from different environments in the Netherlands

NARCIS (Netherlands)

Franssen, Frits; Swart, Arno; van Knapen, Frans|info:eu-repo/dai/nl/070114749; van der Giessen, Joke

2016-01-01

BACKGROUND: Rattus norvegicus (brown rat) and Rattus rattus (black rat) are known carriers of bacteria, viruses, and parasites of zoonotic and veterinary importance. Moreover, rats may play a role in the transmission of muscle larvae of the zoonotic nematode Trichinella spiralis to farm animals. We

Giardiasis: Serum antibodies and coproantigens in brown rats (Rattus norvegicus from Grenada, West Indies

Directory of Open Access Journals (Sweden)

Keshaw Tiwari

2018-03-01

Full Text Available Aim: Giardia is a serious zoonotic parasite, which causes diarrheal disease in humans and animals including rodents. The purpose of this study was to estimate the prevalence of Giardia spp. in brown rats (Rattus norvegicus in Grenada. Materials and Methods: Intestinal contents from 99 and serum samples from 169 brown rats (R. norvegicus from Grenada were collected. These samples were examined for the Giardia coproantigens using Cryptosporidium/Giardia Quik Chek assay (Tech lab® Inc., USA, and the serum was screened through an enzyme-linked immunosorbent assay (ELISA test kit for Giardia antibody (anti-GD ELISA kit (MyBioSource, San Diego, CA, USA. Results: Giardia coproantigens were positive in 17.17% (95% confidence interval [CI]; 10.33-26.06% rats, whereas 55% (95% CI: 47.20-62.68 were positive with serum antibodies (anti-GD to Giardia. Conclusion: The prevalence of Giardia spp. in brown rats in Grenada was moderate based on the presence of coproantigens in the intestinal contents and antibody in serum. The findings of Giardia infections and prevalence in brown rats will help veterinarians and physicians to better plan diagnostic and preventative strategies. This is the first report of prevalence of Giardia in brown rats in Grenada.

A simulation-based attempt to quantify the morphological component of size selection of Nephrops norvegicus in trawl codends

DEFF Research Database (Denmark)

Frandsen, Rikke; Herrmann, Bent; Madsen, Niels

2010-01-01

The selectivity for Nephrops (Nephrops norvegicus) in trawl codends generally is poor and the lack of steepness of the selection curve results in high discard rates and/or loss of legal-sized catch. This poor codend selectivity often is attributed to the irregular shape of Nephrops, which to some...

Optical coherence tomography imaging of the basal ganglia: feasibility and brief review

Energy Technology Data Exchange (ETDEWEB)

Lopez, W. O. Contreras; Ângelos, J. S. [Divisão de Neurocirurgia Funcional, Departamento de Neurologia, Faculdade de Medicina, Universidade de São Paulo, São Paulo, SP (Brazil); Martinez, R. C. R. [Laboratório de Neuromodulação e Dor Experimental, Hospital Sírio-Libanes, São Paulo, SP (Brazil); Takimura, C. K. [Instituto do Coração, Universidade de São Paulo, São Paulo, SP (Brazil); Teixeira, M. J. [Divisão de Neurocirurgia Funcional, Departamento de Neurologia, Faculdade de Medicina, Universidade de São Paulo, São Paulo, SP (Brazil); Lemos, P. A. Neto [Instituto do Coração, Universidade de São Paulo, São Paulo, SP (Brazil); Fonoff, E. T., E-mail: fonoffet@usp.br [Divisão de Neurocirurgia Funcional, Departamento de Neurologia, Faculdade de Medicina, Universidade de São Paulo, São Paulo, SP (Brazil)

2015-09-29

Optical coherence tomography (OCT) is a promising medical imaging technique that uses light to capture real-time cross-sectional images from biological tissues in micrometer resolution. Commercially available optical coherence tomography systems are employed in diverse applications, including art conservation and diagnostic medicine, notably in cardiology and ophthalmology. Application of this technology in the brain may enable distinction between white matter and gray matter, and obtainment of detailed images from within the encephalon. We present, herein, the in vivo implementation of OCT imaging in the rat brain striatum. For this, two male 60-day-old rats (Rattus norvegicus, Albinus variation, Wistar) were stereotactically implanted with guide cannulas into the striatum to guide a 2.7-French diameter high-definition OCT imaging catheter (Dragonfly™, St. Jude Medical, USA). Obtained images were compared with corresponding histologically stained sections to collect imaging samples. A brief analysis of OCT technology and its current applications is also reported, as well as intra-cerebral OCT feasibility on brain mapping during neurosurgical procedures.

Food Neophobia in Wild Rats (Rattus norvegicus Inhabiting a Changeable Environment-A Field Study.

Directory of Open Access Journals (Sweden)

Klaudia Modlinska

Full Text Available Food neophobia is a reaction to novel food observed in many animal species, particularly omnivores, including Rattus norvegicus. A neophobic reaction is typically characterised by avoidance of novel food and the necessity to assess both its potential value and toxicity by the animal. It has been hypothesised that this reaction is not observed in rats inhabiting a changeable environment with a high level of variability with regard to food and food sources. This study was conducted in such changeable conditions and it aims to demonstrate the behaviour of wild rats R. norvegicus in their natural habitat. The rats were studied in a farm setting, and the experimental arena was demarcated by a specially constructed pen which was freely accessible to the rats. At regular intervals, the rats were given new flavour- and smell-altered foods, while their behaviour was video-recorded. The results obtained in the study seem to confirm the hypothesis that rats inhabiting a highly changeable environment do not exhibit food neophobia. The observed reaction to novel food may be connected with a reaction to a novel object to a larger extent than to food neophobia. The value of the results obtained lies primarily in the fact that the study was conducted in the animals' natural habitat, and that it investigated their spontaneous behaviours.

Pemberian makanan enteral berformulasi bahan pangan lokal terhadap kadar zat besi dan hemoglobin pada tikus putih (Rattus norvegicus

Directory of Open Access Journals (Sweden)

Dini Ariani

2013-07-01

Full Text Available Background: Enteral nutrition is nutrition used to fulfill the needs of nutrition entirely and as the supplement for malnutrition patient. In a certain condition of a patient, this nutrition is usually given in the form of liquid. Local material foods such as tempeh, rice, mung bean, and ganyong have adequate nutrition, therefore they are suitable for being used as main raw materials in the making of enteral nutrition. Objective: To know the influence of feeding enteral nutrition formulated with local food material toward malnutrition white rats (Rattus norvegicus of which the parameters are iron (Fe, hemoglobin (Hb level and weight. Method: This research used Completely Random Design (CRD. Twenty-seven of malnutrition male white rats were divided into 3 groups of treatment with 9 repetitions for each group of the treatment. Group A was given enteral nutrition diet of formula A (tempeh, rice, and mung bean as the main raw material, group B was given enteral nutrition diet of formula B (tempeh, rice, mung bean, and ganyong as the main raw material, and group C (as the positive control was given commercial enteral nutrition. The daily giving of enteral nutrition is 20 g/day during 30 days. The analysis of Fe and Hb level and the measurement of weight firstly were done before the treatment is given. The next measurement was conducted in 15th day and 31st day. Statistical analysis used ANOVA test dan DMRT of significance 5%. Results: The result showed that the treatment of the enteral nutrition feeding of formula B was more optimal than formula A in terms of the way to increase the level of Hb and Fe. Those two components will give positive effect toward the increasing of the weight of malnutrition white rats (Rattus norvegicus. Conclusion: The enteral nutrition of formula B is more proper to be developed as the main material of making enteral food in order to treat the malnutrition.

A comparative study of the feeding ecology of Nephrops norvegicus L. (Decapoda: Nephropidae in the bathyal Mediterranean and the adjacent Atlantic

Directory of Open Access Journals (Sweden)

Margarida Cristo

1998-12-01

Full Text Available A comparative study of the feeding ecology of Nephrops norvegicus was carried out on a seasonal basis simultaneously in seven locations in the Eastern and Western Mediterranean and the adjacent Atlantic: the south coast of Portugal, Faro; the Alboran Sea, Malaga; the Catalan Sea, Barcelona; the Ligurian Sea, Genoa; theTyrrhenian Sea, Pisa; the Adriatic Sea, Ancona and the Aegean Sea, Gulf of Euboikos. The major groups observed (frequency of occurrence method in the stomachs of Nephrops norvegicus were decapod crustaceans, other crustaceans (euphausids and peracarids and fish. The results obtained showed no significant differences between sites or seasons, and can be considered very consistent. All major taxa were present in the diet at all sites and for all seasons, a fact that can be explained by the great similarity of the bathyal fauna in all sites, which provide a major trophic resource for N. norvegicus. The percentage of fullness was also estimated per site and season, and we registered a clear decrease of this value during the summer period for all sites, except the Tyrrheanian Sea, where the lowest value was found in autumn. PCA - analysis did not clearly separate the regions (sites. The Shannon-Weaver (H´, index of diversity, was also determined per site and season, and we found a significant difference between the values of the Atlantic coast and the Western Mediterranean when compared with those of the Eastern Mediterranean.

The increasing of odontoblast-like cell number on direct pulp capping of Rattus norvegicus using chitosan

OpenAIRE

Prananingrum, Widyasri

2010-01-01

Background: Pulpal perforation care with direct pulp capping in the case of reversible pulpitis due to mechanical trauma was performed with chitosan which has the ability to facilitate migration, proliferation, and progenitor cell differentiation. Purpose: The purpose of this study was to determine the increasing number of odontoblast-like cells in direct pulp capping dental care of Rattus norvegicus using chitosan for seven and fourteen days. Methods: Samples were molars of male Rattus norve...

Erythrocyte enzymes in groups of Rattus norvegicus with genetic differences in 2,3-diphosphoglycerate levels.

Science.gov (United States)

Noble, N A; Tanaka, K R

1979-01-01

1. A major locus with two alleles is responsible for large differences in erythrocyte 2,3-diphosphoglycerate (DPG) levels in Rattus norvegicus. Blood from homozygous High-DPG, homozygous Low-DPG and heterozygous animals was used to measure blood indices and red cell enzyme activities. 2. Significant differences between groups were found in DPG levels, white blood cell counts and hemoglobin levels. 3. The results suggest that none of the red cell enzymes assayed is structurally or quantitatively different in the three groups.

Rattus norvegicus como indicador de la circulación de Capillaria hepatica y Taenia taeniaeformis en la Plaza Minorista de Medellín, Colombia

Directory of Open Access Journals (Sweden)

Biviana Andrea Duque

2012-12-01

Full Text Available Introducción. Rattus norvegicus cumple un papel epidemiológico en el mantenimiento y dispersión de agentes zoonóticos bacterianos, virales y parasitarios de interés en salud pública. La presencia de infección por helmintos en especies Rattus cercanas a poblaciones expuestas en condiciones ambientales propicias, puede convertirse en un factor de riesgo de transmisión. Objetivo. Reportar la frecuencia de infección con Capillaria hepatica y formas larvarias de Taenia taeniaeformis en ratas silvestres (R. norvegicus capturadas en una zona urbana de Medellín. Materiales y métodos. Se capturaron 254 ejemplares de R. norvegicus. Los hígados de 54 ejemplares que presentaron lesión hepática macroscópica durante la necropsia, fueron examinados por histopatología convencional. Resultados. La frecuencia de infección por C. hepatica fue de 20,1 % (51/254. Seis hígados fueron también positivos para larvas de T. taeniaeformis con una frecuencia de 2,4 % (6/254. Los hígados infestados con C. hepatica exhibían parásitos en el estadio adulto o juvenil y huevos ovalados conopérculos bipolares, asociados con hepatitis granulomatosa leve a moderada multifocal y acompañada por infiltrado leucocitario. Se observaron lesiones granulomatosas en resolución y fibrosis residual o calcificada que contenía huevos. Donde se encontraron cisticercos de T. taeniaeformis, el hallazgo más frecuente fueron quistes hepáticos que contenían larvas, y lesiones inflamatorias y fibróticas. Conclusión. Estos resultados indican que helmintos de potencial zoonótico circulan en R. norvegicus de ambientes urbanos. Debe investigarse la verdadera distribución de estos parásitos, para determinar el riesgo potencial que corren las poblaciones animales y humanas expuestas a adquirir este tipo de infecciones.   doi: http://dx.doi.org/10.7705/biomedica.v32i4.442

BMP4 Expression Following Stem Cells from Human Exfoliated Deciduous and Carbonate Apatite Transplantation on Rattus norvegicus

Directory of Open Access Journals (Sweden)

Tania Saskianti

2018-04-01

Full Text Available Background: Alveolar bone defects in children still have a high incidence. Conventional bone graft technique that has been used as a defect therapy is still not effective, so new techniques with tissue engineering approach are needed. Bone Morphogenetic Protein 4 (BMP4 as one of the indicators of osteogenic differentiation has not been widely studied, especially in the transplantation with combination of Stem Cells from Human Exfoliated Deciduous (SHED and carbonate apatite. Aim and Objectives: This research aimed to determine the expression of BMP4 after SHED and carbonate apatite transplantation on Rattus norvegicus. Material and Methods: The combinations of SHED and carbonate apatite were transplanted on alveolar bone defects of 4 rats (Rattus norvegicus as the treatment groups and another 4 rats were transplanted with carbonate apatite as the control groups. After 21 days, staining with Hematoxylin Eosin (HE and Immunohistochemistry (IHC BMP4 was performed. Results: BMP4 expression in the treatment groups was significantly higher when compared to the control groups. Discussion: Carbonate apatite has low crystallization rate and high osteoconductivity that produce more osteoblasts and increased BMP4 expression. Conclusion: The transplantation of SHED and carbonate apatite increased BMP4 expression as an indicator of osteogenic differentiation in rats.

New policies may call for new approaches: the case of the Swedish Norway lobster (Nephrops norvegicus) fisheries in the Kattegat and Skagerrak

DEFF Research Database (Denmark)

Hornborg, Sara; Jonsson, Patrik; Sköld, Mattias

2017-01-01

-evaluations of current practice are important as a basis for management actions. The Swedish fishery for Norway lobster (Nephrops norvegicus) in the Kattegat–Skagerrak area provides an interesting case study of relevance to emerging policies. Sprung from an unbalance in available fish- and Nephrops quotas...

Development and testing of a separator frame in a Norway lobster Nephrops norvegicus fishery

DEFF Research Database (Denmark)

Madsen, Niels; Holst, René

2017-01-01

Norway lobster Nephrops norvegicus fisheries are often characterized by high bycatch and discard rates. However, fisheries species exhibit differences in vertical behaviour that can be used to develop selective devices. We developed a separator frame that can be inserted into the forward part...... the separator frame and ending up in the bottom cod-end, the top cod-end, or penetrating the window. The majority of Norway lobster and flatfish entered the bottom cod-end, and most gadoids entered the top cod-end. A relatively high proportion of gadoids and flatfish that entered the top cod-end penetrated...

The effect of low-level laser therapy on oxidative stress and functional fitness in aged rats subjected to swimming: an aerobic exercise.

Science.gov (United States)

Guaraldo, Simone A; Serra, Andrey Jorge; Amadio, Eliane Martins; Antônio, Ednei Luis; Silva, Flávio; Portes, Leslie Andrews; Tucci, Paulo José Ferreira; Leal-Junior, Ernesto Cesar Pinto; de Carvalho, Paulo de Tarso Camillo

2016-07-01

The aim of the present study was to determine whether low-level laser therapy (LLLT) in conjunction with aerobic training interferes with oxidative stress, thereby influencing the performance of old rats participating in swimming. Thirty Wistar rats (Norvegicus albinus) (24 aged and six young) were tested. The older animals were randomly divided into aged-control, aged-exercise, aged-LLLT, aged-LLLT/exercise, and young-control. Aerobic capacity (VO2max(0.75)) was analyzed before and after the training period. The exercise groups were trained for 6 weeks, and the LLLT was applied at 808 nm and 4 J energy. The rats were euthanized, and muscle tissue was collected to analyze the index of lipid peroxidation thiobarbituric acid reactive substances (TBARS), glutathione (GSH), superoxide dismutase (SOD), and catalase (CAT) activities. VO2 (0.75)max values in the aged-LLLT/exercise group were significantly higher from those in the baseline older group (p exercise group (p exercise group than those in the LLLT and exercise groups. Young animals presented lesser and statistically significant activities of antioxidant enzymes compared to the aged group. The LLLT/exercise group and the LLLT and exercise group could also mitigate the concentration of TBARS (p > 0.05). Laser therapy in conjunction with aerobic training may reduce oxidative stress, as well as increase VO2 (0.75)max, indicating that an aerobic exercise such as swimming increases speed and improves performance in aged animals treated with LLLT.

Influence of estrogen replacement and aging on the expression of nerve growth factor in the urethra of female rats.

Science.gov (United States)

Zucchi, Eliana V M; Jármy-Di Bella, Zsuzsanna I K; Castro, Rodrigo A; Takano, Claudia C; Simões, Manuel J; Girão, Manoel J B C; Sartori, Marair G F

2012-06-01

To evaluate the expression of nerve growth factor (NGF) in the urethra of adult female rats in different hormonal status using immunohistochemical assay. Forty-eight rats (Rattus norvegicus albinus, Rodentia, Mammalia) from the CEDEME-UNIFESP laboratory animal facility were used in the study. Rats were divided into four groups: group A, 12 non-neutered rats; group B, 12 oophorectomized rats; group C, 12 castrated rats treated with 17β-estradiol for 30 days; and group D, 12 aging rats. Animals were killed by lethal injection and their urethra was removed. NGF expression was evaluated by means of immunohistochemistry using mouse monoclonal primary IgG antibody anti-NGF diluted 1:600, and read under 400× magnification. Digital analysis of the images was done by Imagelab software. The intensity of the dark brown color was used as a measure of NGF cytoplasmatic expression, and was used to quantify the percentage of epithelial and muscular layer cells showing this neurotrophin. After oophorectomy, rats showed a significant increase in NGF expression in the periurethral muscular layer. Compared with oophorectomized rats, NGF expression increased in the epithelial layer and diminished in the periurethral smooth muscle following estrogen administration. In 18-month-old rats, NGF expression was diminished in both epithelial and muscular layers. Hormonal status led to significant differences in NGF protein expression in urethral epithelium and periurethral smooth muscle. Copyright © 2012 Wiley Periodicals, Inc.

WOUND HEALING ACTIVITY OF UNGUENTUM DOSAGE FORM OF ETHANOLIC EXTRACTS OF Areca catechu L. NUT IN Mus musculus albinus

Directory of Open Access Journals (Sweden)

Azizah Vonna

2015-10-01

Full Text Available The activity test of ethanol extract of betel nut ointment (Areca catechu L. in wound healing on mice (Mus musculus albinus has been carried out to determine the ability of the ethanol extract of betel nut ointment in wound healing and determine the concentration which was accelerate the wound healing on mice between 2 concentrations. This experimental research method used completely randomized design (CRD using 20 mices divided into 4 treatment groups ; ointment base, povidone iodine ointment, ethanol extract of betel nut ointment (SEEBP 2% and SEEBP 4%. Each treatment groups was tested in the incision which was made along the 15 mm parallel to the spine (Os. Vetebre with the depth until subcutaneous skin layers. The ointment was applied twice a day for about 21 days and observed changes every day for during the period of observation. The results showed that the average length of time of the scab formation, the scab exfoliation, and the wound healing successively are for the ointment base was 6.6; 10.2 and 18.2 days, povidone iodine ointment was 7; 11.2 and 14.8 days, SEEBP 2% was 5.75; 7.75 and 13.25 days, SEEBP 4% was 4.2; 8.8 and 12.8 days. ANOVA and LSD results of scab formation time showed a significant difference between SEEBP 4% with base ointment and povidone iodine ointment (p <0.05. Results of the exfoliation scab showed a significance difference between SEEBP 2% with base ointment and povidone iodine ointment (p <0.05. The duration of wound healing showed that there was significance difference between SEEBP 2%, SEBP 4% and povidone iodine ointment with ointment base  (p<0.05.Thus, betel nut ointment as an effect on healing process. The concentration which can accelerate wound healing in mice is SEEBP 4%.

Effect of sodium selenite on bone repair in tibiae of irradiated rats

International Nuclear Information System (INIS)

Rocha, Anna Silvia Setti da; Ramos-Perez, Flavia Maria de Moraes; Boscolo, Frab Norberto; Almeida, Solange Maria; Manzi, Flavio Ricardo; Chicareli, Mariliani

2009-01-01

This study evaluated the radioprotective effect of sodium selenite on the bone repair process in tibiae of female rats. For such purpose, 100 female Wistar rats (Rattus norvegicus, albinus) were randomly assigned to 4 groups (n=25), according to the treatment received: administration of distilled water (control); administration of sodium selenite; gamma radiation; and administration of sodium selenite plus gamma radiation. A bone defect was prepared on both tibiae of all animals. Three days after surgery, the gamma radiation and selenium/ gamma radiation groups received 8 Gy gamma rays on the lower limbs. Five animals per group were sacrificed 7, 14, 21, 28 days after surgery for evaluation of the repair process by bone volumetric density analysis. The 5 animals remaining in each group were sacrificed 45 days postoperatively for examination of the mature bone by scanning electron microscopy. Based on all analyzed parameters, the results of the present study suggest that sodium selenite exerted a radioprotective effect in the bone repair of tibia of irradiated rats. (author)

Effect of sodium selenite on bone repair in tibiae of irradiated rats

Energy Technology Data Exchange (ETDEWEB)

Rocha, Anna Silvia Setti da [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR, (Brazil). Dept. of Physics; Ramos-Perez, Flavia Maria de Moraes; Boscolo, Frab Norberto; Almeida, Solange Maria [Universidade Estadual de Campinas (UNICAMP), Piracicaba, SP (Brazil). Piracicaba Dental School. Dept. of Oral Diagnosis], e-mail: flaviamaria@fop.unicamp.br; Manzi, Flavio Ricardo [Pontifical Catholic University of Minas Gerais (PUC-MG), Belo Horizonte, MG (Brazil). Dept. of Stomatology; Chicareli, Mariliani [State Univ. of Maringa, PR (Brazil). Dept. of Oral Diagnosis

2009-07-01

This study evaluated the radioprotective effect of sodium selenite on the bone repair process in tibiae of female rats. For such purpose, 100 female Wistar rats (Rattus norvegicus, albinus) were randomly assigned to 4 groups (n=25), according to the treatment received: administration of distilled water (control); administration of sodium selenite; gamma radiation; and administration of sodium selenite plus gamma radiation. A bone defect was prepared on both tibiae of all animals. Three days after surgery, the gamma radiation and selenium/ gamma radiation groups received 8 Gy gamma rays on the lower limbs. Five animals per group were sacrificed 7, 14, 21, 28 days after surgery for evaluation of the repair process by bone volumetric density analysis. The 5 animals remaining in each group were sacrificed 45 days postoperatively for examination of the mature bone by scanning electron microscopy. Based on all analyzed parameters, the results of the present study suggest that sodium selenite exerted a radioprotective effect in the bone repair of tibia of irradiated rats. (author)

Diminazene aceturate and imidocarb dipropionate in the control of Trypanosoma evansi infection in Rattus norvegicus experimentally infected

OpenAIRE

Silva, Aleksandro Schafer da; Tochetto, Camila; Zanette, Régis Adriel; Pierezan, Felipe; Rissi, Daniel Ricardo; Santurio, Janio Morais; Monteiro, Silvia Gonzalez

2008-01-01

Este estudo teve como objetivo avaliar o efeito do aceturato de diminazeno e do dipropionato de imidocarb no controle da infecção por Trypanosoma evansi em ratos (Rattus norvegicus) infectados experimentalmente. Cinqüenta e quatro ratos machos foram inoculados via intraperitonial com 104 tripomastigotas de T. evansi/animal. Os ratos foram monitorados diariamente por meio de esfregaço sanguíneo periférico. No momento em que se observassem oito protozoários por campo microscópico de 1000x, era ...

Traumatic brain injury: clinical and pathological parameters in an experimental weightdrop model Lesão cerebral traumática: parâmetros clínicos e patológicos em um modelo experimental de queda de peso

Directory of Open Access Journals (Sweden)

Danilo dos Santos Silva

2011-04-01

Full Text Available PURPOSE: To investigate the function of an experimental cranium trauma model in rats. METHODS: The equipment, already described in the literature and under discreet adaptations, is composed by a platform that produces closed head impact controlled by weight drop with pre-defined and known energy. 25 Wistar male rats (Rattus norvegicus albinus were divided into five equal groups that received different quantities of cranial impact energy: G1, G2, G3 and G4 with 0,234J, 0,5J, 0,762J and 1J respectively and G5 (Sham. Under intense analgesia, each group was evaluated clinically in a sequence of intervals and had their encephalon removed for pathologic analysis. RESULTS: Important clinical alterations (convulsions, bradycardia, bradypnea and abnormal postures and focal pathologic (hematomas and hemorrhages kept proportion with the intensity of the impact. No fracture was observed and the group 4 had 80% mortality rate. CONCLUSION: The experimental cranium trauma animal model by weight drop is an alternative of low cost and easy reproduction that allows evaluating clinical and pathological alterations in accordance with studies in experimental surgery aims for new traumatic brain injury approach in rats.OBJETIVO: Investigar o uso de um modelo de trauma craniano experimental em ratos. MÉTODOS: O equipamento, já descrito na literatura e sob discretas adaptações, contitui-se de uma plataforma para produção de lesão craniana fechada controlada por queda de peso com energia pré-definida e conhecida. 25 ratos Wistar machos (Rattus norvegicus albinus foram divididos em cinco grupos iguais que receberam níveis diferentes de energia de impacto craniano: G1, G2, G3 e G4 com 0,234J, 0,5J, 0, 762J e 1J respectivamente e G5 (Sham. Sob intensa analgesia, cada grupo foi avaliado clinicamente em uma seqüência de intervalos e tiveram seus encéfalos removidos para análise patológica. RESULTADOS: Alterações clínicas importantes (convulsões, bradicardia

Possible use of wild-living rats (Rattus norvegicus) as bioindicators for heavy metal pollution. Part I. Sex and age-related quantification of Al, As, Cd, Co, Cu, Mn, Ni, Pb, Sr, Ti, Tl and Zn in liver, heart, lung, kidney, muscle, brain and bones, and the establishment of distribution patterns; Untersuchungen zur Eignung wildlebender Wanderratten (Rattus norvegicus) als Indikatoren der Schwermetallbelastung. T. I. Alters- und geschlechtsspezifische Quantifizierung der Verteilung von Al, As, Cd, Co, Cu, Mn, Ni, Pb, Sr, Ti, Tl und Zn in den Organen Herz, Leber, Lunge, Niere, Muskulatur, Gehirn und Knochen

Energy Technology Data Exchange (ETDEWEB)

Wuenschmann, S. [Internationales Hochschulinstitut Zittau (Germany). Lehrstuhl fuer Umweltverfahrenstechnik; Hochschule fuer Technik, Wirtschaft und Sozialwesen Zittau/Goerlitz (FH), Zittau (Germany). Fachbereich Mathematik/Naturwissenschaften; Oehlmann, J. [J. W. Goethe-Univ. Frankfurt, Zoologisches Inst., Frankfurt/M. (Germany); Delakowitz, B. [Hochschule fuer Technik, Wirtschaft und Sozialwesen Zittau/Goerlitz (FH), Zittau (Germany). Fachbereich Mathematik/Naturwissenschaften; Markert, B. [Internationales Hochschulinstitut Zittau (Germany). Lehrstuhl fuer Umweltverfahrenstechnik

2001-07-01

The objective of the current attempt was to investigate the suitability of wild-living rats (Rattus norvegicus) as a passive bioindicator using quantitative determinations of 12 chemical elements in different organs taken from rats which were caught in the Zoological Garden of Zittau. Aside from the determinations of so-called background levels, the focus of interest was with accumulations of certain elements within the organs depending on either sex or age of the rats. There were different affinities of the elements towards certain organs. Because of apparent sex and age-related differences in element concentrations and accumulation features, a well-planned sampling strategy for the use of rats as possible passive bioindicators is indeed required. The consideration of element distribution patterns within the organ system of Rattus norvegicus (based on body burden calculations (in part 2 of this work)) allows an effective use of the rat for purposes of integrative monitoring. (orig.) [German] Durch die Quantifizierung von 12 chemischen Elementen im Organsystem von wildlebenden Ratten (Rattus norvegicus) aus dem Tierpark Zittau (Sachsen) sollte die Eignung dieser Spezies als passiver Bioindikator untersucht werden. Neben der Ermittlung von sogenannten Hintergrundkonzentrationen standen insbesondere Fragen zur geschlechts- und altersspezifischen Akkumulation einzelner Elemente im Organsystem von Rattus norvegicus im Vordergrund. Spezifisch zeigten dabei einzelne Elemente unterschiedliche Affinitaeten zu den entsprechenden Geweben und Organen. Insbesondere die hierbei ermittelten geschlechts- und altersspezifischen Charakteristika einzelner Elemente macht eine detaillierte Ausarbeitung einer Beprobungsstrategie fuer den spaeteren Einsatz als passiver Bioindikator zwingend. Unter Beruecksichtigung des durch die Berechnung des Body Burden (Koerperlast) im 2. Teil der Arbeit ermittelten typischen Verteilungsmusters einzelner Elemente ist Rattus norvegicus zum

Pinealectomia em ratas Wistar (Rattus norvegicus albinus: descrição de um novo método cirúrgico

Directory of Open Access Journals (Sweden)

F.R.N.F. Burgos

2016-02-01

Full Text Available A necessidade de manejo adequado antes, durante e após a implementação de procedimentos em animais de laboratório é essencial para proporcionar bem-estar. Portanto, no presente trabalho, objetivou-se padronizar uma nova técnica de pinealectomia em ratas Wistar. Trinta fêmeas nulíparas aos 90 dias de idade foram submetidas à anestesia dissociativa. Após a tricotomia e a assepsia, realizou-se uma incisão na linha média dorsal da cabeça. Com um micromotor e uma broca de aço PM 03, realizou-se a craniotomia; a glândula pineal foi removida por intermédio de um fórceps cápsula arruga. Em seguida, o fragmento ósseo foi recolocado em seu lugar de origem, e a pele aproximada por pontos simples. Finalizado o procedimento cirúrgico, foi realizada antibioticoterapia e soroterapia parenteral. O acompanhamento diário dos animais não evidenciou nenhum comprometimento da ferida operatória com padrão de cicatrização por primeira intenção. Os animais apresentaram normalidade de atos fisiológicos, como alimentação, defecação e micção, assim como socialização com o grupo. Técnicas cirúrgicas vêm sendo realizadas com o desenvolvimento das pesquisas envolvendo a glândula pineal. A técnica ideal para pinealectomia consiste no pouco sangramento, na curta duração da cirurgia e na nitidez da glândula pineal, diminuindo a probabilidade de acidentes neurológicos. Considerando-se os resultados obtidos ao longo do desenvolvimento experimental e clínico, o aprimoramento da técnica cirúrgica utilizando a broca PM03 associada ao fórceps cápsula arruga foi exímio na pesquisa científica da pinealectomia de ratas Wistar em virtude da rapidez e praticidade alcançadas. Tem-se a perspectiva de que este artigo sirva de subsídio para o aprimoramento e a otimização do modelo experimental para posteriores estudos acerca de pesquisas com a glândula pineal e, assim, maior compreensão de sua complexidade sobre todos os sistemas do organismo.

The effect of fluoride on the serum level of calcium in the rat (Rattus norvegicus

Directory of Open Access Journals (Sweden)

Fočak M.

2012-01-01

Full Text Available The effect of fluoride on the calcium level in serum was analyzed in the laboratory rat Rattus norvegicus. The control group consisted of 10, and the experimental group of 15 animals. In the experimental group, fluoride at a concentration of 3 mg/100 g body weight of rats was intramuscularly injected into the musculus gluteus maximus. The concentration of calcium was measured by the CPC method. The average serum calcium concentration was 2.46 mmol/l, with female rats having higher values of serum calcium than male rats. Fluoride caused the reduction of calcium concentration in serum (p<0.05; the reduction was significantly expressed in female rats (p<0.000.

Assessment of the risks of rats (Rattus norvegicus and opossums (Didelphis albiventris in different poultry-rearing areas in Argentina Avaliação dos riscos sanitários de ratos (Rattus norvegicus e gambás (Didelphis albiventris em diferentes granjas avícolas na Argentina

Directory of Open Access Journals (Sweden)

Isabel E. Gómez Villafañe

2004-12-01

Full Text Available We have studied the prevalence of Trichinella spiralis, Leptospira spp. and Salmonella spp. in rats and opossums that inhabit poultry farms of Exaltación de la Cruz, Buenos Aires, Argentina, to determine the potential sanitary risk for humans that are in contact with these animals. The study was carried out on 48 poultry farms between spring 1999 and winter 2001. The study of opossums began in winter 2000. During the study period we captured 152 Rattus norvegicus, 3 Rattus rattus, 16 Didelphis albiventris and 1 Lutreolina crassicaudata. We have registered the presence of rats and opossums in 70% and 27% of the studied farms, respectively. The percentage of farms with rats was independent of the presence or absence of pigs. We did not detect the presence of Leptospira spp. and Trichinella spiralis in any individual. We detected the presence of Salmonella Enteritidis in one Rattus norvegicus and one Didelphis albiventris. According to our results, the rats and opossums of poultry farms may not report a risk factor in the transmission of Trichinella and Leptospira under the present conditions; but the detection of Salmonella Enteritidis in rats as well as in opossums suggests the idea of applying prophylactics measurements on poultry farms.A prevalência de Trichinella spiralis, Leptospira spp. e Salmonella spp. foi estudada em ratos e gambás que habitam granjas avícolas da região de Exaltación de la Cruz, Buenos Aires, Argentina, com o objetivo de determinar o potencial risco sanitário para pessoas que ficam em contato com esses animais. O estudo foi realizado entre a primavera de 1999 e o inverno de 2001 em 48 granjas avícolas. O estudo em gambás iniciou-se no inverno de 2000. Foram capturados 152 Rattus norvegicus, 3 Rattus rattus, 16 Didelphis albiventris e 1 Lutreolina crassicaudata. Registrou-se a presença de ratos e de gambás em 70% e 27% das granjas estudadas, respectivamente. A percentagem de granjas com ratos foi independente da

Endemic angiostrongyliasis in the Brazilian Amazon: natural parasitism of Angiostrongylus cantonensis in Rattus rattus and R. norvegicus, and sympatric giant African land snails, Achatina fulica.

Science.gov (United States)

Moreira, V L C; Giese, E G; Melo, F T V; Simões, R O; Thiengo, S C; Maldonado, A; Santos, J N

2013-01-01

Angiostrongylus cantonensis, the rat lungworm, is one etiological agent of eosinophilic meningoencephalitis in humans. This zoonosis is frequently found in Asia and, more recently, in North America, Caribbean Island and northeastern of South America. Until now, research of A. cantonensis in southern, southeastern and northeastern regions of Brazil has been found natural infections only terrestrial and freshwater intermediate snail hosts (Achatina fulica, Sarasinula marginata, Subulina octona, Bradybaena similaris and Pomacea lineate). In this study, we examined the occurrence of helminthes in the synantropic rodents Rattus rattus and Rattus norvegicus in northern Brazil, focusing on the role of these species as vertebrate hosts of A. cantonensis and A. fulica as intermediate host have found natural. Thirty specimens of R. rattus and twelve of R. norvegicus were collected in the Guamá and Jurunas neighborhoods of the city of Belém, in the Brazilian state of Pará, of which almost 10% harbored adult worms in their pulmonary arteries. Sympatric A. fulica were found to be infected by L(3) larvae, which experimental infection confirmed to be A. cantonensis. Natural infection of snails and rodents with A. cantonensis was confirmed through morphological and morphometrical analyses of adults and larvae using light microscopy, scanning electron microscopy and molecular sequences of partial Cytochrome Oxidase subunit I. Phylogenetic analyses showed that A. cantonensis isolated from Pará, Brazil is similar to Japan isolate; once these specimens produced a single haplotype with high bootstrap support with Rio de Janeiro isolate. This study confirms that A. cantonensis is now endemic in northern Brazil, and that R. rattus and R. norvegicus act as natural definitive hosts, and A. fulica as the intermediate host of the parasite in this region. Copyright © 2012 Elsevier B.V. All rights reserved.

Estudo comparativo das reações teciduais à implantação de silicone e politetrafluoroetileno no dorso de ratos

Directory of Open Access Journals (Sweden)

Kafejian Andréa Paula

1997-01-01

Full Text Available A importância das biopróteses na medicina abrange diversas áreas cirúrgicas. Com o objetivo de comparar a reação tecidual do implante de silicone, um dos mais utilizados, com o implante de politetrafluoroetileno expandido (PTFE-E, de uso mais recente, nos propusemos a realizar este estudo. Foram utilizados trinta ratos (Rattus norvegicus albinus machos, distribuídos em três grupos iguais, com implantes de fragmentos discóides dos materiais citados, no dorso de cada rato. Os grupos diferiram entre si quanto ao período de eutanásia: três, sete e trinta dias. Com base no modelo experimental e utilizando metodologia morfométrica, do ponto de vista histológico não houve reação inflamatória aguda importante que se pudesse correlacionar aos materiais de implantes. A proliferação vascular e a presença de fibrose foram prolongadas em relação à cicatrização normal. A irregularidade do PTFE-E, provavelmente relaciona-se à maior quantidade de vasos e de fibrose tardia constatada neste material, quando comparado ao implante de silicone.

Castor oil polyurethane containing silica nanoparticles as filling material of bone defect in rats.

Science.gov (United States)

Nacer, Renato Silva; Poppi, Rodrigo Ré; Carvalho, Paulo de Tarso Camilo de; Silva, Baldomero Antonio Kato da; Odashiro, Alexandre Nakao; Silva, Iandara Schettert; Delben, José Renato Jurkevicz; Delben, Angela Antonia Sanches Tardivo

2012-01-01

To evaluate the biologic behavior of the castor polymer containing silica nanoparticles as a bone substitute in diafisary defect. Twenty seven male Rattus norvegicus albinus Wistar lineage were submitted to bone defect filled with castor oil polymer. Three experimental groups had been formed with nine animals each: (1) castor oil polymer containing only calcium carbonate; (2) castor oil polymer with calcium carbonate and doped with 5% of silica nanoparticles; (3) castor polymer with calcium carbonate doped with 10% of silica nanoparticles; 3 animals of each group were submitted to euthanasia 15, 30 and 60 days after experimental procedure, and their femurs were removed to histological evaluation. there was bone growth in all the studied groups, with a greater tendency of growth in the group 1. After 30 days all the groups presented similar results. After 60 days a greater amount of fibroblasts, osteoblasts, osteocytes and osteoclasts in group 3 was observed, with integrated activity of 3 kinds of cells involved in the bone activation-reabsorption-formation. The castor polymer associated to the silica nanoparticles is biocompatible and allows osteoconduction. The presence of osteoprogenitors cells suggests silica osteoinduction capacity.

Recovery by the Norway lobster Nephrops norvegicus (L.) from the physiological stresses of trawling: Influence of season and live-storage position

DEFF Research Database (Denmark)

Lund, H. S.; Wang, T.; Chang, E. S.

2009-01-01

Live Norway lobsters (Nephrops norvegicus L.) were trawled at depths of 30 to 55 m off the coast of Jutland (Denmark) in late winter (March) and in summer (August) in 2006. Water temperatures at the bottom and surface of the sea were 7 °C and 2 °C during the winter, and 12 °C and 21 °C in the sum......Live Norway lobsters (Nephrops norvegicus L.) were trawled at depths of 30 to 55 m off the coast of Jutland (Denmark) in late winter (March) and in summer (August) in 2006. Water temperatures at the bottom and surface of the sea were 7 °C and 2 °C during the winter, and 12 °C and 21 °C...... in the summer, respectively. The recovery of specific physiological and metabolic variables from the intense stresses associated with capture (trawling and air-exposure during sorting) was followed in seawater at 5 °C in winter or 18 °C in summer. Recovery was compared in lobsters held individually in two......-base status. In winter, a potential metabolic lactic acidosis was compensated by a marked respiratory alkalosis, with significantly increased haemolymph pH and decreased CO2 total content and partial pressure. These effects disappeared gradually over 96 h. Summer lobsters showed combined metabolic...

Improving the effectiveness of escape windows in directed Norway lobster Nephrops norvegicus trawl fisheries

DEFF Research Database (Denmark)

Madsen, Niels; Holst, René; Frandsen, Rikke

2012-01-01

A substantial improvement in the bycatch selectivity of Norway lobster Nephrops norvegicus trawls is required, particularly with respect to cod Gadus morhua , whose stocks are at low levels in several areas. Conventional escape windows are not adequate to properly release cod and other bycatch...... species caught in the trawls. To address this issue, we developed a novel sorting box concept consisting of a four-panel section with a window on the top in order to improve the escape of cod and other bycatch species through an escape window while retaining the target catch of Norway lobster. The concept....... The reduction in bycatch decreased with decreasing mesh size and increasing height of the sorting box. Escape of Norway lobster through the escape window was limited. A modified version of the sorting box concept was implemented in the Kattegat fishery from 2009 onwards...

Hydrodynamic, non-photic modulation of biorhythms in the Norway lobster, Nephrops norvegicus (L.)

Science.gov (United States)

Aguzzi, J.; Puig, P.; Company, J. B.

2009-03-01

Data on biological rhythms of the Norway lobster Nephrops norvegicus (L.) are compared with new findings on inertial currents, a non-photic geophysical hydrodynamic fluctuation. Laboratory experiments on animal endogenous cardiac activity and locomotor rhythms using individuals from the middle slope (400-600 m depth) of the Mediterranean Sea revealed a consistent proportion of ultradian 18-h animals (20.6% and 12.0% of the studied cases for cardiac and locomotor tests, respectively). This characteristic, not reported in similar experiments with individuals from shallower depths (20-200 m) in the Atlantic Ocean, was initially considered meaningless from an ecological point of view. However, a close comparison with in situ oceanographic measurements over 1 year revealed a clear relationship between inertial current fluctuations and the observed 18-h behavioural and physiological rhythms. We propose a novel scenario involving potential non-photic (i.e. hydrodynamic) modulation of Nephrops biorhythms, and suggest that this may provide a paradigm for other benthic species in deep-water areas.

Effects of drilling cuttings on the behavior of the Norway lobster Nephrops norvegicus

Energy Technology Data Exchange (ETDEWEB)

Richardson, C A

1984-05-01

Small quantities of drilling cuttings (100 g/250 cm/sup 2/) were found to affect both the survival and general behavior of Nephrops norvegicus held in experimental aquaria. In one experiment volatile hydrocarbons released from the cuttings caused a significant decrease in the heat of the exopodite on the third maxilliped. Flicking rates of the antennule and the time taken to identify and capture food introduced into the tanks were unaffected by exposure to cuttings. When the water flow through the tanks was interrupted for 12 h, 58% of animals died after exposure to the highest concentration of cuttings but those at the lower concentrations survived. After the water flow was restored the remaining survivors showed disorientated behavior and uncoordinated movements which lasted for about 36 h. In this condition animals will be more vulnerable to predators. This unnatural behavior may have serious implications for natural populations exposed to cuttings discharge in the close vicinity of offshore drilling platforms. 11 references, 3 tables.

Identifikasi Sifat dan Distribusi Sel Endokrin Ghrelin di Lambung Tikus (Rattus Norvegicus: Studi Immunohis-Tokimia pada Kondisi Obesitas

Directory of Open Access Journals (Sweden)

Teguh Budipitojo

2016-06-01

Full Text Available Obesity is one of major nutritional problems in the world. Obesity is very dangerous, especially when concentrated in the abdomen, because it is closely linked to various diseases such as diabetes, hypertension, heart disease, which can to causing death. This study aims to identify the nature and distribution of ghrelin on gastric endocrine cells in the obese rat (Rattus norvegicus by using immunohistochemical techniques. The results will strengthen the understanding of the role and function of ghrelin as an alternative therapeutic target on obesity. The research used gastric tissues of ten obese and control rats which were stained with avidin-biotin-peroxidase complex method of immunohistochemistry. The results showed the existence of two types of ghrelin-producing cells (open and closed types on the gastric mucosa of control rats, and only one type of ghrelin producing cells (open type in obese rats. The intensity of ghrelin immunoreactive positive cells was detected weak in obese rats, but very strong in control rats. Ghrelin endocrine cells mainly distributed in the basal part of the gastric mucosa of the fundus parts, with a very small number in obese rats, but highly abundant in control rats. This study confirmed the decrease of the ghrelin synthesis and secretion in obese rat (Rattus norvegicus at the cellular level. The decrease of ghrelin synthesis is characterized by a reduction on the number of ghrelin producing cells, the disappearance of the close type of ghrelin producing cells, and the low activity of protein synthesis in the ghrelin producing cells. Ghrelin endocrine cells distributed mainly in the basal part of the gastric mucosa, especially in the fundus parts.

Aceturato de diminazeno e dipropionato de imidocarb no controle de infecção por Trypanosoma evansi em Rattus norvegicus infectados experimentalmente Diminazene aceturate and imidocarb dipropionate in the control of Trypanosoma evansi infection in Rattus norvegicus experimentally infected

Directory of Open Access Journals (Sweden)

Aleksandro Schafer da Silva

2008-08-01

Full Text Available Este estudo teve como objetivo avaliar o efeito do aceturato de diminazeno e do dipropionato de imidocarb no controle da infecção por Trypanosoma evansi em ratos (Rattus norvegicus infectados experimentalmente. Cinqüenta e quatro ratos machos foram inoculados via intraperitonial com 104 tripomastigotas de T. evansi/animal. Os ratos foram monitorados diariamente por meio de esfregaço sanguíneo periférico. No momento em que se observassem oito protozoários por campo microscópico de 1000x, era iniciado o tratamento com as drogas (dia zero. O estudo foi dividido em dois protocolos terapêuticos e os fármacos foram administrados via intramuscular. O primeiro protocolo foi aplicado nos grupos A, B, C e D e o segundo protocolo nos grupos E, F, G e H. O grupo controle foi identificado como grupo I, não medicados. No primeiro protocolo, os ratos receberam uma dose única dos fármacos no dia zero e sempre que se observasse T. evansi na circulação periférica. No segundo protocolo, os roedores receberam as mesmas doses, no entanto, por cinco dias consecutivos. No primeiro protocolo, os dois princípios ativos não apresentaram eficácia curativa, ocorrendo reincidência da parasitemia após alguns dias do tratamento. No segundo protocolo, o aceturato de diminazeno eliminou a forma tripomastigota da circulação e os ratos foram eutanasiados após 90 dias do início do tratamento. Os roedores tratados com dipropionato de imidocarb apresentaram recidiva da infecção após 30 dias. Na histopatologia não se observou alteração renal e hepática relacionada à doença ou aos medicamentos testados. Com base nos resultados, foi concluído que o aceturato de diminazeno, quando administrado por cinco dias consecutivos, é efetivo no tratamento da tripanossomose em ratos.The aim of this study was to evaluate the efficacy of diminazene aceturate and imidocarb dipropionate in the control of Trypanosoma evansi infection in rats (Rattus norvegicus

Rat pinealectomy: a modified direct visual approach Pinealectomia em ratos: técnica modificada com visualização direta

Directory of Open Access Journals (Sweden)

Carla Cristina Maganhin

2009-08-01

Full Text Available PURPOSE: To report a new, direct visual approach for rat pinealectomy. METHODS: Eighty adult female rats (Rattus norvegicus albinus EPM-1 strain were weighted and anesthetized intraperitoneally with 15 mg/kg xylazine and 30 mg/kg ketamine. The animal was fastened to a dissection table, an incision was made in the skin and the subcutaneous tissue, bringing the lambda into view. The skullcap was opened with a dental drill, bringing the cerebral hemispheres and the superior sagittal sinus into view. The pineal gland, located under the venous sinus, was removed in a single piece using tweezers. Next, the bone fragment was returned to its place and the surgical layers were sutured. RESULTS: This new technique is easy to be done, avoids bleedings and removes only the pineal gland without damage to the remaining encephalon. In addition it makes possible the achievement of a sham surgery, allowing the pineal gland to remain intact. CONCLUSION: The proposed technique intends to facilitate studies aiming to better understanding the complexity and importance of the pineal gland on reproductive and other body systems.OBJETIVO: Apresentar nova técnica para pinealectomia em ratos. MÉTODOS: 80 ratos adultos fêmeas (Rattus norvegicus albinus foram pesados e em seguida anestesiados por via intraperitoneal com xilazina e cetamina. Em seguida os animais foram fixados em uma prancha de cortiça e feita uma incisão na pele e no tecido subcutâneo, na região superior da cabeça, evidenciando a junção dos ossos parietais e occipital. Na região do lambda, realizou-se uma perfuração circular, na calota craniana, com o auxilio de uma broca (4 mm acoplada a um micromotor. Nesse orifício, após a dissecação da dura-mater visibiliza-se a confluência dos seios venosos longitudinal e transverso. Com o auxilio de uma pinça curva esses seios são deslocados, ligados e identificada a glândula pineal, que pode ser removida em peça única. Em seguida, o fragmento

The Use of Cytochrome b Gene as a Specific Marker of the Rat Meat (Rattus norvegicus on Meat and Meat Products

Directory of Open Access Journals (Sweden)

C. Sumantri

2012-04-01

Full Text Available Falsification of the origin of livestock meat and its processed with rat meat is a problem that must be overcome to ensure food safety. One way that is often used to detect forgeries by using cytochrome b gene as a marker. The purpose of this study was to create a specific primer derived from cytochrome b sequences in rat (Rattus norvegicus as the DNA marker to detect any contamination of rat meat on fresh livestock meat and its processed meat products. Meatballs were made from beef meat with the addition of rat 1%-25%, and the meatballs were obtained from traditional markets. DNA extraction was conducted from seven species (goat, chicken, cattle, sheep, pig, horse, and rat by using phenol-chloroform. The highest success rate in detecting the presence of rat meat in a mixture of beef meatballs at concentration of 15% was 100%. The specific fragment of cytochrome b gene in R. norvegicus has no similarity with the cytochrome b gene from six other species, so it can be used as molecular markers to detect the presence of rat meat contamination in the processed of meat products. Amplified fragment length for goats, chickens, cattle, sheep, pigs, horses, and rats 157, 227, 274, 331, 398, 439 and 603 bp respectively. The amplification of cytochrome b gene in seven species of animals with different fragment length indicated the specificity of cytochrome b gene sequences among species.

The accumulation and retention of 95mTc by the Norway lobster, Nephrops norvegicus L

International Nuclear Information System (INIS)

Swift, D.

2001-01-01

Laboratory experiments were carried out to study bioaccumulation and determine a concentration factor (CF) for technetium ( 95m Tc) in the homarid crustacean Nephrops norvegicus L. The steady state CF for accumulation from seawater was estimated to be about 2000 and the biological half-time was about 50 days. The highest tissue Tc concentrations were found in the green gland and the digestive gland. Depuration following accumulation from water was slow with a half-time of about 165 days. Tc accumulation from labelled food followed a biphasic model with one compartment containing about 94 percent of the ingested activity and with a half-time of about 1 day and the second compartment containing about 6 percent of the ingested activity with a half-time of about 56 days. Most retained activity was found in the digestive gland

TRANEXAMIC ACID ACTION ON LIVER REGENERATION AFTER PARTIAL HEPATECTOMY: EXPERIMENTAL MODEL IN RATS.

Science.gov (United States)

Sobral, Felipe Antonio; Daga, Henrique; Rasera, Henrique Nogueira; Pinheiro, Matheus da Rocha; Cella, Igor Furlan; Morais, Igor Henrique; Marques, Luciana de Oliveira; Collaço, Luiz Martins

2016-01-01

Different lesions may affect the liver resulting in harmful stimuli. Some therapeutic procedures to treat those injuries depend on liver regeneration to increase functional capacity of this organ. Evaluate the effects of tranexamic acid on liver regeneration after partial hepatectomy in rats. 40 rats (Rattus norvegicus albinus, Rodentia mammalia) of Wistar-UP lineage were randomly divided into two groups named control (CT) and tranexamic acid (ATX), with 20 rats in each. Both groups were subdivided, according to liver regeneration time of 32 h or seven days after the rats had been operated. The organ regeneration was evaluated through weight and histology, stained with HE and PCNA. The average animal weight of ATX and CT 7 days groups before surgery were 411.2 g and 432.7 g, and 371.3 g and 392.9 g after the regeneration time, respectively. The average number of mitotic cells stained with HE for the ATX and CT 7 days groups were 33.7 and 32.6 mitosis, and 14.5 and 14.9 for the ATX and CT 32 h groups, respectively. When stained with proliferating cell nuclear antigen, the numbers of mitotic cells counted were 849.7 for the ATX 7 days, 301.8 for the CT 7 days groups, 814.2 for the ATX 32 hand 848.1 for the CT 32 h groups. Tranexamic acid was effective in liver regeneration, but in longer period after partial hepatectomy. Muitas são as injúrias que acometem o fígado e levam a estímulo lesivo. Alguns procedimentos terapêuticos para tratamento dessas lesões dependem da regeneração hepática para aumentar a sua capacidade funcional. Avaliar o efeito do ácido tranexâmico na regeneração hepática após hepatectomia parcial em ratos. Foram utilizados 40 ratos (Rattus norvegicus albinus, Rodentia mammalia) convencionais da linhagem Wistar-UP. Foram divididos aleatoriamente em dois grupos de 20: grupo controle (CT) e grupo ácido tranexâmico (ATX). Cada um deles foi divido em dois subgrupos para avaliar a regeneração hepática no tempo de 32 h e 7 dias do p

Pengaruh Pemberian Jus Buah Naga Merah (Hylocereus polyrhizus Terhadap Kadar Trigliserida Tikus Putih (Rattus norvegicus Hiperlipidemia

Directory of Open Access Journals (Sweden)

Afrida Wira Surya Rizqi

2014-09-01

Results with descriptive analysis obtained that mean of positive control’s pre-test triglyceride level was 104.80 mg/ dl and treatment groups I, II and III respectively 108.15 mg/ dl, 106.47 mg/ dl and 107.43 mg/ dl whereas positive control’s post-test triglyceride level was 51.09 mg/ dl and for the treatment groups were 94.64 mg /dl, 71.01 mg/ dl and 58.75 mg/ dl. One Way ANOVA test obtained p <0.05 which indicated the difference between the treatment of various doses of red dragon fruit juice to white rats’ triglyceride levels. Based on that, means there is the effect of various doses of red dragon fruit (Hylocereus polyrhizus juice to the decrease of triglyceride levels in hyperlipidemic white rats (Rattus norvegicus.

90-Day Inhalation Toxicity Study of Hydroprocessed Esters and Fatty Acids (HEFA) Bio-Based Jet Fuel in Rats (Rattus norvegicus) with Neurotoxicity Testing and Genotoxicity Assay

Science.gov (United States)

2013-06-01

elevated frame to detect vertical rears, as well as differentiate small ( stereotypic ) movements from large movements. Motor activity was measured in a...Laboratory Animals V.3.3.1. Genus / Species Rattus norvegicus V.3.3.2. Strain / Stock 62 Distribution A: Approved for public release...horizontal movement and to differentiate small ( stereotypic ) movements from large movements, and a second frame was elevated above the ground level frame

EFICÁCIA DE TRÊS MEDICAMENTOS NO CONTROLE DA INFECÇÃO EXPERIMENTAL POR TRYPANOSOMA EVANSI EM RATOS (RATTUS NORVEGICUS) LINHAGEM WISTAR

OpenAIRE

Rovaina Laureano Doyle

2006-01-01

Este trabalho objetivou verificar os achados laboratoriais e histológicos da infecção experimental por Trypanosoma (Trypanozoon) evansi (Steel, 1885) Balbiani, 1888, em ratos (Rattus norvegicus) da linhagem Wistar, testando a eficácia de três medicamentos. Foram utilizados 40 ratos, divididos em quatro grupos de 10 cada, sendo cada grupo composto por 5 machos e cinco fêmeas, os quais foram tratados com três quimioterápicos distintos após a detecção de parasitemia superior a oit...

Aceturato de diminazeno e dipropionato de imidocarb no controle de infecção por Trypanosoma evansi em Rattus norvegicus infectados experimentalmente

OpenAIRE

Silva,Aleksandro Schafer da; Tochetto,Camila; Zanette,Régis Adriel; Pierezan,Felipe; Rissi,Daniel Ricardo; Santurio,Janio Morais; Monteiro,Silvia Gonzalez

2008-01-01

Este estudo teve como objetivo avaliar o efeito do aceturato de diminazeno e do dipropionato de imidocarb no controle da infecção por Trypanosoma evansi em ratos (Rattus norvegicus) infectados experimentalmente. Cinqüenta e quatro ratos machos foram inoculados via intraperitonial com 104 tripomastigotas de T. evansi/animal. Os ratos foram monitorados diariamente por meio de esfregaço sanguíneo periférico. No momento em que se observassem oito protozoários por campo microscópico de 1000x, era ...

Susceptibilité de Rattus norvegicus et Rattus rattus frugivurus de la ville de Recife à la Pasteurella pestis

Directory of Open Access Journals (Sweden)

Dalva A. de Mello

1968-06-01

Full Text Available L'auíeur a vérifié la susceptibilité de deux espèces de rongeurs domestiques de la ville de Recife. Etat du Pernambuco, R. norvegicus et Rattus rattus frugivurus, les comparant aux souris albinos de la souche "Swiss" avec deux souches de P. pestis dont une était isolée au municipe d'Exu, Etat du Pernambuco âenommée PEXU 19 et Vautre provenante du Venezuela dite RANGEL. Les deux espèces de rongeurs ont montré une resistence modérée par rapport aux deux souches de P. pestis tandis que les souris ont révélé d'être hautement susceptibles.

Feeding strategies of Rattus norvegicus: a review / Una sintesi di alcuni aspetti della strategia alimentare del ratto Rattus norvegicus

Directory of Open Access Journals (Sweden)

Mara Cagnin

1987-07-01

Full Text Available Abstract Some of the most relevant aspects of the feeding behaviour of the rat (Rattus norvegicus, Berkenhout, 1769 were examined with particular interest in the data collected on wild rats and in natural environments. The rat is considered as an omnivore and generalist species, but both in the wild and in the laboratory marked individual differences were recorded in food preferences and diet spectrum, which probably allow the natural populations to exploit a great number of habitat resources. A number of causes were identified as responsible of these differences: early pup differentiation; mother's and conspecifics' influences, etc. The importance of animal food in the rat diet is also variable. The diet of non-commensal rat colonies was examined with special reference to the predatory behaviour, which is a common habit in natural populations; furthermore the insorgence of "local traditions" such as the Mollusc predation was considered. The hypothesis of social transmission of this feeding habit, widespread in the Po river Basin and Delta, was discussed and confirmed. The hoarding behaviour, well studied under laboratory conditions, was rarely recorded in the wild. It is supposed to be a useful mechanism that the rat uses to cope with particular conditions (e.g. surplus of food, lactating females but this species cannot be defined as a "natural hoarder". The degree of neophobia is variable in populations that interact with man and it is practically absent in non-commensal populations. This confirms that it is a defensive strategy resulting from the commensal habit of the rat and not a fixed behavioural characteristic of this rodent species. The stealing of food between animals, kleptoparasitism, was frequently observed in confined rat groups in laboratory but rarely described in the wild. It is compared with the "worker-parasite" relationship supposed to be a kind of division of labour. The most important components of

Development and test of selective sorting grids used in the Norway lobster (Nephrops norvegicus) fishery

DEFF Research Database (Denmark)

Madsen, Niels; Holst, René; Frandsen, Rikke

2017-01-01

Due to generally high discard rates in Norway lobster (Nephrops norvegicus) fisheries, a discard ban coming up and to the cod recovery plan in several areas, selective sorting grids have been tested in many areas and are specified by legislation for use in the Kattegat and Skagerrak area bordering...... Norway, Denmark and Sweden. Grids are very selective, but they can lead to loss of landable Norway lobster and valuable fish species. To improve retention of these species, we developed three new grids using made by polyurethane to make them flexible: One grid had horizontal bars, one had vertical bars....... More flatfish passed the grid with horizontal bars compared to that with vertical bars, but the retention rate was still low. Use of the guiding funnel increased the contact with the grid considerably for both target and unwanted species. In all three grid designs, there were losses of Norway lobster...

Monochromatic blue light entrains diel activity cycles in the Norway lobster, Nephrops norvegicus (L. as measured by automated video-image analysis

Directory of Open Access Journals (Sweden)

Jacopo Aguzzi

2009-12-01

Full Text Available There is growing interest in developing automated, non-invasive techniques for long-lasting, laboratory-based monitoring of behaviour in organisms from deep-water continental margins which are of ecological and commercial importance. We monitored the burrow emergence rhythms in the Norway lobster, Nephrops norvegicus, which included: a characterising the regulation of behavioural activity outside the burrow under monochromatic blue light-darkness (LD cycles of 0.1 lx, recreating slope photic conditions (i.e. 200-300 m depth and constant darkness (DD, which is necessary for the study of the circadian system; b testing the performance of a newly designed digital video-image analysis system for tracking locomotor activity. We used infrared USB web cameras and customised software (in Matlab 7.1 to acquire and process digital frames of eight animals at a rate of one frame per minute under consecutive photoperiod stages for nine days each: LD, DD, and LD (subdivided into two stages, LD1 and LD2, for analysis purposes. The automated analysis allowed the production of time series of locomotor activity based on movements of the animals’ centroids. Data were studied with periodogram, waveform, and Fourier analyses. For the first time, we report robust diurnal burrow emergence rhythms during the LD period, which became weak in DD. Our results fit with field data accounting for midday peaks in catches at the depth of slopes. The comparison of the present locomotor pattern with those recorded at different light intensities clarifies the regulation of the clock of N. norvegicus at different depths.

Histomorphological study of parotid gland from young rats (Holtzman) submitted to ionizing radiation

International Nuclear Information System (INIS)

Roslindo, E.B.

1988-01-01

A study was performed on rats to verify v the effects of ionizing radiation on the structure of the parotid glands of young rats. Thirty twenty five-day old rats - Rattus norvegicus, albinus, Holtzman - with a medium body weight of 54,20 g were equally distributed in two experimental groups: group I - irradiated; group II - control. After intraperitoneal anesthetics with sodium Pentobarbital in 3% gad been applied, the group I - rats were immobilized in a dorsal position on special surgery tables. The region of the parotid glands were irradiated with a dose of 300 R, this procedure was repeated every 48 hours up to an exposition of 1200 R. The Group II - animals received a simulated treatment as control. The following conclusions may be drawn through the methodology used: the group I - rats gained body weight uniformly after the 13th day, this was not equivalent to the control group; the critical phase of glandular disorganization determined by irradiation corresponded to the experimental period of 8 days, decreasing in the subsequent days; the serous acini and the streated ducts showed to be more radium sensitive even under the use of low fractionated doses; the parotid gland showed indications of gradual morphological recovery after the last exposition to X-rays. (author)

The accumulation and retention of {sup 95m}Tc by the Norway lobster, Nephrops norvegicus L

Energy Technology Data Exchange (ETDEWEB)

Swift, D. E-mail: d.j.swift@cefas.co.uk

2001-07-01

Laboratory experiments were carried out to study bioaccumulation and determine a concentration factor (CF) for technetium ({sup 95m}Tc) in the homarid crustacean Nephrops norvegicus L. The steady state CF for accumulation from seawater was estimated to be about 2000 and the biological half-time was about 50 days. The highest tissue Tc concentrations were found in the green gland and the digestive gland. Depuration following accumulation from water was slow with a half-time of about 165 days. Tc accumulation from labelled food followed a biphasic model with one compartment containing about 94 percent of the ingested activity and with a half-time of about 1 day and the second compartment containing about 6 percent of the ingested activity with a half-time of about 56 days. Most retained activity was found in the digestive gland.

Involvement of hepatic xenobiotic related genes in bromadiolone resistance in wild Norway rats, Rattus norvegicus (Berk.)

DEFF Research Database (Denmark)

Markussen, Mette Drude; Heiberg, Ann-Charlotte; Alsbo, Carsten

2007-01-01

To examine the role of xenobiotic relevant genes in bromadiolone resistance in wild Norway rats (Rattus norvegicus) we compared the constitutive liver gene expression and expression upon bromadiolone administration in bromadiolone resistant and anticoagulant susceptible female rats using a LNA...... expressed in resistant than susceptible rats upon bromadiolone exposure. To establish how bromadiolone affected xenobiotic gene expression in the two strains we compared bromadiolone expression profiles to saline profiles of both strains. Bromadiolone mediated significant up-regulation of Cyp2e1 and Cyp3a3...... expression in the resistant rats whereas the rodenticide conferred down-regulation of Cyp2e1, Cyp3a3 and Gpox1 and induction of Cyp2c12 expression in susceptible rats. Cyp2c13 and Cyp3a2 expression were markedly suppressed in both strains upon treatment. This suggests that xenobiotic relevant enzymes play...

Larval recovery of Toxocara cati in experimentally infected Rattus norvegicus and analysis of the rat as potential reservoir for this ascarid

Directory of Open Access Journals (Sweden)

Sérgio V Santos

2009-09-01

Full Text Available Toxocara cati is a common feline parasite transmitted by the ingestion of embryonated eggs, by the transmammary route or by predation of paratenic hosts harbouring third-stage larvae in their bodies. In the present study, the larval distribution of T. cati in tissues and organs of Rattus norvegicus experimentally infected with 300 embryonated eggs was analysed. Third-stage larvae were recovered from livers, lungs, kidneys, eyes, brains and carcasses of infected rats, following tissue digestion with HCl 0.5% for 24 h at 37°C. Some differences from the known larval distribution of Toxocara canisin the same rodent species were found.

Uji Efek Ekstrak Etanol Daun Lidah Mertua (Sansevieria Trifasciata Prain) Terhadap Penurunan Kadar Gula Darah Tikus Putih Jantan Galur Wistar (Rattus Norvegicus L.) Yang Diinduksi Sukrosa

OpenAIRE

Laimeheriwa, Chornelia

2014-01-01

This study aimed to test the effect of ethanol extract Lidah Mertua leaves (Sansevieria trifasciata Prain) to decrease blood sugar levels of white male wistar (Rattus norvegicus L.) who induced sucrose. This type of research laboratory experiments using a Complete Randomized Design methods. Animal testing of this experiments is a white 15 rat males totaled are divided into 5 groups. The five groups which are a negative control group given a solution of CMC 0,5%, a positive control group was g...

ANALYSIS OF BIOMECHANICAL PARAMETERS IN COLONIC ANASTOMOSIS.

Science.gov (United States)

Iwanaga, Tiago Cavalcanti; Aguiar, José Lamartine de Andrade; Martins-Filho, Euclides Dias; Kreimer, Flávio; Silva-Filho, Fernando Luiz; Albuquerque, Amanda Vasconcelos de

2016-01-01

The use of measures in colonic anastomoses to prevent dehiscences is of great medical interest. Sugarcane molasses, which has adequate tolerability and compatibility in vivo, has not yet been tested for this purpose. To analyze the biomechanical parameters of colonic suture in rats undergoing colectomy, using sugarcane molasses polysaccharide as tape or gel. 45 Wistar rats (Rattus norvegicus albinus) were randomized into three groups of 15 animals: irrigation of enteric sutures with 0.9% saline solution; application of sugarcane molasses polysaccharide as tape; and sugarcane molasses polysaccharide as gel. The rats underwent colon ressection, with subsequent reanastomosis using polypropylene suture; they were treated according to their respective groups. Five rats from each group were evaluated at different times after the procedure: 30, 90 and 180 days postoperatively. The following variables were evaluated: maximum rupture force, modulus of elasticity and specific deformation of maximum force. The biomechanical variables among the scheduled times and treatment groups were statistically calculated. The characteristics of maximum rupture force and modulus of elasticity of the specimens remained identical, regardless of treatment with saline, polysaccharide gel or tape, and treatment time. However, it was found that the specific deformation of maximum force of the intestinal wall was higher after 180 days in the group treated with sugarcane polysaccharide gel (p=0.09). Compared to control, it was detected greater elasticity of the intestinal wall in mice treated with sugarcane polysaccharide gel, without changing other biomechanical characteristics, regardless of type or time of treatment. A aplicação de produtos em anastomoses colônicas que possam prevenir o surgimento de deiscências são de grande interesse médico. O emprego do polissacarídeo de melaço de cana-de-açúcar (Saccharum officinarum), que possui adequada tolerabilidade e compatibilidade in vivo

Growth performance and haematology of the laboratory rat, rattus norvegicus fed on protein supplements and heavy metals

International Nuclear Information System (INIS)

Omotoso, O.T.; Sanya, B.T.

2007-01-01

Laboratory rat Rattus norvegicus. fed on poultry growers mash plus additional protein supplements and some heavy metals, was studied for the growth and the haematological parameters. All the dietary supplements resulted in an increase in the growth of the rats. The rats, fed on growers mash and prawn meal showed the best growth within 7 weeks. Effects of diets were significantly, correlated at 0.01 level. Weight loss was recorded in case of all heavy Metal-laced diets, however, calcium sulphate-laced diets resulted in an increase in growth. Mercurous chloride was the most toxic salt which resulted in the greatest weight loss. Haematological analysis of rats revealed that RBC/sub s/ were higher in the case of heavy metal-laced diets than heavy metal-free diets. Generally, RBC counts were higher in females than in males within a group. Fish meal and prawn meal feeding. (author)

Dusk but not dawn burrow emergence rhythms of Nephrops norvegicus (Crustacea: Decapoda

Directory of Open Access Journals (Sweden)

Valerio Sbragaglia

2013-10-01

Full Text Available The Norway lobster, Nephrops norvegicus, can be captured by haul nets only during the emergence from its burrow. In the last few decades, an extensive field research revealed distinct diel (24-h–based catchability patterns at different depths. Laboratory experiments suggested that burrow emergence (used as a proxy of catchability is endogenously controlled via a circadian system. Results were usually presented in terms of mean effects without a quantification of inter-individual variability and arrhythmia. Here, we studied the burrow emergence of 52 adult Nephrops by an infrared actograph endowed with an artificial burrow. Animals were exposed to 12-12 h light-darkness cycle, simulating photic condition of the lower shelf. Forty-five animals showed rhythmic emergence (87%, while seven were arrhythmic (13%. Rhythmic animals were clustered according to their timing of emergence: 54% at dusk and 4% at dawn. Moreover, other animals showed fully diurnal or nocturnal emergence (10% and 19%, respectively. The comparison of our results with those derived from temporally scheduled trawling indicates that bimodal catch patterns observed in shelf populations are poorly observed during individual experiments in the laboratory, where the same light conditions are simulated. Nephrops burrow emergence seems to be the result of a mixed endogenous-exogenous control, while arrhythmia could also be present in the wild.

The in vivo antioxidant effect of vitamin C on hemogram in Paraquat treated male rats (rattus norvegicus

Directory of Open Access Journals (Sweden)

Benjamin Nnamdi Okolonkwo

2013-06-01

Full Text Available Paraquat (PQ is one of the most used herbicide globally; applied around trees in orchards and between crop rows to control broad-leaved and grassy weeds. Its oxidation results in the formation of superoxides which causes damage to cellular components. In this study, we determined the antioxidant effect vitamin C has on hemograms [hemoglobin (Hb, packed cell volume (PCV and total white blood cells count] of rats under these toxic insults. The animals grouped (A-D, comprising subgroups without vitamin C (A1, B1, C1, D1 and subgroups on vitamin C (A2, B2, C2, D2, received different sub-lethal doses of PQ administered intraperitoneally monthly to the animals over a period of three months. The Hb values obtained were significantly reduced (P≤0.05 at month 1 and (P≤0.001 at months 2 and 3. These changes became more pronounced with increased dose and time. Vitamin C treated subgroups (B2, C2 and D2 had better Hb values than those without it (B1, C1 and D1 but the values were still significantly low when compared to the control subgroups (A1 and A2. This same trend was observed in the PCV results obtained. The Control subgroups showed that vitamin C treated subgroup (A2 had a more improved hemogram values than subgroup on water only (A1, but they were all higher than that of the test subgroups. These PQ induced anaemia were ameliorated by the subsequent administration of vitamin C, and continuous treatment with vitamin C restored the health status of the animals so treated.

Efecto hipolipidémico del extracto acuoso de las hojas de Artocarpus altilis "árbol del pan" en Rattus norvegicus con hiperlipidemia inducida

OpenAIRE

Julio Campos Florián

2013-01-01

La presente investigación tuvo como objetivo demostrar la actividad hipolipidémica del extracto acuoso de las hojas del árbol del pan, Artocarpus altilis, en un modelo de hiperlipidemia aguda inducida con tritón X-305, utilizando como especímenes Rattus norvegicus machos, peso promedio 204,5 g, a los que se les administró por vía oral 0,05 g/100 g y 0,2 g/100 g del extracto acuoso de A. altilis; se incluyó un grupo control negativo que recibió solución salina fisiológica y un grupo control po...

Efecto del sulfato de sodio y sulfato de calcio en la detoxificación de los taninos presentes en la pulpa de café

Directory of Open Access Journals (Sweden)

Miguel A Marín C

2016-03-01

Full Text Available 48 white rats (Rattus norvegicus albinus with an average body weight of 118 g.from both sexes were distributed in a complete randomized design to determine the effect of 3 levels of  CaSO4 and 3 levels of Na2SO4 (0.1, 0.3 y 0.5 % detoxificant agents of the tannins present in the coffee pulp, which was included in the diet at a fixed level of 20%. The experiment last for 28 days and weight gain, feed intake and feed conversion were evaluated. On the third week, during 3 consecutive days, samples of feces were collected to perform digestibility trials of dry matter, crude protein, energy and crude fiber. The results show that any of the sulfate sources at any of the levels used had any effect on the diets with coffee pulp regarding to weight gain, feed intake and fee conversion. The digestibility of the dry matter, crude protein and energy of the diets containing pulp was improved when the 0.1% levels of CaSO4 was used. The levels of 0.3 and 0.5% of the sulfate sources in the diet did not have any positive effect on the performance of the animals; on the contrary, in some cases they caused a decrement in their performance.

Improved ovulation rate and implantation in rats treated with royal jelly

African Journals Online (AJOL)

The ovaries and uteris of 12 mature female rats (Rattus norvegicus) were examined to determine the effect of commercial royal jelly on ovulation, ovarian weight and implantation rates. Rats were split in two groups of 6 each. Group one served as the treatment and group two the control. A daily dose of 25mg of royal jelly ...

Factors affecting carriage and intensity of infection of Calodium hepaticum within Norway rats (Rattus norvegicus) from an urban slum environment in Salvador, Brazil.

Science.gov (United States)

Walker, R; Carvalho-Pereira, T; Serrano, S; Pedra, G; Hacker, K; Taylor, J; Minter, A; Pertile, A; Panti-May, A; Carvalho, M; Souza, F N; Nery, N; Rodrigues, G; Bahiense, T; Reis, M G; Ko, A I; Childs, J E; Begon, M; Costa, F

2017-01-01

Urban slum environments in the tropics are conducive to the proliferation and the spread of rodent-borne zoonotic pathogens to humans. Calodium hepaticum (Brancroft, 1893) is a zoonotic nematode known to infect a variety of mammalian hosts, including humans. Norway rats (Rattus norvegicus) are considered the most important mammalian host of C. hepaticum and are therefore a potentially useful species to inform estimates of the risk to humans living in urban slum environments. There is a lack of studies systematically evaluating the role of demographic and environmental factors that influence both carriage and intensity of infection of C. hepaticum in rodents from urban slum areas within tropical regions. Carriage and the intensity of infection of C. hepaticum were studied in 402 Norway rats over a 2-year period in an urban slum in Salvador, Brazil. Overall, prevalence in Norway rats was 83% (337/402). Independent risk factors for C. hepaticum carriage in R. norvegicus were age and valley of capture. Of those infected the proportion with gross liver involvement (i.e. >75% of the liver affected, a proxy for a high level intensity of infection), was low (8%, 26/337). Sixty soil samples were collected from ten locations to estimate levels of environmental contamination and provide information on the potential risk to humans of contracting C. hepaticum from the environment. Sixty percent (6/10) of the sites were contaminated with C. hepaticum. High carriage levels of C. hepaticum within Norway rats and sub-standard living conditions within slum areas may increase the risk to humans of exposure to the infective eggs of C. hepaticum. This study supports the need for further studies to assess whether humans are becoming infected within this community and whether C. hepaticum is posing a significant risk to human health.

Perbandingan Kecepatan Kesembuhan Luka Insisi yang Diberi Amoksisilin-Deksametason dan Amoksisilin-Asam Mefenamat pada Tikus Putih (Rattus Norvegicus

Directory of Open Access Journals (Sweden)

Ni Kadek Laura Sastrawan

2016-03-01

Full Text Available Penelitian ini bertujuan untuk mengetahui perbedaan kecepatan kesembuhan luka insisi pada tikus putih (Rattus norvegicus yang diberikan obat deksametason dan asam mefenamat ditinjau dari gambaran makroskopik dan mikroskopik. Tiga puluh ekor tikus putih jantan dengan berat 150-200 gram dibagi menjadi tiga perlakuan, yang diinsisi pada daerah linea alba dengan panjang insisi dua cm dengan kedalaman hingga menembus peritoneum. Penelitian menggunakan Rancangan Acak Lengkap (RAL. Pengamatan makroskopik dilakukan setiap hari selama 14 hari. Pada hari ketujuh dan hari ke14, lima ekor tikus dari semua kelompok dieutanasi, kemudian kulit hingga peritoneum lokasi luka insisi dikoleksi untuk pemeriksaan histopatologis. Hasil pemeriksaan makroskopik dianalis secara deskriptif dan pemeriksaan histopatologis dianalisis menggunakan uji Non Parametrik. Hasil pemeriksaan makroskopik dan mikroskopik menunjukan bahwa tikus perlakuan III memberikan efek kesembuhan luka lebih cepat dibandingkan tikus perlakuan II dan tikus perlakuan I karena efek dari peradangan terjadi lebih sedikit (minimal dan kerapatan kolagen yang lebih padat.

Técnica para preparo angioarquitetônico hepático de ratos Preparation technique for angioarquitetonic liver model in rats

Directory of Open Access Journals (Sweden)

Vitormauro Araújo da Silva

2000-09-01

Full Text Available Os métodos de injeção-corrosão são os principais métodos utilizados para o estudo da anatomia vascular do fígado. Alguns autores mencionam a técnica para estudo de fígado de cães, porcos, hamsters, coelhos e gatos, entretanto são escassos os trabalhos que mencionam o estudo da anatomia hepática de ratos. Desta forma é importante o conhecimento de novas técnicas de preparo para modelos angioarquitetônico de fígados, possibilitando um melhor conhecimento da anatomia e por conseguinte, aperfeiçoando significativamente a abordagem operatória deste órgão. Em função disso o objetivo do presente estudo é demonstrar a técnica para realização de angioarquitetura venosa do fígado de ratos. Foram utilizados 10 Rattus norvegicus albinus (Wistar, com massa corporal entre 250 e 300g, para verificar a funcionalidade do método. A técnica para preparo de modelo vascular apresenta três tempos fundamentais: cateterização da veia porta, veia cava intra-abdominal e veia cava intra-torácica; preparo e infusão da solução de acrílico; corrosão em ácido clorídrico e maceração da peça. Concluímos que, esta técnica é factível e apresenta como vantagem um baixo custo (30 dólares e com a utilização de duas cores diferentes de tinta pode-se separar o sistema vascular portal do sistema de drenagem supra-hepático, portanto sendo capaz de moldar a estrutura vascular hepática de ratos.The injection-erosion methods are the principal methods used for the study of the vascular anatomy of the liver. Some authors mention the technique for study of liver of dogs, pigs, hamsters, rabbits and cats, however they are scarce the works that mention the study of the hepatic anatomy of rats. This way it is important the knowledge of new preparation techniques for angioarquitetonic livers' models, making possible a better knowledge of the anatomy and consequently, improving the operative approach of this organ significantly. Due above of that

Interaction of haematopoietic tissue cultures of the Dublin Bay Prawn, Nephrops norvegicus (L.), with the causal agent of luminous vibriosis Vibrio harveyi

Science.gov (United States)

Mulford, A. L.; Zhang, X. H.; Xu, H. S.; Austin, B.

2002-04-01

Vibrio harveyi cells (dose—25 μmg mL-1 of total protein concentration) destroyed haematopoietic cultures of Nephrops norvegicus within 24 h of exposure. Cytopathic effects (CPE) started after 4h of exposure to the bacterial cells, with some granularity in the cytoplasm, mostly in cells in the outer periphery of the explant growth. At the end of the infection, a considerable number of nuclei remained attached to the substrate, apparently unaffected. Following exposure to ECP, initial deterioration was observed at 2 h with the presence of granularity in the cytoplasm of<20% cells, and few cells displayed small vacuoles around the nuclei. Parallel results were obtained using whole animal experiments, with V. harveyi cells being lethal to nephrops within 24 h.

FGF-2 expression and the amount of fibroblast in the incised wounds of Rattus norvegicus rats induced with Mauli banana (Musa acuminata stem extract

Directory of Open Access Journals (Sweden)

Didit Aspriyanto

2017-09-01

Full Text Available Background: Traditional wound treatment using herbal medicine is thought to maintain the health of families and society in general economically, effectively, and efficiently without inducing side effects. One genus of plant that can be used as a traditional medicine is the Mauli banana, indigenous to South Borneo. Mauli banana stem contains bioactive compounds, most of which are tannins along with ascorbic acid, saponin, β-carotene, flavonoids, lycopene, alkaloids, and flavonoids. Tanin has antibacterial and antioxidant effects at low concentrations, as wells as antifungal ones at high concentrations. Purpose: This study aimed to analyze the effects of Mauli banana stem extract at concentrations of 25%, 37.5%, and 50% on the quality of incised wound healing in male Rattus norvegicus rats by assessing FGF-2 expression and fibroblast concentration on days 3 and 7. Methods: This research represented an experimental laboratory-based investigation involving 32 rats of the Rattus norvegicus strain aged 2-2.5 months old. Sampling was performed using a simple random sampling technique since the research population was considered homogeneous and divided into 8 treatment groups (C3, M3-25, M3-37.5, M3-50, C7, M7-25, M7-37.5, M7-50. The rats in each group were anesthetized before their back was incised with length and width of 15x15mm with a depth of 2mm. Gel hydroxy propyl cellulose medium (HPMC was applied to the incised wound of each rat in the control group, while stem Mauli banana extract was applied to that of each rat in the treatment groups three times a day at an interval of 6-8 hours. On day 3, four rats from each group were sacrificed, while, in the remaining groups, the same procedure was performed until day 7, at which point they (8 groups were sacrificed for HE examination in order to assess the amount of fibroblast and for IHC examination to examine FGF-2 expression. Data regarding FGF-2 expression and the amount of fibroblast were analysed

Total arsenic in raw and boiled portions of Norway lobster (Nephrops norvegicus) from the central Adriatic Sea.

Science.gov (United States)

Visciano, Pierina; Perugini, Monia; Manera, Maurizio; Abete, Maria Cesarina; Tarasco, Renata; Salese, Carmine; Amorena, Michele

2013-12-18

The distribution of total arsenic in different portions of Norway lobster (Nephrops norvegicus L., Crustacea) was studied both in fresh samples and after a boiling process. All individuals (n = 80) were selected of medium standard commercial size (13-15 cm). The highest mean concentrations (26.86 ± 1.57 mg/kg wet weight (ww)) were found in the raw brown meat of the crustacean, probably due to its detoxification role, whereas the lowest mean values (15.97 ± 0.85 mg/kg ww) were in the raw exoskeleton. The raw white meat reported mean values of 16.09 ± 0.61 mg/kg ww. The levels of arsenic contamination detected in the boiled portions showed a significant (p < 0.01) decrease compared to the raw portions, as a consequence of solubilization phenomena. In fact, a large amount of arsenic from raw lobsters was transferred to the corresponding boiling broth. In the most commonly consumed portion, the white meat, only slight losses (7.22%) in total arsenic content were observed compared to the raw portion.

Determinación de metabolitos secundarios en Physalis angulata (L) 1758 "mullaca" y su importancia en el efecto hipoglucemiante en Rattus norvegicus "rata albina", Iquitos - Perú;

OpenAIRE

Donayre Ramirez, Marjorie Raquel; Carrasco Montañez, Daniel Diomedes

2013-01-01

El presente trabajo se desarrolló en el laboratorio de Química Analítica de la Universidad Nacional de la Amazonía Peruana (UNAP) y en el Instituto de Medicina Tradicional (IMET) de la Ciudad de !quitos - Perú. Se evaluó la actividad hipoglucemiante de los extractos, etanólico y metanólico de raíz, tallo y hoja de Physalis angulata (Linneo) "mullaca", en ratas albinas machos Rattus norvegicus cepa Holtzman, previa inducción de un estado de hiperglicemia con alloxano al 5% (125mg/kg de masa co...

Temporal modification in cardiac rhythmicity of Nephrops norvegicus (Crustacea: Decapoda in relation to trawl capture stress

Directory of Open Access Journals (Sweden)

Jacopo Aguzzi

2005-09-01

Full Text Available The effects of trawling on cardiac rhythmicity of Nephrops norvegicus (L. are still mostly unknown. Ultradian rhythms reported in previous studies may result from trawling capture stress, thus disappearing following acclimatisation to laboratory conditions. To test this hypothesis, 34 time series of cardiac activity data recorded in constant darkness were studied by Fourier analysis. Spectral decomposition of time series was obtained by defining the fundamental or circadian harmonic (CH in 24-h together with 9 submultiples of this period. The power content (PC of each harmonic was estimated in data segments of 24-h duration (days, giving graphic matrices of PC values over consecutive days. Values of PC for 9 submultiples were summed and studied in a block named ultradian band (UB. The modification in the PC of the CH and of the UB was evaluated during laboratory acclimatisation. A significant increase in the PC of the circadian harmonic component (CH over consecutive days of testing was observed. These findings suggest that, rather than being a product of dim light environmental fluctuations experienced by the animals from the deep waters of the continental slope, ultradian periodicity could well be caused by the stress of capture.

Morphologic and quantitative study of the myenteric neurons of the jejunum of malnourished rats (Rattus norvegicus Estudo morfológico e quantitativo dos neurônios mientéricos do jejuno de ratos desnutridos (Rattus norvegicus

Directory of Open Access Journals (Sweden)

MARCÍLIO HUBNER DE MIRANDA NETO

1999-06-01

Full Text Available We studied the effects of maternal proteic desnutrition on the neurons of the myenteric plexus of the jejunum of rats from Rattus norvegicus species. It was used litters of female rats which received diet with normal proteic level during gestation and lactation (group NN, normal diet during gestation and hypoproteic diet during lactation (group ND; hypoproteic diet during gestation and normal diet during lactation (group DN; hypoproteic diet during both gestation and lactation (group DD. After weaning all the animals received diet of normal proteic level until the 60th day of age, when they were killed. The jejunum of the animals was subjected to whole-mount preparations stained by the method of Giemsa and used for the morphologic and quantitative analyses of the neurons of the myenteric plexus. We verified that maternal proteic malnutrition does not cause decrease on the number of myenteric neurons per unit area of jejunum in rats, but elicits mechanisms which assure that, when the animal again receives normal proteic level diet (22% there occurs storage of proteic material on the cytoplasm of the neurons, thus rendering them larger and strongly basophylic.Estudamos os efeitos da desnutrição protéica materna sobre os neurônios do plexo mientérico do jejuno de ratos da espécie norvegicus. Utilizamos filhotes de ratas que receberam dieta com teor protéico normal durante a gestação e a lactação (grupo NN, dieta normoprotéica durante a gestação e hipoprotéica durante a lactação (grupo ND; dieta hipoprotéica durante a gestação e normoprotéica durante a lactação (grupo DN; dieta hipoprotéica durante a gestação e lactação (grupo DD. Após o desmame todos os animais receberam dieta com teor protéico normal até os 60 dias de vida ocasião em que foram sacrificados. Preparados de membrana do jejuno foram corados pelo método de Giemsa e foram utilizados para análises morfológicas e quantitativas dos neurônios do plexo

Interaction of Haematopoietic Tissue Cultures of the Dublin Bay Prawn,Nephrops Norvegicus(L.),with the Causal Agent of Luminous Vibriosis Vibrio Harveyi

Institute of Scientific and Technical Information of China (English)

Mulford A.L.; ZHANG X.H.; XU H. S.; Austin B.

2002-01-01

Vibrio harveyi cells (dose = ＞ 103 cells mL 1) and extracellular products (ECP; ＞25μg m L-1 of total protein concentration) destroyed haematopoietic cultures of Nephrops norvegicus within 24 h of exposure. Cytopathic effects (CPE)started after 4 h of exposure to the bacterial cells, with some granularity in the cytoplasm, mostly in cells in the outer periphery of the explant growth. At the end of the infection, a considerable number of nuclei remained attached to the substrate,apparently unaffected. Following exposure to ECP, initial deterioration was observed at 2 h with the presence of granularity in the cytoplasm of＜ 20% cells, and few cells displayed small vacuoles around the nuclei. Parallel results were obtained using whole animal experiments, with V. harveyi cells being lethal to nephrops within 24 h.

A Two-Year Ecological Study of Norway Rats (Rattus norvegicus) in a Brazilian Urban Slum.

Science.gov (United States)

Panti-May, Jesús A; Carvalho-Pereira, Ticiana S A; Serrano, Soledad; Pedra, Gabriel G; Taylor, Josh; Pertile, Arsinoê C; Minter, Amanda; Airam, Vladimir; Carvalho, Mayara; Júnior, Nivison N; Rodrigues, Gorete; Reis, Mitermayer G; Ko, Albert I; Childs, James E; Begon, Mike; Costa, Federico

2016-01-01

The Norway or brown rat (Rattus norvegicus) is among the most ubiquitous of rodents. However, the lack of studies describing Norway rat populations from tropical areas have limited our understanding regarding their demography and seasonal dynamics. In this study, we describe seasonal pattern in the abundance, reproductive parameters, and morphometrics of Norway rat populations in Salvador, Brazil. Rodents were trapped over four seasonal trapping periods (2013-2014) from three valleys. A total of 802 Norway rats were trapped over the course of the study over 7653 trap-nights. Norway rat abundance was high, but there was no significant differences between seasons. The reproductive parameters (e.g. frequency of pregnant and lactating females) did not show statistical differences between seasons. Female rats collected in the rainy season were heavier and older than females from the dry season. Salvador rats had a high incidence of pregnancy and birth rate (estimated birth rate of 79 young per year) compared to previous studies. The information generated is critical for the understanding of the ecology of Norway rat, the main reservoir of Leptospira in Salvador. However, future studies examining the effect of rodent control programs aimed at reducing populations, and determining rates of recovery, will further clarify our understanding of population dynamics.

Pengaruh Antikoagulan dan Waktu Penyimpanan Terhadap Profil Hematologis Tikus (Rattus norvegicus Berkenhout, 1769 Galur Wistar

Directory of Open Access Journals (Sweden)

Laksmindra Fitria

2017-06-01

Full Text Available Darah merupakan komponen penting karena menunjukkan kondisi fisiologis individu. Oleh  karena  itu  darah  menjadi salah  satu  parameter  pokok  dalam penelitian praklinik/ biomedik. Hematologi merupakan ilmu yang mempelajari kondisi sel-sel darah perifer dalam kondisi normal maupun patologis. Parameter pemeriksaan hematologis yang rutin dilakukan antara lain profil eritrosit dan leukosit. Sampel darah yang diterima kadangkala tidak langsung diperiksa karena berbagai alasan. Untuk menjaga supaya kondisinya tidak rusak, maka sampel darah ditambah antikoagulan dan disimpan di dalam lemari pendingin selama beberapa jam hingga beberapa hari. Penelitian ini bertujuan untuk mempelajari profil eritrosit dan leukosit pada sampel darah tikus (Rattus norvegicus Berkenhout, 1769 Galur Wistar yang sehat/normal dengan antikoagulan EDTA atau Heparin dan variasi waktu penyimpanan (0, 6, 18, 24, dan 48 jam. Untuk pembahasan lebih lanjut, data dianalisis secara statistik berdasarkan ANOVA two-factor (P0,05. Disimpulkan bahwa pemeriksaan profil hematologis yang terbaik adalah menggunakan darah tanpa antikoagulan namun harus langsung dilakukan segera setelah sampel diperoleh (sebelum darah mengalami koagulasi. Apabila tidak memungkinkan, maka dapat digunakan EDTA atau Heparin, dan jenis antikoagulan harus dijelaskan dalam pelaporannya. Pemeriksaan darah dengan antikoagulan hendaknya juga tetap dilakukan segera setelah sampel diterima (tidak ditunda.

Structure of the GH1 domain of guanylate kinase-associated protein from Rattus norvegicus

International Nuclear Information System (INIS)

Tong, Junsen; Yang, Huiseon; Eom, Soo Hyun; Chun, ChangJu; Im, Young Jun

2014-01-01

Graphical abstract: - Highlights: • The crystal structure of GKAP homology domain 1 (GH1) was determined. • GKAP GH1 is a three-helix bundle connected by short flexible loops. • The predicted helix α4 associates weakly with the helix α3, suggesting dynamic nature of the GH1 domain. - Abstract: Guanylate-kinase-associated protein (GKAP) is a scaffolding protein that links NMDA receptor-PSD-95 to Shank–Homer complexes by protein–protein interactions at the synaptic junction. GKAP family proteins are characterized by the presence of a C-terminal conserved GKAP homology domain 1 (GH1) of unknown structure and function. In this study, crystal structure of the GH1 domain of GKAP from Rattus norvegicus was determined in fusion with an N-terminal maltose-binding protein at 2.0 Å resolution. The structure of GKAP GH1 displays a three-helix bundle connected by short flexible loops. The predicted helix α4 which was not visible in the crystal structure associates weakly with the helix α3 suggesting dynamic nature of the GH1 domain. The strict conservation of GH1 domain across GKAP family members and the lack of a catalytic active site required for enzyme activity imply that the GH1 domain might serve as a protein–protein interaction module for the synaptic protein clustering

Low prevalence of human enteropathogenic Yersinia spp. in brown rats (Rattus norvegicus in Flanders.

Directory of Open Access Journals (Sweden)

Lieze Oscar Rouffaer

Full Text Available Brown rats (Rattus norvegicus have been identified as potential carriers of Yersinia enterocolitica and Y. pseudotuberculosis, the etiological agents of yersiniosis, the third most reported bacterial zoonosis in Europe. Enteropathogenic Yersinia spp. are most often isolated from rats during yersiniosis cases in animals and humans, and from rats inhabiting farms and slaughterhouses. Information is however lacking regarding the extent to which rats act as carriers of these Yersinia spp.. In 2013, 1088 brown rats across Flanders, Belgium, were tested for the presence of Yersinia species by isolation method. Identification was performed using MALDI-TOF MS, PCR on chromosomal- and plasmid-borne virulence genes, biotyping and serotyping. Yersinia spp. were isolated from 38.4% of the rats. Of these, 53.4% were designated Y. enterocolitica, 0.7% Y. pseudotuberculosis and 49.0% other Yersinia species. Two Y. enterocolitica possessing the virF-, ail- and ystA-gene were isolated. Additionally, the ystB-gene was identified in 94.1% of the other Y. enterocolitica isolates, suggestive for biotype 1A. Three of these latter isolates simultaneously possessed the ail-virulence gene. Significantly more Y. enterocolitica were isolated during winter and spring compared to summer. Based on our findings we can conclude that brown rats are frequent carriers for various Yersinia spp., including Y. pseudotuberculosis and (human pathogenic Y. enterocolitica which are more often isolated during winter and spring.

Structure of the GH1 domain of guanylate kinase-associated protein from Rattus norvegicus

Energy Technology Data Exchange (ETDEWEB)

Tong, Junsen; Yang, Huiseon [College of Pharmacy, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Eom, Soo Hyun [School of Life Sciences, Steitz Center for Structural Biology, and Department of Chemistry, Gwangju Institute of Science and Technology, Gwangju 500-712 (Korea, Republic of); Chun, ChangJu, E-mail: cchun1130@jnu.ac.kr [College of Pharmacy, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Im, Young Jun, E-mail: imyoungjun@jnu.ac.kr [College of Pharmacy, Chonnam National University, Gwangju 500-757 (Korea, Republic of)

2014-09-12

Graphical abstract: - Highlights: • The crystal structure of GKAP homology domain 1 (GH1) was determined. • GKAP GH1 is a three-helix bundle connected by short flexible loops. • The predicted helix α4 associates weakly with the helix α3, suggesting dynamic nature of the GH1 domain. - Abstract: Guanylate-kinase-associated protein (GKAP) is a scaffolding protein that links NMDA receptor-PSD-95 to Shank–Homer complexes by protein–protein interactions at the synaptic junction. GKAP family proteins are characterized by the presence of a C-terminal conserved GKAP homology domain 1 (GH1) of unknown structure and function. In this study, crystal structure of the GH1 domain of GKAP from Rattus norvegicus was determined in fusion with an N-terminal maltose-binding protein at 2.0 Å resolution. The structure of GKAP GH1 displays a three-helix bundle connected by short flexible loops. The predicted helix α4 which was not visible in the crystal structure associates weakly with the helix α3 suggesting dynamic nature of the GH1 domain. The strict conservation of GH1 domain across GKAP family members and the lack of a catalytic active site required for enzyme activity imply that the GH1 domain might serve as a protein–protein interaction module for the synaptic protein clustering.

Evaluation of the Effects of Atorvastatin and Ischemic Postconditioning Preventing on the Ischemia and Reperfusion Injury: Experimental Study in Rats

Directory of Open Access Journals (Sweden)

Henrique Budib Dorsa Pontes

Full Text Available Abstract Introduction: Reperfusion injury leads to systemic morphological and functional pathological alterations. Some techniques are already estabilished to attenuate the damage induced by reperfusion. Ischemic preconditioning is one of the standard procedures. In the last 20 years, several experimental trials demonstrated that the ischemic postconditioning presents similar effectiveness. Recently experimental trials demonstrated that statins could be used as pharmacological preconditioning. Methods: 41 Wistar rats (Rattus norvegicus albinus were distributed in 5 groups: Ischemia and Reperfusion (A, Ischemic Postconditioning (B, Statin (C, Ischemic Postconditioning + Statins (D and SHAM (E. After euthanasia, lungs, liver, kidneys and ileum were resected and submitted to histopathological analysis. Results: The average of lung parenchymal injury was A=3.6, B=1.6, C=1.2, D=1.2, E=1 (P=0.0029. The average of liver parenchymal injury was A=3, B=1.5, C=1.2, D=1.2, E = 0 (P<0.0001. The average of renal parenchymal injury was A=4, B=2.44, C=1.22, D=1.11, E=1 (P<0.0001. The average of intestinal parenchymal injury was A=2, B=0.66, C=0, D=0, E=0 (P=0.0006. The results were submitted to statistics applying Kruskal-Wallis test, estabilishing level of significance P<0.05. Conclusion: Groups submitted to ischemic postconditioning, to pre-treatment with statins and both methods associated demonstrated less remote reperfusion injuries, compared to the group submitted to ischemia and reperfusion without protection.

Репродуктивная функция семенников крыс после семидневной адаптации к низким температурам по данным морфологического анализа

OpenAIRE

Саяпина, Ирина; Огородникова, Татьяна

2013-01-01

В статье приведены результаты исследований генеративной функции семенников крыс Rattus norvegicus Albinus после семидневной адаптации к низким температурам. Было установлено, что в семенниках развиваются выраженные нарушения сперматогенеза, обусловленные развитием общего адаптационного синдрома...

Closed head injury in rats: histopathological aspects in an experimental weight drop model Trauma craniano fechado em ratos: aspectos histopatológicos em um modelo experimental de queda de peso

Directory of Open Access Journals (Sweden)

Danilo dos Santos Silva

2012-04-01

Full Text Available PURPOSE: To study histopathological findings due to a model of closed head injury by weight loss in rats. METHODS: A platform was used to induce closed cranial lesion controlled by weight loss with a known and predefined energy. 25 male Wistar rats (Rattus novergicus albinus were divided in five equal groups which received different cranial impact energy levels: G1, G2, G3 and G4 with 0.234J, 0.5J, 0.762J and 1J respectively and G5 (Sham. Under the effect of analgesia, the brain of each group was collected and prepared for histopathological analysis by conventional optic microscopy. RESULTS: It was observed greater number of injured neurons in animals of group 4, however neuronal death also could be noticed in animals of group 5. Intraparenchymal hemorrhages were more frequent in animals of group 4 and the cytotoxic brain swelling and vascular congestion were more intense in this group CONCLUSION: The histopathological analysis of these findings allowed to observe typical cranial trauma alterations and these keep close relation with impact energy.OBJETIVO: Investigar as alterações histopatológicas produzidas por um modelo de trauma craniano fechado por queda de peso em ratos. MÉTODOS: Utilizando uma plataforma para produção de lesão craniana fechada controlada por queda de peso com energia pré-definida e conhecida, 25 ratos Wistar machos (Rattus norvegicus albinus foram divididos em cinco grupos iguais que receberam níveis diferentes de energia de impacto craniano: G1, G2, G3 e G4 com 0,234J, 0,5J, 0,762J e 1J respectivamente e G5 (Sham. Sob analgesia, cada grupo teve seus encéfalos coletados e processados para análise histopatológica por microscopia óptica convencional. RESULTADOS: Houve maior número de neurônios lesados em animais do grupo 4, mas morte neuronal também pôde ser constatada nos animais do grupo 5. Hemorragias parenquimatosas foram mais frequentes nos animais do grupo 4 e o inchaço cerebral citotóxico e congest

Characterization of Bromadiolone Resistance in a Danish Strain of Norway Rats, Rattus norvegicus, by Hepatic Gene Expression Profiling of VKORC1 and Calumenin

DEFF Research Database (Denmark)

Markussen, Mette Drude; Heiberg, Ann-Charlotte; Fredholm, Merete

2007-01-01

Anticoagulant agents, such as warfarin and bromadiolone, are used to control populations of Norway rats (Rattus norvegicus). The anticoagulants compromise the blood-coagulation process by inhibiting the vitamin K2,3 epoxide reductase enzyme complex (VKOR). Mutations in the VKORC1 gene, encoding...... (with an Y139C-VKORC1 mutation), we compared VKORC1 and calumenin liver gene expression between resistant and anticoagulant-susceptible rats upon saline and bromadiolone-administration. Additionally, we established the effect of bromadiolone on VKORC1 and calumenin expression in the two rat strains....... Bromadiolone had no effect on gene expression in resistant rats but significantly induced calumenin expression in susceptible rats. Calumenin expression was similar between resistant and susceptible rats upon saline administration but two-fold lower in resistant rats upon bromadiolone-treatment. These results...

PENGARUH PEMBERIAN MONOSODIUM GLUTAMAT (MSG PADA TIKUS JANTAN (Rattus Norvegicus TERHADAP FSH DAN LH

Directory of Open Access Journals (Sweden)

Zulkarnain Edward

2010-09-01

post only group design, take place in Biology Laboratorium and Biochemistry, Faculty of Medicine Andalas University in December 20th, 2009 until Februari 30th, 2010. The population is the white rat strain Japan (Rattus Norvegicus taken from Faculty of Mathematic and Natural Sciences Andalas University. There are 20 samples devided into 4 groups with 1 group controller and three treated groups. P1=4800 mg/kgbw/day, P2=7200 mg/kgbw/day and P3=9600 mg/kgbw/day used as MSG dose, given orally about two seminiferus epitel cycles. The analysis by Anova test with 95% of trust and if there would sense of in meaning, continued with Multiple Comparissons test, kind of Bonferroni.The result of the research taken that the MSG given with 4800 mg/kgbw/day, 7200 mg/kgbw/day and 9600 mg/kgbw/day showed the significant effect to FSH (p=0,000 and LH (p=0,000, but for the Multiple Comparissons Bonferroni test between groups in FSH, there were not yet have the meaning in effect (p>0,05 then to LH for the treated groups, between P1, P2 there were not any significant differences (p>0,05 P1 and P3 got the significant differenciates (p<0,05 and P2 with P3 got the significant effect (p<0,05.The research concluded that the MSG given for the male rat could decrease the FSH and LH. Suggested to do the following research to find the minimal dose change level FSH and LH.Key word : MSG, FSH, LH

Effect of an indigenous herbal compound preparation 'Trikatu' on the lipid profiles of atherogenic diet and standard diet fed Rattus norvegicus.

Science.gov (United States)

Sivakumar, Valsala; Sivakumar, S

2004-12-01

Combating heart disease is one of the challenging problems of biomedical science today. Towards this goal an indigenous preparation 'Trikatu' (a herbal combination containing Piper longum (fruit), Piper nigrum (fruit) and Zingiber officinale (rhizome) dry powder) was fed to normal and cholesterol fed male Rattus norvegicus to ascertain its efficacy as a hypolipidaemic agent. Its effects on body weight, blood and tissue (aortic, cardiac and hepatic) lipids--total, free and esterified cholesterol, low density lipoprotein(LDL) and high density lipoprotein(HDL) cholesterol, triglycerides and phospholipids--and the atherogenic index were measured. It was found that 'Trikatu' by virtue of its ability to reduce triglycerides and LDL cholesterol and to increase HDL cholesterol can reduce the risk of hyperlipidaemia and atherosclerosis. Hence 'Trikatu' can be used as a potent hypolipidaemic agent and it can reduce the atherosclerosis associated with a high fat diet. 2004 John Wiley & Sons, Ltd.

Expression of vascular endothelial growth factor and matrix metalloproteinase-9 in Apis mellifera Lawang propolis extract gel-treated traumatic ulcers in diabetic rats

Directory of Open Access Journals (Sweden)

Diah Savitri Ernawati

2018-03-01

Full Text Available Aim: The aim of this study was to determine the effect of Apis mellifera propolis extract gel on vascular endothelial growth factor (VEGF and matrix metalloproteinase-9 (MMP-9 expression in the traumatic ulcers of rats afflicted with diabetes mellitus (DM. Materials and Methods: The study was conducted on 24 male Wistar rats (Rattus norvegicus induced with DM by injecting 50 mg/kg of Streptozotocin, intraperitoneally, and a traumatic ulcer on their lower lip mucosa. These were divided into eight groups: Four each for control and treatment groups. Each control and treatment group consisted of three rats. The control groups treated with hydroxypropyl methylcellulose 5% gel and treatment groups were administered with propolis extract gel. The expression of VEGF and MMP-9 was observed on days 3, 5, 7, and 9. Furthermore, mice sacrificed and the lower lip labial mucosa tissue of mice has been taken to make the histopathology anatomy preparation by means of immunohistochemical examination with monoclonal antibodies anti-VEGF and anti-MMP-9. Results: This experiment revealed higher VEGF expression and lower MMP-9 expression in the treatment group as compared to that of the control group. Analysis of Variance showed significant differences (p<0.01 of both VEGF expression and MMP-9 expression between the two groups. A Tukey's analysis did not find strong contrasts in VEGF and MMP-9 expressions between various treatment groups. However, those between treatment and control groups were found to be considerable. Conclusion: Propolis extract gel increased the expression of VEGF and decreased that of MMP-9 during the healing process of traumatic ulcers on the oral mucosa of diabetes afflicted Wistar rats (R. norvegicus.

Uji teratogenik ekstrak Pandanus conoideus varietas buah kuning terhadap perkembangan embrio tikus putih (Rattus norvegicus

Directory of Open Access Journals (Sweden)

LINTAL MUNA

2011-11-01

Full Text Available Muna L, Astirin OP, Sugiyarto. 2011. Uji teratogenik ekstrak Pandanus conoideus varietas buah kuning terhadap perkembangan embrio tikus putih (Rattus norvegicus. Bioteknologi 8: 65-77. Penelitiian ini betujuan untuk mengkaji pengaruh pemberian ekstrak Pandanus conoideus Lam. var. buah kuning terhadap persentase fetus hidup, kematian intrauterus, berat dan panjang fetus, keadaan morfologi fetus, serta struktur skeleton fetus tikus putih. Dalam penelitian ini diggunakan 25 tikus bunting yang dibagi menjadi lima kelompok secara acak, sehingga masing-masing kelompok terdiri dari lima ekor tikus. Setiap kelompok diberi dosis yang berbeda. P1 (kontrol diberi 1 mL minyak wijen, P2 , P3, P4 dan P5 diberi ekstrak masing-masing: 0,02 mL, 0,04 mL, 0,08 mL dan 0,16 mL. Ekstrak tersebut diberikan secara oral pada kebuntingan hari ke 5 sampai hari ke 17 (fase organogenesis. Pengamatan dilakukan pada hari ke 18 dengan cara bedah sesar untuk menggambil fetus dari uterus. Morfologi fetu s diamati setelah fetus dikeluarkan dari uterus, sedangkan untuk pengamatan struktur skeleton dibuat preparat wholemount dengan pewarnaan ganda Alcian blue dan Allizarrin Red-S. Hasil percobaan diianalisis dengan ANAVA satu jalur. Hasil penelitiann menunjukkan bahwa pemberian ekstrak tidak berpengaruh terhadap persentase fetus hidup, kematian intrauterus, serta berat dan panjang fetus (P≥0,05. Pemberian ekstrak pada induk mengakibatkan kecacatan skeleton (lordosis fetus pada dosis 0,16 mL dan menghambat osifikasi fetus.

Possible use of wild-living rats (Rattus norvegicus) as bioindicators for heavy metal pollution. Part 2. Body burden calculations for identification of depot compartments; Untersuchungen zur Eignung wildlebender Wanderratten (Rattus norvegicus) als Indikatoren der Schwermetallbelastung. Teil 2. Die Berechnung der Koerperlast zur Identifikation von Depotkompartimenten

Energy Technology Data Exchange (ETDEWEB)

Wuenschmann, S. [Internationales Hochschulinstitut Zittau, Lehrstuhl Umweltverfahrenstechnik, Zittau (Germany); Hochschule Zittau/Goerlitz, Fachbereich Mathematik/Naturwissenschaften, Zittau (Germany); Oehlmann, J. [J.W. Goethe-Univ. Frankfurt, Zoologisches Inst., Frankfurt/M. (Germany); Delakowitz, B. [Hochschule Zittau/Goerlitz, Fachbereich Mathematik/Naturwissenschaften, Zittau (Germany); Markert, B. [Internationales Hochschulinstitut Zittau, Lehrstuhl Umweltverfahrenstechnik, Zittau (Germany)

2002-07-01

Background concentrations of eleven elements in tissues and organs of wild-living rats (Rattus norvegicus) obtained from a region (Euroregion Neisse, around the trilateral border region of Germany, Poland and the Czech Republic) distinguished by low to intermediate levels of environmental contaminations are given in part I of this work. In order to identify the most important depot compartments for certain elements, a body burden method was applied. Differences of affinity due to sex and age of analyzed rats are discussed, as are the suitability of specific organs and tissues with regard to bioaccumulation measurements concerning metals. The principal depot compartments for the heavy metals Cu, Mn, Cd, (in adult rats) and Tl are the liver and kidneys, whereas the elements Ni, Sr, Pb (for adult animals) and Ti are more affinitively to bones. Co and Zn displayed a more pronounced affinity towards tissues of the bones and liver. The analysis revealed large differences in Cd and Pb distributions both among young and adult rats, and with respect to sexes. It can be concluded that the distribution of the elements investigated in this study in free-living rats agrees with that in man, except for that of Ni. The above agreement gives proof of the possibility to use depot organs of rats for bioindication which was already mentioned in part I of this work. (Sex and age-related quantification of Al, As, Cd, Co, Cu, Mn, Ni, Pb, Sr, Ti, Tl and Zn in liver, heart, lung, kidney, muscle, brain and bones and establishment of distribution patterns'). (orig.) [German] Die in Teil I quantifizierten Hintergrundkonzentrationen von 11 Elementen in Geweben und Organen wildlebender Ratten (Rattus norvegicus) aus einem gering bis maessig belasteten Untersuchungsgebiet (Euroregion Neisse) werden im 2. Teil fuer die Berechnung ihres relativen Beitrags zur Gesamtkoerperbelastung (Koerperlast oder Bodyburden) verwendet, um bevorzugte Depotkompartimente fuer die untersuchten Elemente

Histological investigation of a 10% metronidazole and 2% lidocaine dressing on wound healing in rats.

Science.gov (United States)

Rodrigues, T S; Poi, W R; Panzarini, S R; Bezerra, C S; Silva, J L

2006-01-01

Alveolitis is considered a disturbance of the alveolar healing process that is characterized by blood clot disintegration, alveolar wall infection and extreme pain. Several substances have been investigated to improve healing and guarantee postoperative comfort to patients. The aim of this study was to evaluate, microscopically, in rats, the healing process in non-infected tooth sockets, after application of a 10% metronidazole and 2% lidocaine dressing, using lanolin as vehicle and mint as flavoring. Forty-five rats (Rattus norvegicus albinus, Wistar) had their right incisor extracted and were randomly assigned to 3 groups (n=15): Group I (control): the sockets were filled with blood clot; Group II: application of adrenaline solution at 1:1 000 with an absorbent paper point during 1 min plus filling of the socket with a 10% metronidazole and 2% lidocaine dressing, with lanolin as vehicle, and mint as flavoring; Group III: filling of the socket with the 10% metronidazole and 2% lidocaine dressing, with lanolin as vehicle and mint as flavoring. After 6, 15 and 28 days postoperatively, 5 animals per group were euthanized with an injectable anesthetic overdose. Histological and statistical analyses were performed. The results showed that the 10% metronidazole and 2% lidocaine dressing with lanolin as vehicle and mint as flavoring yielded similar response as that of the normal repair group and may be used to prevent the onset of alveolitis in those cases in which any predisposing factor is present. The use of this dressing has shown a good postoperative patient's comfort and does not cause a significant delay in the alveolar healing process.

Viabilidade celular da mucosa do intestino delgado de ratos, após correção de choque hipovolêmico com solução de NaCl 7,5%

Directory of Open Access Journals (Sweden)

Brito Marcus Vinicius Henriques

2003-01-01

Full Text Available OBJETIVO: Estudar o efeito da correção volêmica com diferentes tipos de solução, na mucosa do intestino delgado de ratos. MÉTODOS: Foram utilizados 120 ratos Wistar (Rattus norvegicus albinus, machos, adultos, com peso individual entre 310 e 410g, oriundos do Instituto Evandro Chagas de Belém do Pará, submetidos a período de adaptação por 15 dias, recebendo água e ração ad libitum, durante todo o experimento. Os animais foram distribuídos em: Grupo Padrão (P, Grupo Choque (C, Grupo Solução Fisiológica (SF e Grupo Solução Hipertônica (SH, com 30 animais cada. Estes foram divididos em subgrupos com 10 animais cada, de acordo com o dia de pós-operatório (DPO previsto para a eutanásia dos animais, (1masculine, 3masculine ou 7masculine DPO, sendo após esta, colhido material para realização de teste de absorvância pelo MTT em todos os animais. RESULTADOS: O grupo SF apresentou menores índices de viabilidade celular comparado aos grupos SH e C (p<0.05. CONCLUSÃO: A correção volêmica com solução de cloreto de sódio a 7.5% levou a manutenção de maior quantidade de células viáveis, no intestino delgado em ratos no 7masculine dia do experimento.

The change in cholesterol content of long chain fatty acid egg during processing and its influence to the Rattus norvegicus L. blood cholesterol content

Directory of Open Access Journals (Sweden)

Dini Hardini

2006-12-01

Full Text Available Egg containing long chain unsaturated fatty acids is a functional food, because it is highly nutritious and could prevent diseases, (omega 3 and 6 such as coronary heart attack. The research was aimed to measure the change of egg cholesterol content during proceesing: frying, oiless frying and boiling and their influence to the blood plasma cholesterol of normal and hypercholesterolemia rat. Seven treatments of egg yolk were frying at 170°C for 3 min (welldone = GM, and 1min (half medium fried = GSM using deep fryer , oilless frying at 70°C for10 min (fried = TM, and 6 min (half fried = TSM using Teflon pan, and boiling at 100°C for 10’ (boiled = RM dan 4 min (half boiled = RSM using pan provided with thermoregulator and a fresh omega egg as a control. The Completely randomized design was apllied for 4 weeks research period. The data from different treatments were analyzed by Orthogonal Contrast. Fifty 2 months old male rats Rattus norvegicus L. separated in 2 groups; normal and hypercholesterolemia (blood cholesterol > 200 mg dl-1. The rats were placed in individual cage, fed 15 g h-1 day-1 and water drinking ad libitum. The ration was composed of 90% basal commercial feed BR II and 10% egg yolk was given to each animal at 20% of live weight. Factorial 2 x 7 of completely randomized design was applied. The data were analyzed by ANOVA and Duncan’s Multiple Range Test. Processsing method of egg affected to cholesterol content of egg, The lowest and the highest cholesterol contents were observed in TSM (0.30 g/100g and GM (0.37 g/100g, respectively. Biological test using Rattus norvegicus L rat showed that either fresh and processed long chain fatty acid egg decreased plasma cholesterol. The highest and the lowest decreases of cholesterol content were found in the group consumed RSM (8.64% and GM (1.77% for normal rat; and control (46.3% followed by RSM (44.53% and GM (24.86%, respectively. To maintain normal cholesterol and decrease

Clinical Procedures Training for Veterinary Technicians and Investigators using Common Laboratory Animal Species, including: Mice (Mus musculus), Rats (Rattus norvegicus), Hamsters (Mesocricetus auratus), Guinea Pigs (Gavia porcellus), Rabbits (Otyctolagus cuniculus), Ferrets (Mustela putorius furo), Pigs (Sus scrofa), Sheep (Ovis aries), and Goats (Capra hircus)

Science.gov (United States)

2016-08-30

60th Medical Group (AMC), Travis AFB, CA INSTITUTIONAL ANIMAL CARE AND USE COMMITTEE (IACUC) FINAL REPORT SUMMARY (Please !ml all information. Use...Technicians and Investigators using Common Laboratory Animal Species, including: Mice (Mus muscu/us), Rats (Rattus norvegicus), Hamsters (Mesocricetus auratus...DATE: 14 November 2016 FUNDING SOURCE: SG O&M funds LAST TRIENNIAL REVISION DATE: 15 October 2015 1. RECORD OF ANIMAL USAGE: Animal Species: Total

Green Tea Extract (Camellia sinensis L. Effects on Uric Acid Levels on Hyperuricemia Rats (Rattus norvegicus

Directory of Open Access Journals (Sweden)

Putranty Widha Nugraheni

2017-09-01

Full Text Available Uric acid is the end product of purine degradation. When uric acid levels exceed normal limits, it will build up and cause hyperuricemia. Allopurinol is one of the most effective and common medicine for hyperuricemia, but it brings serious side effects, therefore it is needed alternative therapy for hyperuricemia. One plant that may be expected to low uric acid levels is green tea (Camellia sinensis L., that contains many antioxidants polyphenols, especially flavonoids. Flavonoid has strong antioxidant properties, act as free radical and metal scavengers, and also xanthine oxidase (XOD inhibitors. This study investigates the potential of green tea using various doses of 150 mg/kg, 300 mg/kg, and 600 mg/kg of body weight in 24 white male rats (Rattus norvegicus Wistar strain that has been received high purine diet in 60 consecutive days. This study used DHBSA methods to measure uric acid levels in blood serum and urine that excreted 8 hours before surgery. Green tea extract that contains polyphenol can inhibit XOD activities, therefore, it leads to decrease uric acid level in blood and increase the excretion through urine by modulating urate gene transporter. A therapy with 600 mg/kg body weight of GTE is the most effective dose to decrease uric acid levels in serum and to increase excretion of exceeding uric acid significantly (p < 0.01, from One Way ANOVA and Tukey analysis.

Efeitos das fontes e níveis de lipídios nas dietas de ratos machos da linhagem wistar (rattus norvegicus sobre frações lipídicas do sangue Effect of source and level of fat in the diet of wistar rats (rattus norvegicus on lipoidal fractions in the serum

Directory of Open Access Journals (Sweden)

Cecília Sandra Nunes Morais

2003-10-01

Full Text Available Foram estudadas quatro fontes lipídicas (óleo de soja, óleo de canola, azeite de oliva e gordura suína em dois níveis na dieta (7 e 14%, verificando a influência do consumo dessas fontes lipídicas sobre algumas frações lipídicas do sangue de ratos. Assim, oito grupos de ratos machos da linhagem Wistar (Rattus norvegicus foram alimentados ad libitum por 56 dias com oito dietas distintas contendo as fontes e níveis citados de lipídios. As dosagens de colesterol total e triacilgliceróis no soro foram realizadas pelo método colorimétrico/enzimático utilizando "kit" comercial específico. O colesterol em HDL foi determinado por precipitação dos quilomícrons, VLDL e LDL, utilizando também "kit" específico. O aumento de lipídios na dieta para 14% elevou os valores de colesterol total, HDL-colesterol e LDL+VLDL-colesterol séricos, quando a fonte foi a gordura suína. Com 14% de lipídios na dieta, os menores valores de triacilgliceróis séricos foram observados nas fontes lipídicas óleo de soja e canola, com valores de 76,09 e 84,42 mg/dL, respectivamente.Four fat sources (soybean oil, canola oil, olive oil, swine fat were evaluated with regard to their influence, at two levels in the diet (7 and 14%, on some fat fractions in rats' blood. Thus, eight groups of Wistar rat (Rattus norvegicus males were ad libitum fed eight different diets, containing the fat and level reported, for 56 days. The dosages of total serum cholesterol and thriacylglicerols were performed by the colorimetric/enzymatic method utilizing a commercial specific kit. The HDL cholesterol was determined by precipitation of kilomicra (VLDL and LDL by utilizing also a specific kit. The increase of fat in the diet to 14% raised the total cholesterol contents, serum HDL cholesterol and LDL + VLDL cholesterol when the source was swine fat. With 14% of fat in the diet, the lowest values of serum triacylglycerols were found for the fat sources soybean and canola oils

Effect of six antiretroviral drugs (delavirdine, stavudine, lamivudine, nelfinavir, amprenavir and lopinavir/ritonavir in association) on albino pregnant rats (Rattus norvegicus Albinus, Rodentia, Mammalia): biological assay.

Science.gov (United States)

Nakamura, M U; Araujo Júnior, E; Simões, J M; Oliveria, R M Filho; Kulay, L Júnior

2014-08-01

To compare the chronic effects of antiretrovirals (lamivudine, stavudine, delavirdine, nelfinavir, amprenavir and an association of lopinavir/ritonavir) on albino pregnant rats. Review. Department of Obstetrics, Federal University of São Paulo (UNIFESP), São Paulo, SP, Brazil. This was a comparative retrospective study formed by 18 groups of 10 pregnant rats each, which were nearly three months of age and weighed 200 g. All of them were medicated every day using a stomach probe, while the control group was given 1 mL of distilled water. The study groups received lamivudine (at 5, 15 and 45 mg/kg/day); stavudine (at 1, 3 and 9 mg/kg/day); nelfinavir (at 40, 120 and 360 mg/kg/day); amprenavir (at 46, 138 and 414 mg/kg/day); lopinavir/ritonavir (at 12.8/3.2, 38.4/9.6 and 115/28.8 mg/kg/day) and delavirdine (at 20 and 60 mg/kg/day). These represented 1, 3 and 9 times the human therapeutic dose, except for the last drug, for which the 9-times dose was not used. Maternal, litter and placental weights, implantation and reabsorption numbers, major external fetal malformations and fetal and maternal deaths were evaluated. The Kruskal-Wallis test was used to compare quantitative variables and the chi-square test was used to compare qualitative variables. At all three doses, stavudine increased the maternal weight (p=0.001), while lamivudine at 3- and 9-times doses reduced it (p0.05). Stavudine at all doses reduced the litter weights (p<0.001); however, lamivudine at the usual and 3-times doses, delavirdine at 3-times dose, and amprenavir at 3-times dose increased the litter weight (p<0.001). In the maternal compartment, we observed lethal toxicity in the pregnant rats that received amprenavir and ritonavir/lopinavir; and maternal weight change with lamivudine and stavudine. In the fetal compartment, adverse effects were observed in relation to litter weight from stavudine, lamivudine, delavirdine and amprenavir.

A survey on helminthic infection in mice (Mus musculus and rats (Rattus norvegicus and Rattus rattus in Kermanshah, Iran

Directory of Open Access Journals (Sweden)

Norollah Pakdel

2013-06-01

Full Text Available Parasitic infections of rodents can compromise scientific research as well as the health of the animals and humans. Based on previous studies, infection rate of parasitic helminths is different in various regions of Iran. The current survey was aimed to determine endoparasitic helminths infection in 138 trapped rodents of Kermanshah county, Iran. Mice and rats were trapped using metal snares from January to October 2011 and euthanized. Rodents included 110 Mus musculus (79.00%, 23 Rattus norvegicus (17.00%, and five Rattus rattus (4.00%. The gastrointestinal and respiratory tracts were removed and examined to identify parasitic helminths. The results indicated that 42.02% of examined rodents were infected with eight helminths species, i.e. Trichuris muris (14.49%, Syphacia obvelata (13.76%, Syphacia muris (2.89%, Aspicularis tetrapetra (5.07%, Heterakis spumosa (5.07%, Capillaria hepatica eggs (3.62%, Hyminolepis diminuta (12.30%, and Cystisercus fasciolaris, the larva of Taenia teanieformis (4.34%. Given the results of this study, we concluded that examined rodents were more infected with nematodes than other helminths. As rodents are usually infected with a number of zoonotic parasites, hence control of these animals has an important role in safeguarding public health.

Evaluation of bone repair in the femur of rats submitted to laser therapy in different wavelengths: An image segmentation method of analysis

Science.gov (United States)

Queiroga, A. S.; Sousa, F. B.; Araújo, J. M. S.; Santos, S. D.; Sousa, C. D'f. S.; Quintans, T. C.; Almeida, T. P.; Nonaka, C. F. W.; Batista, L. V.; Limeira Junior, F. A.

2008-09-01

The aim of this study was to histologically assess the effect of laser therapy (LILT, 660 and 780 nm) on the repair of standardized bone defects on the femur of Wistar albinus rats. The sample was composed of 12 Wistar albinus young adult rats of both genders. Three randomized groups were studied: group I (control, n = 4), group II (LILT, 660 nm, n = 4), and group III (LILT, 780 nm, n = 4). Samples were prepared using a bone defect on the left-side femur surface of the animals, with a total dimension of approximately 3 mm3. Groups II and III were irradiated every 48 h from the second application, where the first dose was given immediately after surgery and the second application came 24 h after surgery. The irradiations were applied transcutaneously at four points around the wound for 14 days. At each point, a dose of 50 J/cm2 (2 J) was given ( s ˜ 0.04 cm2, 40 mW) and the total dose per session was 200 J/cm2 (8 J). The sacrifices were made 15 days after surgery and the specimens were routinely processed to wax, serially cut, stained with an H&E stain, and analyzed under light microscopy. The images were submitted to morphometric analysis using the image segmentation method using the K-means algorithm. The data obtained through the morphometric analysis were submitted to statistical analysis using the Tukey test. The results showed that the group treated with laser therapy in the infrared spectrum resulted in an increase in the repair of bone defects when compared with the group treated with the laser in the red spectrum and control group, which, in turn, had a very similar pattern of repair. A statistical significance ( p spectrum produced a positive biomodulation effect on the repair of bone defects in the femur of rats.

The application of lesion sterilization and tissue repair 3Mix-MP for treating rat's dental pulp tissue

Directory of Open Access Journals (Sweden)

Raditya Nugroho

2015-03-01

Full Text Available Background: Lesion sterilization and tissue repair (LSTR 3Mix-MP are three broad-spectrum antibiotics, including metronidazole, ciprofloxacin and minocycline are mixed with propylene glycol or macrogol. There is the possibility ofthe healing process that marked proliferation ofnew blood vessels and proliferation offibroblasts in the treatment ofirreversible pulpitis by pulp capping LSTR 3MixMP because of  the principle of the method LSTR 3Mix-MP is to kill bacteria. Purpose: The purpose of this study to prove the effect of LSTR 3Mix-MP on chronic inflammation and the healing process in rat dental pulp tissue in vivo. Methods: Rattus norvegicus anaesthetized by using ketamine and xylazine dissolved in sterile isotonic saline solution (0.2 ml/50gr mm on the upper right thigh. Cavity preparation class I to perforation by using a low speed tapered diamond round bur. In the treatment group, rats were treated 3Mix-MP at a dose of10 mg and then covered with glass ionomer cement for 7 days on the pulp that has been opened for 3 days. The control group treated with saline irrigation on the pulp that has been opened for 3 days. Rats were killed after seven days, and then made preparations pulp tissue to count the number oflymphocytes, macrophages, plasma cells, blood vessels, and fibroblasts Results: There is an increase in the average number ofmacrophage cells, plasma, and fibroblasts; and decreased lymphocytes and blood vessels in the treated group exposure LSTR 3Mix-MP. Conclusion:LSTR 3Mix-MP can reduce chronic inflammation process and enhance the healing process in rat dental pulp tissue.

Repeated exposure to cat urine induces complex behavioral, hormonal, and c-fos mRNA responses in Norway rats ( Rattus norvegicus)

Science.gov (United States)

Yin, Baofa; Gu, Chen; Lu, Yi; Hegab, Ibrahim M.; Yang, Shengmei; Wang, Aiqin; Wei, Wanhong

2017-08-01

Prey species show specific adaptations that allow recognition, avoidance, and defense against predators. This study was undertaken to investigate the processing of a chronic, life-threatening stimulus to Norway rats ( Rattus norvegicus). One hundred forty-four Norway rats were tested by repeated presentation of cat urine for 1 h at different days in a defensive withdrawal apparatus. Rats exposed to urine for short periods showed significantly larger defensive behavioral and medial hypothalamic c-fos messenger RNA (mRNA) responses than other groups. These defensive responses habituated shortly after the presentation of cat urine. Serum levels of adrenocorticotropic hormone and corticosterone increased significantly when animals were repeatedly exposed to cat urine. However, the hormonal responses took longer to habituate than the behavioral and molecular responses did. We conclude that the behavioral and c-fos mRNA responses are "primed" for habituation to repeated exposures to cat urine, while the hormonal responses show "resistance." The results support our hypothesis that the strongest anti-predator responses at three levels would occur during short-term exposure to cat urine and that these responses would subsequently disappear on prolonged exposure. This study assists understanding the way in which the different levels of defensive responses are integrated and react during chronic stress.

Modelo experimental de hepatectomia parcial laparoscópica em ratos

Directory of Open Access Journals (Sweden)

Oliveira Fabrício Mascarenhas de

2003-01-01

Full Text Available OBJETIVO: Descrever um modelo experimental de hepatectomia parcial laparoscópica em ratos. MÉTODOS: Foram utilizados 35 ratos Rattus Norvegicus albinus da linhagem Wistar todos machos pesando 250+/-50g. Os animais foram anestesiados com cetamina e xilasina, e submetidos à insuflação através da agulha de Veress com PCO2 de 7mmHg. Após o pneumoperitôneo foram transpassados pela parede abdominal dois trocateres com 5 e um com 11 mm de espessura, de tal modo a formarem uma figura geométrica triangular. A ligadura de três lobos hepáticos (esquerdo, central esquerdo e central direito foi feita utilizando-se o "endoloop" e a eletrocoagulação dos pontos hemorrágicos através do "hook". Os animais foram sacrificados após um período de observação de oito dias. RESULTADOS: Três animais (8,6% morreram na indução anestésica. Após um período de observação de oito dias 30 animais sobreviveram (85,7%, e apenas 2 (5,7% vieram a óbito no pós-operatório imediato. Quanto às complicações, a presença de granuloma foi observada em 54,3% dos ratos (n=19. Nenhuma conversão para a cirurgia aberta foi necessária. CONCLUSÃO: O modelo de hepatectomia parcial laparoscópica em ratos utilizando material cirúrgico semelhante ao usado em humanos é factível para o treinamento e aprimoramento de novos cirurgiões.

Growth studies on Norway lobster, Nephrops norvegicus (L., in different areas of the Mediterranean Sea and the adjacent Atlantic

Directory of Open Access Journals (Sweden)

Chryssi Mytilineou

1998-12-01

Full Text Available A comparative study of the growth of Nephrops norvegicus among different areas in the Mediterranean Sea and the adjacent Atlantic was conducted. MIX and Bhattacharya´s length-based methods were used for age determination. Both methods were used for all the studied areas. For the estimation of the growth parameters two non-linear methods, based on the results of the length frequency analysis, were used; the Gauss-Newton method, implemented by the SAS program, was applied using the results of the MIX and the FISHPARM program using the results of the Bhattacharya´s method. The identification of the age groups and their mean lengths-at-age as well as the estimation of the growth parameters proved to be difficult. A question regarding the adequacy of the von Bertalanffy model was also posed. Remarkable differences were obvious between sexes in the number of identified age groups and their mean lengths-at-age as well as in their growth parameters in all areas. The comparison of the results obtained for the studied areas showed differences, which could not be considered very important except in the case of the Nephrops population of the Alboran Sea, which was characterised by a high growth rate. All other areas seemed to be close; among them the populations from Euboikos Gulf and Catalan Sea being the most different.

Modeling the distribution of Norway rats (Rattus norvegicus on offshore islands in the Falkland Islands

Directory of Open Access Journals (Sweden)

Michael A. Tabak

2015-01-01

Full Text Available Non-native rats (Rattus spp. threaten native island species worldwide. Efforts to eradicate them from islands have increased in frequency and become more ambitious in recent years. However, the long-term success of some eradication efforts has been compromised by the ability of rats, particularly Norway rats (Rattus norvegicus which are good swimmers, to recolonize islands following eradications. In the Falkland Islands, an archipelago in the South Atlantic Ocean, the distance of 250 m between islands (once suggested as the minimum separation distance for an effective barrier to recolonization has shown to be insufficient. Norway rats are present on about half of the 503 islands in the Falklands. Bird diversity is lower on islands with rats and two vulnerable passerine species, Troglodytes cobbi (the only endemic Falkland Islands passerine and Cinclodes antarcticus, have greatly reduced abundances and/or are absent on islands with rats. We used logistic regression models to investigate the potential factors that may determine the presence of Norway rats on 158 islands in the Falkland Islands. Our models included island area, distance to the nearest rat-infested island, island location, and the history of island use by humans as driving variables. Models best supported by data included only distance to the nearest potential source of rats and island area, but the relative magnitude of the effect of distance and area on the presence of rats varied depending on whether islands were in the eastern or western sector of the archipelago. The human use of an island was not a significant parameter in any models. A very large fraction (72% of islands within 500 m of the nearest potential rat source had rats, but 97% of islands farther than 1,000 m away from potential rat sources were free of rats.

ACTIVITY TEST OF GUAVA (Psidium guajava L. LEAF METHANOL EXTRACT AS CONTRACEPTION ANTIFERTILITY TO WHITE MICE (Rattus norvegicus

Directory of Open Access Journals (Sweden)

Sri Retno Dwi Ariani

2010-06-01

Full Text Available The aim of this research is to know about if the guava (Psidium guajava L. leaf methanol extract on 10.5 mg/mL and 21.0 mg/mL dossages indicate a positive test as contraception antifertility to white mice (Rattus norvegicus. The sample is guava leaf from Mungkid, Magelang Central of Java Indonesia. The animals experiment are the white mice on 140-300 g for female, 200-250 g for male and about 3 months of age in average. The steps of this research are : (1 preparing  sample, i.e. washing, drying on to indirect sunlight and make the sample into powder, (2 isolation the guava leaf powder in soxhlet instrument with hexane, (3 evaporation the sample with rotary evaporator until guava leaf hexane extract produced, (4 maseration the sample with methanol, (5 evaporation the sample with rotary evaporator until guava leaf methanol extract produced, (6 conducting contraception antifertility activity test to guave leaf methanol extract on 10.5 mg/mL and 21.0 mg/mL dossages to mice white. The results of this research are guava leaf methanol extract on 10.5 mg/mL and 21.0 mg/mL dossages indicate a negative contraception antifertility test to white mice but in these dossages have indicated that an antiimplantation effect (the total natality of fetus is less than the total implantation site in mice white.   Keywords: Guava leaf, contraseption antifertility, methanol extract, white mice, implantation

NCBI nr-aa BLAST: CBRC-MEUG-01-1124 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1124 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-111 52% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-1354 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1354 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-137 78% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-1135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1135 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-171 87% ...

NCBI nr-aa BLAST: CBRC-MLUC-01-0792 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0792 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-156 75% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2918 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2918 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-149 74% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-1365 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1365 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-144 75% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-0764 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0764 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-128 68% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1069 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1069 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-177 86% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-0810 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0810 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-160 80% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-0280 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0280 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-176 84% ...

NCBI nr-aa BLAST: CBRC-GGOR-01-1001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1001 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-129 80% ...

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_062037.1| chondroadherin [Rattus norvegicus] sp|O70210|CHAD_RAT Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAC40060.1| chondroadherin [Rattus norveg...icus] gb|EDM05713.1| chondroadherin [Rattus norvegicus] NP_062037.1 9e-85 57% ...

NCBI nr-aa BLAST: CBRC-MDOM-02-0334 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-02-0334 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 94% ...

NCBI nr-aa BLAST: CBRC-GGOR-01-1297 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1297 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1594 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-0982 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0982 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-1494 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1494 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-1316 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1316 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 81% ...

NCBI nr-aa BLAST: CBRC-MEUG-01-1939 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1939 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 94% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2565 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2565 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 2e-82 91% ...

NCBI nr-aa BLAST: CBRC-VPAC-01-1554 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1554 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 94% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-1368 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1368 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

Commensal ecology, urban landscapes, and their influence on the genetic characteristics of city-dwelling Norway rats (Rattus norvegicus).

Science.gov (United States)

Gardner-Santana, L C; Norris, D E; Fornadel, C M; Hinson, E R; Klein, S L; Glass, G E

2009-07-01

Movement of individuals promotes colonization of new areas, gene flow among local populations, and has implications for the spread of infectious agents and the control of pest species. Wild Norway rats (Rattus norvegicus) are common in highly urbanized areas but surprisingly little is known of their population structure. We sampled individuals from 11 locations within Baltimore, Maryland, to characterize the genetic structure and extent of gene flow between areas within the city. Clustering methods and a neighbour-joining tree based on pairwise genetic distances supported an east-west division in the inner city, and a third cluster comprised of historically more recent sites. Most individuals (approximately 95%) were assigned to their area of capture, indicating strong site fidelity. Moreover, the axial dispersal distance of rats (62 m) fell within typical alley length. Several rats were assigned to areas 2-11.5 km away, indicating some, albeit infrequent, long-distance movement within the city. Although individual movement appears to be limited (30-150 m), locations up to 1.7 km are comprised of relatives. Moderate F(ST), differentiation between identified clusters, and high allelic diversity indicate that regular gene flow, either via recruitment or migration, has prevented isolation. Therefore, ecology of commensal rodents in urban areas and life-history characteristics of Norway rats likely counteract many expected effects of isolation or founder events. An understanding of levels of connectivity of rat populations inhabiting urban areas provides information about the spatial scale at which populations of rats may spread disease, invade new areas, or be eradicated from an existing area without reinvasion.

PENGARUH KONSUMSI KAPPA-KARAGENAN TERHADAP GLUKOSA DARAH TIKUS WISTAR (Ratus norvegicus DIABETES [The Effect of Kappa-Carrageenan Consumption on Blood Glucose Level of Diabetic Wistar Rat (Ratus norwegicus

Directory of Open Access Journals (Sweden)

Hardoko

2006-04-01

Full Text Available The effect of kappa-carrageenan consumption on blood glucose level were studied on diabetic male wistar rat (Ratus norvegicus.The rats were made diabetic by aloxan injection, and then were given that a ration contains 5, 10, 15, 20% (w/w kappa-carrageenan, standard ration (negative control, and parental glibenklamid (positive control. The results showed that the standard ration could not reduce blood glucose from hyperglycemic to normal level, while the ration contained kappacarrageenan could. The higher kappa-carrageenan seaweed level in the ration has higher capacity to decrease blood glucose level. The ration containing 20% and 15% kappa-carrageenan could reduce blood glucose in 18 and 21 days, respectively.The effect of this ration was similar to that of glibenklamid which reduced blood glucose to normal level in 18 days. The ration containing 5 and 10% kappa-carrageenan could reduce blood glucose level; Blood glucose leve return to normal on the 21st day.

NCBI nr-aa BLAST: CBRC-PCAP-01-0533 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0533 ref|NP_570096.2| protein kinase C and casein kinase substrate in neurons...ein kinase C and casein kinase substrate in neurons 2 [Rattus norvegicus] gb|EDM15628.1| protein kinase C an...d casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] gb|EDM1...5629.1| protein kinase C and casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] gb|EDM1...5631.1| protein kinase C and casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] NP_570096.2 1e-176 87% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-0237 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0237 ref|NP_570096.2| protein kinase C and casein kinase substrate in neurons...ein kinase C and casein kinase substrate in neurons 2 [Rattus norvegicus] gb|EDM15628.1| protein kinase C an...d casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] gb|EDM1...5629.1| protein kinase C and casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] gb|EDM1...5631.1| protein kinase C and casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] NP_570096.2 0.0 85% ...

Alveolar bone healing in rats: micro-CT, immunohistochemical and molecular analysis

Directory of Open Access Journals (Sweden)

Jaqueline Suemi HASSUMI

2018-06-01

Full Text Available Abstract Alveolar bone healing after upper incisor extraction in rats is a classical model of preclinical studies. The underlying morphometric, cellular and molecular mechanism, however, remains imprecise in a unique study. Objectives The aim of this study was therefore to characterize the alveolar bone healing after upper incisor extraction in rats by micro computed tomographic (Micro-CT, immunohistochemical and real-time polymerase chain reaction (RT-PCR analysis. Material and Methods Thirty animals (Rattus norvegicus, Albinus Wistar were divided into three groups after upper incisors extraction at 7, 14, and 28 days. Micro-CT was evaluated based on the morphometric parameters. Subsequently, the histological analyses and immunostaining of osteoprotegerin (OPG, receptor activator of nuclear kappa B ligand (RANKL and tartrate resistant acid phosphate (TRAP was performed. In addition, RT-PCR analyses of OPG, RANKL, the runt-related transcription factor 2 (RUNX2, osteocalcin (OC, osteopontin (OPN, osterix (OST and receptor activator of nuclear kappa B (RANK were performed to determine the expression of these proteins in the alveolar bone healing. Results Micro-CT: The morphometric parameters of bone volume and trabecular thickness progressively increased over time. Consequently, a gradual decrease in trabecular separation, trabecular space and total bone porosity was observed. Immunohistochemical: There were no differences statistically significant between the positive labeling for OPG, RANKL and TRAP in the different periods. RT-PCR: At 28 days, there was a significant increase in OPG expression, while RANKL expression and the RANKL/OPG ratio both decreased over time. Conclusion Micro-CT showed the newly formed bone had favorable morphometric characteristics of quality and quantity. Beyond the RUNX2, OC, OPN, OST, and RANK proteins expressed in the alveolar bone healing, OPG and RANKL activity showed to be essential for activation of basic

Ecology of Leptospira interrogans in Norway rats (Rattus norvegicus in an inner-city neighborhood of Vancouver, Canada.

Directory of Open Access Journals (Sweden)

Chelsea G Himsworth

Full Text Available Leptospira interrogans is a bacterial zoonosis with a worldwide distribution for which rats (Rattus spp. are the primary reservoir in urban settings. In order to assess, monitor, and mitigate the risk to humans, it is important to understand the ecology of this pathogen in rats. The objective of this study was to characterize the ecology of L. interrogans in Norway rats (Rattus norvegicus in an impoverished inner-city neighborhood of Vancouver, Canada.Trapping was performed in 43 city blocks, and one location within the adjacent port, over a 12 month period. Kidney samples were tested for the presence of L. interrogans using PCR and sequencing. A multivariable model was built to predict L. interrogans infection status in individual rats using season and morphometric data (e.g., weight, sex, maturity, condition, etc. as independent variables. Spatial analysis was undertaken to identify clusters of high and low L. interrogans prevalence. The prevalence of L. interrogans varied remarkably among blocks (0-66.7%, and spatial clusters of both high and low L. interrogans prevalence were identified. In the final cluster-controlled model, characteristics associated with L. interrogans-infection in rats included weight (OR = 1.14, 95% CI = 1.07-1.20, increased internal fat (OR = 2.12, 95% CI = 1.06-4.25, and number of bite wounds (OR = 1.20, 95% CI = 0.96-1.49.Because L. interrogans prevalence varied with weight, body fat, and bite wounds, this study suggests that social structure and interactions among rats may influence transmission. The prevalence and distribution of L. interrogans in rats was also highly variable even over a short geographic distance. These factors should be considered in future risk management efforts.

Population genetics, community of parasites, and resistance to rodenticides in an urban brown rat (Rattus norvegicus) population.

Science.gov (United States)

Desvars-Larrive, Amélie; Pascal, Michel; Gasqui, Patrick; Cosson, Jean-François; Benoît, Etienne; Lattard, Virginie; Crespin, Laurent; Lorvelec, Olivier; Pisanu, Benoît; Teynié, Alexandre; Vayssier-Taussat, Muriel; Bonnet, Sarah; Marianneau, Philippe; Lacôte, Sandra; Bourhy, Pascale; Berny, Philippe; Pavio, Nicole; Le Poder, Sophie; Gilot-Fromont, Emmanuelle; Jourdain, Elsa; Hammed, Abdessalem; Fourel, Isabelle; Chikh, Farid; Vourc'h, Gwenaël

2017-01-01

Brown rats are one of the most widespread urban species worldwide. Despite the nuisances they induce and their potential role as a zoonotic reservoir, knowledge on urban rat populations remains scarce. The main purpose of this study was to characterize an urban brown rat population from Chanteraines park (Hauts-de-Seine, France), with regards to haematology, population genetics, immunogenic diversity, resistance to anticoagulant rodenticides, and community of parasites. Haematological parameters were measured. Population genetics was investigated using 13 unlinked microsatellite loci. Immunogenic diversity was assessed for Mhc-Drb. Frequency of the Y139F mutation (conferring resistance to rodenticides) and two linked microsatellites were studied, concurrently with the presence of anticoagulant residues in the liver. Combination of microscopy and molecular methods were used to investigate the occurrence of 25 parasites. Statistical approaches were used to explore multiple parasite relationships and model parasite occurrence. Eighty-six rats were caught. The first haematological data for a wild urban R. norvegicus population was reported. Genetic results suggested high genetic diversity and connectivity between Chanteraines rats and surrounding population(s). We found a high prevalence (55.8%) of the mutation Y139F and presence of rodenticide residues in 47.7% of the sampled individuals. The parasite species richness was high (16). Seven potential zoonotic pathogens were identified, together with a surprisingly high diversity of Leptospira species (4). Chanteraines rat population is not closed, allowing gene flow and making eradication programs challenging, particularly because rodenticide resistance is highly prevalent. Parasitological results showed that co-infection is more a rule than an exception. Furthermore, the presence of several potential zoonotic pathogens, of which four Leptospira species, in this urban rat population raised its role in the maintenance

Defensive aggregation (huddling in Rattus norvegicus toward predator odor: individual differences, social buffering effects and neural correlates.

Directory of Open Access Journals (Sweden)

Michael T Bowen

Full Text Available Aggregation is a defensive strategy employed by many prey species in response to predatory threat. Our group has characterized defensive aggregation (huddling in Rattus norvegicus in response to a ball of cat fur. In this situation some rats huddle less, and approach the threatening cue more than others (active vs. passive responders. The present study explored whether active responding is a stable phenotype associated with behaviors outside direct predatory encounters. The neural substrates of active and passive responding under predatory threat were explored using c-Fos immunohistochemistry. Finally, we examined whether the presence of conspecifics during predatory threat biases behavior towards active responding. Active and passive responding styles were found to be stable in individual rats across consecutive group exposures to cat fur, and were predicted by anxiety-like behavior in an open-field emergence test. Active responders displayed less conditioned fear in an environment associated with predatory threat, and had higher post-exposure intake of a weak sucrose solution (a test of "anhedonia". Active responding was associated with: greater cat fur-induced activation of the accessory olfactory bulb, reflecting greater olfactory stimulation in rats actively approaching the fur; lowered activation of somatosensory cortex, reflecting reduced huddling with conspecifics; and reduced activation in the lateral septum. Social exposure to cat fur promoted active responding relative to individual exposure, and lowered c-Fos expression in the dorsomedial periaqueductal grey, medial caudate putamen and lateral habenula. We conclude that individual differences in anti-predator behavior appear stable traits with active responders having a more resilient phenotype. Social exposure to predatory threat has an acute buffering effect, subtly changing the neural and behavioral response towards threat and encouraging active responding. An association between

Defensive Aggregation (Huddling) in Rattus Norvegicus toward Predator Odor: Individual Differences, Social Buffering Effects and Neural Correlates

Science.gov (United States)

Bowen, Michael T.; Kevin, Richard C.; May, Matthew; Staples, Lauren G.; Hunt, Glenn E.; McGregor, Iain S.

2013-01-01

Aggregation is a defensive strategy employed by many prey species in response to predatory threat. Our group has characterized defensive aggregation (huddling) in Rattus norvegicus in response to a ball of cat fur. In this situation some rats huddle less, and approach the threatening cue more than others (active vs. passive responders). The present study explored whether active responding is a stable phenotype associated with behaviors outside direct predatory encounters. The neural substrates of active and passive responding under predatory threat were explored using c-Fos immunohistochemistry. Finally, we examined whether the presence of conspecifics during predatory threat biases behavior towards active responding. Active and passive responding styles were found to be stable in individual rats across consecutive group exposures to cat fur, and were predicted by anxiety-like behavior in an open-field emergence test. Active responders displayed less conditioned fear in an environment associated with predatory threat, and had higher post-exposure intake of a weak sucrose solution (a test of “anhedonia”). Active responding was associated with: greater cat fur-induced activation of the accessory olfactory bulb, reflecting greater olfactory stimulation in rats actively approaching the fur; lowered activation of somatosensory cortex, reflecting reduced huddling with conspecifics; and reduced activation in the lateral septum. Social exposure to cat fur promoted active responding relative to individual exposure, and lowered c-Fos expression in the dorsomedial periaqueductal grey, medial caudate putamen and lateral habenula. We conclude that individual differences in anti-predator behavior appear stable traits with active responders having a more resilient phenotype. Social exposure to predatory threat has an acute buffering effect, subtly changing the neural and behavioral response towards threat and encouraging active responding. An association between active

Defensive aggregation (huddling) in Rattus norvegicus toward predator odor: individual differences, social buffering effects and neural correlates.

Science.gov (United States)

Bowen, Michael T; Kevin, Richard C; May, Matthew; Staples, Lauren G; Hunt, Glenn E; McGregor, Iain S

2013-01-01

Aggregation is a defensive strategy employed by many prey species in response to predatory threat. Our group has characterized defensive aggregation (huddling) in Rattus norvegicus in response to a ball of cat fur. In this situation some rats huddle less, and approach the threatening cue more than others (active vs. passive responders). The present study explored whether active responding is a stable phenotype associated with behaviors outside direct predatory encounters. The neural substrates of active and passive responding under predatory threat were explored using c-Fos immunohistochemistry. Finally, we examined whether the presence of conspecifics during predatory threat biases behavior towards active responding. Active and passive responding styles were found to be stable in individual rats across consecutive group exposures to cat fur, and were predicted by anxiety-like behavior in an open-field emergence test. Active responders displayed less conditioned fear in an environment associated with predatory threat, and had higher post-exposure intake of a weak sucrose solution (a test of "anhedonia"). Active responding was associated with: greater cat fur-induced activation of the accessory olfactory bulb, reflecting greater olfactory stimulation in rats actively approaching the fur; lowered activation of somatosensory cortex, reflecting reduced huddling with conspecifics; and reduced activation in the lateral septum. Social exposure to cat fur promoted active responding relative to individual exposure, and lowered c-Fos expression in the dorsomedial periaqueductal grey, medial caudate putamen and lateral habenula. We conclude that individual differences in anti-predator behavior appear stable traits with active responders having a more resilient phenotype. Social exposure to predatory threat has an acute buffering effect, subtly changing the neural and behavioral response towards threat and encouraging active responding. An association between active responding

NCBI nr-aa BLAST: CBRC-EEUR-01-0952 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-0952 ref|NP_446083.1| barrier to autointegration factor 1 [Rattus norv...egicus] sp|Q9R1T1|BAF_RAT Barrier-to-autointegration factor (LAP2-binding protein 1) dbj|BAA83101.1| L2BP1 [...Rattus norvegicus] gb|AAH84726.1| Barrier to autointegration factor 1 [Rattus norvegicus] NP_446083.1 4e-06 47% ...

Formigas em Carcaças de Rattus norvegicus (Berkenhout em uma Área de Cerrado no Sudeste do Brasil: Riqueza e Abundância

Directory of Open Access Journals (Sweden)

Alysson Fonseca

2015-04-01

Abstract. We studied the main species of ants associated with carcasses of Rattus norvegicus (Berkenhout during the decomposition process, in different seasons in a savannah area. In each of the four seasons a carcass was disposed in the field and we installed around it five pitfall traps. Ants were collected from the tray containing the carcass and from the traps daily, until the end of decomposition in each season. Ants belonging to twenty-three species, with 63.85% of the total individuals collected in the traps and the rest directly in the trays, were sampled. The presence of predatory and nectarivorous species were registered. The scarcity of available resources in the environment in the dry season possibly makes the carcasses important food sources, explaining the higher richness of active species near the trays (collected in the pitfall traps. This increased activity is also reflected in a higher number of species and individuals in the carcasses. The opposite also seems to occur once in the autumn, end of wet season, we observed lower abundance of ants in the carcasses. The presence of ants on carcasses throughout all stages of the decomposition process and in all seasons of the year highlighted the importance of the association between representatives of this taxon and carcasses in Cerrado environments.

Efecto hipolipidémico del extracto acuoso de las hojas de Artocarpus altilis "árbol del pan" en Rattus norvegicus con hiperlipidemia inducida

Directory of Open Access Journals (Sweden)

Julio Campos Florián

2013-01-01

Full Text Available La presente investigación tuvo como objetivo demostrar la actividad hipolipidémica del extracto acuoso de las hojas del árbol del pan, Artocarpus altilis, en un modelo de hiperlipidemia aguda inducida con tritón X-305, utilizando como especímenes Rattus norvegicus machos, peso promedio 204,5 g, a los que se les administró por vía oral 0,05 g/100 g y 0,2 g/100 g del extracto acuoso de A. altilis; se incluyó un grupo control negativo que recibió solución salina fisiológica y un grupo control positivo hiperlipidémico. Luego de 24 horas de administrar los tratamientos, se realizaron las mediciones en suero de las concentraciones de colesterol y triglicéridos. Encontramos reducciones significativas (p < 0,01 tanto de las cifras de colesterol, como de triglicéridos en relación a las concentraciones obtenidas en el grupo control positivo. También encontramos diferencia significativa (p < 0,01 entre las concentraciones de triglicéridos de los animales tratados con las dos dosis del extracto acuoso de A. altilis. Concluimos que el extracto acuoso de las hojas de A. altilis presenta efecto hipolipidémico a las dosis ensayadas para el modelo de hiperlipidemia inducida con tritón X-305.

NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-14-0023 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 74% ...

NCBI nr-aa BLAST: CBRC-OANA-01-2200 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-2200 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 93% ...

NCBI nr-aa BLAST: CBRC-RNOR-05-0081 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0081 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 100% ...

NCBI nr-aa BLAST: CBRC-TGUT-05-0032 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-05-0032 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 92% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-3023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-3023 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-HSAP-06-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-06-0074 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-12-0016 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 98% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1883 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 98% ...

NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0845 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 86% ...

NCBI nr-aa BLAST: CBRC-GGAL-03-0034 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-03-0034 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 93% ...

NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-04-0050 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1332 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-EEUR-01-1648 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-1648 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-1516 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-1516 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0013 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 99% ...

NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-07-0067 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-PABE-07-0058 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-07-0058 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-1020 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 98% ...

NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-1734 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 91% ...

Characterization of the dominant bacterial communities during storage of Norway lobster and Norway lobster tails (Nephrops norvegicus) based on 16S rDNA analysis by PCR-DGGE.

Science.gov (United States)

Bekaert, Karen; Devriese, Lisa; Maes, Sara; Robbens, Johan

2015-04-01

The aim of this study was to investigate the microbial quality of whole Norway lobster (Nephrops norvegicus) and Norway lobster tails to optimize handling conditions. This was done by assessing the total viable count (TVC) and characterizing the dominant microbiota. The cultivable microorganisms were quantified via classical microbiological plating methods. To characterize as many bacterial species present as possible, we performed advanced molecular identification techniques (PCR-DGGE). The initial TVC of fresh Norway lobster meat was high (3.0 log cfu/g) as compared to fish. No significant difference between whole Norway lobster and Norway lobster tails could be found during the storage period. From day 6 of storage, a significant difference between Plate Count Agar (PCA) and Marine Agar (MA) was observed. The microbiota of Norway lobster was dominated by members of the Gram-negative genera such as Psychrobacter spp., Pseudoalteromonas spp., Pseudomonas spp., Luteimonas spp., and Aliivibrio spp. From these bacteria, mainly Psychrobacter spp. and Pseudomonas spp. remained present until the end of the storage period. These are known spoilage organisms in fishery products. Other known spoilage organisms of crustaceans such as Photobacterium spp. could not be identified. Copyright © 2014 Elsevier Ltd. All rights reserved.

NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0074 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 1e-159 61% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1522 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 1e-28 94% ...

Gene : CBRC-RNOR-04-0153 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0153 4 A Pheromone receptors V1A16_RAT 1e-51 40% ref|NP_001009531.1| vomeronasa...l V1r-type receptor V1rc40 [Rattus norvegicus] gb|AAR87997.1| vomeronasal V1r-type receptor V1rc40 ...[Rattus norvegicus] 1e-169 100% gnl|UG|Rn#S22668978 Rattus norvegicus vomeronasal V1r-type receptor V1rc40 m...LSVFQAITISPSTSLMARFKHKLKRYVINALFYIWVFNLSASSDAILSVGGFTNVSEIKQVKITKTCSLFPMNYIIRGLTFILSSSRDVFFVGVMLNASAYMVIILHR

Perfil do corpo celular de neurônios mioentéricos nadh-diaforase positivos do estômago de ratos (Rattus norvegicus submetidos ao alcoolismo crônico - DOI: 10.4025/actascibiolsci.v26i3.1599 Profile of the cell body of nadh-diaphorase positive myenteric neurons from the stomach of rats (Rattus norvegicus subjected to chronic alcoholism - DOI: 10.4025/actascibiolsci.v26i3.1599

Directory of Open Access Journals (Sweden)

Marcílio Hubner de Miranda Neto

2004-04-01

Full Text Available O objetivo do trabalho foi comparar o perfil dos corpos celulares dos neurônios mioentéricos NADH-diaforase positivos do estômago de ratos. Utilizou-se 10 animais (Rattus norvegicus, provenientes dos grupos: a controle (n=5, que durante 210 dias receberam, ad libitum, dieta com teor protéico normal (22% e água; e b experimental (n = 5, que durante 210 dias receberam, ad libitum, ração com teor protéico normal (22% e aguardente-de-cana diluída a 30 Gay Lussac (30º v/v. Os estômagos coletados foram submetidos à técnica de evidenciação neuronal. A mensuração do perfil dos corpos celulares dos neurônios (n = 1.000 foi através de um Sistema Computadorizado de Análise de Imagem. O perfil dos corpos celulares dos neurônios do grupo controle ficou entre 60,16 a 638,64 µm2. No grupo experimental variou de 40,84 a 599,15 µm2. Constatamos redução significante no tamanho do corpo celular, aumento de neurônios pequenos e diminuição de neurônios grandesThe purpose of this work was to compare the profile of the cell body of the NADH-diaphorase positive myenteric neurons from the stomach of rats. It was used 10 animals (Rattus norvegicus, from groups a control (n = 5, that during 210 days had ad libitum supply of chow with normal protein level (22% and water; and b experimental (n = 5, that during 210 days had ad libitum supply of chow with normal protein level (22% and sugar cane brandy diluted to 30 Gay Lussac (30o v/v. The stomachs collected and subjected to the technique for neuronal staining. The cell body of the neurons (n = 1.000 was measured through a computerized system of image analysis. The profile of the neurons from the control rats ranged from 60.16 and 638.64 µm2. In the experimental group the values ranged from 40.84 to 599.15 µm2. We observed a significant decrease on the cell body size, increase of the small neurons and decrease of the large neurons

Intestinal helminths infection of rats (Ratus norvegicus) in the Belgrade area (Serbia): the effect of sex, age and habitat.

Science.gov (United States)

Kataranovski, M; Mirkov, I; Belij, S; Popov, A; Petrovic, Z; Gaci, Z; Kataranovski, D

2011-05-01

Gastrointestinal helminths of Norway rat (Rattus norvegicus) from the Belgrade area were studied as a part of a wider ecological research of rats in Serbia (data on the distribution, population ecology, economic and epizoothiological-epidemiological importance, and density control). Rats were captured from May 2005 to July 2009 at both urban and suburban-rural sites. Of a total of 302 trapped rats 48% were males and 52% females, with 36.5% and 38.8% of juvenile-subadult individuals, per sex respectively. Intestinal helminth infection was noted in 68.5% of rats, with a higher prevalence in male hosts and in adult individuals. Higher numbers of infected juveniles-subadults were noted in suburban-rural habitats, while an opposite tendency was noted in adult rats. Seven helminth species were recovered, of which five were nematode (Heterakis spumosa, Nippostrongylus brasiliensis, Capillaria sp., Trichuris muns and Syphacia muris) and two cestode species (Hymenolepis diminuta and Rodentolepis fraterna). The most prevalent parasites were Heterakis spumosa (36.7%) and Hymenolepis diminuta (30.5 %). Sex and habitat-related differences were noted in the prevalence of infection with Capillaria sp. and Trichuris muris, while there were no age-related differences in the prevalence of infection with any individual helminth species. Significantly higher prevalence of infection was noted in summer as compared to spring or winter, with a tendency to be higher in autumn as compared to spring. The only significant difference in the prevalence of infection between habitat-related was noted during spring. H. spumosa was most prevalent in summer, while H. diminuta and N. brasiliensis in autumn. The mean intensity of infection with H. spumosa, R. fraterna, S. muris and T muris was higher in autumn than in the other seasons, while N. brasiliensis and Capillaria sp. occured in winter. No more than four helminth species were found in one host.

The potential of chitosan combined with chicken shank collagen as scaffold on bone defect regeneration process in Rattus norvegicus

Directory of Open Access Journals (Sweden)

Fitria Rahmitasari

2016-12-01

Full Text Available Background: In the field of dentistry, alveolar bone damage can be caused by periodontal disease, traumatic injury due to tooth extraction, cyst enucleation, and tumor surgery. One of the ways to regenerate the bone defect is using graft scaffold. Thus, combination of chitosan and collagen can stimulate osteogenesis. Purpose: The aim of this study was to examine the potential of chitosan combined with chicken shank collagen on bone defect regeneration process. Method: Twelve Rattus norvegicus were prepared as animal models in this research. A bone defect was intentionally created at both of the right and left femoral bones of the models. Next, 24 samples were divided into four groups, namely Group 1 using chitosan – collagen scaffold (50:50, Group 2 using chitosan collagen-scaffold (80:20, Group 3 using chitosan scaffold only, and Control Group using 3% CMC-Na. On 14th day, those animals were sacrificed, and histopathological anatomy examination was conducted to observe osteoclast cells. In addition, immunohistochemistry examination was also performed to observe RANKL expressions. Result: There was a significant difference in RANKL expressions among the groups, except between Group 3 using chitosan scaffold only and control group (p value > 0.05. The highest expression of RANKL was found in Group 1 with chitosan – collagen scaffold (50:50, followed by Group 2 with chitosan-collagen scaffold (80:20. Moreover, there was also a significant difference in osteoclast generation, except between Group 1 using chitosan – collagen scaffold (50:50 and Group 2 using chitosan-collagen scaffold (80:20, p value 0.05. Less osteoclast was found in the groups using chitosan – collagen scaffold (Group 1 and Group 2. Conclusion: Combination of chitosan and chicken shank collagen scaffold can improve regeneration process of bone defect in Rattus novergicus animals through increasing of RANKL expressions, and decreasing of osteoclast.

NCBI nr-aa BLAST: CBRC-CINT-01-0214 [SEVENS

Lifescience Database Archive (English)

Full Text Available monocarboxylic acid transporters), member 12 [Rattus norvegicus] ref|XP_001079987.1| PREDICTED: similar to s...olute carrier family 16 (monocarboxylic acid transporters), member 12 [Rattus norvegicus] XP_220057.4 3e-18 28% ...

NCBI nr-aa BLAST: CBRC-AGAM-02-0156 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-AGAM-02-0156 ref|XP_234385.3| PREDICTED: similar to pecanex homolog [Rattus no...rvegicus] ref|XP_001055794.1| PREDICTED: similar to pecanex homolog [Rattus norvegicus] XP_234385.3 1e-94 39% ...

Identification of Potential Therapeutic Mechanisms for HIP1 Inhibition in Breast Cancer

Science.gov (United States)

2007-05-01

HIP1 siRNA. The data represent experimental triplicates normalized to actin lev- els from cells treated with a scrambled control siRNA and the error...NP_003950), Sp putative clathrin coat assembly protein (NP_596345), ScSla2p (NP_014156), Xl Hip1-prov protein (AAH77182), and RnAP180 (CAA48748). Hs, Homo ... sapiens ; Sc, Saccharomyces cerevisiae; Sp, Schizosaccharomyces pombe; Xl, Xenopus laevis; Rn, Rattus norvegicus. An I/LWEQ module sequence alignment

NCBI nr-aa BLAST: CBRC-RNOR-05-0235 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0235 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 0.0 99% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-0894 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0894 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-163 81% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2314 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2314 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-158 87% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0499 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-162 80% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-1379 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1379 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-168 83% ...

Atherosclerosis and atherosensitivity in two southwest Algerian desert rodents, Psammomys obesus and Gerbillus gerbillus, and in Rattus norvegicus

Directory of Open Access Journals (Sweden)

El-Aoufi S

2012-09-01

Full Text Available Salima El-Aoufi,1 Mohamed-Amine Lazourgui,1 Lakhdar Griene,2 Boubekeur Maouche31Laboratoire de Biologie et de Physiologie des Organismes/MMDED, Faculté des Sciences Biologiques, USTHB, El-Alia, Dar El Beida, Algeria; 2Laboratoire d'Hormonologie, Centre Pierre et Marie Curie, C.H.U Mustapha, Algeria; 3Laboratoire de Physicochimie Théorique et Chimie Informatique, Faculté de Chimie, USTHB, El-Alia, Dar El Beida, AlgeriaAbstract: Cardiovascular disease, including atherosclerosis, is the leading cause of death in patients with diabetes worldwide; thus, it is a major medical concern. The endothelium contributes to the control of many vascular functions, and clinical observations show that it is a primary target for diabetic syndrome. To get better insight into the mechanisms underlying atherosclerosis, we studied the interspecific differences in the arterial metabolisms of two, Psammomys obesus and Gerbillus gerbillus, as well as Rattus norvegicus (Wistar rat, well known for its atheroresistance. Twenty-two enzymatic activities and six macromolecular substances were histochemically compared in the two desert species and in Wistar aortas (abdominal and thoracic and arteries (femoral and caudal embedded in a common block. In the healthy adult rodents, enzyme activities were very intense. They demonstrated that aortic myocytes are capable of various synthesis and catabolism processes. However, considering the frequency of atherosclerosis and its phenotypes, significant differences appeared between the species studied. Our comparative study shows that aortic atherosensitive animals have several common metabolic characteristics, which are found in Psammomys rich in metachromatic glycosaminoglycans (involved in the inhibition of lipolysis and in calcification of the organic matrix, reduced activity in enzymes related to the Krebs cycle (weakening energetic power, and low lipolytic enzyme, adenosine triphosphatase, and adenosine diphosphatase activities

NCBI nr-aa BLAST: CBRC-MEUG-01-1506 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1506 ref|XP_236329.4| PREDICTED: similar to Ladybird homeobox corepres...sor 1 [Rattus norvegicus] ref|XP_001075793.1| PREDICTED: similar to Ladybird homeobox corepressor 1 [Rattus norvegicus] XP_236329.4 1e-123 66% ...

NCBI nr-aa BLAST: CBRC-TGUT-03-0000 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-03-0000 ref|NP_446167.2| solute carrier family 5 (inositol transporters),... member 3 [Rattus norvegicus] gb|EDM10751.1| solute carrier family 5 (inositol transporters), member 3 [Rattus norvegicus] NP_446167.2 0.0 81% ...

NCBI nr-aa BLAST: CBRC-MDOM-09-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-09-0050 ref|NP_001017377.1| progestin and adipoQ receptor family member I...V [Rattus norvegicus] gb|AAH92635.1| Progestin and adipoQ receptor family member IV [Rattus norvegicus] gb|EDM03772.1| progesti

NCBI nr-aa BLAST: CBRC-DSIM-01-0068 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-01-0068 ref|NP_001017377.1| progestin and adipoQ receptor family member I...V [Rattus norvegicus] gb|AAH92635.1| Progestin and adipoQ receptor family member IV [Rattus norvegicus] gb|EDM03772.1| progesti

Effects of microcurrent stimulation on Hyaline cartilage repair in immature male rats (Rattus norvegicus

Directory of Open Access Journals (Sweden)

de Campos Ciccone Carla

2013-01-01

Full Text Available Abstract Background In this study, we investigate the effects of microcurrent stimulation on the repair process of xiphoid cartilage in 45-days-old rats. Methods Twenty male rats were divided into a control group and a treated group. A 3-mm defect was then created with a punch in anesthetized animals. In the treated group, animals were submitted to daily applications of a biphasic square pulse microgalvanic continuous electrical current during 5 min. In each application, it was used a frequency of 0.3 Hz and intensity of 20 μA. The animals were sacrificed at 7, 21 and 35 days after injury for structural analysis. Results Basophilia increased gradually in control animals during the experimental period. In treated animals, newly formed cartilage was observed on days 21 and 35. No statistically significant differences in birefringent collagen fibers were seen between groups at any of the time points. Treated animals presented a statistically larger number of chondroblasts. Calcification points were observed in treated animals on day 35. Ultrastructural analysis revealed differences in cell and matrix characteristics between the two groups. Chondrocyte-like cells were seen in control animals only after 35 days, whereas they were present in treated animals as early as by day 21. The number of cuprolinic blue-stained proteoglycans was statistically higher in treated animals on days 21 and 35. Conclusion We conclude that microcurrent stimulation accelerates the cartilage repair in non-articular site from prepuberal animals.

Effects of microcurrent stimulation on hyaline cartilage repair in immature male rats (Rattus norvegicus).

Science.gov (United States)

de Campos Ciccone, Carla; Zuzzi, Denise Cristina; Neves, Lia Mara Grosso; Mendonça, Josué Sampaio; Joazeiro, Paulo Pinto; Esquisatto, Marcelo Augusto Marretto

2013-01-19

In this study, we investigate the effects of microcurrent stimulation on the repair process of xiphoid cartilage in 45-days-old rats. Twenty male rats were divided into a control group and a treated group. A 3-mm defect was then created with a punch in anesthetized animals. In the treated group, animals were submitted to daily applications of a biphasic square pulse microgalvanic continuous electrical current during 5 min. In each application, it was used a frequency of 0.3 Hz and intensity of 20 μA. The animals were sacrificed at 7, 21 and 35 days after injury for structural analysis. Basophilia increased gradually in control animals during the experimental period. In treated animals, newly formed cartilage was observed on days 21 and 35. No statistically significant differences in birefringent collagen fibers were seen between groups at any of the time points. Treated animals presented a statistically larger number of chondroblasts. Calcification points were observed in treated animals on day 35. Ultrastructural analysis revealed differences in cell and matrix characteristics between the two groups. Chondrocyte-like cells were seen in control animals only after 35 days, whereas they were present in treated animals as early as by day 21. The number of cuprolinic blue-stained proteoglycans was statistically higher in treated animals on days 21 and 35. We conclude that microcurrent stimulation accelerates the cartilage repair in non-articular site from prepuberal animals.

Effet thérapeutique de l’extrait aqueux de Globularia alypum suite à une insulinotoxicité induite in vitro sur les cardiomyocytes de Rattus norvegicus. [Therapeutic effect of aqueous extract of Globularia alypum following in vitro insulin induced toxicity on Rattus norvegicus cardiomyocytes

Directory of Open Access Journals (Sweden)

Leila SMAIL

2017-07-01

Full Text Available Introduction. L’insulino‐résistance, marquée par une réaction inflammatoire via la production de TNF‐α et par l’hyperinsulinémie compensatoire, conduit à long terme à l’installation d’une glucolipotoxicité et du diabète de type 2. Objectif. Dans cette étude, les effets d’un extrait aqueux de Globularia alypum (Ga a été analysé in vitro, suite à un stress induit sur le cardiomyocyte de Rattus norvegicus. Matériel et Méthodes. Le stress a été induit par addition d’une dose élevée d’insuline (10 UI/ mL. Les taux de prolifération ont été déterminés par comptage et les contenus cellulaires en monoxyde d’azote (NO, en malondialdéhyde (MDA et en catalase ont été évalués. Résultats. En présence de la dose élevée d’insuline, les cardiomyocytes ont montré une diminution de la survie cellulaire, un déséquilibre du statut redox en faveur d’une augmentation de NO et de MDA et d’une diminution d’une enzyme du système antioxydant, la catalase. Suite à l’action de l’extrait de Ga, il a été noté une amélioration du taux de prolifération cellulaire, une diminution du taux de No et de MDA ainsi qu’une augmentation de l’activité de la catalase. Conclusion. L’état de stress induit sur le cardiomyocyte par l’insulino‐résistance, mimé par la dose élevée d’insuline, entraîne des altérations physiologiques et biochimiques. Ces dernières, précurseurs de mort cellulaire par apoptose sont atténuées après addition d’un extrait de Globularia alypum, lequel pourrait constituer une cible thérapeutique en aval de l’installation du DT2.

NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

A gradient structure for reaction–diffusion systems and for energy-drift-diffusion systems

International Nuclear Information System (INIS)

Mielke, Alexander

2011-01-01

In recent years the theory of the Wasserstein metric has opened up new treatments of diffusion equations as gradient systems, where the free energy or entropy take the role of the driving functional and where the space is equipped with the Wasserstein metric. We show on the formal level that this gradient structure can be generalized to reaction–diffusion systems with reversible mass-action kinetic. The metric is constructed using the dual dissipation potential, which is a quadratic functional of all chemical potentials including the mobilities as well as the reaction kinetics. The metric structure is obtained by Legendre transform from the dual dissipation potential. The same ideas extend to systems including electrostatic interactions or a correct energy balance via coupling to the heat equation. We show this by treating the semiconductor equations involving the electron and hole densities, the electrostatic potential, and the temperature. Thus, the models in Albinus et al (2002 Nonlinearity 15 367–83), which stimulated this work, have a gradient structure

Food Color Induced Hepatotoxicity in Swiss Albino Rats, Rattus norvegicus.

Science.gov (United States)

Saxena, Beenam; Sharma, Shiv

2015-01-01

Certain dietary constituents can induce toxicity and play a critical role in the development of several hepatic disorders. Tartrazine, metanil yellow and sunset yellow are widely used azo dyes in food products, so the present study is aimed to investigate the food color induced hepatotoxicity in Swiss albino rats. Swiss albino rats were divided into four groups, each group having six animals. Group I served as control, Group II, Group III and Group IV were administered with 25, 50 and 75 mg/kg body weight blend of sunset yellow, metanil yellow and tartrazine for 30 days. Hepatotoxicity in rats treated with a blend of these food colors was studied by assessing parameters such as serum total protein, serum albumin, serum alkaline phosphatase (ALP) as well as hepatic malondialdehyde (MDA). The activity of superoxide dismutase (SOD), reduced glutathione (GSH) and catalase (CAT) were assessed. Significantly increased concentrations of serum total protein, serum albumin, serum ALP and hepatic MDA and significantly lowered levels of SOD, reduced GSH and CAT in the liver tissue of treated animals were observed when compared with control animals. The alteration in the liver includes necrosis of hepatocytes, infiltration and vacuolation. The result indicates that consumption of food color in diet induces liver tissue damage. The used doses of food color were mostly attributable to hepatocellular damage and drastic alteration in antioxidant defense system.

UJI AKTIVITAS ANTIINFLAMASI KOMBINASI DEKOKTA AKAR BELUNTAS (Pluchea indica L. DAN INFUSA DAUN JAMBU BIJI (Psidium guajava L. TERHADAP TIKUS PUTIH (Rattus norvegicus YANG DIINDUKSI KARAGENAN

Directory of Open Access Journals (Sweden)

Ersamukti Rahmatullah Achmad

2015-10-01

Full Text Available Marsh fleabane roots (Pluchea indica L. and guava leaves (Psidium guajava L. are traditionally used as an anti-inflammatory. The research has been conducted with the aim of knowing the anti-inflammatory effect of the combination of decoction of Marsh fleabane  roots (Pluchea indica L. and infusion of guava leaves (Psidium guajava L., and also determining  the effective concentration of such combination. The research used artificial edema method in white rat's leg ( Rattus norvegicus with the observation for 6 hours on the change of leg volume in white rat.  The measurement of white rat's leg volume used a pletismometer. The type of treatment was devided into 5 groups: negative control (Aquadest, positive control (Na Diclofenac, combination 1 (MFR 10% : IGL 8%, combination 2 (MFR 5% : IGL 5%, and combination 3 (MFR 8% : IGL 10%.  The data obtained were processed using One-Way ANOVA method with the result seen on the percent inhibition of inflammation resulting concentration of MFR 5%: IGL 5% amounting to 23.47%, and subsequently combined with a concentration of MFR 10% : IGL 8% and concentrations MFR 8% : IGL 10% respectively by the percent inhibition of inflammation by 20.70% and 13.75%.  The data obtained show the combination with a concentration of 5% : 5% have anti- inflammatory effect are better than the other combinations as well as comparable to the positive  control

The effect of organic quail egg supplementation on the blood lipid profile of white mice (Rattus Norvegicus L.) during the lactation period

Science.gov (United States)

lestari purba, Sri; Rini Saraswati, Tyas; Isdadiyanto, Sri

2018-05-01

Background: Quail eggs contain a considerable amount of complete nutritional sources such as carbohydrates, proteins, fats, and micronutrients. However, they also have a high cholesterol level, which can potentially cause atherosclerosis and chronic heart diseases. The response of the body to foods containing is influenced by factors such as ethnicity, genetics, and hormonal and nutrient status of the consumer. The cholesterol level of quail eggs can be reduced by manipulating the feed using supplemental organic feed. Organic quail eggs have been believed to correct the lipid profile of white mice during the lactation phase. Purpose: The aim of this study was to analyze the effect of feed containing organic quail eggs on the blood lipid profile of white mice (Rattus norvegicus L.) during the lactation phase. Materials and Methods: This experimental study was conducted using a completely randomized design with four experiments and five repetitions. Experimental mice: T0 mice were used as control; T1 mice were supplemented with quail eggs produced by quails that were fed with standard feed; T2 mice were supplemented with eggs produced by quails fed with standard organic feed; and T3 mice were supplemented with eggs produced by quails fed with organic feed with the addition of cassava leaf flour, mackerel flour, and turmeric powder. Quail egg supplementation was administered to the mice from the early pregnancy period till the end of the lactation phase. The acquired data were analyzed using ANOVA. SPSS version 16.0 software for Windows was used for data analyses. Results and summary: Feeding the white mice with different compositions of organic quail egg supplements had no effect on the consumption of feed and water, body weight, and lipid profile (including total cholesterol, LDL, HDL, and triglyceride) during the lactation phase (P > 0.05).

Frequent combination of antimicrobial multiresistance and extraintestinal pathogenicity in Escherichia coli isolates from urban rats (Rattus norvegicus) in Berlin, Germany.

Science.gov (United States)

Guenther, Sebastian; Bethe, Astrid; Fruth, Angelika; Semmler, Torsten; Ulrich, Rainer G; Wieler, Lothar H; Ewers, Christa

2012-01-01

Urban rats present a global public health concern as they are considered a reservoir and vector of zoonotic pathogens, including Escherichia coli. In view of the increasing emergence of antimicrobial resistant E. coli strains and the on-going discussion about environmental reservoirs, we intended to analyse whether urban rats might be a potential source of putatively zoonotic E. coli combining resistance and virulence. For that, we took fecal samples from 87 brown rats (Rattus norvegicus) and tested at least three E. coli colonies from each animal. Thirty two of these E. coli strains were pre-selected from a total of 211 non-duplicate isolates based on their phenotypic resistance to at least three antimicrobial classes, thus fulfilling the definition of multiresistance. As determined by multilocus sequence typing (MLST), these 32 strains belonged to 24 different sequence types (STs), indicating a high phylogenetic diversity. We identified STs, which frequently occur among extraintestinal pathogenic E. coli (ExPEC), such as STs 95, 131, 70, 428, and 127. Also, the detection of a number of typical virulence genes confirmed that the rats tested carried ExPEC-like strains. In particular, the finding of an Extended-spectrum beta-lactamase (ESBL)-producing strain which belongs to a highly virulent, so far mainly human- and avian-restricted ExPEC lineage (ST95), which expresses a serogroup linked with invasive strains (O18:NM:K1), and finally, which produces an ESBL-type frequently identified among human strains (CTX-M-9), pointed towards the important role, urban rats might play in the transmission of multiresistant and virulent E. coli strains. Indeed, using a chicken infection model, this strain showed a high in vivo pathogenicity. Imagining the high numbers of urban rats living worldwide, the way to the transmission of putatively zoonotic, multiresistant, and virulent strains might not be far ahead. The unforeseeable consequences of such an emerging public health

Frequent combination of antimicrobial multiresistance and extraintestinal pathogenicity in Escherichia coli isolates from urban rats (Rattus norvegicus in Berlin, Germany.

Directory of Open Access Journals (Sweden)

Sebastian Guenther

Full Text Available Urban rats present a global public health concern as they are considered a reservoir and vector of zoonotic pathogens, including Escherichia coli. In view of the increasing emergence of antimicrobial resistant E. coli strains and the on-going discussion about environmental reservoirs, we intended to analyse whether urban rats might be a potential source of putatively zoonotic E. coli combining resistance and virulence. For that, we took fecal samples from 87 brown rats (Rattus norvegicus and tested at least three E. coli colonies from each animal. Thirty two of these E. coli strains were pre-selected from a total of 211 non-duplicate isolates based on their phenotypic resistance to at least three antimicrobial classes, thus fulfilling the definition of multiresistance. As determined by multilocus sequence typing (MLST, these 32 strains belonged to 24 different sequence types (STs, indicating a high phylogenetic diversity. We identified STs, which frequently occur among extraintestinal pathogenic E. coli (ExPEC, such as STs 95, 131, 70, 428, and 127. Also, the detection of a number of typical virulence genes confirmed that the rats tested carried ExPEC-like strains. In particular, the finding of an Extended-spectrum beta-lactamase (ESBL-producing strain which belongs to a highly virulent, so far mainly human- and avian-restricted ExPEC lineage (ST95, which expresses a serogroup linked with invasive strains (O18:NM:K1, and finally, which produces an ESBL-type frequently identified among human strains (CTX-M-9, pointed towards the important role, urban rats might play in the transmission of multiresistant and virulent E. coli strains. Indeed, using a chicken infection model, this strain showed a high in vivo pathogenicity. Imagining the high numbers of urban rats living worldwide, the way to the transmission of putatively zoonotic, multiresistant, and virulent strains might not be far ahead. The unforeseeable consequences of such an emerging public

Betel Leaf Extract (Piper betle L. Antihyperuricemia Effect Decreases Oxidative Stress by Reducing the Level of MDA and Increase Blood SOD Levels of Hyperuricemia Wistar Rats (Rattus norvegicus

Directory of Open Access Journals (Sweden)

I Made Sumarya

2016-06-01

Full Text Available Background: Betel leaf extracts (Piper betle L. antioxidant activity and enzyme inhibitors of XO. Hyperuricemia cause oxidative stress by increasing the formation of reactive oxygen species (ROS cause lipid peroxidation and oxygenation of low-density lipoprotein cholesterol (LDLc. Objective: The aim of this research was to determine the betel leaf extract as an anti hyperuricemia that can lower the blood uric acid levels and oxidative stress by lowering the levels of MDA and increase the SOD of hyperuricemia of the rat’s blood. Method: Experimental research was conducted with the design of The Randomized Post Test Only Control Group Design, on normal Wistar rats (Rattus norvegicus, administered with oxonic potassium (hyperuricemia and the hyperuricemia rats either given betel leaf extract and allopurinol. After the experiment of uric acid levels, MDA and SOD in rat blood determined. Results: The results showed that the betel leaf extract significantly (p <0.05 lower uric acid levels, MDA and increase levels of SOD in rat blood. There is a positive correlation between the levels of uric acid with MDA levels and a negative correlation, although not significantly with SOD (p >0.05. Conclusion: It can be concluded that the betel leaf extract as an anti-hyperuricemia can lower the uric acid levels and decreases oxidative stress by lowering the levels of MDA and increasing the SOD.

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_001100988.1| non imprinted in Prader-Willi/Angelman syndro...me 2 homolog [Rattus norvegicus] gb|EDL86457.1| non imprinted in Prader-Willi/Angelman syndrome 2 homolog (h...uman) (predicted), isoform CRA_a [Rattus norvegicus] gb|EDL86458.1| non imprinted in Prader-Willi/Angelman s

Direct evidence of an efficient energy transfer pathway from jellyfish carcasses to a commercially important deep-water species.

Science.gov (United States)

Dunlop, Kathy M; Jones, Daniel O B; Sweetman, Andrew K

2017-12-12

Here we provide empirical evidence of the presence of an energetic pathway between jellyfish and a commercially important invertebrate species. Evidence of scavenging on jellyfish carcasses by the Norway lobster (Nephrops norvegicus) was captured during two deployments of an underwater camera system to 250-287 m depth in Sognefjorden, western Norway. The camera system was baited with two Periphylla periphylla (Scyphozoa) carcasses to simulate the transport of jellyfish detritus to the seafloor, hereby known as jelly-falls. N. norveigus rapidly located and consumed a large proportion (>50%) of the bait. We estimate that the energy input from jelly-falls may represent a significant contribution to N. norvegicus energy demand (0.21 to 10.7 times the energy required for the population of N. norvegicus in Sognefjorden). This potentially high energetic contribution from jelly-falls highlights a possible role of gelatinous material in the support of commercial fisheries. Such an energetic pathway between jelly-falls and N. norvegicus could become more important with increases in jellyfish blooms in some regions.

(RattusNorvegicus)

African Journals Online (AJOL)

2015-02-18

Feb 18, 2015 ... ... use in sickle cell disease management regimen can cause hepatocellular damage in wistar rats. ... synergistic clinical benefit in sickle cell disease. (SCD) than ... was made to expose the thoraco-abdominal region. Part of ...

Food Color Induced Hepatotoxicity in Swiss Albino Rats, Rattus norvegicus

Science.gov (United States)

Saxena, Beenam; Sharma, Shiv

2015-01-01

Objective: Certain dietary constituents can induce toxicity and play a critical role in the development of several hepatic disorders. Tartrazine, metanil yellow and sunset yellow are widely used azo dyes in food products, so the present study is aimed to investigate the food color induced hepatotoxicity in Swiss albino rats. Materials and Methods: Swiss albino rats were divided into four groups, each group having six animals. Group I served as control, Group II, Group III and Group IV were administered with 25, 50 and 75 mg/kg body weight blend of sunset yellow, metanil yellow and tartrazine for 30 days. Hepatotoxicity in rats treated with a blend of these food colors was studied by assessing parameters such as serum total protein, serum albumin, serum alkaline phosphatase (ALP) as well as hepatic malondialdehyde (MDA). The activity of superoxide dismutase (SOD), reduced glutathione (GSH) and catalase (CAT) were assessed. Results: Significantly increased concentrations of serum total protein, serum albumin, serum ALP and hepatic MDA and significantly lowered levels of SOD, reduced GSH and CAT in the liver tissue of treated animals were observed when compared with control animals. The alteration in the liver includes necrosis of hepatocytes, infiltration and vacuolation. Conclusion: The result indicates that consumption of food color in diet induces liver tissue damage. The used doses of food color were mostly attributable to hepatocellular damage and drastic alteration in antioxidant defense system. PMID:26862277

From in silico to in vitro: a trip to reveal flavonoid binding on the Rattus norvegicus Kir6.1 ATP-sensitive inward rectifier potassium channel.

Science.gov (United States)

Trezza, Alfonso; Cicaloni, Vittoria; Porciatti, Piera; Langella, Andrea; Fusi, Fabio; Saponara, Simona; Spiga, Ottavia

2018-01-01

ATP-sensitive inward rectifier potassium channels (Kir), are a potassium channel family involved in many physiological processes. K ATP dysfunctions are observed in several diseases such as hypoglycaemia, hyperinsulinemia, Prinzmetal angina-like symptoms, cardiovascular diseases. A broader view of the K ATP mechanism is needed in order to operate on their regulation, and in this work we clarify the structure of the Rattus norvegicus ATP-sensitive inward rectifier potassium channel 8 (Kir6.1), which has been obtained through a homology modelling procedure. Due to the medical use of flavonoids, a considerable increase in studies on their influence on human health has recently been observed, therefore our aim is to study, through computational methods, the three-dimensional (3D) conformation together with mechanism of action of Kir6.1 with three flavonoids. Computational analysis by performing molecular dynamics (MD) and docking simulation on rat 3D modelled structure have been completed, in its closed and open conformation state and in complex with Quercetin, 5-Hydroxyflavone and Rutin flavonoids. Our study showed that only Quercetin and 5-Hydroxyflavone were responsible for a significant down-regulation of the Kir6.1 activity, stabilising it in a closed conformation. This hypothesis was supported by in vitro experiments demonstrating that Quercetin and 5-Hydroxyflavone were capable to inhibit K ATP currents of rat tail main artery myocytes recorded by the patch-clamp technique. Combined methodological approaches, such as molecular modelling, docking and MD simulations of Kir6.1 channel, used to elucidate flavonoids intrinsic mechanism of action, are introduced, revealing a new potential druggable protein site.

Influence of CSN1S2 protein from Caprine milk Etawah Breed (EB) on histology of microglial cells in rat (Rattus norvegicus) Type-2 diabetes mellitus (T2DM)

Science.gov (United States)

Rika, Margareth; Fatchiyah

2017-11-01

Type-2 diabetes mellitus (T2DM) is a degenerative disease that causes an imbalance in the metabolism. The aim of this research is to determine the influences of CSN1S2 on the structure of microglial cells in T2DM. Rats (Rattus norvegicus) were divided into eight groups of treatment with looping three times each between treatment groups (CM) Control. The control is given a milk treatment with doses of 375 mg/kg (CM375), 750 mg/kg (CM750), and 1500 mg/kg (CM1500), T2DM (DMK), and T2DM with CSN1S2 375 mg/kg dose (DM375), 750mg/kg (DM750), and 1500 mg/kg (DM1500). The animal model T2DM was induced by a high-fat diet in the form of feed followed by injection of STZ (dose of 25 mg/kg of animal treatment) and treatment of CSN1S2 for 28 days. Brain organs were taken and analysed in histopathology stained by Hematoxylin-eosin (HE) and observed using Olympus BX53. Based on the results, it was concluded that CSN1S2 protein is influential for induction of microglial cell proliferation in animal models of T2DM, as immunity responds to the inflammatory condition in T2DM.

Analysis of lipid profile and atherogenic index in hyperlipidemic rat (Rattus norvegicus Berkenhout, 1769) that given the methanolic extract of Parijoto (Medinilla speciosa)

Science.gov (United States)

Sa'adah, Noor Nailis; Purwani, Kristanti Indah; Nurhayati, Awik Puji Dyah; Ashuri, Nova Maulidina

2017-06-01

Diet of high lipids cause hyperlipidemia, which marked by an increase of total cholesterols, triglycerides, LDL-C, and decreasing of HDL-C. Hyperlipidemia lead the occurrence of atherosclerosis, one of factors that trigger cardiovascular disease, as hypertention; coronary heart and stroke. Parijoto (M. speciosa) is endemic plants in Asia with a distribution center in Malaysia, Indonesia and Philippines. Parijoto contain phytochemical components such as flavonoids, saponins and kardenolin. Flavonoid potensial as an antioxidants and can improve the hyperlipidemia condition. This study was aimed to determine lipid profiles and atherogenic index of hyperlipidemic Wistar rats (R. norvegicus Berkenhout, 1769) which given the methanolic extract of Parijoto (M. speciosa). The research was done with pre and post test randomized control group design. Rats were given a mixture of duck yolk and reused cooking oil (1:1) orally as much as 1% of body weight (BW) for 30 days. After hyperlipidemia achieved, rats were divided into 5 group: normal rats, hyperlipidemic rats, hyperlipidemic rats were given the methanolic extract of Parijoto (M. speciosa) 500 mg/kg, 1000 mg/kg, and 1500 mg/kg BW. Blood samples were collected when rats in hyperlipidemia conditions and after treatment with the methanolic extract of Parijoto (M. speciosa) for 30 days. The data of total cholesterol, HDL-Cholesterol, LDL-Cholesterol level, and atherogenic index were analyzed using ANOVA followed by Tukey test at 5% significance level. The result showed that giving of methanolic extract of Parijoto (M. speciosa) in hyperlipidemic rats reduced the total cholesterol, LDL-Cholesterol levels, and increased of HDL-cholesterol levels significantly (p<0.01), so atherogenic index reduced significantly too (p<0.01). Total cholesterol and LDL-Cholesterol levels were positively correlated with the atherogenic index, whereas HDL-cholesterol levels were negatively correlated with the atherogenic index.

High diversity of picornaviruses in rats from different continents revealed by deep sequencing.

Science.gov (United States)

Hansen, Thomas Arn; Mollerup, Sarah; Nguyen, Nam-Phuong; White, Nicole E; Coghlan, Megan; Alquezar-Planas, David E; Joshi, Tejal; Jensen, Randi Holm; Fridholm, Helena; Kjartansdóttir, Kristín Rós; Mourier, Tobias; Warnow, Tandy; Belsham, Graham J; Bunce, Michael; Willerslev, Eske; Nielsen, Lars Peter; Vinner, Lasse; Hansen, Anders Johannes

2016-08-17

Outbreaks of zoonotic diseases in humans and livestock are not uncommon, and an important component in containment of such emerging viral diseases is rapid and reliable diagnostics. Such methods are often PCR-based and hence require the availability of sequence data from the pathogen. Rattus norvegicus (R. norvegicus) is a known reservoir for important zoonotic pathogens. Transmission may be direct via contact with the animal, for example, through exposure to its faecal matter, or indirectly mediated by arthropod vectors. Here we investigated the viral content in rat faecal matter (n=29) collected from two continents by analyzing 2.2 billion next-generation sequencing reads derived from both DNA and RNA. Among other virus families, we found sequences from members of the Picornaviridae to be abundant in the microbiome of all the samples. Here we describe the diversity of the picornavirus-like contigs including near-full-length genomes closely related to the Boone cardiovirus and Theiler's encephalomyelitis virus. From this study, we conclude that picornaviruses within R. norvegicus are more diverse than previously recognized. The virome of R. norvegicus should be investigated further to assess the full potential for zoonotic virus transmission.

NCBI nr-aa BLAST: CBRC-TNIG-01-0000 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-01-0000 ref|NP_036871.2| adrenergic receptor, alpha 2a [Rattus norvegicus...] sp|P22909|ADA2A_RAT Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor) (Alpha-2A adrenoreceptor) (Alpha-...2AAR) (CA2-47) (Alpha-2D adrenergic receptor) gb|AAC24959.1| alpha2D adrenergic receptor [Rattus norvegicus] NP_036871.2 4e-41 37% ...

NCBI nr-aa BLAST: CBRC-MMUS-19-0098 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-19-0098 ref|NP_036871.2| adrenergic receptor, alpha 2a [Rattus norvegicus...] sp|P22909|ADA2A_RAT Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor) (Alpha-2A adrenoreceptor) (Alpha-...2AAR) (CA2-47) (Alpha-2D adrenergic receptor) gb|AAC24959.1| alpha2D adrenergic receptor [Rattus norvegicus] NP_036871.2 0.0 97% ...

Pneumocystis carinii: its incidence in rodents and enhancement of the infection by corticosteroids

Directory of Open Access Journals (Sweden)

Helly A. Lage

1973-01-01

Full Text Available A survey was made on the incidence of Pneumocystis carinii in 361 rodents including sewer rats, albino rats, albino mice, guinea-pigs and rabbits. P. carinii was found in 4 of the 215 Rattus norvegicus examined (1,8%. These results accord with recent observations but disagree with investigations made by the researchers who first studied this parasite in the past when high indexes of infection were found. However, in 20 albino rats treated with corticosteroids (betamethazone we found 8 positive (40% and in 20 albino mice treated by the same way, 9 were positive for P. carinii (45%. These results confirm the opportunistic character of P. carinii in rodents already well demonstrated in man.Foi feita uma investigação sobre a ocorrência de P. carinii em 361 roedores, incluindo ratos de esgoto, ratos albinos, camundongos albinos, cobaios e coelhos. Só foram encontrados positivos 4 Rattus norvegicus em 215 examinados (1.8%. Estes resultados estão de acordo com observações feitas nos últimos anos, os quais constrastam com as verificações feitas nos primeiros anos, os quais contrastam com as verificações feitas nos primeiros anos de estudo do P. carinii, quando foram assinalados altos índices infecciosos. Entretanto, em 20 ratos albinos tratados com corticosteróides (betametasona foram encontrados 8 positivos (40%; e em 20 camundongos albinos, tratados do mesmo modo, foram encontrados 9 positivos (45%. Estes resultados confirmaram o caráter oportunístico do P. carinii no roedores, do mesmo modo como acontece no homem.

SURVEILLANCE OF SEAPORT RODENTS AND ITS PARASITES AT SEMARANG, CENTRAL JAVA, AND UJUNG PANDANG, SOUTH SULAWESI, INDONESIA

Directory of Open Access Journals (Sweden)

K. C. Megawe

2012-09-01

Full Text Available Survai rodent dan pinjal dilakukan di pelabuhan Semarang dan Ujung Pandang pada bulan Desember 1984 — Mei 1985. Pada survai tersebut ditemukan 3 jenis tikus yaitu Rattus norvegicus, R. r. diardii dan R. exulans dan satu jenis cecurut Suncus murinus. Jenis tikus yang banyak di­temukan di pelabuhan Semarang adalah R. r. diardii sedang di pelabuhan Ujung Pandang adalah R. norvegicus. Pinjal Xenopsylla cheopis ditemukan di kedua daerah yang disurvai, infestasi lebih tinggi pada R. norvegicus dan R. r. diardii daripada R. exulans dan S. murinus. Indeks pinjal di pelabuhan Ujung Pandang dan sekitarnya 4 kali lebih besar daripada di Semarang. Hasil uji kerentanan pinjal menunjukkan bahwa pinjal di kedua daerah pelabuhan tersebut masih peka terhadap DDT 4%, malathion 0,5% dan fenitrothion 1%.

Spatial transferability of habitat suitability models of Nephrops norvegicus among fished areas in the Northeast Atlantic: sufficiently stable for marine resource conservation?

Directory of Open Access Journals (Sweden)

Valentina Lauria

Full Text Available Knowledge of the spatial distribution and habitat associations of species in relation to the environment is essential for their management and conservation. Habitat suitability models are useful in quantifying species-environment relationships and predicting species distribution patterns. Little is known, however, about the stability and performance of habitat suitability models when projected into new areas (spatial transferability and how this can inform resource management. The aims of this study were to model habitat suitability of Norway lobster (Nephrops norvegicus in five fished areas of the Northeast Atlantic (Aran ground, Irish Sea, Celtic Sea, Scotland Inshore and Fladen ground, and to test for spatial transferability of habitat models among multiple regions. Nephrops burrow density was modelled using generalised additive models (GAMs with predictors selected from four environmental variables (depth, slope, sediment and rugosity. Models were evaluated and tested for spatial transferability among areas. The optimum models (lowest AICc for different areas always included depth and sediment as predictors. Burrow densities were generally greater at depth and in finer sediments, but relationships for individual areas were sometimes more complex. Aside from an inclusion of depth and sediment, the optimum models differed between fished areas. When it came to tests of spatial transferability, however, most of the models were able to predict Nephrops density in other areas. Furthermore, transferability was not dependent on use of the optimum models since competing models were also able to achieve a similar level of transferability to new areas. A degree of decoupling between model 'fitting' performance and spatial transferability supports the use of simpler models when extrapolating habitat suitability maps to different areas. Differences in the form and performance of models from different areas may supply further information on the processes

Lipid Composition of Oil Extracted from Wasted Norway Lobster (Nephrops norvegicus Heads and Comparison with Oil Extracted from Antarctic Krill (Euphasia superba

Directory of Open Access Journals (Sweden)

Amaya Albalat

2016-12-01

Full Text Available In the UK, the Norway lobster (Nephrops norvegicus supports its most important shellfish fishery. Nephrops are sold either whole, or as “tails-only” for the scampi trade. In the “tailing” process, the “head” (cephalothorax is discarded as waste. A smaller crustacean species, the Antarctic krill Euphasia superba, represents an economically valuable industry, as its extractable oil is sold as a human dietary supplement. The aim of this study was to determine the amount and composition of the oil contained in discarded Nephrops heads and to compare its composition to the oil extracted from krill. Differences due to Geographical variation and seasonal patterns in the amount and composition of lipid were also noted. Results indicated that Nephrops head waste samples collected from more southern locations in Scotland (Clyde Sea area contained higher levels of oil when compared to samples collected from northern locations in Iceland. Moreover, seasonal differences within the Clyde Sea area in Scotland were also observed, with oil extracted from Nephrops head waste peaking at around 11.5% during the summer months when larger and more mature females were caught by trawl. At this time of the year, the valuable fatty acids eicosapentaenoic acid (EPA and docosahexaenoic acid (DHA accounted for around 23% of the total fatty acid content in oil extracted from Nephrops head waste. A seasonal effect on EPA content was found, with higher levels obtained in the summer, while no trend was found in DHA percentages. Finally, oil from Nephrops head waste contained a higher proportion of EPA and DHA than krill oil but these fatty acids were more abundantly linked to the neutral lipids rather to than polar lipids. The characterization of lipid that could be extracted from Nephrops head waste should be seen as a first step for the commercial use of a valuable resource currently wasted. This approach is extremely relevant given the current limited supply of

PREVALENCE OF SOME HELMINTHS IN RODENTS CAPTURED FROM DIFFERENT CITY STRUCTURES INCLUDING POULTRY FARMS AND HUMAN POPULATION OF FAISALABAD, PAKISTAN

Directory of Open Access Journals (Sweden)

A. RAFIQUE, S. A. RANA, H. A. KHAN AND A. SOHAIL1

2009-07-01

Full Text Available The aim of the present study was to investigate prevalence of zoonotic helminths from human, Rattus rattus (R. rattus, Rattus norvegicus (R. norvegicus and Mus musculus of eight different structures, namely grain shops in grain market, departmental stores, railway godowns, food processing plants (bakeries, poultry farms, houses in kachi-abadies, houses in departmental colonies and posh residences and banglows in Faisalabad city. All the structures were sampled for 2 months each and completed in 16 months. Highest prevalence (70% of Vsmpirolepis spp. was observed in R. rattus sampled from poultry farms, which was significantly higher (P<0.05 than the prevalence of all the helminths recovered from other structures. Hymenolepis nana (H. nana was observed in 60% of the sampled Mus musculus collected from kachi-abadies, which was significantly higher (P<0.05 than all other structures studies for H. nana, except R. rattus from kachi-abadies (55% and R. norvegicus from grain shops in grain market (55%. The rodent’s endo-parasites viz., Hymenolepis nana, Teania taenaeformis, Entrobius spps and Trichuiris spps observed in R. rattus, R. norvegicus and M. musculus at different percentages were also recorded in human stool samples with an incidence of 48, 21, 76 and 10%, respectively.

HYSTOPATHOLOGIC CHANGES ON AORTA OF CIRRHOSIS MALE RATS (RATTUS NORVEGICUS INDUCTED BY ESCHERICIA COLI O55 : B5

Directory of Open Access Journals (Sweden)

Tony Hartono

2008-09-01

Full Text Available ABSTRACT The background of this study is to visualize histopathological changes on aorta of cirrhosis rats (Rattus norvegicus induced by endotoxin E. coli O55 : B5 This study was a laboratory experimental using complete randomized design with five treatments and five repetitions. Twenty five male Wistar rats were used as experimental model of cirrhosis by bile duct ligation (BDL technique. Three weeks after BDL, all cirrhosis experimental models were induced with a single intra venous injection of Eschericia coli endotoxin (3mg/kg b.b in 1 ml sterile saline, except those of five control rats that induced with sterile saline at the same volume only. Aortas of control rats group were excised at 6 hours after induction with sterile saline, whereas the other four groups were done at 6, 12, 18 and 24 hours after induction with endotoxin. The quantity of endothelial cell, discontinuity increment and the thickness of internal elastic lamina layer were observed to know histopathological changes on aorta. Histopathological changes were observed using a light mycroscope, dyscontinuity and thickness of internal elastic lamina were measured by reticular micrometer. The quantity of endothelial cell on control and observation interval of 6 and 12 hours as significant difference (P<0.05, which are bigger than that of 18 and 24 hours. Rats in the control group have the biggest quantity comparing to the other treatments. Discontinuity and thickness of internal elastic lamina layer had significant difference (P<0.05 on control, observation on 6 and 12 hours compared to observation on 18 and 24 hours after being induced with endotoxine. The highest discontinuity and the thinnest elastic lamina internal were obtained within observation on 24 hours. VCAM-1 expression on control group differ from observation on 6 and 12hours but all of them have significant difference to observation on 18 and 24 hours (P<0,05. The decrease of endothelial cell number is caused by

NCBI nr-aa BLAST: CBRC-RNOR-04-0246 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0246 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-125 75% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-1266 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1266 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 6e-64 44% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0249 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0249 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-134 76% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0238 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-133 80% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0255 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0255 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-120 74% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0243 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0243 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0244 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0244 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-175 100% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0923 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0923 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 8e-74 48% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0259 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-126 74% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0240 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0240 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...

AKTIVITAS DIURETIK KOMBINASI EKSTRAK BIJI PEPAYA (Carica papaya L DAN BIJI SALAK (Salacca zalacca varietas zalacca (Gaert.Voss PADA TIKUS JANTAN GALUR WISTAR (Rattus norvegicus L

Directory of Open Access Journals (Sweden)

Nurihardiyanti Nurihardiyanti

2015-10-01

Full Text Available Research on diuretic activity of seed extract combination of papaya (Carica papaya L and snake fruit (Salacca zalacca (Gaert. Voss to male wistar strain rats (Rattus norvegicus L. has been conducted. This study aimed to determine the diuretic effect of the seed extract combination and its effective dose combination as diuretics. The extract was prepared by maceration method using ethanol 96%. Diuretic activity test was divided into 5 treatment groups. Each group consisted of 5 rats. Group 1 (negative control was given suspension of Na-CMC 0.5%; Group 2 (positive control was given furosemide 3.6 mg/kgBW; Group 3, 4, and 5 were given dose combination of snake fruit seed extract and papaya seed extract successively at “37.5 mg/kgBW + 7.5 mg/kgBW”; “70 mg/kgBW + 15mg/kgBW”; and “140 mg/kgBW + 30 mg/kgBW”. Each rat was then orally given warm distilled water (70°C 10ml/100gBW as loading dose. The excreted urine volume was measured and recorded every 30 minutes for 6 hours which was continued to cumulative urine volume calculation. Furthermore, sample was taken from the cumulative urine to measure levels of sodium (Na, potassium (K, and the pH of the urine. Data were statistically analyzed using ANOVA (Analysis of Variance. The results showed that the effective extract dose combination was found in Group 5’s dose (140 mg/kgBW of snake fruit seed extract and 30 mg/kgBW papaya seed extract with diuretic activity index of 1.48; urine pH of 7.52; sodium saluretic index of 1.62; and potassium saluretik index of 1.56

Atividade antibacteriana e cicatrizante do óleo de buriti Mauritia flexuosa L. Antibacterial and healing activities of buriti oil Mauritia flexuosa L.

Directory of Open Access Journals (Sweden)

Jael Soares Batista

2012-01-01

Full Text Available O objetivo deste estudo foi avaliar a atividade antibacteriana in vitro e cicatrizante do óleo de buriti (M. flexuosa em feridas realizadas em ratos (Rattus norvegicus albinus. Para a avaliação antibacteriana in vitro, foram utilizados cinco patógenos bacterianos incluindo espécies gram-positivas e espécies gram-negativas mediante o uso do método de difusão em ágar. Para a avaliação da atividade cicatrizante, foram utilizados 40 ratos da linhagem Wistar, divididos em dois grupos: o grupo I, composto por 20 ratos com feridas cutâneas, tratados com aplicação tópica do creme base com 10% de óleo de buriti, e o grupo II, controle, com o mesmo número de animais que receberam a aplicação tópica do creme base. A aplicação do produto foi realizada em feridas padronizadas, circulares de 1cm de diâmetro na região dorsolombar. As avaliações clínica, morfométrica e histopatológica das feridas foram realizadas no 3°, 7°, 14° e 21° dias. Em relação à avaliação da atividade antibacteriana, os resultados mostraram que houve inibição do crescimento bacteriano em quatro dos cinco patógenos testados. Em relação à área da ferida, foi observada redução significativa da área no 14o dia e maior percentual de contração das feridas do grupo tratado em relação ao controle. No décimo quarto dia, as feridas tratadas com o óleo do buriti apresentavam aumento significativo na contagem de fibroblastos e fibras colágenas, além de completo processo de reepitelização, enquanto o grupo controle necessitava de mais tempo para resolução do processo cicatricial.The aim of this study was to evaluate the in vitro antimicrobial activity and wound healing effect of buriti oil (M. flexuosa in rats. To evaluate the in vitro antimicrobial activity, five species of bacteria, including both gram-negative and gram-positive, were tested by the agar diffusion method. To assess the wound healing effect, 40 rats of Wistar lineage were

STUDIES ON INDUCED HEPATOTOXICITY IN MALE ALBINO RATS (RATTUS NORVEGICUS)

International Nuclear Information System (INIS)

ABULYAZID, I.; ABBAS, O.A.; FAYEZ, V.

2008-01-01

Levanox, a hepato protective drug, and garlic powder have been considered as safe anti-oxidant agents. The present investigation refers to biochemical and molecular studies to evaluate the protective role of levanox and/or garlic powder toward CCl4-induced toxicity in adult male albino rats. CCl4 intoxication was attempted using a dose of 0.03 ml/kg of rat body weight.Pre-treatment with levanox (one capsule/ kg of rat body weight, each capsule contains 100 mg catechu, 7.5 mg dandelion, 75 mg termiric 2 % curcumin , 17.5 mg silymarin, 100 mg lecithin) was more effective than garlic powder (100mg/kg of rat body weight) in reducing CCl4-induced hepatotoxicity as revealed by its higher potency in reducing elevation of aspartate (AST) and alanine (ALT) aminotransferases in serum. Serum of control rats and those treated with levanox or garlic or CCl4 produced 13 types of proteins, differing in the molecular weight (MW) and densities, while those of levanox + garlic or garlic +CCl4 produced 14 bands differing in the MW and densities. The similarity index at the epigenetic level was also studied using the primers under study. The control sample produced one amplified DNA fragment with Rf of 0.73 and a molecular size (MS) of 67 base pair (bp) . Using the same primers, no amplified DNA fragment with the same MS was produced in the sample taken from levanox + garlic treated group.OPA-2 primer of sequence 5?- AGA TGC AGC C-3? produced one amplified DNA band with MS of 292 bp and Rf of 0.46 . However, the same primer produced one amplified DNA characteristic band with a molecular size of 363 bp and Rf of 0.43 in the sample of levanox + garlic group.In the control sample, OPA-4 primer of sequence 5? - ACG CAC AAC C-3? produced one amplified DNA band of MS of 299 bp and Rf of 0.43. The same primer produced one amplified characteristic DNA band with MS of 363 bp and Rf of 0.43 in the sample of levanox + garlic group.Dual treatment with levanox and garlic powder resulted in a

Effect of Turmeric Etanol Extract (Curcuma Longa L) on Low Density Lipoprotein Level and Liver Histopathology Image in Type 1 Diabetes Mellitus Rat Model Induced by Streptozotocin

OpenAIRE

Herlina Pratiwi; Djoko Winarso; Nunung Handoyo

2017-01-01

This study was conducted to determine levels of LDL and liver damage in rats (Rattus norvegicus) models of type 1 diabetes mellitus inducted by streptozotocin (STZ) with etanol extract of turmeric (Curcuma Longa L) therapy. Animals used rat (Rattus norvegicus) 3-month-old males who were divided into 5 groups, each group consisting of four mice. The group was divided according to treatment: negative control (not induced by STZ), the positive control group (STZ induced), groups of rats DM 1 wit...

Gene Therapy for Fracture Repair

Science.gov (United States)

2007-05-01

modulator-1; c-myc binding protein [ Homo sapiens ]. regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin...myc binding protein [ Homo sapiens ] Regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin (A2m) Protease...1-HIV LTR-MLV Promoter EG FP -C el l N um be r (M ea n) 10 ul Vector 50 ul Vector 7 Periosteal/Endosteal Cell Transduction 0 200 400 600 800

Ornitina alfa-cetoglutarato na isquemia-reperfusÃo intestinal em ratos

OpenAIRE

Eduardo Silvio Gouveia GonÃalves

2009-01-01

Objetivo: Avaliar os efeito da ornitina α-cetoglutarato (OKG) no sangue e tecido intestinal de ratos submetidos à isquemia/reperfusÃo intestinal atravÃs da determinaÃÃo das concentraÃÃes in vivo no sangue e no tecido do intestino delgado, submetido a isquemia/reperfusÃo, de glicose, G 6 PDH, piruvato, acetoacetato, lactato, 3 HBDH, glutationa, T-Bars, mieloperoxidase, CPK e LDH. MÃtodo: Sessenta ratos (Rattus norvergicus albinus, Rodentia Mammalia) foram distribuÃdos aleatoriamente em ci...

Comparative Ultrastructural Studies on the Impact of Moderate and Hyperthermic Environment on the Corneal Structure of two Species of Wild Rodents

International Nuclear Information System (INIS)

Naguib, N.I.; El-Dawi, E.F.

2011-01-01

This study was carried out to investigate the impact of environmental climate (temperature) on the corneal structure of two wild rodents; the nocturnal Norway rats (Rattus norvegicus) and the diurnal golden spiny mouse (Acomys russatus). Both rodents were collected from two extreme climatic environment and their dissected corneas were prepared for light, scanning and transmission electron microscopy. The corneas of both rodents are composed of three main layers; an outer epithelium, stroma, Descemet's membrane, and an inner endothelium. The mean thickness of the epithelium, stroma, Descemet's membrane and inner endothelium of both rodents were measured. The scanning electron microscopy revealed that in R. norvegicus and A. russatus; the outermost cells of the corneal epithelium, are mostly polygonal in shape with nearly regular borders and show dense pattern of microplicae with different scatter electron that exhibits three polymorphic appearances (A, B, C) and two (A, B), respectively. Numerous A-light cells with dense microplicae, many B-dark cells with a moderate density of microplicae and few C-dark cells with a less density of microplicae were observed. Using transmission electron microscope, the epithelial cells of both species possess glycocalyx and the cytokeratin filaments are more extensive in the apical epithelial cells in A. russatus. The stroma in R. norvegicus is formed of outer and inner lamellar zones with spaces in between its wavy bundles. In A. russatus, the stroma is formed of one lamellar zone of flattened bundles of highly wavy and branched collagen fibrils. On the other hand, the surface of the endothelial cells in R. norvegicus is slightly bulging with many blebs whereas it showed flattened and nearly smooth surface in A. russatus. In conclusion, the differences in the number of the superficial epithelial cells and the thickness of the stroma and structure of the endothelium of R. norvegicus (nocturnal) and A. russatus (diurnal) are most

Biochemical and histopathological profiling of Wistar rat treated with Brassica napus as a supplementary feed

Directory of Open Access Journals (Sweden)

Kazi Md. Mahmudul Hasan

2018-03-01

Full Text Available Metabolic changes together with cardiovascular and hepatic factors are related to the development of diseases like myocardial lipidosis, heart disease, and profound toxicity. The aim of this animal study is to determine the effects of high erucic acid containing rapeseed oil (Brassica napus L. varieties on liver, kidney and heart muscles in Wistar rats. Male Wistar rats were divided into three groups where each group containing four rats. Group A was considered as control diet group, while Group B rapeseed wild oil group and Group C rapeseed hybrid oil group were considered as experimental diet groups. The levels of aspartate aminotransferase (AST, alanine aminotransferase (ALT,alkaline phosphatase(ALP, creatine kinase-MB (CK-MB and creatinine of two experimental groups were significantly elevated while compared to the control groups (p  0.05. Noticeable tissue injury observed in this study is a sign of the relative toxicity of erucic acid containing rapeseed oil to mammalian species. The use of Brassica napus as a supplementary feed ingredient should be, therefore, thoroughly considered Keywords: Rapeseed oil, Rattus norvegicus, Serum enzymes, Erucic acid, Tissue profiling

Gene : CBRC-MLUC-01-0981 [SEVENS

Lifescience Database Archive (English)

Full Text Available CTED: similar to Salivary gland secretion 1 CG3047-PA [Rattus norvegicus] 7e-34 41% MPQATMPIDHDAHRPRCPQVYDAHSPDAHRSRCSQATMP...TGHDAHRPRCSQAPMPTGHDARRPRCSQARCPTGHDAHRPRCPQATMFTGHDAHRPRCSQATMPTGHDAHRPRCPQATMPTGHDAHRPRCSQAMMPTGHDVHRPRCLQATMPTGHDVHRPRCLQATMPTGHDARRPRCSQAMMPAGHDAHRP ...

Systematics and position of Nephrops among the lobsters.

Science.gov (United States)

Tshudy, Dale

2013-01-01

This chapter presents and explains the position of Nephrops norvegicus in the classification of lobsters. Covered, in order, are systematic classification of Nephrops, taxonomic history of Nephrops, and analysis of Nephrops in nephropid phylogeny. The genus Nephrops was erected by Leach in 1814 and has a long and interesting taxonomic history. Prior to 1972, Nephrops was known by 14 Recent species. All but one of these, N. norvegicus, were removed to a new genus, Metanephrops, by Jenkins (1972). Today, N. norvegicus is still the only known living representative of the genus. Similarly, Nephrops is known by only one fossil species, the Miocene Nephrops kvistgaardae, although several other fossil species have been previously referred to this genus. Nephrops, along with the other familiar and commercially important marine clawed lobsters, is referred to Family Nephropidae, one of 17 marine clawed lobster families arrayed in 3 infraorders, 6 families each in the Astacidea and Glypheidea and 5 in the Polychelida. Infraorder Astacidea includes the Superfamily Nephropoidea, as well as the lesser known 'reef lobsters' of the Superfamily Enoplometopoidea, and the freshwater crayfish, Superfamily Astacoidea. In phylogenetic analyses, the freshwater crayfish form a sister group to the Nephropoidea. It is interpreted that freshwater crayfish evolved from nephropoid lobsters, but from which lobster group is uncertain. The taxonomic placement of N. norvegicus is stable at all levels, from species on up. Despite that, the phylogenetic relationships of Nephrops to other nephropid genera are unsettled due to conflicting results in morphological and molecular analyses. Currently, new morphological characters and new genes are being analysed in the hope of elucidating nephropid phylogeny. Copyright © 2013 Elsevier Ltd. All rights reserved.

Dicty_cDB: Contig-U06984-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available tigen NY-CO-7 (NY-C... 36 0.56 AF129085_1( AF129085 |pid:none) Homo sapiens carboxy terminus of H... 36 0.56... DNA Entam... 44 5.1 1 ( EK423693 ) 1095515647805 Global-Ocean-Sampling_GS-31-01-...2962047198 Global-Ocean-Sampling_GS-31-01-01-1... 34 8.3 2 ( AC117108 ) Rattus norvegicus clone CH230-240I5,...SEQUENC... 30 8.6 2 ( EK533234 ) 1095516016996 Global-Ocean-Sampling_GS-32-01-01-1... 40 8.9 2 ( AC106212 ) ...Rattus norvegicus clone CH230-42I19, *** SEQUENCI... 30 9.0 2 ( ER390099 ) 1094428835918 Global-Ocean-Sampli

EFEK PEMBERIAN SUSU SAPI BUBUK TERHADAP KADAR SERUM HDL (HIGH DENSITY LIPOPROTEIN PADA TIKUS PUTIH (Rattus norvegicus GALUR WISTAR MODEL DIABETES MELITUS TIPE 2

Directory of Open Access Journals (Sweden)

Zakia Umami

2015-05-01

Full Text Available ABSTRACTThe purpose of this study was to determine the cow’s milk powder to increased serum levels of High Density Lipoprotein (HDL of white male rat model with diabetes mellitus type 2. The design of this study was a post-test control group study conducted in 30 male rats which randomly divided into five groups. Negative control group was the group of rats which fed normally, the positive control group was induced by streptozotocin (STZ without given cow’s milk, group P1, P2, P3 were given a normal diet and cow’s milk 0.9; 1.8, and 2.7 g orally every day. The results of this study were the levels of HDL in K(-=44.22 mg/dl, K(+=47.45 mg/dl, P1=56.56 mg/dl, P2=51.82 mg/dl, and P3=59.45 mg/dl. The conclusion was the milk powder was not significantly increase levels of HDL (p>0.05. More longer intervention was suggested for further research to get more significant of HDL level on type 2 diabetes mellitus.Keywords: HDL serum level, high fat diet, milk powder, streptozotocinABSTRAKTujuan penelitian ini adalah menganalisis pengaruh pemberian susu sapi bubuk terhadap peningkatan kadar serum High Density Lipoprotein (HDL tikus putih (Rattus norvegicus berjenis kelamin jantan model diabetes melitus (DM tipe 2. Penelitian ini menggunakan desain penelitian post test control group dengan 30 ekor tikus dibagi secara acak menjadi lima kelompok. Kelompok K(- adalah tikus yang diberi pakan normal, kelompok K(+ diinduksi dengan streptozotocin (STZ tanpa diberi susu, kelompok P1 sampai P3 diberi diet normal dan susu 0,9; 1,8, dan 2,7 g secara oral setiap hari. Hasil penelitian menunjukkan kadar HDL pada K(-=44,22 mg/dl, K(+=47,45 mg/dl, P1=56,56 mg/dl, P2=51,82 mg/dl, dan P3=59,45 mg/dl. Susu sapi bubuk mampu meningkatkan kadar HDL tikus model DM tipe 2 akan tetapi tidak signifikan (p>0,05. Perlu dilakukan penelitian lebih lanjut dengan waktu lama penelitian yang berbeda sehingga bisa berdampak yang lebih signifikan untuk kadar HDL pada DM tipe 2.Kata kunci

Tricky Treats

Centers for Disease Control (CDC) Podcasts

The Eagle Books are a series of four books that are brought to life by wise animal characters - Mr. Eagle, Miss Rabbit, and Coyote - who engage Rain That Dances and his young friends in the joy of physical activity, eating healthy foods, and learning from their elders about health and diabetes prevention. Tricky Treats shows children the difference between healthy snacks and sweet treats.

Estudo morfométrico de pulmões remanescentes de ratos após lobectomia ou bilobectomia Morphometric study of the remaining lungs of rats submitted to lobectomy or bilobectomy

Directory of Open Access Journals (Sweden)

Amélia C. Seidel

1997-12-01

Full Text Available Este estudo foi realizado para analizar a morfometria de pulmões remanescentes de ratos tendo-se como parâmetros o peso e o volume médio pulmonares. Foram utilizados 45 Rattus novergicus albinus, Wistar, fêmeas, adultos. Os animais foram divididos em 3 grupos. Grupo I, submetido a lobectomia média do pulmão direito; grupo II, a bilobectomia cranial e média do pulmão direito e o grupo controle não sofreu intervenção cirúrgica. Os 3 grupos foram submetidos para avaliação do pós-operatório aos 30 e 60 dias. A comparação entre os grupos operados e destes com o grupo controle não apresentou diferenças significantes quanto aos parâmetros estudados.The present study has been carried out in order to analyse the morphometry of remaining lungs of rats bearing in mind the average weight and volume of these lungs. Forty-five female adults Rattus novergicus albinus, Wistar were utilized. The animals were divided into three groups. Group I was submitted to middle lobectony of the right lung. Group II was submitted to upper and middle bilobectomy of the right lung and the control group did not undergo operation. The groups were subdivided into subgroups for post operatory evaluation at 30 and 60 days. The comparison between the groups operated on and the comparison between these two groups with the control group did not show major differences regarding average weight and volume of the lungs.

Microscopic Evaluation of the Effect of Oral Microbiota on the Development of Bisphosphonate-Related Osteonecrosis of the Jaws in Rats

Directory of Open Access Journals (Sweden)

Felipe M. Silveira

2017-01-01

Full Text Available Objectives: Osteonecrosis of the jaws is a side effect associated with the use of bisphosphonates. Using histologic analysis, this study aimed to evaluate the influence of microbial colonies in the development of osteonecrosis in the jaws of rats subjected to nitrogenous and non-nitrogenous bisphosphonates, undergoing surgical procedures. Material and Methods: Thirty-four rats (Rattus norvegicus, Wistar strain were allocated randomly into three groups: 12 animals treated with zoledronic acid; 12 animals treated with clodronate; and 10 animals treated with saline. Sixty days after the start of treatment, the animals underwent three extractions of the upper right molars. After 120 days of drug administration, the rats were killed. Histologic analysis was performed on specimens stained with hematoxylin and eosin by the technique of manual counting points using Image-Pro Plus software on images of the right hemimaxilla. Results: Osteonecrosis was induced in the test groups. There was no statistically significant association between the presence of microbial colonies and the presence of non-vital bone (Kruskal-Wallis, P > 0.05. Conclusions: Use of zoledronic acid was associated with non-vital bone and the results suggested that the presence of microbial colonies does not lead to osteonecrosis.

UniProt search blastx result: AK287898 [KOME

Lifescience Database Archive (English)

Full Text Available oxidil sulfotransferase) (Mx-ST) - Rattus norvegicus (Rat) 4.00E-21 ... ...ransferase) (Phenol sulfotransferase) (PST-1) (Sulfokinase) (Aryl sulfotransferase IV) (ASTIV) (Tyrosine-ester sulfotransferase) (Min

UniProt search blastx result: AK287865 [KOME

Lifescience Database Archive (English)

Full Text Available oxidil sulfotransferase) (Mx-ST) - Rattus norvegicus (Rat) 4.00E-23 ... ...ransferase) (Phenol sulfotransferase) (PST-1) (Sulfokinase) (Aryl sulfotransferase IV) (ASTIV) (Tyrosine-ester sulfotransferase) (Min

Pharmacotherapeutic approaches for treating psoriasis in difficult-to-treat areas.

Science.gov (United States)

Kivelevitch, Dario; Frieder, Jillian; Watson, Ian; Paek, So Yeon; Menter, M Alan

2018-04-01

Despite great therapeutic advancements in psoriasis, four notable difficult-to-treat areas including the scalp, nails, intertriginous (including genitals), and palmoplantar regions, pose a challenge to both physicians and patients. Localized disease of these specific body regions inflicts a significant burden on patients' quality of life and requires an adequate selection of treatments. Areas covered: This manuscript discusses appropriate therapies and important treatment considerations for these difficult-to-treat areas based on the available clinical data from the literature. Expert opinion: Clinical trials assessing therapies for the difficult-to-treat areas have been inadequate. With the first biological clinical trial for genital psoriasis pending publication, it is with hope that other biological agents will be evaluated for region-specific psoriasis. A greater understanding of the genetic and immunologic aspects of regional psoriasis, as well as identification of unique biomarkers, will further guide management decisions. For example, the recent discovery of the IL-36 receptor gene for generalized pustular psoriasis may prove valuable for other forms of psoriasis. Ultimately, identification of the most beneficial treatments for each psoriasis subtype and difficult-to-treat area will provide patients with maximal quality of life.

Tricky Treats

Centers for Disease Control (CDC) Podcasts

2008-08-04

The Eagle Books are a series of four books that are brought to life by wise animal characters - Mr. Eagle, Miss Rabbit, and Coyote - who engage Rain That Dances and his young friends in the joy of physical activity, eating healthy foods, and learning from their elders about health and diabetes prevention. Tricky Treats shows children the difference between healthy snacks and sweet treats.  Created: 8/4/2008 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 8/5/2008.

Treating chancroid with enoxacin.

Science.gov (United States)

Naamara, W; Kunimoto, D Y; D'Costa, L J; Ndinya-Achola, J O; Nsanze, H; Ronald, A R; Plummer, F A

1988-01-01

Increasing resistance of Haemophilus ducreyi to antimicrobials necessitates further trials of new antimicrobial agents for treating chancroid. Enoxacin has excellent in vitro activity against H ducreyi, and a randomised clinical trial of three doses of enoxacin 400 mg at intervals of 12 hours compared with a single dose of trimethoprim/sulphametrole (TMP/SMT) 640/3200 mg was therefore conducted. Of 169 men enrolled in the study, 86 received enoxacin and 83 received TMP/SMT. Ulcers were improved or cured in 65/73 men treated with enoxacin and 57/70 men treated with TMP/SMT. This difference was not significant. At 72 hours after treatment, H ducreyi was eradicated from ulcers of 72/77 men treated with enoxacin and of 67/74 of those treated with TMP/SMT. Patients with buboes responded equally well to both treatments. Of 100 H ducreyi strains tested, all were susceptible to both 0.25 mg/l enoxacin and the combination of 0.25 mg/l TMP and 5 mg/l SMT. Although most men treated with either regimen were cured, neither regimen appeared to be the optimum treatment for chancroid. This study shows the efficacy of enoxacin for a soft tissue infection caused by Gram negative organisms. PMID:3044978

Treated Effluent Disposal Facility

Data.gov (United States)

Federal Laboratory Consortium — Treated non-hazardous and non-radioactive liquid wastes are collected and then disposed of through the systems at the Treated Effluent Disposal Facility (TEDF). More...

Intention-to-treat

OpenAIRE

Molenberghs, Geert

2005-01-01

The randomized clinical trial paradigm is sketched, as well as the foundations on which its validity is based. Issues that jeopardize this validity, such as patient noncompliance and early withdrawal, are discussed. Intention to treat, being an important historical answer to this problem, is introduced, together with a set of criticisms and an indication of alternative approaches. as-treated analysis;clinical trial;incomplete data;last observation carried forward;randomization

Arabidopsis CDS blastp result: AK105135 [KOME

Lifescience Database Archive (English)

Full Text Available AK105135 001-102-A05 At2g27170.1 structural maintenance of chromosomes (SMC) family protein similar to basem...ent membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:178

Upgrading of TREAT experimental capabilities

International Nuclear Information System (INIS)

Dickerman, C.E.; Rose, D.; Bhattacharyya, S.K.

1982-01-01

The TREAT facility at the Argonne National Laboratory site in the Idaho National Engineering Laboratory is being upgraded to provide capabilities for fast-reactor-safety transient experiments not possible at any other experimental facility. Principal TREAT Upgrade (TU) goal is provision for 37-pin size experiments on energetics of core-disruptive accidents (CDA) in fast breeder reactor cores with moderate sodium void coefficients. this goal requires a significant enhancement of the capabilities of the TREAT facility, specifically including reactor control, hardened neutron spectrum incident on the test sample, and enlarged building. The upgraded facility will retain the capability for small-size experiments of the types currently being performed in TREAT. Reactor building and crane upgrading have been completed. TU schedules call for the components of the upgraded reactor system to be finished in 1984, including upgraded TREAT fuel and control system, and expanded coverage by the hodoscope fuel-motion diagnostics system

Estrogen hormone level of prepubertal female rat treated with Calliandra calothyrsus ethanolic leaf extract

Science.gov (United States)

Setyawati, I.; Wiratmini, N. I.; Narayani, I.

2018-03-01

This research examined the phytoestrogen potential of Calliandra calothyrsus leaf extract in prepubertal female rat (Rattus norvegicus). Sixty weaned female rats (21 days old) were divided into five groups i.e. control (K), negative control which was given 0.5% Na CMC suspension (KN) and treatment groups which were given with C. calothyrsus ethanolic leaf extract doses 25 mg/kg bw (P1), 50 mg/kg bw (P2) and 75 mg/kg bw (P3). The treatment suspension was administered 0.5 mL/rat/day by gavage for 28 days, started at the age of 21st days old. The rats were sacrificed and the blood samples were collected from 4 rats / group at the age of 28th, 42nd and 56th days old, each. The concentration of estrogen hormone levels were measured from blood serum by ELISA kit and were read at 450 nm wavelength with an ELISA Spectrophotometer. Data was analyzed statistically by General Linear Model with 95% of confidence. The result showed that rat’s body weight decreased significantly with the higher doses and the longer the treatment of C. calothyrsus leaf extract due to the anti-nutritive activity of calliandra tannins. The estrogen hormone level was significantly increased at the highest dose. The highest estrogen levels were found in the group of female rats which were given the exctract of 75 mg/kg bw until the age of 42nd days. This results showed that there was a phytoestrogen potential in the C. calothyrsus leaf extract.

GenBank blastx search result: AK058591 [KOME

Lifescience Database Archive (English)

Full Text Available AK058591 001-017-G08 AY953023.1 Rattus norvegicus smooth muscle myosin heavy chain, alternative... isoform B, S1 region mRNA, partial cds, alternatively spliced.|ROD ROD 4e-66 +2 ...

To treat or not to treat: should psychologists treat tobacco use disorder?

Science.gov (United States)

Bodie, Linda P

2014-08-01

The author presented this Presidential Address for Divison 18, Psychologists in Public Service, at the 2012 American Psychological Association Convention in Orlando, Florida. The address challenges public service psychologists to reduce the tobacco disease burden through their roles as researchers, leaders, educators, and practitioners and explains why treating tobacco use disorder is important and relevant for psychologists. The address discusses the prevalence and the resulting mortality and morbidity rates of tobacco use disorder, which call for effective evidence-based interventions that can be integrated by psychologists into other ongoing treatments. Treatment of the underserved populations, including those with serious mental illness and/or substance use disorders, presents many barriers. In addition, education and training for tobacco use disorder in undergraduate and graduate clinical psychology programs present further barriers for psychology trainees. However, progress is being made because of the numerous resources and psychology leaders who are advocates for tobacco use disorder treatment and research. Challenges for the future include increasing awareness of the importance of treatment for tobacco use disorder, finding innovative ways to increase access to comprehensive evidence-based treatment, and acknowledging that psychologists can make a difference in reducing the tobacco use disorder disease burden. Psychologists have an ethical and professional responsibility to treat tobacco use disorder.

The activity of pomegranate extract standardized 40% ellagic acid during the healing process of incision wounds in albino rats (Rattus norvegicus

Directory of Open Access Journals (Sweden)

Wiwik Misaco Yuniarti

2018-03-01

Full Text Available Aim: This research aimed to evaluate the effects of pomegranate extract standardized to 40% ellagic acid on the incised wound in albino rats. Materials and Methods: Fifty albino rats were divided into 10 treatment groups. The five groups were sacrificed on the 8th day, while the others were sacrificed on the 15th day. Two groups of albino rats with incised wound were not treated at all (P0, the other two groups of albino rats with incised wound were treated with Betadine® (P1 ointment, and the rest of the groups were treated with pomegranate extract standardized to 40% ellagic acid with a concentration of 2.5% (P2, 5% (P3, and 7.5% (P4. The treatments were carried out twice a day with an interval of 12 h for 7 and 14 days. At the end of the research, the skin tissue of those albino rats had been taken for histopathologic preparations before H and E staining was performed. Results: Collagen deposition, polymorphonuclear neutrophils (PMN infiltration, angiogenesis, and fibrosis degree in Group P4 treated with 7.5% pomegranate extract standardized to 40% ellagic acid for 14 days were significantly different from those in Groups P0, P1, P2, and P3, especially in the case of PMN inflammation (p<0.05. Conclusion: The administration of 7.5% pomegranate extract standardized to 40% ellagic acid for 14 days on incised wounds of those albino rats can accelerate the wound healing process characterized by collagen deposition improvement, PMN infiltration in the wound area, angiogenesis, and fibrosis degree.

The effect of low LET (Linear Energy Transfer ionizing radiation to catalase activity of Wistar’s submandibular gland

Directory of Open Access Journals (Sweden)

Nevy Triditha Putri

2016-12-01

Full Text Available Intraoral periapical radiograph examination is the additional examination which is the most widely used in Dentistry. This radiograph examination using an x-ray ionizing radiation with low LET (Linear Energy Transfer, and may affect submandibular salivary gland. Ionizing radiation exposure can cause damage by inducing a series of changes at the molecular and cellular level. This study aimed to prove the effects of x-ray ionizing radiation with low LET towards the catalase activity of Rattus norvegicus strain Wistar’s submandibular gland. The subjects were 28 male Wistar rats and divided into 4 groups (n=7. Three groups were exposed 4, 8 and 14 times to radiation with 0.002 µSv for each exposure. The catalase activity of each rat was examined by a spectrophotometer. Data were analyzed using one-way ANOVA followed by Bonferroni test. The results showed the average of catalase activity on Wistar rat’s submandibular gland, respectively for: 0.150±0.0895 (KK, 0.1405±0.0607 (K1, 0.1228±0.0290 (K2, 0.1227±0.0556 (K3. Data showed significant differences of catalase activity between test groups, but showed not significant differences of catalase activity between each groups of Rattus norvegicus strain Wistar’s submandibular gland. In this study concluded decreased catalase activity of Rattus norvegicus strain Wistar’s submandibular gland resulting from x-rays ionizing radiation by 4 times, 8 times and 14 times exposures.

Comparative Studies on the Cardiovascular System in the Wistar ...

African Journals Online (AJOL)

PROF HORSFALL

http://ww.bioline.org.br/ja. Comparative Studies on the Cardiovascular System in the Wistar Rat (Rattus .... norvegicus) were gotten from the animal house of the. Department of Anatomy .... Locomotion and Respiration in. Marine Air – Breathing ...

UniProt search blastx result: AK287865 [KOME

Lifescience Database Archive (English)

Full Text Available AK287865 J065201C22 P49889|ST1E3_RAT Estrogen sulfotransferase, isoform 3 (EC 2.8.2....4) (EST-3) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 2.00E-28 ...

UniProt search blastx result: AK287865 [KOME

Lifescience Database Archive (English)

Full Text Available AK287865 J065201C22 P52844|ST1E1_RAT Estrogen sulfotransferase, isoform 1 (EC 2.8.2....4) (EST-1) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 3.00E-28 ...

UniProt search blastx result: AK287865 [KOME

Lifescience Database Archive (English)

Full Text Available AK287865 J065201C22 P49890|ST1E6_RAT Estrogen sulfotransferase, isoform 6 (EC 2.8.2....4) (EST-6) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 1.00E-27 ...

UniProt search blastx result: AK287898 [KOME

Lifescience Database Archive (English)

Full Text Available AK287898 J065210I16 P52845|ST1E2_RAT Estrogen sulfotransferase, isoform 2 (EC 2.8.2....4) (EST-2) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 2.00E-18 ...

UniProt search blastx result: AK287898 [KOME

Lifescience Database Archive (English)

Full Text Available AK287898 J065210I16 P49890|ST1E6_RAT Estrogen sulfotransferase, isoform 6 (EC 2.8.2....4) (EST-6) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 2.00E-18 ...

UniProt search blastx result: AK287898 [KOME

Lifescience Database Archive (English)

Full Text Available AK287898 J065210I16 P49889|ST1E3_RAT Estrogen sulfotransferase, isoform 3 (EC 2.8.2....4) (EST-3) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 1.00E-18 ...

UniProt search blastx result: AK287898 [KOME

Lifescience Database Archive (English)

Full Text Available AK287898 J065210I16 P52844|ST1E1_RAT Estrogen sulfotransferase, isoform 1 (EC 2.8.2....4) (EST-1) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 6.00E-19 ...

UniProt search blastx result: AK289207 [KOME

Lifescience Database Archive (English)

Full Text Available sor (EC 1.4.1.3) (GDH) (Memory-related protein 2) (MRG-2) - Rattus norvegicus (Rat) 1.00E-64 ... ...AK289207 J100056H18 P10860|DHE3_RAT Glutamate dehydrogenase 1, mitochondrial precur

Escape panels in trawls – a consistent management tool?

DEFF Research Database (Denmark)

Krag, Ludvig Ahm; Herrmann, Bent; Feekings, Jordan P.

2016-01-01

), saithe (Pollachius virens), haddock (Melanogrammus aeglefinus), plaice (Pleuronectes platessa) and Norway lobster (Nephrops norvegicus). Thus the modification by fishers of certain gear properties not specified in the legislation can significantly influence the efficiency of an escape panel. We discuss...

[Urinary tract infections in pregnancy: when to treat, how to treat, and what to treat with].

Science.gov (United States)

Kladenský, J

2012-04-01

Urinary tract infections (UTI) in pregnant women are a relatively frequent occurrence and the spectrum of these infections ranges from lower urinary tract disease (asymptomatic bacteriuria, acute cystitis) to upper urinary tract disease (acute pyelonephritis). Anatomical and functional changes in the urinary tract in pregnancy result in significantly higher susceptibility to progression of the infection from asymptomatic bacteriuria to the stage of acute pyelonephritis. Untreated asymptomatic bacteriuria in pregnancy leads, in as much as 40%, to the development of acute pyelonephritis with all the subsequent negative effects not only for the woman herself, but particularly for the fetus. Bacteriuria in pregnancy accounts for a significantly higher number of newborns with a low birth weight, low gestational age and higher neonatal mortality rate. Therefore, it is necessary to perform screening for bacteriuria in pregnant women and, when the finding is positive, to treat this bacteriuria. The selection of an appropriate antimicrobial agent to treat urinary tract infection in pregnancy is limited by the safety of a given drug not only for the woman, but particularly for the fetus. The article provides an overview of medications that can be safely used throughout the pregnancy or only in certain stages of pregnancy. The selection of an appropriate antibiotic should always be preceded by the result of urine culture. The article presents the principles and rules for treating asymptomatic bacteriuria, acute cystitis and acute pyelonephritis in pregnant women.

Fulltext PDF

Indian Academy of Sciences (India)

rats and mice have, as commensals of man or by natural means, invaded every continent ... Split open the kegs of salted sprats. Made nests inside the ... The brown rat, Rattus norvegicus, also called the field or sewer. Rodents encompass a ...

Immunocytochemistry of the nervous system and the musculature of the chordoid larva of Symbion pandora (Cycliophora)

DEFF Research Database (Denmark)

Wanninger, Andreas

2005-01-01

To date, the phylum Cycliophora comprises only one described extant species of acoelomate marine invertebrates, Symbion pandora. Adult specimens live commensally on the mouthparts of the Norwegian lobster, Nephrops norvegicus. Its complicated life cycle includes an asexually produced Pandora larva...

Increased systolic ambulatory blood pressure and microalbuminuria in treated and non-treated hypertensive smokers

DEFF Research Database (Denmark)

Sørensen, Kaspar; Kristensen, Kjeld S; Bang, Lia E

2004-01-01

The primary aim of the present study was to evaluate the impact of smoking status on both clinic and ambulatory blood pressure (BP) and heart rate (HR) by using 24-h ambulatory BP monitoring in treated and non-treated hypertensive smokers and non-smokers. A secondary aim was to evaluate...

Process for treating oil-chalk

Energy Technology Data Exchange (ETDEWEB)

1925-10-20

A process for treating oil-chalk or similar oil-containing minerals is characterized in that the material is treated in a stream of air diluted with indifferent gases at a temperature of about 150/sup 0/ to 160/sup 0/C.

Hybrid options for treating cardiac disease.

Science.gov (United States)

Umakanthan, Ramanan; Leacche, Marzia; Zhao, David X; Gallion, Anna H; Mishra, Prabodh C; Byrne, John G

2011-01-01

The options for treating heart disease have greatly expanded during the course of the last 2 1/2 decades with the advent of hybrid technology. The hybrid option for treating cardiac disease implies using the technology of both interventional cardiology and cardiac surgery to treat cardiac disease. This rapidly developing technology has given rise to new and creative techniques to treat cardiac disease involving coronary artery disease, coronary artery disease and cardiac valve disease, and atrial fibrillation. It has also led to the establishment of new procedural suites called hybrid operating rooms that facilitate the integration of technologies of interventional cardiology catheterization laboratories with those of cardiac surgery operating rooms. The development of hybrid options for treating cardiac disease has also greatly augmented teamwork and collaboration between interventional cardiologists and cardiac surgeons. Copyright © 2011 Elsevier Inc. All rights reserved.

Application of a CCA-treated wood waste decontamination process to other copper-based preservative-treated wood after disposal

Energy Technology Data Exchange (ETDEWEB)

Janin, Amelie, E-mail: amelie.janin@ete.inrs.ca [University of Toronto, Faculty of Forestry, 33, Willcocks St., Toronto, ON, M5S 3B3 (Canada); Coudert, Lucie, E-mail: lucie.coudert@ete.inrs.ca [Institut national de la recherche scientifique (Centre Eau, Terre et Environnement), Universite du Quebec, 490 rue de la Couronne, Quebec, QC, G1K 9A9 (Canada); Riche, Pauline, E-mail: pauline.riche@ete.inrs.ca [Institut national de la recherche scientifique (Centre Eau, Terre et Environnement), Universite du Quebec, 490 rue de la Couronne, Quebec, QC, G1K 9A9 (Canada); Mercier, Guy, E-mail: guy_mercier@ete.inrs.ca [Institut national de la recherche scientifique (Centre Eau, Terre et Environnement), Universite du Quebec, 490 rue de la Couronne, Quebec, QC, G1K 9A9 (Canada); Cooper, Paul, E-mail: p.cooper@utoronto.ca [University of Toronto, Faculty of Forestry, 33, Willcocks St., Toronto, ON, M5S 3B3 (Canada); Blais, Jean-Francois, E-mail: blaisjf@ete.inrs.ca [Institut national de la recherche scientifique (Centre Eau, Terre et Environnement), Universite du Quebec, 490 rue de la Couronne, Quebec, QC, G1K 9A9 (Canada)

2011-02-28

Research highlights: {yields} This paper describes a process for the metal removal from treated (CA-, ACQ- or MCQ-) wood wastes. {yields} This sulfuric acid leaching process is simple and economic. {yields} The remediated wood could be recycled in the industry. - Abstract: Chromated copper arsenate (CCA)-treated wood was widely used until 2004 for residential and industrial applications. Since 2004, CCA was replaced by alternative copper preservatives such as alkaline copper quaternary (ACQ), copper azole (CA) and micronized copper quaternary (MCQ), for residential applications due to health concerns. Treated wood waste disposal is becoming an issue. Previous studies identified a chemical process for decontaminating CCA-treated wood waste based on sulfuric acid leaching. The potential application of this process to wood treated with the copper-based preservatives (alkaline copper quaternary (ACQ), copper azole (CA) and micronized copper quaternary (MCQ)) is investigated here. Three consecutive leaching steps with 0.1 M sulfuric acid at 75 deg, C for 2 h were successful for all the types of treated wood and achieved more than 98% copper solubilisation. The different acidic leachates produced were successively treated by coagulation using ferric chloride and precipitation (pH = 7) using sodium hydroxide. Between 94 and 99% of copper in leachates could be recovered by electrodeposition after 90 min using 2 A electrical current. Thus, the process previously developed for CCA-treated wood waste decontamination could be efficiently applied for CA-, ACQ- or MCQ-treated wood.

NCBI nr-aa BLAST: CBRC-MDOM-01-0241 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-01-0241 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 2e-54 67% ...

NCBI nr-aa BLAST: CBRC-MDOM-11-0078 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-11-0078 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 1e-50 61% ...

NCBI nr-aa BLAST: CBRC-MDOM-04-0193 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0193 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 3e-51 66% ...

NCBI nr-aa BLAST: CBRC-MDOM-02-0479 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-02-0479 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 4e-65 94% ...

NCBI nr-aa BLAST: CBRC-MDOM-01-0082 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-01-0082 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 2e-55 68% ...

NCBI nr-aa BLAST: CBRC-MDOM-01-0046 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-01-0046 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 5e-69 84% ...

NCBI nr-aa BLAST: CBRC-MDOM-05-0033 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-05-0033 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 2e-68 85% ...

NCBI nr-aa BLAST: CBRC-MDOM-02-0442 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-02-0442 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 9e-61 64% ...

NCBI nr-aa BLAST: CBRC-MDOM-01-0547 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-01-0547 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 3e-61 82% ...

NCBI nr-aa BLAST: CBRC-MDOM-04-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0085 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 3e-66 86% ...

NCBI nr-aa BLAST: CBRC-FRUB-02-0728 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0728 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 3e-26 73% ...

NCBI nr-aa BLAST: CBRC-MDOM-06-0136 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-06-0136 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 8e-54 74% ...

NCBI nr-aa BLAST: CBRC-MDOM-07-0064 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-07-0064 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 1e-60 64% ...

UniProt search blastx result: AK287474 [KOME

Lifescience Database Archive (English)

Full Text Available AK287474 J043022N04 P04917|PGSG_RAT Secretory granule proteoglycan core protein pre...cursor (Chondroitin sulfate proteoglycan core protein) (Proteoglycan 10K core protein) (PG19 core protein) (Cytolytic granule proteoglycan core protein) - Rattus norvegicus (Rat) 0 ...

Co-location of passive gear fisheries in offshore wind farms in the German EEZ of the North Sea: A first socio-economic scoping

DEFF Research Database (Denmark)

Stelzenmüller, V.; Diekmann, Rabea; Bastardie, Francois

2016-01-01

and size selectivityhave motivated the development of selective systems in trawl fisheries that utilize more than one selec-tive device simultaneously. An example can be found in the Swedish demersal trawl fishery targetingNorway lobster (Nephrops norvegicus), which simultaneously aims at avoiding catches...

Bell-shaped size selection in a bottom trawl: A case study for Nephrops directed fishery with reduced catches of cod

DEFF Research Database (Denmark)

Lövgren, Johan; Herrmann, Bent; Feekings, Jordan P.

2016-01-01

and size selectivity have motivated the development of selective systems in trawl fisheries that utilize more than one selective device simultaneously. An example can be found in the Swedish demersal trawl fishery targeting Norway lobster (Nephrops norvegicus), which simultaneously aims at avoiding catches...

NCBI nr-aa BLAST: CBRC-OPRI-01-1187 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1187 ref|XP_344240.3| PREDICTED: similar to Paired mesoderm homeobox p...rotein 2B (Paired-like homeobox 2B) (PHOX2B homeodomain protein) (Neuroblastoma Phox) (NBPhox) [Rattus norvegicus] XP_344240.3 8.8 38% ...

GenBank blastn search result: AK288534 [KOME

Lifescience Database Archive (English)

Full Text Available AK288534 J090045E15 AC095876.6 AC095876 Rattus norvegicus BAC CH230-10G12 (Children's Hospital Oakland Resea...rch Institute Rat (BN/SsNHsd/MCW) BAC library) complete sequence. ROD 3e-81 1 -1 ...

Dicty_cDB: Contig-U15301-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 6 |pid:none) Amphimedon queenslandica hedgling ... 35 2.9 AP005643_12( AP005643 |...l... 35 2.9 AB003753_1( AB003753 |pid:none) Rattus norvegicus genes for high s... 35 2.9 EU285556_1( EU28555

Carriage of Leptospira interrogans among domestic rats from an urban setting highly endemic for leptospirosis in Brazil

NARCIS (Netherlands)

de Faria, Marcos Tucunduva; Calderwood, Michael S.; Athanazio, Daniel A.; McBride, Alan J. A.; Hartskeerl, Rudy A.; Pereira, Martha Maria; Ko, Albert I.; Reis, Mitermayer G.

2008-01-01

A survey was conducted to identify reservoirs for urban leptospirosis in the city of Salvador, Brazil. Sampling protocols were performed in the vicinity of households of severe leptospirosis cases identified during active hospital-based surveillance. Among a total of 142 captured Rattus norvegicus

Electrolyte Concentrates Treat Dehydration

Science.gov (United States)

2009-01-01

Wellness Brands Inc. of Boulder, Colorado, exclusively licensed a unique electrolyte concentrate formula developed by Ames Research Center to treat and prevent dehydration in astronauts returning to Earth. Marketed as The Right Stuff, the company's NASA-derived formula is an ideal measure for athletes looking to combat dehydration and boost performance. Wellness Brands also plans to expand with products that make use of the formula's effective hydration properties to help treat conditions including heat stroke, altitude sickness, jet lag, and disease.

TIKUS RIUL (Rattus norvegicus Berkenhout, 1769

Directory of Open Access Journals (Sweden)

Dian Indra Dewi

2012-11-01

Full Text Available Tikus riul telah menyebabkan lebih banyak kematian jika dibandingkan dengan semua perang dalam sejarah. Rat-borne diseases diperkirakan telah menewaskan banyak orang dalam 1000 tahun terakhir. Mereka merupakan ancaman bagi kesehatan masyarakat. Mereka menjadi hospes dari kutu dan pinjal yang dapat menyebabkan pes, trichinosus, tularemia, infeksi penyakit kuning, demam tifus endemik, ratbite fever, dan beberapa penyakit berbahaya.

Serological Changes Induced by Blend of Sunset Yellow, Metanil Yellow and Tartrazine in Swiss Albino Rat, Rattus Norvegicus

OpenAIRE

Saxena, Beenam; Sharma, Shiv

2014-01-01

Objective: The present study was carried out to evaluate the toxic effect of blend of some food colors on Swiss albino rats. Materials and Methods: A blend (1:1:1) of sunset yellow, metanil yellow and tartrazine showed additive effects on serological parameters which indicate that addition of these dye together in food stuff may give rise to more toxic effects than are produced by each dye individually. Animals were divided into four groups (I, II, III, and IV). First group was treated as con...

Immuno-modulatory properties of prebiotics extracted from Vernonia ...

African Journals Online (AJOL)

Methods: The immuno-modulatory potential was evaluated by monitoring the effects of oral administration of the extract on immunological, haematological and lipid profiles of Rattus norvegicus, while the prebiotic components were identified by thin layer chromatography (TLC), following liquid-liquid fractionation of the ...

AcEST: DK954928 [AcEST

Lifescience Database Archive (English)

Full Text Available tus norvegicus ... 31 7.1 sp|P24614|FUS_TRTV Fusion glycoprotein F0 OS=Turkey rhinotrachei... 31 7.2 >sp|A5D...bjct: 97 NLIQHRRIHTGEKPYKCD 114 >sp|P24614|FUS_TRTV Fusion glycoprotein F0 OS=Turkey rhinotracheitis virus G

Effects of chronic bottom trawling on soft-seafloor macrofauna in the Kattegat

DEFF Research Database (Denmark)

Sköld, Mattias; Göransson, Peter; Jonsson, Patrik

2018-01-01

intensities as a consequence of reduction in predation by benthivorous flatfish and Norway lobster Nephrops norvegicus, which are significant catches of the fishery. The response was supported by a corresponding trend towards lower abundance of the dominating brittle stars following enforcement of the MPA...

Performance of rats orogastrically dosed with faecal strains of ...

African Journals Online (AJOL)

Administrator

strains of Lactobacillus acidophilus and challenged ... Albino rats (Rattus norvegicus) were orogastrically dosed with faecal strains of Lactobacillus .... Chang et al. (2001) reported a similar observation in piglets fed probiotic strain, Lactobacillus reuteri BSA 131. Francisco et al. (1995) had earlier reported that selected ...

Access to enriched housing is rewarding to rats as reflected by their anticipatory behaviour

NARCIS (Netherlands)

Harst, van der J.E.; Fermont, P.C.J.; Bilstra, A.; Spruijt, B.M.

2003-01-01

We tested the general assumption that enrichment of the housing environment is rewarding to laboratory rats, Rattus norvegicus. We used the behavioural response in anticipation of a forthcoming reward as a measure of the rewarding property of a simple enriched cage. For this, a Pavlovian

Dicty_cDB: SFL375 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 15 |pid:none) Rhodococcus opacus B4 DNA, comp... 88 4e-16 BC088249_1( BC088249 |pid:none) Rattus norvegicus pipecoli... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 87 1e-15 BC116493_1( B

Arabidopsis CDS blastp result: AK061637 [KOME

Lifescience Database Archive (English)

Full Text Available AK061637 001-036-A11 At1g77130.1 glycogenin glucosyltransferase (glycogenin)-relate...d contains similarity to glycogenin-1 from Mus musculus [SP|Q9R062], Rattus norvegicus [SP|O08730], Homo sapiens [SP|P46976] 4e-84 ...

Effect of electrolyzed reduced water on malondialdehyde levels and ...

African Journals Online (AJOL)

Purpose: To evaluate the effects of electrolyzed reduced water (ERW) on malondialdehyde (MDA) levels and neutrophil cells in Wistar rats suffering from aggressive periodontitis. Methods: Wistar rats (Rattus norvegicus) were infected with A. actinomycetemcomitans before being divided into a control group and a treatment ...

Genome sequence of the Brown Norway rat yields insights into mammalian evolution

DEFF Research Database (Denmark)

Gibbs, Richard A; Weinstock, George M; Metzker, Michael L

2004-01-01

The laboratory rat (Rattus norvegicus) is an indispensable tool in experimental medicine and drug development, having made inestimable contributions to human health. We report here the genome sequence of the Brown Norway (BN) rat strain. The sequence represents a high-quality 'draft' covering ove...

Oil concentrations below a demulsifier treated slick

International Nuclear Information System (INIS)

Lunel, T.; Lewis, A.

1993-01-01

During field trials in the North Sea in 1992, three 20-tonne slicks of a relatively weak 30% water-in-oil emulsion were released. Two of the slicks were treated with demulsifier from spray aircraft and one of the treated slicks was sprayed with dispersant seven hours later. The experiment used flow-through fluorometry to determine oil concentrations below the control and demulsifier-treated slick. Remote sensing imagery was used to determine the area of the surface slicks. Emulsion formation was slowed down in the two demulsifier-treated slicks relative to the control slick. The demulsifier-treated slicks resulted in maximum oil concentrations in water some five times higher than the control slick and spread over a volume 10-20 times as large. The control slick was therefore more persistent on the sea surface than either of the treated slicks. 5 refs., 5 figs., 5 tabs

Absorption edge imaging of sporocide-treated and non-treated bacterial spores

International Nuclear Information System (INIS)

Panessa-Warren, B.J.; Tortora, G.T.; Warren, J.B.

1987-01-01

When deprived of nutrients, spore forming bacilli produce endospores which are remarkably resistant to chemical sterilization. Little is known about the morphology and response fo these spores following exposure to sporocidal agents. Light microscopy does not provide sufficient resolution for studying the rupture of the spore coat and fate of intracellular material. Transmission and scanning electron microscopy offer superior resolution but require specimen preparation methods that induce physiologic as well as morphologic changes in the spores, thereby making accurate interpretation of micrographs difficult. To eliminate the possible artifacts induced by chemical fixation, dehydration, embeddment, staining and sectioning, treated and non-sporocide-treated endospores of B. thuringiensis and B. subtilis were imaged by x-ray contact microscopy using monochromatic x-rays. 6 refs., 2 figs

Process for treating biomass

Science.gov (United States)

Campbell, Timothy J.; Teymouri, Farzaneh

2018-04-10

This invention is directed to a process for treating biomass. The biomass is treated with a biomass swelling agent within the vessel to swell or rupture at least a portion of the biomass. A portion of the swelling agent is removed from a first end of the vessel following the treatment. Then steam is introduced into a second end of the vessel different from the first end to further remove swelling agent from the vessel in such a manner that the swelling agent exits the vessel at a relatively low water content.

Effectiveness of Russian current in bone regeneration process in rats

Directory of Open Access Journals (Sweden)

Renata Aparecida de Oliveira Lima

Full Text Available Abstract Introduction: Russian current is an electric current of average frequency that is able to restore the properties of skeletal muscle at a low treatment cost. It is essential to know the effects of Russian current in bone tissue, since electromagnetic energy could be an efficient and low cost method to treat bone disorders. Objective: The aim of the study was to evaluate the effectiveness of Russian current in the consolidation of tibia fracture in adult rats. Methods: 24 adult male Albinus Wistar rats wereused. The animals were divided randomly into two groups: control group (CG, composed of 12 animals, and Intervention Group (IG consisting of 12 animals, both groups were submitted to osteotomy (proximal medial surface of the tibia. The IG underwent an electrical stimulation protocol with Russian current, while the CG did not undergo any kind of intervention. Euthanasia was performed in three animals of each group on the following days: 5, 10, 20, and 30 days of treatment. Results: The results suggested higher primary ossification, intense osteogenic activity, and increased thickness of the periosteum, characterizing more advanced ossification and a greater presence of trabecular bone marrow in rats in the group subjected to the treatment. In this way, we can assign one more beneficial effect to interventions with Russian current, for the treatment of postfracture rehabilitation. Conclusion: In both groups the bone tissue repair process occurred, but in the electrically stimulated group the osteogenesis process was more advanced.

Do Surgeons Treat Their Patients Like They Would Treat Themselves?

NARCIS (Netherlands)

Janssen, Stein J.; Teunis, Teun; Guitton, Thierry G.; Ring, David; Spoor, Andy B.; Chauhan, Aakash; Shafritz, Adam B.; Wasterlain, Amy; Terrono, Andrew L.; Neviaser, Andrew S.; Schmidt, Andrew; Nelson, Andy; Miller, Anna N.; Kristan, Anze; Apard, Thomas; Berner, Arne; Ilyas, Asif; Jubel, Axel; Jost, Bernhard; Babis, George; Watkins, Barry; Kreis, Barbara; Nolan, Betsy M.; Crist, Brett D.; Cross, Brian J.; Wills, Brian P. D.; Barreto, Camilo Jose Romero; Ekholm, Carl; Swigart, Carrie; Spath, Catherine; Zalavras, Charalampos; Cassidy, Charles; Garnavos, Christos; Moreno-Serrano, Constanza L.; Rodner, Craig; Klostermann, Cyrus; Osei, Daniel A.; Rikli, Daniel A.; Haverkamp, Daniel; Polatsch, Daniel; Drosdowech, Darren; Edelstein, David M.; Eygendaal, Denise; Verbeek, Diederik O. F.; Doornberg, Job N.; van den Bekerom, Michel P. J.; Schep, Niels; Kloen, Peter; Haverlag, Robert; Schepers, Tim

2015-01-01

There is substantial unexplained geographical and surgeon-to-surgeon variation in rates of surgery. One would expect surgeons to treat patients and themselves similarly based on best evidence and accounting for patient preferences. (1) Are surgeons more likely to recommend surgery when choosing for

Vagus Nerve Stimulation for Treating Epilepsy

Science.gov (United States)

... and their FAMILIES VAGUS NERVE STIMULATION FOR TREATING EPILEPSY This information sheet is provided to help you ... how vagus nerve stimulation (VNS) may help treat epilepsy. The American Academy of Neurology (AAN) is the ...

Trick or Treat and Telescopes

Science.gov (United States)

Buratti, Bonnie J.; Meinke, Bonnie K.; Schmude, Richard W.

2017-10-01

Based on an activity that DPS member Richard Schmude Jr. has been doing for years, with over 5000 children reached, DPS initiated in 2016 a pilot program entitled “Trick-or-Treat and Telescopes.” DPS encouraged its members to put out their telescopes during trick-or-treat time on Halloween, in their own lawns or in a neighbor’s lawn with better viewing (or more traffic). The program will be continued in 2017. This year should offer good viewing with a waxing gibbous moon and Saturn visible. The program was also advertised though the Night Sky Network, a consortium of astronomy clubs. The following website gives advice and connections to resources.https://dps.aas.org/education/trick-or-treat-and-telescopes acknowledged.

The number needed to treat for second-generation biologics when treating established rheumatoid arthritis

DEFF Research Database (Denmark)

Kristensen, L E; Jakobsen, A K; Bartels, E M

2011-01-01

To evaluate the number needed to treat (NNT) and the number needed to harm (NNH) of the second-generation biologics abatacept, certolizumab, golimumab, rituximab, and tocilizumab in patients with established rheumatoid arthritis (RA) taking concomitant methotrexate (MTX).......To evaluate the number needed to treat (NNT) and the number needed to harm (NNH) of the second-generation biologics abatacept, certolizumab, golimumab, rituximab, and tocilizumab in patients with established rheumatoid arthritis (RA) taking concomitant methotrexate (MTX)....

System of treating flue gas

International Nuclear Information System (INIS)

Ziegler, D.L.

1975-01-01

A system is described for treating or cleaning incinerator flue gas containing acid gases and radioactive and fissionable contaminants. Flue gas and a quench solution are fed into a venturi and then tangentially into the lower portion of a receptacle for restricting volumetric content of the solution. The upper portion of the receptacle contains a scrub bed to further treat or clean the flue gas

FLEXSELECT: counter-herding device to reduce bycatch in crustacean trawl fisheries

DEFF Research Database (Denmark)

Melli, Valentina; Karlsen, Junita Diana; Feekings, Jordan P.

2018-01-01

FLEXSELECT is a simple counter-herding device which aims at reducing the bycatch of fish by scaring them away from the trawl path without affecting the catches of the target species. FLEXSELECT was tested in the Norway lobster (Nephrops norvegicus) directed trawl fishery, as this includes bycatch...

Long-term effect of diet amended by risk elements contaminated soils on risk element penetration and physiological parameters of rats

Czech Academy of Sciences Publication Activity Database

Vlčková, V.; Malinová, M.; Koubková, B.; Szaková, J.; Zídek, Václav; Fučíková, A.; Zídková, J.; Kolihová, D.; Tlustoš, P.

2014-01-01

Roč. 59, č. 9 (2014), s. 416-427 ISSN 1212-1819 R&D Projects: GA ČR GA13-04580S Institutional support: RVO:67985823 Keywords : risk elements * soil * soil ingestion * liver * kidney * blood * Rattus norvegicus Subject RIV: ED - Physiology Impact factor: 1.183, year: 2014

Rhipicephalus sanguineus sensu lato(Ixodidae in synantropic rodents in Rio Grande do Sul, Brazil

Directory of Open Access Journals (Sweden)

Kathleen Tavares Winkel

Full Text Available Rhipicephalus sanguineus, the brown dog tick, is responsible for maintaining and transmitting various pathogens, both in animals and human beings, and it is of great sanitary importance. This communication reports the first occurrence of Rhipicephalus sanguineus sensu lato parasitizing Rattus norvegicus in the state of Rio Grande do Sul, Brazil, and it is also the first record of this tick species parasitizing Rattus rattus in Brazil. The rodents were captured from the port area, located in the city of Pelotas, Rio Grande do Sul, Brazil. We collected 6 larvae of this tick species from 2 male R. rattus individuals, and 3 larvae from 2 female R. norvegicus individuals; parasitized specimens of both rodent species were captured from different sites within the experimental area. This record broadens the number of Rhipicephalus sanguineus sensu lato hosts in urban areas, indicating the need for continued monitoring on population density for both R. sanguineus and synanthropic rodents.

FLAMMABILITY OF HERBICIDE-TREATED GUAVA FOLIAGE

Science.gov (United States)

Guava leaves treated with herbicide were found to be less flammable than untreated green leaves or dead leaves . Differences in flammability were...determined by small-scale laboratory fires, differential thermal analysis, and thermogravimetric analysis. The herbicide-treated leaves had a higher ash

Effect of water treated and urea treated neem ( Azadirachta indica ...

African Journals Online (AJOL)

In a study to evaluate the carcass haematological and biochemical characteristics of broiler birds fed graded levels of water and urea-treated neem kernel cake (NKC), 300 day-old broilers (Cobb, 500) were randomly assigned to five dietary treatments for 56 days. Water and feed were fed adlibitum. The diets were ...

Performance of rats orogastrically dosed with faecal strains of ...

African Journals Online (AJOL)

Albino rats (Rattus norvegicus) were orogastrically dosed with faecal strains of Lactobacillus acidophilus and simultaneously infected with Escherichia coli, while the control was challenged with E. coli alone. The treatment was repeated the second day and post ingestion period of 18 days follow. It was observed that rats ...

Use of selective devices in trawls to support recovery of the Kattegat cod stock: a review of experiments and experience

DEFF Research Database (Denmark)

Madsen, Niels; Valentinsson, Daniel

2010-01-01

this provides a valuable management tool for reducing the bycatch of cod and reducing mortality, and thus helping to rebuild the depleted stock. Gear research in the area has been focused on devices that allow for continued exploitation of the Norway lobster (Nephrops norvegicus) and flatfish, but minimizing...

AcEST: BP917335 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 Length = 993 Score = 42.4 bits (98),...THGEYTSAAE 635 >tr|Q9EQN5|Q9EQN5_RAT Antifreeze-enhancer binding protein AEP OS=Rattus norvegicus GN=Ighmbp2

Effect of the diet amended with risk elements contaminated soil on risk elements content in tissues and hematological parameters of rats

Czech Academy of Sciences Publication Activity Database

Száková, J.; Novosadová, Z.; Zídek, Václav; Fučíková, A.; Zídková, J.; Miholová, D.; Tlustoš, P.

2012-01-01

Roč. 57, č. 9 (2012), s. 430-441 ISSN 1212-1819 Grant - others:GA AV ČR(CZ) IAA400400806 Program:IA Institutional support: RVO:67985823 Keywords : risk elements * soil ingestion * liver * kidney * bones * Rattus norvegicus Subject RIV: GG - Livestock Rearing Impact factor: 0.922, year: 2012

Treating mine water

Energy Technology Data Exchange (ETDEWEB)

Matlak, E S; Kochegarova, L V; Zaslavskaya, I Yu

1980-10-01

Taking into account the negative influence of mine waters with suspended matter on the natural environment on the surface, the maximum treatment of mine water underground, is proposed. It is noted that full treatment of mine water, using conventional filtration methods, would be rather expensive, but a limited treatment of mine water is possible. Such treated mine water can be used in dust suppression and fire fighting systems. Mine water treated underground should be free of any odor, with pH level ranging from 6 to 9.5, with suspended matter content not exceeding 50 mg/l and coli-titre not less than 300 cm$SUP$3. It is suggested that water treatment to produce water characterized by these parameters is possible and economical. Recommendations on construction of underground sedimentation tanks and channels, and a hydraulic system of cleaning sedimentation tanks are proposed. The settling would be stored underground in abandoned workings. (2 refs.) (In Russian)

Streptomycin action to the mammalian inner ear vestibular organs: comparison between pigmented guinea pigs and rats.

Science.gov (United States)

Meza, Graciela; Aguilar-Maldonado, Beatriz

2007-01-01

Streptomycin is the antibiotic of choice to treat tuberculosis and other infectious diseases but it causes vestibular malfunction and hipoacusia. Rodents are usually employed as models of drug action to the inner ear and results are extrapolated to what happens in humans. In rats, streptomycin destroys macular sensory cells and does not affect cochlear ones, whereas in guinea pigs the contrary is true. Action on the vestibular cristae cells involved in vestibulo-ocular reflex integrity is less clear. Thus, we compared this response in both pigmented guinea pigs (Cavia cobaya) and rats (Rattus norvegicus) after parallel streptomycin chronic treatment. In guinea pigs, the reflex was obliterated along treatment time; in rats this behavior was not observed, suggesting that the end organ target was diverse. In recent studies, streptidine, a streptomycin derivative found in the blood of humans and rats treated with streptomycin, was the actual ototoxic agent. The putative streptomycin vestibular organ target observed in humans corresponds with the guinea pig observations. Results observed in rats are controversial: streptidine did not cause any damage either to vestibular cristae nor auditory cells. We hypothesize differential drug metabolism and distribution and conclude that results in laboratory animals may not always be applicable in the human situation.

Effect of selenium-enriched defatted rape seeds on tissue cadmium and essential elements utilization in rats

Czech Academy of Sciences Publication Activity Database

Myška, A.; Száková, J.; Fučíková, A.; Mlejnek, Petr; Zídek, Václav; Tremlová, J.; Mestek, O.; Koplík, R.; Zídková, J.; Melčová, M.; Tlustoš, P.

2016-01-01

Roč. 61, č. 11 (2016), s. 496-505 ISSN 1212-1819 R&D Projects: GA ČR(CZ) GA13-04580S Institutional support: RVO:67985823 Keywords : Se * Brassica napus * fortification * Rattus norvegicus * trace and major minerals Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.741, year: 2016

AcEST: DK959154 [AcEST

Lifescience Database Archive (English)

Full Text Available fadin OS=Rattus norvegicus GN=Mllt4 PE=1 SV=1 33 0.57 sp|Q80ZC9|PS1C2_MOUSE Psoriasis susceptibility 1 candi...APPPPPQRNASYLKTQVLSPDSLF 1731 >sp|Q80ZC9|PS1C2_MOUSE Psoriasis susceptibility 1 candidate gene 2 protein hom

Acute and Four-Week Inhalation Toxicity Study in Rats Exposed to Pyrotechnically Disseminated Black Smoke (PVA)

Science.gov (United States)

2014-06-01

level of activity, gait and posture, reactivity to handling or sensory stimuli, altered strength, and stereotypes or bizarre behavior (e.g., self...historical database. V.3.3. Laboratory Animals V.3.3.1. Genus and Species: Rattus norvegicus V.3.3.2. Strain/Stock: Sprague-Dawley V.3.3.3

A influência do azul de metileno na prevenção da lesão pulmonar após isquemia-reperfusão intestinal The role of the methylene blue as a lung protector after intestinal ischemia and reperfusion

Directory of Open Access Journals (Sweden)

Fernando Hintz Greca

2004-08-01

Full Text Available OBJETIVO: Estudar a ação do azul de metileno como supressor da produção de radicais livres de oxigênio, atuando como receptor alternativo de elétrons na enzima xantina oxidase. MÉTODOS: Foram utilizados 32 ratos Wistar (Rattus norvegicus albinus, Rodentia mammalia divididos em 2 grupos de 16 animais, os quais foram denominados grupos: experimento e controle. Ambos os grupos foram submetidos a laparotomia mediana e oclusão da artéria mesentérica cranial por 60 minutos. A reperfusão foi confirmada por meio da verificação do reaparecimento da pulsação na arcada mesentérica. Foi então administrado no grupo experimento 2 ml de azul de metileno 1 % estéril intraperitonealmente, enquanto que no grupo controle foi administrado solução salina isotônica estéril em mesmo volume e pela mesma via de administração. Após 4 horas de reperfusão, os animais foram sacrificados. Amostras dos pulmões foram obtidas para: análise histopatológica, avaliação do edema e para determinação da atividade da xantina oxidase. RESULTADOS: O dano pulmonar encontrado no grupo controle foi superior ao encontrado no grupo experimento. Observou-se uma maior formação de edema nos pulmões do grupo controle. A atividade da xantina oxidase foi semelhante em ambos os grupos. CONCLUSÃO: O azul de metileno diminui a lesão pulmonar após isquemia-reperfusão intestinal.PURPOSE: To study the role of methylene blue as an inibitor of superoxide production by xantine oxidase. METHODS: Thirty two Wistar rats were divided in 2 groups of 16 animals: the control group and the experimental group. All the animals were submitted to a laparotomy for the occlusion of the cranial mesenteric artery during 60 minutes. The reperfusion was confirmed by the 'pulsation of the artery after releasing the temporary ligature. In the animals of the control group, 2 ml of saline were injected in the peritoneal cavity and in the animals of the experimental group 2 ml of methylene

Efeito hipolipidêmico do suco de camu-camu em ratos

Directory of Open Access Journals (Sweden)

Maíra Cássia Schwertz

2012-02-01

Full Text Available OBJETIVO: Este estudo teve como objetivo avaliar o potencial hipolipidêmico do suco de camu-camu (Myrciaria dubia (Kunth McVaugh em ratos dislipidêmicos. MÉTODOS: Foram utilizados 72 ratos (Rattus norvegicus var. albinus machos adultos da linhagem Wistar, com peso médio de 200g. O experimento foi dividido em duas fases: indução da dislipidemia e tratamento. Para indução da dislipidemia, todos os ratos receberam ração hiperlipídica (ração comercial adicionada a 10,0% de banha suína, 1,0% colesterol e 0,1% de ácido cólico durante 21 dias. Na fase de tratamento, 40 ratos dislipidêmicos foram divididos aleatoriamente em 5 grupos (n=8, sendo 3 deles submetidos a tratamento com diferentes concentrações de suco de camu-camu (0,4mL.kg-1, 4,0mL.kg-1 e 10mL.kg-1 por 14 dias, 1 grupo submetido a tratamento com quercetina (10mL.kg-1 e 1 grupo hiperlidêmico. Estes dois últimos foram mantidos como parâmetro, ao lado do grupo basal. Para avaliar o efeito modulador do suco de camu-camu no perfil lipídico dos ratos, foram verificadas as concentrações de triacilgliceróis, colesterol total, lipoproteína de alta intensidade e lipoproteína de baixa intensidade, no plasma, assim como os níveis de colesterol fecal e hepático. Também foram observados o controle da ingestão de ração e a avaliação da massa corporal. RESULTADOS: As diferentes doses de suco de camu-camu e de quercetina apresentaram efeitos moduladores do perfil lipídico, ou seja, redução de triacilgliceróis, colesterol total, excreção fecal de colesterol, bem como redução do colesterol hepático. Salienta-se que os melhores resultados foram obtidos com a concentração de 10mL.kg-1. Em relação à massa corporal, os ratos que receberam essa concentração de suco de camu e quercetina mantiveram peso significativamente inferior ao obervado nos demais tratamentos, tanto no início quanto ao final da intervenção. Resultado similar foi observado quanto ao consumo

Efeito mutagênico da água natural (poço, rios Ficha e Minas Gerais, próximos à cidade de Ubiratã, Estado do Paraná, Brasil em sistema teste animal - DOI: 10.4025/actascibiolsci.v26i1.1665 Mutagenic effect of fresh water (well, rivers Ficha and Minas Gerais, close to the town of Ubiratã, Paraná, Brazil in the animal test system - DOI: 10.4025/actascibiolsci.v26i1.1665

Directory of Open Access Journals (Sweden)

Veronica Elisa Pimenta Vicentini

2004-04-01

Full Text Available O intenso desenvolvimento industrial e crescimento populacional têm promovido alterações na qualidade da água, sendo esta fonte de muitos estudos para análise desses efeitos no ser humano. Devido a contaminação dos rios por agrotóxicos, herbicidas, pesticidas e demais aditivos químicos utilizados nas lavouras, e pelas indústrias que despejam através de esgotos, resíduos de sua produção, que não são devidamente tratados, torna-se importante a investigação da atividade citotóxica e mutagênica da água dos rios. Neste estudo foi utilizado como sistema teste animal as células da medula óssea de ratos Wistar (,em>Rattus norvegicus, tratados in vivo, via gavagem, de forma subcrônica (7 dias, para investigação dos efeitos das águas do poço, e dos rios Ficha e Minas Gerais, próximos à Ubiratã, Estado do Paraná, Brasil, analisando-se o ciclo de divisão celular e os cromossomos metafásicos. A análise estatística demonstrou que as águas não alteraram o ciclo de divisão celular dos ratos Wistar e também não provocaram aumento no número de aberrações cromossômicas, mostrando não terem neste tratamento, efeito citotóxico e nem clastogênicoIntense industrial development and population growth have been altering the quality of water and innumerous studies have been undertaken to analyze their effects on humans. Due to rivers contamination with agrotoxics, herbicides, pesticides, excess of farming chemical additives and through sewers spilling not properly treated industrial waste, investigating cytotoxic and mutagenic activity of river water becomes all-important. Bone marrow cells of Wistar rats (Rattus norvegicus, treated in vivo, through gavage, in subchronic treatment (7 days, were used as experimental animal test system to investigate the effects of well water and water from the rivers Ficha and Minas Gerais, close to the municipality of Ubiratã, State of Paraná, southern Brazil. Cell division index and

Performance review: neutron hodoscope at TREAT

International Nuclear Information System (INIS)

Stanford, G.S.; DeVolpi, A.; Fink, C.L.; Regis, J.P.; Rhodes, E.A.; Stewart, R.R.

1976-01-01

The current fuel-motion-detection capabilities of the neutron hodoscopes at TREAT are outlined and discussed, including such topics as spatial and fuel-density resolution, dynamic range, and corrections for detector dead time and supralinearity. Capabilities and analytical techniques are illustrated with examples from several of the power-transient experiments that have been run in the TREAT reactor

Under treated Breast Cancer in the Elderly

International Nuclear Information System (INIS)

Malik, M.K.; Tartter, P.I.; Belfer, R.

2013-01-01

The effect of under treatment with adjuvant hormonal therapy, chemotherapy, or radiation was studied in elderly women with breast cancer. A prospectively maintained database was used to identify women undergoing potentially curative surgery between 1978 and 2012. The presentation, pathologic findings, treatment, and outcomes of 382 women over 70 were compared to the findings in 2065 younger patients. Subsequently, conventionally treated and under treated elderly patients were identified and their characteristics and outcomes were compared. Both young and old patients presented most frequently with mammographic findings, but older patients presented more frequently with mammographic masses while younger patients presented more frequently with mammographic calcifications. Cancers of older patients were significantly more favorable than cancers in younger patients: smaller, with more infiltrating lobular, fewer ductal carcinoma in situ, and more frequently estrogen receptor positive and fewer were poorly differentiated. Elderly patients had less axillary sampling, fewer mastectomies, less adjuvant radiation therapy, and more hormonal therapy. Fifty-one percent of the 382 elderly patients were under treated by conventional criteria. Under treated patients were more frequently in situ, better differentiated, smaller, and more often estrogen receptor positive. Forty-four percent of the under treated patients died during followup without disease recurrence. Despite under treatment, local and distant disease-free survival was comparable to patients who were not under treated.

Process of treating tars

Energy Technology Data Exchange (ETDEWEB)

Hansen, C; Hempel, H; Weissenburger, H

1955-05-05

A process is described for treating tars or tar oils, especially carbonization tars, characterized in that the tars or tar oils are mixed with benzene or light oils which contain no aromatic material or only slight amounts, or with gas oil in such amounts that the asphalt precipitates, and after separation of the precipitated material the mixture is treated with caustic solution for separation of the phenols, and after separation of the phenolate liquor the mixture is subjected to heating for removal of the dilution medium, then the remaining oil can be used as heating oil or it is submitted to distillation for the purpose of recovering a fuel suitable for diesel motors, while the phenolate liquor is worked up into phenols.

N-Springs pump and treat system optimization study

International Nuclear Information System (INIS)

1997-03-01

This letter report describes and presents the results of a system optimization study conducted to evaluate the N-Springs pump and treat system. The N-Springs pump and treat is designed to remove strontium-90 (90Sr) found in the groundwater in the 100-NR-2 Operable Unit near the Columbia River. The goal of the system optimization study was to assess and quantify what conditions and operating parameters could be employed to enhance the operating and cost effectiveness of the recently upgraded pump and treat system.This report provides the results of the system optimization study, reports the cost effectiveness of operating the pump and treat at various operating modes and 90Sr removal goals, and provides recommendations for operating the pump and treat

How Are Genetic Conditions Treated or Managed?

Science.gov (United States)

... mtDNA Resources Help Me Understand Genetics Share: Email Facebook Twitter Home Help Me Understand Genetics Genetic Consultation How are genetic conditions treated or managed? How are genetic conditions treated or managed? Many ...

Fluid sign in the treated bodies after percutaneous vertebroplasty

International Nuclear Information System (INIS)

Lin, Chao-Chun; Yen, Pao-Sheng; Wen, Shu-Hui

2008-01-01

The aims of this study are to describe non-healing in the treated vertebral body after percutaneous vertebroplasty and analyze the influence of vacuum cleft, location, and severity of collapse on the development of nonunion cement. Of 208 patients (266 treated vertebral bodies) who were treated with percutaneous vertebroplasty from September 2002 to May 2006, 23 patients (41 treated levels) with residual or recurrent pain underwent follow-up magnetic resonance imaging (MRI) study. Retrospective chart review with analysis of preoperative and postoperative MRIs were performed in these 23 patients. In the 41 treated vertebral bodies, 22 of 41 bodies had vacuum cleft found in the preoperative MRI study. Eight of the 22 treated vertebral bodies with preoperative vacuum clefts were found to have fluid between the interface of cement and the residual bone in the collapsed vertebral bodies on follow-up MRI. The adjacent discs of these treated vertebral bodies were upward/downward displaced. The endplate of the adjacent vertebral body exhibited fibrotic change. Treated bodies with vacuum clefts and level A location (T9, T11, T12, and L1) had higher probability of developing nonunion of the cement with statistical significance. The probability of nonunion cement in severe collapsed bodies might be higher than that of union cement in mild collapsed ones, but was not statistically significant. Fluid sign in the treated body represents unhealed bone-cement interface. The location of the treated vertebral body and existence of vacuum cleft in the treated bodies may be important factors influencing the nonunion of cement. (orig.)

Antidiabetic potentials of essential oil extracted from the leaves of Hoslundia opposita Vahl.

Science.gov (United States)

Akolade, Jubril Olayinka; Usman, Lamidi Ajao; Okereke, Omoaruemike Ebele; Muhammad, Nasir Olarewaju

2014-10-01

This study was aimed at assessing the potential of essential oil from the leaf of Hoslundia opposita in the treatment of diabetes. Forty-eight rats (Rattus norvegicus) were randomized into two groups; nondiabetic and diabetic groups, each with four subgroups. Animals in the diabetic group were induced with diabetes using a single dose of alloxan monohydrate, 160 mg/kg body weight (b. wt.). The rats were treated with 110 and 220 mg/kg b. wt. of the essential oil. All treatments were administered, intraperitoneally, once a day for 4 days. In the nondiabetic condition, there was no effect of the oil on fasting blood glucose (FBG) levels in rats. In diabetic rats, the oil caused a significant reduction in FBG levels. Treatment with 110 mg/kg b. wt. of the oil reduced FBG almost to the normoglycemic level by day 4 and the overall glucose excursion during a 3-h intraperitoneal glucose tolerance test approached the baseline level at 120 min. Also, hepatic glycogen was significantly higher, while the glucose concentrations were lower in the diabetic-treated group when compared with the diabetic untreated group. Histological examinations revealed a mildly distorted architecture of the pancreatic islets β-cells of diabetic rats treated with the oil, while those of the untreated rats were severely degenerated. Overall, the in vivo antihyperglycemic activity of the essential oil may prove to be of clinical importance in the management of type 2 diabetes.

Asymptomatic Bacteriuria: To Treat or Not To Treat. Pro Treatment.

Science.gov (United States)

Köves, Béla

2018-06-14

Asymptomatic bacteriuria (ABU) should be treated only in pregnant women and before urological procedures that breach the mucosa. In all other clinical settings, treatment of ABU is not beneficial and only contributes to antibiotic-associated morbidity and the selection of antibiotic resistance; therefore, screening and treatment are not recommended. Copyright © 2018 European Association of Urology. Published by Elsevier B.V. All rights reserved.

Heart failure in patients treated with bisphosphonates

DEFF Research Database (Denmark)

Grove, E L; Abrahamsen, B; Vestergaard, P

2013-01-01

The aim of this study was to investigate the occurrence of heart failure in patients treated with bisphosphonates.......The aim of this study was to investigate the occurrence of heart failure in patients treated with bisphosphonates....

AcEST: DK961397 [AcEST

Lifescience Database Archive (English)

Full Text Available norvegicus GN=Odz2 PE=2 ... 31 3.2 sp|Q6PCG7|EAP1B_XENLA Enhanced at puberty protein 1 homolog B OS... 30 5...T ELGIC P+ RS CSD LH Sbjct: 75 QGANFTLAELGICEPSPHRSGYCSDMGILH 104 >sp|Q6PCG7|EAP1B_XENLA Enhanced at puberty

Dandruff: How to Treat

Medline Plus

Full Text Available ... skin, hair, and nails Skin dictionary Camp Discovery Good Skin Knowledge lesson plans and ... Dandruff: How to treat Dandruff is a common scalp condition in which small pieces of dry ...

Treating gynaecological disorders with traditional Chinese medicine ...

African Journals Online (AJOL)

Traditional Chinese Medicine (TCM) has significant advantages in treating gynaecological disorders. The paper has provided a brief introduction on the current progress of treating some gynaecological disorders including endometriosis, infertility, dysmenorrhea, abnormal uterine bleeding, premenstrual syndrome, ...

PRESERVATIVE LEACHING FROM WEATHERED CCA-TREATED WOOD

Science.gov (United States)

Disposal of discarded CCA-treated wood in landfills raises concerns with respect to leaching of preservative compounds. When unweathered CCA-treated wood is leached using the toxicity characteristic leaching procedure (TCLP), arsenic concentrations exceed the toxicity characteris...

Treating P.A.D.

Science.gov (United States)

... Issue Past Issues Special Section Treating P.A.D. Past Issues / Summer 2008 Table of Contents For ... Illustration courtesy of NHLBI Treatment for P.A.D. is designed to reduce a patient's symptoms, prevent ...

Treat to target in gout.

Science.gov (United States)

Perez-Ruiz, Fernando; Moreno-Lledó, Aitana; Urionagüena, Irati; Dickson, Alastair J

2018-01-01

The treat-to-target (T2T) approach has been successfully implemented in a number of diseases. T2T has been proposed for rheumatic diseases such as RA, spondyloarthritis, lupus, and recently for gout. The level of evidence for such approaches differs from one condition to the other (moderate to high for hyperlipidaemia, for example). Practice is based on the best available evidence at any time, and in absence of good evidence for T2T in gout, some suggest a conservative only-treat-symptoms approach. Evidence suggests that not treating gout to target in the long term is overall associated with worsening outcomes, such as flares, tophi and structural damage, which is associated to loss of quality of life and mortality. Different targets have been proposed for hyperuricaemia in gout; lower than 6 mg/dl (0.36 mmol/l) for all patients, at least gout. © The Author 2018. Published by Oxford University Press on behalf of the British Society for Rheumatology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Second malignancy in patients treated for Hodgkin's disease

International Nuclear Information System (INIS)

Baccarani, M; Bosi, A.; Papa, G.

1980-01-01

Six hundred and thirteen consecutive patients with Hodgkin's disease (HD), with a follow-up of two to ten years, were reviewed with the aim of establishing the type and frequency of second malignancies. Acute non-lymphoid leukemia developed in 2 of 152 patients treated by chemotherapy (CHT), and in 5 of 344 patients treated by CHT and radiotherapy (RT). Leukemia developed 12 to 83 months after diagnosis of HD, was always preceded by a preleukemic phase (3 to 25 months), and was always fatal (after 1 to 12 months). The karyotype of leukemic cells was studied in 4 of 7 patients and was always abnormal. Solid tumors developed in 1 of 152 patients treated by CHT, and in 4 of 344 patients treated by CHT and RT. The tumors appeared 10 to 63 months after diagnosis of HD and killed all 5 patients after 10 to 16 months. For patients treated by CHT, the actuarial frequency of leukemia and other tumors seven years after diagnosis of HD was 2.0% and 1.26%, respectively. For patients treated by CHT and RT, the figures were 2.04% and 2.26%, respectively. Second malignancies were not recorded among 117 patients treated by RT alone. These data are consistent with a relationship of acute leukemia to therapy for HD

Dandruff: How to Treat

Medline Plus

Full Text Available ... C. Fox Award and Lectureship Grants from outside organizations Health Volunteers Overseas Grant Honorary International Society Meeting ... complex. The most effective way to treat and control dandruff is to use dandruff shampoo and scalp ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... the causes, which appear to be complex. The most effective way to treat and control dandruff is ... when outdoors and seeking shade whenever possible. For most people, dandruff does not require medical attention. However, ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... Skin Knowledge lesson plans and activities Video library Find a dermatologist Why see a board-certified dermatologist? ... hair, and nail care Kids’ zone Video library Find a dermatologist Dandruff: How to treat Dandruff is ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... treat and control dandruff is to use dandruff shampoo and scalp treatments. Follow these tips from dermatologists ... best results: Follow the instructions on the dandruff shampoo bottle: There are many different dandruff shampoos, and ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... NP/PA laws Action center Public and patients SPOT Skin Cancer™ Community programs & events Learn about skin ... and scalp problems Dandruff: How to treat public SPOT Skin Cancer™ Diseases and treatments Acne and rosacea ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... Rotation PICMED Grant Professionalism Award Resident-Fellow QI Project Award Resident International Grant Resident Scholarship to Legislative ... are still studying the causes, which appear to be complex. The most effective way to treat and ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... Hair and scalp problems Dandruff: How to treat public SPOT Skin Cancer™ Diseases and treatments Acne and ... Member resources Practice Tools Education Meetings & events Advocacy Public & patients Academy resources for: Dermatologists in the US ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... hair, and nail care Skin care Hair care / hair loss Injured skin Nail care Anti-aging skin care ... sweaty skin Eczema / dermatitis Hair and scalp problems Alopecia areata Dandruff: How to treat Hair loss Scalp ...

Fuel-motion diagnostics for PFR/TREAT experiments

International Nuclear Information System (INIS)

DeVolpi, A.; Doerner, R.C.; Fink, C.L.; Regis, J.P.; Rhodes, E.A.; Stanford, G.S.

1984-01-01

In all the transients in the PFR/TREAT series, fuel motion had been monitored by the fast-neutron hodoscope. This paper treats the enhancements in hodoscope operation and data analysis since the start of the PFR/TREAT tests. The hodoscope has a maximum viewing height of 1.2 m. Data collection intervals for the series have been in the order of 1 ms, depending on the duration of the transient. Mass-displacement resolutions of about 0.1 g are achievable for the single-pin tests and 1 g for 7-pin tests. The hodoscope system can accommodate the full dynamic range of power

TREAT - Teachers redesigning educational activities with technology

DEFF Research Database (Denmark)

Nielsen, Tobias Alsted; Andersen, Mathias Elmose; Alsholm, Anne-Mette

undervisningssituationer på Aarhus Universitet BSS. TREAT kan anvendes som en selvstændig ressource af den enkelte underviser, eller som en integreret del af Educational IT/blended learning kurser. TREAT tager afsæt i Dee Finks “Integrated Course Design” (2005), som belyser hvordan undervisere kan sammensætte et...... ressourcen i forbindelse med CUL’s blended learning kurser har været positive. Vi oplever derudover en national såvel som international interesse for ressourcen. treat.au.dk Referencer: Biggs, J. & C. Tang (2007): Teaching for Quality Learning at University. Open University Press, McGraw- Hill Education...

Dandruff: How to Treat

Medline Plus

Full Text Available ... Meet our partners Español Donate Diseases and treatments Acne and rosacea Bumps and growths Color problems Contagious ... treat public SPOT Skin Cancer™ Diseases and treatments Acne and rosacea Bumps and growths Color problems Contagious ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... World Dialogues in Dermatology JAAD Mohs AUC MyDermPath+ Psoriasis Patient education resources Practice Management Center Coding and ... areata Dandruff: How to treat Hair loss Scalp psoriasis Itchy skin Painful skin / joints Rashes Scaly skin ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... NP/PA laws Action center Public and patients SPOT Skin Cancer™ Community programs & events Learn about skin cancer ... and scalp problems Dandruff: How to treat public SPOT Skin Cancer™ Diseases and treatments Acne and rosacea Bumps ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... hair, and nail care Skin care Hair care / hair loss Injured skin Nail care Anti-aging skin care ... scalp problems Alopecia areata Dandruff: How to treat Hair loss Scalp psoriasis Itchy skin Painful skin / joints Rashes ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... and patients Diseases and treatments Hair and scalp problems Dandruff: How to treat public SPOT Skin Cancer™ Diseases and treatments Acne and rosacea Bumps and growths Color problems Contagious skin diseases Cosmetic treatments Dry / sweaty skin ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... Mohs AUC MyDermPath+ Psoriasis Patient education resources Practice Management Center Coding and reimbursement Coding MACRA Fee schedule ... complex. The most effective way to treat and control dandruff is to use dandruff shampoo and scalp ...

Understanding academic clinicians' intent to treat pediatric obesity.

Science.gov (United States)

Frankfurter, Claudia; Cunningham, Charles; Morrison, Katherine M; Rimas, Heather; Bailey, Karen

2017-02-08

To examine the extent to which the theory of planned behavior (TPB) predicts academic clinicians' intent to treat pediatric obesity. A multi-disciplinary panel iteratively devised a Likert scale survey based on the constructs of the TPB applied to a set of pediatric obesity themes. A cross-sectional electronic survey was then administered to academic clinicians at tertiary care centers across Canada from January to April 2012. Descriptive statistics were used to summarize demographic and item agreement data. A hierarchical linear regression analysis controlling for demographic variables was conducted to examine the extent to which the TPB subscales predicted intent to treat pediatric obesity. A total of 198 physicians, surgeons, and allied health professionals across Canada (British Columbia, Alberta, Manitoba, Saskatchewan, Nova Scotia, Ontario and Quebec) completed the survey. On step 1, demographic factors accounted for 7.4% of the variance in intent scores. Together in step 2, demographic variables and TPB subscales predicted 56.9% of the variance in a measure of the intent to treat pediatric obesity. Perceived behavioral control, that is, confidence in one's ability to manage pediatric obesity, and subjective norms, congruent with one's context of practice, were the most significant predictors of the intent to treat pediatric obesity. Attitudes and barriers did not predict the intent to treat pediatric obesity in this context. Enhancing self-confidence in the ability to treat pediatric obesity and the existence of supportive treatment environments are important to increase clinician's intent to treat pediatric obesity.

Current developments in TREAT hodoscope technology

International Nuclear Information System (INIS)

De Volpi, A.

1975-01-01

The development of fuel motion monitoring is traced from its inception through present operation and into future programs. After noting the role of fuel motion studies in terms of safety assurance for the LMFBR, the history of in-pile fuel monitoring is reviewed. The operational record of the present TREAT fast neutron hodoscope is summarized with attention to various performance features. Development plans for the TREAT hodoscope are described in some detail. Application of the hodoscope has been considered for eight safety facilities other than TREAT. In addition, there is a possible role for fuel monitoring techniques to be extended to real-time ex-vessel core surveillance in operating reactors. Certain intrinsic strengths of the hodoscope technique for material monitoring are identified. The pattern of development may be characterized as an adaptation of several technologies to fit available requirements and resources

Physics design of the upgraded TREAT reactor

International Nuclear Information System (INIS)

Bhattacharyya, S.K.; Lell, R.M.; Liaw, J.R.; Ulrich, A.J.; Wade, D.C.; Yang, S.T.

1980-01-01

With the deferral of the Safety Test Facility (STF), the TREAT Upgrade (TU) reactor has assumed a lead role in the US LMFBR safety test program for the foreseeable future. The functional requirements on TU require a significant enhancement of the capability of the current TREAT reactor. A design of the TU reactor has been developed that modifies the central 11 x 11 fuel assembly array of the TREAT reactor such as to provide the increased source of hard spectrum neutrons necessary to meet the functional requirements. A safety consequence of the increased demands on TU is that the self limiting operation capability of TREAT has proved unattainable, and reliance on a safety grade Plant Protection System is necessary to ensure that no clad damage occurs under postulated low-probability reactivity accidents. With that constraint, the physics design of TU provides a means of meeting the functional requirements with a high degree of confidence

Branding to treat jaundice in India.

Science.gov (United States)

John, Selva Inita; Balekuduru, Ainash; Zachariah, Uday; Eapen, C E; Chandy, George

2009-01-01

Jaundice is regarded as a mysterious disease rather than a symptom of disease in several parts of India. We describe 8 cases that underwent branding to treat jaundice and subsequently presented to our centre. The causes for jaundice in these patients included a variety of benign and malignant disorders. Our report suggests that despite being literate, strong cultural beliefs lead people to seek potentially harmful procedures like branding to treat jaundice in parts of India.

Plexiform Neurofibroma Treated with Pharmacopuncture

Directory of Open Access Journals (Sweden)

Chungsan Lim

2014-09-01

Full Text Available Objectives: The purpose of this study is to report a case of a plexiform neurofibroma (PNF in the pelvic region treated with sweet bee venom (SBV and mountain ginseng pharmacopuncture (MGP. Methods: A 16-year-old girl was diagnosed as having PNFs, neurofibromatosis type 1, 10 years ago and she had surgery three times to remove the benign tumors, but the growth of the PNFs continued. She has been treated in our clinic with SBV and MGP two times per month from March 2010 to April 2014. SBV was injected intra-subcutaneously at the borders of the PNFs in the pelvic region, and MGP was administrated intravenously each treatment time. Results: The growths of the PNFs occurred rapidly and continued steadily before treatment. Since March 2010, she has been treated in our clinic, and the growths of the PNFs have almost stopped; further-more, the discomfort of hip joint pain has been reduced, and her general condition has improved. Conclusion: We cautiously conclude that SBV and MGP treatment has some effects that suppress the growth and the spread of the PNFs in this patient.

Treating hydrocarbon oils

Energy Technology Data Exchange (ETDEWEB)

Knottenbelt, H W

1910-04-13

An improved process of treating petroleum and shale oils is disclosed consisting in separating by distillation fractions suitable after treatment as a substitute for turpentine and for illuminating purposes respectively such treatment consisting in separating any tar bodies that may be present and subjecting the fractions to the action of a solution of ammonia carrying litmus, substantially as and for the purpose set forth.

Distribution pattern of surgically treated symptomatic prolapsed ...

African Journals Online (AJOL)

Background: The pattern of distribution of surgically treated symptomatic prolapsed lumbar and sacral intervertebral discs has been published, though scantily, especially in males. We decided to look at our own series, compare and contrast ours with some of those published. Materials and Methods: We treated 88 locations ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... which appear to be complex. The most effective way to treat and control dandruff is to use dandruff shampoo and scalp treatments. Follow these tips from dermatologists to get the best results: Follow the instructions on the dandruff shampoo ...

Outcome of Endodontically Treated Cracked Teeth

Science.gov (United States)

2016-06-01

directed by: CAPT Te!Ty Webb, D.D.S., M.S. A " cracked tooth" is defined as a thin surface enamel and dentin disruption of unknown depth, and is often...OUTCOME OF ENDODONTICALL Y TREATED CRACKED TEETH by David Michael Dow II, D.D.S. Lieutenant Commander, Dental Corps United States Navy A thesis...copyrighted material in the thesis manuscript titled: "Outcome ofEndodontically Treated Cracked Teeth" is appropriately acknowledged and, beyond

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 437 ... Vol 13, No 1 (2016), Bird species of Mouau with special emphasis on foraging behavior of the northern ... Vol 11, No 2 (2014), Challenges of E-Waste pollution to soil ... Vol 12, No 3 (2015), Consumer preference for swine offals and its ... ethanolic leaf extracts on packed cell volume of Rattus norvegicus ...

Effects of diets containing alkali-treated Soybeans on performance ...

African Journals Online (AJOL)

Effects of diets containing alkali-treated Soybeans on performance traits, nutrient digestibility and cost benefits of broiler chickens. ... These factors accounted for the overall best performance recorded in 1% K2CO3 - treated soybeans which was closely followed by 1% Na2CO3 treated soybean base diets. Keywords: ...

Boron Diffusion in Surface-Treated Framing Lumber

Science.gov (United States)

Patricia K. Lebow; Stan T. Lebow; Steven A. Halverson

2013-01-01

The extent of boron penetration in framing lumber treated by spray applications during construction is not well quantified. This study evaluated the effect of formulation and concentration on diffusion of boron in lumber specimens that were equilibrated in conditions that produced wood moisture contents of 18 to 21 percent. One set of specimens was pressure treated...

Botulinum toxin type-A effect as a preemptive treatment in a model of acute trigeminal pain: a pre-clinical double-blind and placebo-controlled study

Directory of Open Access Journals (Sweden)

Elcio Juliato Piovesan

2011-02-01

Full Text Available The purpose of this study was to investigate if botulinum neurotoxin type-A (BoNT/A had a preemptive antinociceptive effect in a formalin-induced orofacial pain model (FT. To test this hypothesis, male Rattus norvegicus were injected with isotonic saline solution 0.9% or BoNT/A administered as a 40 μl bolus, lateral to their nose, at 24 hours, 8, 15, 22, 29 or 36 days pre-FT. The procedures were repeated 42 days later. Influence on motor activity was assessed through the open-field test. Pain scores corresponded to the time spent rubbing and flicking the injected area. Animals pre-treated with BoNT/A at the first protocol (8 days subgroup showed reduced inflammatory scores (p=0.011. For the other groups no significant results were observed at any phase. Motor activity was similar in both groups. BoNT/A showed to be effective preventing inflammatory pain up to eight days after the first treatment, an effect not reproduced on the second dose administration.

Treating infidelity in same-sex couples.

Science.gov (United States)

Martell, Christopher R; Prince, Stacey E

2005-11-01

Psychotherapy with same-sex couples does not differ markedly from standard couple therapies; this is also true for treating couples facing infidelity. However, same-sex couples often design their relationships differently, without tradition and formal marital contracts to prescribe behavior. Based on clinical experience and the empirical research, this article addresses the differing norms involved in affirmatively treating infidelity in gay and lesbian couples within the framework of integrative behavioral couple therapy (IBCT). Two cases illustrate the process and outcome of IBCT with same-sex couples.

Bladder Control Problems: Medications for Treating Urinary Incontinence

Science.gov (United States)

... control problems, including how they work to treat urinary incontinence and possible side effects. By Mayo Clinic Staff ... a look at medications commonly prescribed to treat urinary incontinence and their possible side effects. Keep in mind ...

Experimental and modelling studies on a laboratory scale anaerobic bioreactor treating mechanically biologically treated municipal solid waste.

Science.gov (United States)

Lakshmikanthan, P; Sughosh, P; White, James; Sivakumar Babu, G L

2017-07-01

The performance of an anaerobic bioreactor in treating mechanically biologically treated municipal solid waste was investigated using experimental and modelling techniques. The key parameters measured during the experimental test period included the gas yield, leachate generation and settlement under applied load. Modelling of the anaerobic bioreactor was carried out using the University of Southampton landfill degradation and transport model. The model was used to simulate the actual gas production and settlement. A sensitivity analysis showed that the most influential model parameters are the monod growth rate and moisture. In this case, pH had no effect on the total gas production and waste settlement, and only a small variation in the gas production was observed when the heat transfer coefficient of waste was varied from 20 to 100 kJ/(m d K) -1 . The anaerobic bioreactor contained 1.9 kg (dry) of mechanically biologically treated waste producing 10 L of landfill gas over 125 days.

Resistance of treated rubber wood ( Hevea brasiliensis ) to termite ...

African Journals Online (AJOL)

Spent rubber trees from a 25 year old plantation were cut, sawn and treated with Copper Chromium Arsenate (CCA) and Cashew Nut Shell Liquid (CNSL). Two sets of wood samples were treated with CCA and CNSL respectively while the third set was not treated to serve as control. The three sets were exposed to termite ...

Pre-treating water with non-thermal plasma

Science.gov (United States)

Cho, Young I.; Fridman, Alexander; Rabinovich, Alexander; Cho, Daniel J.

2017-07-04

The present invention consists of a method of pre-treatment of adulterated water for distillation, including adulterated water produced during hydraulic fracturing ("fracking") of shale rock during natural gas drilling. In particular, the invention is directed to a method of treating adulterated water, said adulterated water having an initial level of bicarbonate ion in a range of about 250 ppm to about 5000 ppm and an initial level of calcium ion in a range of about 500 ppm to about 50,000 ppm, said method comprising contacting the adulterated water with a non-thermal arc discharge plasma to produce plasma treated water having a level of bicarbonate ion of less than about 100 ppm. Optionally, the plasma treated water may be further distilled.

The number needed to treat for second-generation biologics when treating established rheumatoid arthritis

DEFF Research Database (Denmark)

Kristensen, L. E.; Jakobsen, A. K.; Bartels, E. M.

2011-01-01

To evaluate the number needed to treat (NNT) and the number needed to harm (NNH) of the second-generation biologics abatacept, certolizumab, golimumab, rituximab, and tocilizumab in patients with established rheumatoid arthritis (RA) taking concomitant methotrexate (MTX)....

Dandruff: How to Treat

Medline Plus

Full Text Available ... problems Dandruff: How to treat public SPOT Skin Cancer™ Diseases and treatments Acne and rosacea Bumps and growths Color problems ... can properly diagnose your condition and recommend a treatment plan that best meets your needs. FIND A FREE SPOTme® ... FIND A DERMATOLOGIST Advanced Search Explore the ...

Nanofluids with plasma treated diamond nanoparticles

International Nuclear Information System (INIS)

Yu Qingsong; Kim, Young Jo; Ma Hongbin

2008-01-01

In this study, diamond nanoparticles were plasma treated by glow discharges of methane and oxygen with an aim of improving their dispersion characteristics in a base fluid of water and enhancing the thermal conductivity of the resulting nanofluids. It was found that, after plasma treatment, stable nanofluids with improved thermal conductivity were obtained without using any stabilizing agents. With <0.15 vol % addition of plasma treated nanoparticles into water, a 20% increase in thermal conductivity was achieved and a 5%-10% increase in both fluid density and viscosity was observed

Gas treating absorption theory and practice

CERN Document Server

Eimer, Dag

2014-01-01

Gas Treating: Absorption Theory and Practice provides an introduction to the treatment of natural gas, synthesis gas and flue gas, addressing why it is necessary and the challenges involved.  The book concentrates in particular on the absorption-desorption process and mass transfer coupled with chemical reaction. Following a general introduction to gas treatment, the chemistry of CO2, H2S and amine systems is described, and selected topics from physical chemistry with relevance to gas treating are presented. Thereafter the absorption process is discussed in detail, column hardware is explain

Methods for treating a metathesis feedstock with metal alkoxides

Science.gov (United States)

Cohen, Steven A.; Anderson, Donde R.; Wang, Zhe; Champagne, Timothy M.; Ung, Thay A.

2018-04-17

Various methods are provided for treating and reacting a metathesis feedstock. In one embodiment, the method includes providing a feedstock comprising a natural oil, chemically treating the feedstock with a metal alkoxide under conditions sufficient to diminish catalyst poisons in the feedstock, and, following the treating, combining a metathesis catalyst with the feedstock under conditions sufficient to metathesize the feedstock.

Baseline Assessment of TREAT for Modeling and Analysis Needs

Energy Technology Data Exchange (ETDEWEB)

Bess, John Darrell [Idaho National Lab. (INL), Idaho Falls, ID (United States); DeHart, Mark David [Idaho National Lab. (INL), Idaho Falls, ID (United States)

2015-10-01

TREAT is an air-cooled, graphite moderated, thermal, heterogeneous test facility designed to evaluate reactor fuels and structural materials under conditions simulating various types of nuclear excursions and transient undercooling situations that could occur in a nuclear reactor. After 21 years in a standby mode, TREAT is being re-activated to revive transient testing capabilities. Given the time elapsed and the concurrent loss of operating experience, current generation and advanced computational methods are being applied to begin TREAT modeling and simulation prior to renewed at-power operations. Such methods have limited value in predicting the behavior of TREAT without proper validation. Hence, the U.S. DOE has developed a number of programs to support development of benchmarks for both critical and transient operations. Extensive effort has been expended at INL to collect detailed descriptions, drawings and specifications for all aspects of TREAT, and to resolve conflicting data found through this process. This report provides a collection of these data, with updated figures that are significantly more readable than historic drawings and illustrations, compositions, and dimensions based on the best available sources. This document is not nor should it be considered to be a benchmark report. Rather, it is intended to provide one-stop shopping, to the extent possible, for other work that seeks to prepare detailed, accurate models of the core and its components. Given the nature of the variety of historic documents available and the loss of institutional memory, the only completely accurate database of TREAT data is TREAT itself. Unfortunately, disassembly of TREAT for inspection, assay, and measurement is highly unlikely. Hence the data provided herein is intended serve as a best-estimate substitute.

Serological changes induced by blend of sunset yellow, metanil yellow and tartrazine in swiss albino rat, rattus norvegicus.

Science.gov (United States)

Saxena, Beenam; Sharma, Shiv

2014-01-01

The present study was carried out to evaluate the toxic effect of blend of some food colors on Swiss albino rats. A blend (1:1:1) of sunset yellow, metanil yellow and tartrazine showed additive effects on serological parameters which indicate that addition of these dye together in food stuff may give rise to more toxic effects than are produced by each dye individually. Animals were divided into four groups (I, II, III, and IV). First group was treated as control and respective group of animals received 25, 50 and 75 mg/kg body weight blend of food colors by gavaging up to 30 days. The serological study showed a decrease in total protein and albumin and an increase in alkaline phosphatase, SGPT and total bilirubin. The results revealed that oral administration of these blend did not affect the body weight gain. The prolonged consumption of the blend may cause adverse effect on human health.

Assessing the Diversity of Rodent-Borne Viruses: exploring of high-throughput sequencing and classical amplification/sequencing approaches

Czech Academy of Sciences Publication Activity Database

Drewes, S.; Straková, Petra; Drexler, J. F.; Jacob, J.; Ulrich, R. G.

2017-01-01

Roč. 99, č. 4 (2017), s. 61-108 ISSN 0065-3527 Institutional support: RVO:68081766 Keywords : hepatitis-e virus * squirrels Sciurus-vulgaris * dependent DNA-polymerase * korean hemorrhagic-fever * beaver Castor-canadensis * mouse Micromys-minutus * rats Rattus-norvegicus * rous-sarcoma-virus * West-Nile-virus * population-cycles Subject RIV: EE - Microbiology, Virology OBOR OECD: Virology Impact factor: 4.243, year: 2016

NCBI nr-aa BLAST: CBRC-RNOR-03-0467 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-03-0467 ref|NP_077809.1| adrenergic receptor, alpha 1d [Rattus norvegicus...] sp|P23944|ADA1D_RAT Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (RA42) gb|AAB59704.1| alpha 1a/d adrenergic receptor NP_077809.1 0.0 99% ...

NCBI nr-aa BLAST: CBRC-GGAL-04-0044 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-04-0044 ref|NP_077809.1| adrenergic receptor, alpha 1d [Rattus norvegicus...] sp|P23944|ADA1D_RAT Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (RA42) gb|AAB59704.1| alpha 1a/d adrenergic receptor NP_077809.1 1e-171 59% ...

Dandruff: How to Treat

Medline Plus

Full Text Available ... see a board-certified dermatologist? Home Public and patients Diseases and treatments Hair and scalp problems Dandruff: How to treat ... can properly diagnose your condition and recommend a treatment plan that best meets your needs. FIND A FREE SPOTme® SKIN CANCER SCREENING ... & patients Academy resources for: Dermatologists in the US and ...

Evaluating and Treating Transverse Myelitis

Science.gov (United States)

... myelitis (TM). Neurologists from the American Academy of Neurology are doctors who identify and treat diseases of ... an educational service of the American Academy of Neurology. It is based on an assessment of current ...

Treating Cushing's Disease in Dogs

Science.gov (United States)

... For Consumers Consumer Updates Treating Cushing's Disease in Dogs Share Tweet Linkedin Pin it More sharing options ... FDA Consumer Health Information Your 9-year old dog has been drinking a lot more lately and ...

A new flowsheeting tool for flue gas treating

NARCIS (Netherlands)

van Elk, E. P.; Arendsen, A. R. J.; Versteeg, G. F.

2009-01-01

A new flowsheeting tool, specifically designed for steady-state simulation of acid gas treating processes, has been developed. The models implemented in the new tool combine all issues relevant for the design, optimization and analysis of acid gas treating processes, including post-combustion and

A Novel Therapeutic Frame for Treating Depression in Group Treating Depression Downhill

OpenAIRE

Valery Krupnik

2014-01-01

We describe an original protocol Treating Depression Downhill (TDD) that was designed as a specific therapy for depression. Evolutionary theories of depression served as a basis for its development. We discuss the rationale for using evolutionary theory and describe the structure and integrative nature of TDD. We then present an observation on TDD’s application to group therapy of active duty military personnel. In the...

TREAT hodoscope interpretation. II. Fuel-state identification

International Nuclear Information System (INIS)

Wu, R.M.; Omberg, R.P.; Albrecht, R.W.

1982-01-01

By using the autoregressive-integrated-moving-average (ARIMA) process, the onset of fuel disposal and the restructured fuel states of a TREAT test can be unambiguously identified. The results of the ARIMA analyses on the TREAT L7 hodoscope data show the most probable time of the restructuring began at 14.038 seconds, and four restructured fuel states are required to interpret adequately the L7 hodoscope data

Treating and Preventing Sports Hernias

Science.gov (United States)

... Close ‹ Back to Healthy Living Treating and Preventing Sports Hernias If you play ice hockey, tennis or ... for the most commonly misdiagnosed groin pain—a sports hernia. A sports hernia often results from overuse ...

Effect of the caffeine on treated and non-treated plasmid DNA with stannic chloride

International Nuclear Information System (INIS)

Moreno, Silvana Ramos F.; Universidade Federal Fluminense, Niteroi, RJ; Mattos, Jose C.P. de; Dantas, Flavio; Araujo, Adriano Caldeira de; Bernardo-Filho, Mario

2000-01-01

Caffeine, a methilxantine drug is a component of coffee, tea, stimulants and other drinks. Caffeine inhibits phosphodiesterase leading to intracellular accumulation of cyclic AMP, blocks adenosine receptors, and increases the release of Ca 2+ . We have studied the possible effect of caffeine in DNA plasmid treated or not with stannous chloride (SnCl 2 ). Previous evaluations of the effect of caffeine on the labeling of red blood cells and plasma proteins with technetium-99m have showed a decrease of % ATI in the insoluble fraction of plasma proteins. Samples of DNA were treated with SnCl 2 (0 and 200μg/ml) in 0.8% agarose. SnCl 2 has induced break on DNA and caffeine has not showed effect on the DNA. This indicates that caffeine does not eliminate the oxidant action of SnCl 2 and does not promote break in isolated DNA plasmid. (author)

Treat upgrade fuel fabrication

International Nuclear Information System (INIS)

Davidson, K.V.; Schell, D.H.

1979-01-01

An extrusion and thermal treatment process was developed to produce graphite fuel rods containing a dispersion of enriched UO 2 . These rods will be used in an upgraded version of the Transient Reactor Test Facility (TREAT). The improved fuel provides a higher graphite matrix density, better fuel dispersion and higher thermal capabilities than the existing fuel

Agricultural use of treated municipal wastewaters preserving environmental sustainability

OpenAIRE

Pietro Rubino; Maurizia Catalano; Antonio Lonigro

2007-01-01

In this paper the utility of the treated municipal wastewaters in agriculture, analyzing the chemical, physical and microbiological characteristics and their pollution indicators evaluation are being illustrated. Some methods employed for treating wastewaters are examined, as well as instructions and rules actually in force in different countries of the world, for evaluating the legislative hygienic and sanitary and agronomic problems connected with the treated wastewaters use, are being coll...

Gene response in rice plants treated with continuous fog influenced by pH, was similar to that treated with biotic stress.

Science.gov (United States)

Satoh, Kouji; Saji, Shoko; Ito, Shoko; Shimizu, Hideyuki; Saji, Hikaru; Kikuchi, Shoshi

2014-01-01

Throughout Asia, including Japan, rice plants are cultivated in a wide range of areas from lowlands to highlands and are frequently exposed to fog, including acid fog. Some physiological studies have shown that acid fog can be a stress factor for plants. We analyzed the gene expression profiles of rice plants treated with artificially prepared simulated acid fog (SiAF) or simulated neutral fog (SiNF) for 1 or 7 days. Microarray analysis results suggested that both the SiAF and the SiNF treatments induced the expression of genes involved in the defense and stress responses in rice plants. Induction of such genes was detected in plants treated with SiAF for 1 day, and the number of induced genes increased in plants treated with SiAF for 7 days. The genes for defense and stress responses were also induced by SiNF for 7 days, although they were not induced by SiNF for 1 day. The gene expression profiles of the SiAF-treated and the SiNF-treated plants were compared to those of plants treated with other stress factors. The comparison revealed that both SiAF and SiNF treatments have similar effects to biotic stresses and ozone stress. The genes encoding NADPH oxidase and germin, which function in apoplasts, were also induced by SiAF, SiNF and biotic stresses. These findings suggest that both the SiAF and the SiNF treatments may result in oxidative stress through the apoplastic production of reactive oxygen species.

Best Medications to Treat Fibromyalgia

Science.gov (United States)

... open('/content/cro/en/health/prescription-drugs/best-buy-drugs/Evaluating_Prescription_Drugs_Used_to_Treat_Fibromyalgia.print. ... price, we have chosen three Consumer Reports Best Buy Drugs as initial options to consider if you and ...

Pump and treat may be the solution

International Nuclear Information System (INIS)

Hoffman, A. H.; Truax, S. K.; Conrad, D.

1997-01-01

A case history of a 'pump and treat' system, designed to remediate chlorinated solvents and petroleum hydrocarbons in soil and groundwater resulting from historic leaking of six underground storage tanks, was described. The objective of this paper was two-fold: (1) to call into question the findings of some earlier studies which claimed that 'pump and treat' will not work to remediate impacted groundwater in a timely or cost-effective manner, and (2) to demonstrate that under certain circumstances, at some sites, groundwater 'pump and treat' may be the most appropriate, lowest cost remediation alternative. The paper also demonstrates the applicability of horizontal wells and methods to use soil venting in the saturated zone as opposed to its traditional use in the vadose zone. Details of the design parameters, system characteristics and operation are provided. 2 refs., 2 tabs

How to Treat Gestational Diabetes

Science.gov (United States)

... A Listen En Español How to Treat Gestational Diabetes Be sure to see the latest Diabetes Forecast ... and a healthy start for your baby. Gestational Diabetes – Looking Ahead Gestational diabetes usually goes away after ...

Treating Obesity As a Disease

Science.gov (United States)

... Obesity, And What You Can Do Understanding the American Obesity Epidemic Stress Management How Does Stress Affect You? ... Keeping the Weight Off • Obesity - Introduction - Understanding the American Obesity Epidemic - Treating Obesity as a Disease - Childhood Obesity ...

Treating oil shale

Energy Technology Data Exchange (ETDEWEB)

Dolbear, S H

1921-01-04

Oil shale is treated for the separation of the valuable organic compounds, with a view to economy in subsequent destructive distillation, by grinding to powder, mixing with water to form a pulp, adding a small quantity of an oil liquid and aerating the mixture to form a froth containing the organic compounds. If the powdered shale contains sufficient free oil, the addition of oil to the pulp may be dispensed with. In some cases an electrolyte such as sulfuric acid may be added to the pulp.

An ethnobotanical survey of indigenous flora for treating ...

African Journals Online (AJOL)

An ethnobotanical survey of medicinal plants used locally for treating tuberculosis (TB) and other respiratory diseases was conducted from November 2004 to March 2005 in Niger State-Nigeria. The survey was aimed at identifying plants used in traditional medicine for treating TB and other pulmonary ailments in Niger ...

Study on the improvement of hydrophilic character on polyvinylalcohol treated polyester fabric

Directory of Open Access Journals (Sweden)

S. Pitchai

2014-12-01

Full Text Available Polyester fabric was treated with polyvinyl alcohol in alkaline medium. The moisture regain, water retention and wettability of the PVA treated polyester fabric were tested. The PVA treated PET fabric was dyed with disperse dye. The presence of PVA in the treated PET fabric was assessed by spot test. The treated fabric was also characterized by scanning electron microscope, FTIR and differential scanning calorimetry. The PVA treated polyester fabric showed improved hydrophilic character over intact and sodium hydroxide treated PET fabrics.

Legislation on treating animals in human care

OpenAIRE

Konečná, Petra

2016-01-01

1 Abstract This Master's thesis entitled Legislation on treating animals in human care compares Czech and Australian legislation in selected aspects of three categories of animals in human care - farm animals, companion animals and animals used for scientific and other research purposes. The thesis is composed of 5 main chapters. The first chapter describes sources of law regarding treating animals in human care from the perspectives of international law, European Union law, federal Czech law...

Studies on sequestration of neuraminidase-treated red blood cells

International Nuclear Information System (INIS)

Simchon, S.; Jan, K.M.; Chien, S.

1988-01-01

The effects of reduction in the surface charge of red blood cells (RBCs) on regional blood flow and RBC distribution were studied in rats anesthetized with pentobarbital sodium. RBCs were treated with neuraminidase to reduce their electrophoretic mobility by 56%. Normal and neuraminidase-treated RBCs labeled with 51Cr or 111In were injected into a femoral vein while an equal volume of blood was simultaneously withdrawn from a femoral artery. More than 70% of the neuraminidase-treated RBCs injected disappeared from the circulating blood in 30 min compared with less than 2% of normal RBCs. The relative distributions of neuraminidase-treated RBCs to normal RBCs, as determined from radioactivity counting, were significantly greater than 1 in the spleen (5.65 +/- 0.97, mean +/- SD), the liver (2.84 +/- 0.21), the lung (1.48 +/- 0.31), and the kidney (1.49 +/- 0.27), indicating a preferential trapping of neuraminidase-treated RBCs in these regions. This ratio was approximately 1 in all other organs. Regional blood flows in tissues were determined with 15-micron microspheres in the control period and after the infusion of neuraminidase-treated RBCs (experimental). Experimental-to-control blood flow ratios were 0.40 +/- 0.05 in the spleen, 0.66 +/- 0.06 in the liver, 0.78 +/- 0.03 in the lung, and 0.78 +/- 0.09 in the kidneys; this ratio was approximately 1 in all other organs. An experimental-to-control blood flow ratio less than 1 indicates a reduction in blood flow; this occurred in the same organs as those with trapping of neuraminidase-treated RBCs

Effectiveness of 308-nm Excimer Laser Therapy in Treating Alopecia Areata, Determined by Examining the Treated Sides of Selected Alopecic Patches.

Science.gov (United States)

Byun, Ji Won; Moon, Jong Hyuk; Bang, Chan Yl; Shin, Jeonghyun; Choi, Gwang Seong

2015-01-01

Some studies have reported the use of 308-nm excimer laser therapy for treating alopecia areata (AA); however, the effectiveness of this therapy on a theoretical basis has not yet been comparatively analyzed. To determine the therapeutic effect of excimer laser therapy on AA. One alopecic patch was divided into control and treated sides in 10 patients with AA. Then, 308-nm excimer laser therapy was administered twice a week for 12 weeks. Photograph and phototrichogram analyses were performed. Photographic assessments by both dermatologists and individuals of the general population showed objective improvements after excimer laser therapy. On the treated side, the hair count and hair diameter had statistically increased after treatment. However, only the hair diameter was found to be significantly high in the treated half when it was compared with the control side. The 308-nm excimer laser has a therapeutic effect on AA, which is proven by photograph and phototrichogram analysis by a side-by-side comparison. © 2015 S. Karger AG, Basel.

Cryotherapy usage to treat plantar warts

International Nuclear Information System (INIS)

Miranda Diaz, BelkisTamara

2010-01-01

Treating dermatosis with liquid nitrogen as cryogen (substance generating cold) allows cellular destruction in more than 5 mm depth, making it indispensable to use it treating cutaneous cancers; besides that, it is cheap, easy to conserve and manage, and it is not considered flammable or toxic. Its applying retains the growth factor inside the injury, the collagen is not damaged as it is in burning by hot, there is not almost injury contraction, the perineurium is not altered, and when the tissue necrosis takes place, it retains tissue necrosis factor, helping to increase the necrosis of tissues. Taking into account the high incidence of dermatosis that can be treated with cryogen, in our consultation; we decided to generalize this treatment at the Provincial Interior Ministry Clinic. Plantar warts represent a big percent, limiting our patients in developing their working activities. This cutaneous viral disease is favored by the patients' systemic immunodepressions, hyperhidrosis and podalic disturbances. We selected the patients assisting to our extern al consultation with plantar wart clinical diagnosis in the period from September 2006 to September 2007. They signed an act of informed consent where the possible side effects are explained. Liquid nitrogen was applied with cotton applicators once a week after mechanical reduction. We made a clinical evolving evaluation fortnightly during the treatment, according to the elements and clinical characteristics referred by the patient, and proved by the physical examination carried out by the main investigator, because of the likelihood of short and long time side effects. This investigation demonstrated that cryotherapy is efficacious in treating plantar warts, since all the patients were healed in a short time period, most of them without side effects

Method of treating depression

Science.gov (United States)

Henn, Fritz [East Patchogue, NY

2012-01-24

Methods for treatment of depression-related mood disorders in mammals, particularly humans are disclosed. The methods of the invention include administration of compounds capable of enhancing glutamate transporter activity in the brain of mammals suffering from depression. ATP-sensitive K.sup.+ channel openers and .beta.-lactam antibiotics are used to enhance glutamate transport and to treat depression-related mood disorders and depressive symptoms.

Anxiety in Patients Treated with Hemodialysis.

Science.gov (United States)

Cohen, Scott D; Cukor, Daniel; Kimmel, Paul L

2016-12-07

Anxiety is a common yet frequently overlooked psychiatric symptom in patients with ESRD treated with hemodialysis (HD). Anxiety is characterized by disruptive feelings of uncertainty, dread, and fearfulness. A variety of common medical complaints may be manifestations of an anxiety disorder, including palpitations, tremors, indigestion, numbness/tingling, nervousness, shortness of breath, diaphoresis, and fear. It is essential for the clinician to rule out specific medical conditions, including cardiovascular, pulmonary, and neurologic diseases, before ascribing these symptoms to an anxiety disorder. In addition, there is considerable overlap between the symptoms of anxiety and those of depression and uremia. This psychiatric condition has a significant adverse impact on patients' perception of quality of life. Little is known regarding the prevalence and impact of anxiety disorders in patients with ESRD treated with HD; however, many of the seemingly irrational behaviors of patients, or behaviors which place them in conflict with staff and physicians, such as behavioral noncompliance, may be the expression of an underlying anxiety disorder. In this review, we present three clinical vignettes, highlighting the impact of anxiety disorders in patients with ESRD treated with HD. Copyright © 2016 by the American Society of Nephrology.

Effectiveness testing of spill-treating agents

International Nuclear Information System (INIS)

Fingas, M.F.; Stoodley, R.; Laroche, N.

1990-01-01

Laboratory effectiveness tests are described for four classes of spill-treating agents: solidifiers, demulsifying agents, surface-washing agents and dispersants. Many treating agents in these four categories have been tested for effectiveness and the results are presented. Solidifiers or gelling agents solidify oil, requiring a large amount of agent to solidify oil-ranging between 16% by weight, to over 200%. Emulsion breakers prevent or reverse the formation of water-in-oil emulsions. A newly-developed effectiveness test shows that only one product is highly effective; however, many products will work, but require large amounts of spill-treating agent. Surfactant--containing materials are of two types, surface-washing agents and dispersants. Testing has shown that an agent that is a good dispersant is conversely a poor surface-washing agent, and vice versa. Tests of surface-washing agents show that only a few agents have effectiveness of 25-40%, where this effectiveness is the percentage of heavy oil removed from a test surface. Results using the 'swirling flask' test for dispersant effectiveness are reported. Heavy oils show effectiveness values of about 1%, medium crudes of about 10%, light crude oils of about 30% and very light oils of about 90%. (author)

Development of new concepts for escape windows to minimise cod catches in Norway lobster fisheries

DEFF Research Database (Denmark)

Madsen, Niels; Frandsen, Rikke; Holst, René

2010-01-01

Gear selectivity with regard to cod (Gadus morhua) needs to be improved in the Kattegat and Skagerrak Norway lobster (Nephrops norvegicus) fishery. One way to achieve this goal is to improve the selectivity of an escape window (henceforth window) in the gear. Our gear development focused particul......Gear selectivity with regard to cod (Gadus morhua) needs to be improved in the Kattegat and Skagerrak Norway lobster (Nephrops norvegicus) fishery. One way to achieve this goal is to improve the selectivity of an escape window (henceforth window) in the gear. Our gear development focused...... particularly on moving the window further back, gaining more stability in the codend to avoid loss of Norway lobster through the window, making a relatively narrow section where the window is located, and testing larger mesh sizes in the window. We designed a four panel sorting section—the sorting box......, but no improvement was observed for cod that came into contact with the window after reducing the distance from the window to the codline. The sorting box also showed a high reduction of flatfish and other roundfish species. The retention of Norway lobster above minimum landing size in the sorting box was higher...

Ocorrência de Babesia sp em pequenos roedores no Brasil Occurrence of Babesia sp in small rodents in Brazil

Directory of Open Access Journals (Sweden)

G.S. Gazeta

2004-12-01

Full Text Available Foi analisada a ocorrência de babesiose em pequenos roedores nos municípios de Silva Jardim e Nova lguaçu, Estado do Rio de Janeiro. Foram capturados 44 roedores de seis espécies diferentes e entre eles a prevalência da infecção foi de 27,3%. Rattus norvegicus foi considerado o principal reservatório (50,0% e Oligoryzomys nigripes como novo hospedeiro para Babesia sp. Este foi o primeiro relato de Babesia sp. em roedores no Brasil. A freqüência de roedores positivos e o risco de infecção dos roedores não diferiram entre as áreas estudadas.The occurrence of babesiosis was studied in 44 small rodents of six species captured in Silva Jardim and Nova lguaçu counties, State of Rio de Janeiro, Brazil. The prevalence of injection was 27.3%. Rattus norvegicus was considered as the main reservoir and Oligoryzomys nigripes as a new host to Babesia sp. The frequency and the risk of rodent infection were considered equal among the studied areas. This is the first report of Babesia sp in small rodents in Brazil.

Treated Wastewater Reuse on Potato (Solanum Tuberosum)

DEFF Research Database (Denmark)

Battilani, A; Plauborg, Finn; Andersen, Mathias Neumann

2014-01-01

A field experiment was carried out in Northern Italy (Po Valley), within the frame of the EU project SAFIR, to asses the impact of treated wastewater reuse on potato yield, quality and hygiene. The potato crop was drip irrigated and fertigated. Wastewater produced by small communities (≤2000 EI......) was treated by Membrane Bio Reactor (MBR) technology and gravel filter (FTS) during three cropping seasons. Treated wastewater, soil and tubers were analysed for the faecal indicator bacterium E. coli and heavy metals contents. Potato total yield was similar for tap and reused water, while the marketable...... production has been found higher with the latter. The tuber dry matter content as well as reducing sugars were not affected by reused water. Total sugars content was higher with MBR and FTS water. Water use efficiency (WUE) was significantly higher with reused water. Compared to tap water, crop gross margin...

Using atmospheric pressure plasma treatment for treating grey cotton fabric.

Science.gov (United States)

Kan, Chi-Wai; Lam, Chui-Fung; Chan, Chee-Kooi; Ng, Sun-Pui

2014-02-15

Conventional wet treatment, desizing, scouring and bleaching, for grey cotton fabric involves the use of high water, chemical and energy consumption which may not be considered as a clean process. This study aims to investigate the efficiency of the atmospheric pressure plasma (APP) treatment on treating grey cotton fabric when compared with the conventional wet treatment. Grey cotton fabrics were treated with different combinations of plasma parameters with helium and oxygen gases and also through conventional desizing, scouring and bleaching processes in order to obtain comparable results. The results obtained from wicking and water drop tests showed that wettability of grey cotton fabrics was greatly improved after plasma treatment and yielded better results than conventional desizing and scouring. The weight reduction of plasma treated grey cotton fabrics revealed that plasma treatment can help remove sizing materials and impurities. Chemical and morphological changes in plasma treated samples were analysed by FTIR and SEM, respectively. Finally, dyeability of the plasma treated and conventional wet treated grey cotton fabrics was compared and the results showed that similar dyeing results were obtained. This can prove that plasma treatment would be another choice for treating grey cotton fabrics. Copyright © 2013 Elsevier Ltd. All rights reserved.

Agricultural use of treated municipal wastewaters preserving environmental sustainability

Directory of Open Access Journals (Sweden)

Antonio Lonigro

2007-07-01

Full Text Available In this paper the utility of the treated municipal wastewaters in agriculture, analyzing the chemical, physical and microbiological characteristics and their pollution indicators evaluation are being illustrated. Some methods employed for treating wastewaters are examined, as well as instructions and rules actually in force in different countries of the world, for evaluating the legislative hygienic and sanitary and agronomic problems connected with the treated wastewaters use, are being collected and compared. Successively, in order to provide useful indications for the use of treated municipal wastewaters, results of long-term field researches, carried out in Puglia, regarding two types of waters (treated municipal wastewater and conventional water and two irrigation methods (drip and capillary sub-irrigation on vegetable crops grown in succession, are being reported. For each crop cycle, chemical physical and microbiological analyses have been performed on irrigation water, soil and crop samples. The results evidenced that although irrigating with waters having high colimetric values, higher than those indicated by law and with two different irrigation methods, never soil and marketable yield pollutions have been observed. Moreover, the probability to take infection and/or disease for ingestion of fruits coming from crops irrigated with treated wastewaters, calculated by Beta-Poisson method, resulted negligible and equal to 1 person for 100 millions of exposed people. Concentrations of heavy metals in soil and crops were lesser than those admissible by law. The free chlorine, coming from disinfection, found in the wastewaters used for watering, in some cases caused toxicity effects, which determined significant yield decreases. Therefore, municipal wastewaters, if well treated, can be used for irrigation representing a valid alternative to the conventional ones.

[Endodontically treated teeth. Success--failure. Endorestorative treatment plan].

Science.gov (United States)

Zabalegui, B

1990-01-01

More and more often the general dentist is finding the presence of endodontically treated teeth during his treatment planning procedure. He has to ask himself if the endo-treated tooth functions and will continue to function function successfully, when deciding which final endo-restorative procedure to apply. For this reason the dentist or the endodontist with whom he works should clinically evaluate these teeth, establish a diagnostic criteria of their success or failure and a treatment plan according to the prognosis. The purpose of this article is to offer an organized clinical view of the steps to follow when evaluating an endodontically treated tooth and how to establish a final endo-restorative plan.

Treating rheumatoid arthritis to target

DEFF Research Database (Denmark)

Smolen, Josef S; Breedveld, Ferdinand C; Burmester, Gerd R

2016-01-01

BACKGROUND: Reaching the therapeutic target of remission or low-disease activity has improved outcomes in patients with rheumatoid arthritis (RA) significantly. The treat-to-target recommendations, formulated in 2010, have provided a basis for implementation of a strategic approach towards this t...

Factors affecting sodium hypochlorite extraction of CCA from treated wood.

Science.gov (United States)

Gezer, E D; Cooper, P A

2009-12-01

Significant amounts of chromated copper arsenate (CCA) treated wood products, such as utility poles and residential construction wood, remain in service. There is increasing public concern about environmental contamination from CCA-treated wood when it is removed from service for reuse or recycling, placed in landfills or burned in commercial incinerators. In this paper, we investigated the effects of time, temperature and sodium hypochlorite concentration on chromium oxidation and extraction of chromated copper arsenate from CCA-treated wood (Type C) removed from service. Of the conditions evaluated, reaction of milled wood with sodium hypochlorite for one hour at room temperature followed by heating at 75 degrees C for two hours gave the highest extraction efficiency. An average of 95% Cr, 99% Cu and 96% As could be removed from CCA-treated, milled wood by this process. Most of the extracted chromium was oxidized to the hexavalent state and could therefore be recycled in a CCA treating solution. Sodium hypochlorite extracting solutions could be reused several times to extract CCA components from additional treated wood samples.

Intracellular Protein Delivery for Treating Breast Cancer

Science.gov (United States)

2014-08-01

machinery. In stark contrast, hen HeLa cells were treated with S S Rho—APO NC, strong ed fluorescence of rhodamine was present in the nuclei, esulting...limit (>2500mm3) within 12 days. n sharp contrast, tumor growth was significantly delayed hen treated with S S APO NC (Fig. 4a). Fixed tumor tis- ues...estimation of that each nano molecules throu l groups. ting ligands g” of cycloocty ed nanocapsule targeting ligand ing hormone (L eu -Arg-Pro-NH that

Variability in evaluating environmental impacts of treated wood.

Science.gov (United States)

Stan T. Lebow; Paul Cooper; Patricia K. Lebow

2004-01-01

Preservative-treated wood contains components that may be toxic to non-target organisms if released into the environment in sufficient quantities. Numerous studies have been conducted to determine the rate of preservative release from treated wood and/or the extent of their subsequent accumulation in the environment. These studies have produced a wide range of results...

[Ultraminipercutaneous nephrolithotripsy in treating kidney stones].

Science.gov (United States)

Martov, A G; Dutov, S V; Andronov, A S

2016-04-01

Percutaneous nephrolithotripsy (PNL) is the recommended method of surgical treatment of kidney stones of size greater than 2 cm. Trends in the development of modern urology have been steadily toward less traumatic method to treat nephrolithiasis - minimally invasive PNL. The present work aimed to explore of the possibilities of one of the modern variants of minimally invasive PNL - ultra-mini-PNL in treating nephrolithiasis. The study included 60 patients (mean age 45.6+/-7.2 years) with isolated kidney calculus, up to 2.0 cm or several stones with a total size of up to 2.5 cm. All patients were found to have 77 kidney stones, six of which had a size of 10 mm, 51 had a size of 11-15 mm and 20 had a size of 16-20 mm. 45% of patients had isolated renal pelvic stones and 28.3% had stones in the renal pelvis and lower calyx. All patients underwent ultra-mini-PNL using nephroscope size 7.5 Ch and tube size 12 Fr. The average duration of surgery from the moment of the puncture of the pyelocaliceal system to installing the nephrostomy tube was 65.4 minutes. Complete clearance of stones after single-stage ultra-mini-PNL was observed in 80% of cases. Nephrostomy tube was removed on days 2-3. The average postoperative hospital stay was 5.1 days. The most common complication was postoperative exacerbation of pyelonephritis (13.3% of patients), successfully treated with conservative measures. There were no cases of postoperative bleeding, accompanied by anemia and needed a blood transfusion. Considering high effectiveness and low rate of complications of ultra-mini-PNL, it can be successfully used in treating nephrolithiasis among a wide group of patients.

AcEST: BP912733 [AcEST

Lifescience Database Archive (English)

Full Text Available C and casein kinase substrate in neurons protein 1 OS=Mus musculus GN=Pacsin1 PE...se substrate in neurons protein 1 OS=Rattus norvegicus GN=Pacsin1 PE=1 SV=1 Length = 441 Score = 32.3 bits (...e in neurons protein 1 OS=Pongo abelii GN=Pacsin1 PE=2 SV=1 Length = 444 Score = 32.0 bits (71), Expect = 2.

Comparison of long-term prognosis of patients with AIDS treated and not treated with zidovudine. AIDS in Europe Study Group

DEFF Research Database (Denmark)

Lundgren, Jens Dilling; Phillips, A N; Pedersen, C

1994-01-01

zidovudine, the death rate was approximately constant for the first 5 years after AIDS diagnosis. For patients treated with zidovudine, the death rate within the first year since starting zidovudine was markedly lower than for untreated patients who had developed AIDS at the same time (relative rate, 0......OBJECTIVE--To determine the association between elapsed time since starting zidovudine and survival in patients with acquired immunodeficiency syndrome (AIDS). DESIGN--Inception cohort and observational study of patients treated and not treated with zidovudine. SETTING--Fifty-one centers in 17...... European countries. PATIENTS--A total of 4484 patients diagnosed as having AIDS from 1979 to 1989 who survived their initial AIDS-defining event and who had not started zidovudine before AIDS diagnosis. MAIN OUTCOME MEASURES--Use of zidovudine and mortality. RESULTS--Among patients who did not receive...

Surface resistivity measurement of plasma treated polymers

International Nuclear Information System (INIS)

Simon, D.; Pigram, P.J.; Liesegang, J.

2000-01-01

Full text: Resistivity of insulators is an important property of materials used within the integrated circuit and packaging industries. The measurement of electrical resistivity of insulator materials in the surface region in this work is interpreted through observations of surface charge decay. A self-field driven and diffusion charge transport theory is used to model the process and resistivity values obtained computationally. Data for the charge decay of surface charged samples are collected by suspending them inside a coaxial cylinder connected to an electrometer. Samples used have been low density polyethylene LDPE sheet, both pristine and surface treated. Some samples have been treated by air plasma at low vacuum pressures for different periods of time; others have been washed in ethyl acetate and then plasma treated before the resistivity measurement. The sets of resistivity measurements form the various treatments are compared below. X-ray photoelectron spectroscopy (XPS) has also been used to investigate and account for the observed variations in surface resistivity

Young Children Treat Robots as Informants.

Science.gov (United States)

Breazeal, Cynthia; Harris, Paul L; DeSteno, David; Kory Westlund, Jacqueline M; Dickens, Leah; Jeong, Sooyeon

2016-04-01

Children ranging from 3 to 5 years were introduced to two anthropomorphic robots that provided them with information about unfamiliar animals. Children treated the robots as interlocutors. They supplied information to the robots and retained what the robots told them. Children also treated the robots as informants from whom they could seek information. Consistent with studies of children's early sensitivity to an interlocutor's non-verbal signals, children were especially attentive and receptive to whichever robot displayed the greater non-verbal contingency. Such selective information seeking is consistent with recent findings showing that although young children learn from others, they are selective with respect to the informants that they question or endorse. Copyright © 2016 Cognitive Science Society, Inc.

Treating infidelity: clinical and ethical directions.

Science.gov (United States)

Snyder, Douglas K; Doss, Brian D

2005-11-01

This article addresses clinical and ethical directions in treating clients coping with infidelity. Developing competence in this domain requires familiarity with empirical research regarding infidelity, individual and cultural differences involving non-monogamy, and assessment and intervention skills related to treating infidelity. Practical directions will entail distinguishing among responsibilities to individual partners versus their relationship and managing related potential conflicts of interest with other involved parties. Confidentiality assumes increased complexity when confronting undisclosed infidelity in couple therapy and when a client engaging in high-risk behaviors for contracting STDs or testing seropositive for HIV has not informed his or her partner(s). Finally, we discuss therapists' need to concretely articulate their values that influence treatment of infidelity.

Influence of household rat infestation on leptospira transmission in the urban slum environment.

Science.gov (United States)

Costa, Federico; Ribeiro, Guilherme S; Felzemburgh, Ridalva D M; Santos, Norlan; Reis, Renato Barbosa; Santos, Andreia C; Fraga, Deborah Bittencourt Mothe; Araujo, Wildo N; Santana, Carlos; Childs, James E; Reis, Mitermayer G; Ko, Albert I

2014-12-01

The Norway rat (Rattus norvegicus) is the principal reservoir for leptospirosis in many urban settings. Few studies have identified markers for rat infestation in slum environments while none have evaluated the association between household rat infestation and Leptospira infection in humans or the use of infestation markers as a predictive model to stratify risk for leptospirosis. We enrolled a cohort of 2,003 urban slum residents from Salvador, Brazil in 2004, and followed the cohort during four annual serosurveys to identify serologic evidence for Leptospira infection. In 2007, we performed rodent infestation and environmental surveys of 80 case households, in which resided at least one individual with Leptospira infection, and 109 control households. In the case-control study, signs of rodent infestation were identified in 78% and 42% of the households, respectively. Regression modeling identified the presence of R. norvegicus feces (OR, 4.95; 95% CI, 2.13-11.47), rodent burrows (2.80; 1.06-7.36), access to water (2.79; 1.28-6.09), and un-plastered walls (2.71; 1.21-6.04) as independent risk factors associated with Leptospira infection in a household. We developed a predictive model for infection, based on assigning scores to each of the rodent infestation risk factors. Receiver operating characteristic curve analysis found that the prediction score produced a good/excellent fit based on an area under the curve of 0.78 (0.71-0.84). Our study found that a high proportion of slum households were infested with R. norvegicus and that rat infestation was significantly associated with the risk of Leptospira infection, indicating that high level transmission occurs among slum households. We developed an easily applicable prediction score based on rat infestation markers, which identified households with highest infection risk. The use of the prediction score in community-based screening may therefore be an effective risk stratification strategy for targeting control

Suitability of green solvent in pre treating agricultural waste

International Nuclear Information System (INIS)

Yoon, Li Wan; Ngoh, Gek Cheng; Chua, Adeline Seak May

2010-01-01

Full text: Agricultural wastes such as palm oil residue, rice husk and sugarcane bagasse have been found to occupy the largest fraction in the total biomass generated in Malaysia. These residues are normally lacking of commercial values and have limited alternative uses. Since they are being generated substantially every year, their disposal has caused a serious problem to the society and the environment. Hence, it is essential to discover the potentials of converting these wastes into wealth. One of the major drawbacks which hinder their effective utilization is due to their recalcitrant nature. Thus, pretreatment is necessary in order to disrupt the complex carbohydrate structures in the substrate and improves its digestibility. The present study showed the efficiencies of various mediums namely ionic liquid, acid, alkali and water in pre treating sugarcane bagasse. The performances of these pretreatment mediums were evaluated by the reducing sugar generated after enzymatically hydrolysed the treated substrate. The results obtained were compared with the untreated sugarcane bagasse. In this study, substrate treated by ionic liquid has yielded the highest amount of reducing sugar followed by alkali treated substrate. The performance of untreated bagasse is found to be better than acid and water treated bagasse. These results showed that ionic liquid which has been identified as the green solvent can be an effective medium in pre treating the sugarcane bagasse. This finding has given a new prospect in the production of value added products from agricultural wastes. (author)

Somatic symptom disorder treated with electroconvulsive therapy.

Science.gov (United States)

Borisovskaya, Anna; Augsburger, Jay Alan

2017-05-01

Somatic symptom disorder (SSD) is a challenging condition to treat with chronic pain, a common and disabling symptom. We present a patient who received electroconvulsive therapy (ECT) for SSD with significant improvement in pain and gastrointestinal symptoms. We also present a brief literature review of similar cases treated with ECT. Preliminary evidence suggests that ECT should be considered for treatment of SSD comorbid with major depressive disorder, when standard treatments fail. Further research is needed to clarify whether ECT can be used for SSD without associated depression.

Restoration of Endodontically Treated Molars Using All Ceramic Endocrowns

Directory of Open Access Journals (Sweden)

Roopak Bose Carlos

2013-01-01

Full Text Available Clinical success of endodontically treated posterior teeth is determined by the postendodontic restoration. Several options have been proposed to restore endodontically treated teeth. Endocrowns represent a conservative and esthetic restorative alternative to full coverage crowns. The preparation consists of a circular equigingival butt-joint margin and central retention cavity into the entire pulp chamber constructing both the crown and the core as a single unit. The case reports discussed here are moderately damaged endodontically treated molars restored using all ceramic endocrowns fabricated using two different systems, namely, CAD/CAM and pressed ceramic.

TREAT (TREe-based Association Test)

Science.gov (United States)

TREAT is an R package for detecting complex joint effects in case-control studies. The test statistic is derived from a tree-structure model by recursive partitioning the data. Ultra-fast algorithm is designed to evaluate the significance of association between candidate gene and disease outcome

Articles Treated with Biocidal Products

OpenAIRE

Söyleriz, Yüksel

2015-01-01

In this study, articles treated with biocidal products have been assessed in the scope of Directive 98/8/EC Concerning the Placing of Biocidal Products on the Market and of Regulation (EU) No 528/2012 concerning the Making Available on the Market and Use of Biocidal Products.

Pulmonary cryptococcosis in a ruxolitinib-treated patient with primary myelofibrosis

Directory of Open Access Journals (Sweden)

Anna Hirano

2017-01-01

Full Text Available We present the case of a 79-year-old man who showed multiple pulmonary nodules on chest computed tomography (CT after being treated for 6 months with ruxolitinib, an inhibitor of Janus kinase (JAK 1 and 2, to treat primary myelofibrosis. We examined the lesions by bronchoscopy, and the biopsy specimen revealed fungus bodies of Cryptococcus with granulomatous inflammation. As a result, the patient was diagnosed with pulmonary cryptococcosis. The patient was treated with fluconazole (200 mg daily for 2 weeks with concomitant ruxolitinib administration, but the pulmonary lesions progressed. Subsequently, the patient was treated with voriconazole (300 mg daily for 3 weeks, but the lesions worsened further. The administration of ruxolitinib was therefore discontinued, and the dosage of voriconazole was increased to 400 mg daily. Three months later, the pulmonary lesions diminished in size. The present case of pulmonary cryptococcosis occurred in a patient treated with ruxolitinib. Treatment of pulmonary cryptococcosis with concomitant JAK inhibitor administration may result in poor treatment efficacy. It might be better to stop administration of JAK inhibitors, if possible, in patients being treated for pulmonary cryptococcosis.

[Studies on interaction of acid-treated nanotube titanic acid and amino acids].

Science.gov (United States)

Zhang, Huqin; Chen, Xuemei; Jin, Zhensheng; Liao, Guangxi; Wu, Xiaoming; Du, Jianqiang; Cao, Xiang

2010-06-01

Nanotube titanic acid (NTA) has distinct optical and electrical character, and has photocatalysis character. In accordance with these qualities, NTA was treated with acid so as to enhance its surface activity. Surface structures and surface groups of acid-treated NTA were characterized and analyzed by Transmission Electron Microscope (TEM) and Fourier Transform Infrared Spectrometry (FT-IR). The interaction between acid-treated NTA and amino acids was investigated. Analysis results showed that the lengths of acid-treated NTA became obviously shorter. The diameters of nanotube bundles did not change obviously with acid-treating. Meanwhile, the surface of acid-treated NTA was cross-linked with carboxyl or esterfunction. In addition, acid-treated NTA can catch amino acid residues easily, and then form close combination.

Surface treated fly ash filled modified epoxy composites

Directory of Open Access Journals (Sweden)

Uma Dharmalingam

2015-01-01

Full Text Available Abstract Fly ash, an inorganic alumino silicate has been used as filler in epoxy matrix, but it reduces the mechanical properties due to its poor dispersion and interfacial bonding with the epoxy matrix. To improve its interfacial bonding with epoxy matrix, surface treatment of fly ash was done using surfactant sodium lauryl sulfate and silane coupling agent glycidoxy propyl trimethoxy silane. An attempt is also made to reduce the particle size of fly ash using high pressure pulverizer. To improve fly ash dispersion in epoxy matrix, the epoxy was modified by mixing with amine containing liquid silicone rubber (ACS. The effect of surface treated fly ash with varying filler loadings from 10 to 40% weight on the mechanical, morphological and thermal properties of modified epoxy composites was investigated. The surface treated fly ash was characterized by particle size analyzer and FTIR spectra. Morphological studies of surface treated fly ash filled modified epoxy composites indicate good dispersion of fillers in the modified epoxy matrix and improves its mechanical properties. Impact strength of the surface treated fly ash filled modified epoxy composites show more improvement than unmodified composites.

Characteristics of Acupoint Selection in Treating Apoplexy

Institute of Scientific and Technical Information of China (English)

ZHAO Chao-rong; ZHANG Yan; GU Hong; ZHOU Yun; XIAO Yuan-chun

2003-01-01

Objective: To explore the characteristics of acupoint selection in the treatment of apoplexy. Method:This paper reviews and analyzes the ancient and current medical literature, and then summarizes the characteris -tics of acupoint selection in treating apoplexy. Results:Four characteristics are presented: the acupoints on the head are mostly used; the acupoints are principally selected according to the course of nerves; the acupoints of the yang meridians are usually selected; the special acupoints and empirical acupoints are often combined.Conclusion: Above principles may be adopted in the selection of acupoints to treat apoplexy.

Severe iron intoxication treated with exchange transfusion

DEFF Research Database (Denmark)

Carlsson, M; Cortes, D; Jepsen, S

2009-01-01

An 18-month-old previous healthy girl who had ingested 442 mg elemental iron/kg was admitted to a paediatric intensive care unit. The child was treated with gastric lavage, whole bowel irrigation and intravenous deferoxamine. After 2 h of standard therapy serum iron had risen threefold to 1362 µg....../dl (244 µmol/l). The child was treated with exchange transfusion (ET; 52 ml/kg) and serum iron fell to 134 µg/dl (24 µmol/l). The patient made an uncomplicated recovery. ET should be considered in severe iron poisoning when standard therapy is inadequate....

Process for treating waste water having low concentrations of metallic contaminants

Science.gov (United States)

Looney, Brian B; Millings, Margaret R; Nichols, Ralph L; Payne, William L

2014-12-16

A process for treating waste water having a low level of metallic contaminants by reducing the toxicity level of metallic contaminants to an acceptable level and subsequently discharging the treated waste water into the environment without removing the treated contaminants.

Simulation of the TREAT-Upgrade Automatic Reactor Control System

International Nuclear Information System (INIS)

Lipinski, W.C.; Kirsch, L.W.; Valente, A.D.

1984-01-01

This paper describes the design of the Automatic Reactor Control System (ARCS) for the Transient Reactor Test Facility (TREAT) Upgrade. A simulation was used to facilitate the ARCS design and to completely test and verify its operation before installation at the TREAT facility

Intraperitoneal Injection of Ethanol for the Euthanasia of Laboratory Mice (Mus musculus) and Rats (Rattus norvegicus).

Science.gov (United States)

Allen-Worthington, Krystal H; Brice, Angela K; Marx, James O; Hankenson, F Claire

2015-11-01

Compassion, professional ethics, and public sensitivity require that animals are euthanized humanely and appropriately under both planned and emergent situations. According to the 2013 AVMA Guidelines for the Euthanasia of Animals, intraperitoneal injection of ethanol is "acceptable with conditions" for use in mice. Because only limited information regarding this technique is available, we sought to evaluate ethanol by using ECG and high-definition video recording. Mice (n = 85) and rats (n = 16) were treated with intraperitoneal ethanol (70% or 100%), a positive-control agent (pentobarbital-phenytoin combination [Pe/Ph]), or a negative-control agent (saline solution). After injection, animals were assessed for behavioral and physiologic responses. Pain-assessment techniques in mice demonstrated that intraperitoneal injection of ethanol was not more painful than was intraperitoneal Pe/Ph. Median time to loss of consciousness for all mice that received ethanol or Pe/Ph was 45 s. Median time to respiratory arrest was 2.75, 2.25, and 2.63 min, and time (mean ± SE) to cardiac arrest was 6.04 ± 1.3, 2.96 ± 0.6, and 4.03 ± 0.5 min for 70% ethanol, 100% ethanol, and Pe/Ph, respectively. No mouse that received ethanol or Pe/Ph regained consciousness. Although successful in mice, intraperitoneal ethanol at the doses tested (9.2 to 20.1 g/kg) was unsuitable for euthanasia of rats (age, 7 to 8 wk) because of the volume needed and prolonged time to respiratory effects. For mice, intraperitoneal injection of 70% or 100% ethanol induced rapid and irreversible loss of consciousness, followed by death, and should be considered as "acceptable with conditions."

Thermal-treated soil for mercury removal: Soil and phytotoxicity tests

Energy Technology Data Exchange (ETDEWEB)

Roh, Y.; Edwards, N.T.; Lee, S.Y.; Stiles, C.A.; Armes, S.; Foss, J.E.

2000-04-01

Mercury (Hg) contamination of soils and sediments is one of many environmental problems at the Oak Ridge Reservation, Oak Ridge, TN. Mercury-contaminated soil from the Lower East Fork Poplar Creek (LEFPC) at the Oak Ridge Reservation was treated thermally to reduce Hg concentration to a below target level (20 mg kg{sup {minus}1}) as a pilot scale thermal treatment demonstration. As a part of performance evaluation, the soil characteristics and plant growth response of the untreated and treated soil were examined. The soil treated at 350 C retained most of its original soil properties, but the soil treated at 600 C exhibited considerable changes in mineralogical composition and physicochemical characteristics. Growth and physiological response of the three plant species radish (Raphanus sativus L.), fescue (Festuca arundinacea Schreb.), and oat (Avena sativa L.) indicated adverse effects of the thermal treatment. The addition of N fertilizer had beneficial effects in the 350 C treated soil, but had little beneficial effect in the 600 C treated soil. Some changes of soil characteristics induced by thermal treatment cannot be avoided. Soil characteristics and phytotoxicity test results strongly suggest that changes occurring following the 350 C treatment do not limit the use of the treated soil to refill the excavated site for full-scale remediation. The only problem with the 350 C treatment is that small amounts of Hg compounds (<15 mg kg{sup {minus}1}) remain in the soil and a processing cost of $45/Mg.

Stem cell transplantation for treating Duchenne muscular dystrophy

Science.gov (United States)

Yang, Xiaofeng

2012-01-01

OBJECTIVE: To identify global research trends in stem cell transplantation for treating Duchenne muscular dystrophy using a bibliometric analysis of Web of Science. DATA RETRIEVAL: We performed a bibliometric analysis of studies on stem cell transplantation for treating Duchenne muscular dystrophy from 2002 to 2011 retrieved from Web of Science. SELECTION CRITERIA: Inclusion criteria: (a) peer-reviewed published articles on stem cell transplantation for treating Duchenne muscular dystrophy indexed in Web of Science; (b) original research articles, reviews, meeting abstracts, proceedings papers, book chapters, editorial material, and news items; and (c) publication between 2002 and 2011. Exclusion criteria: (a) articles that required manual searching or telephone access; (b) documents that were not published in the public domain; and (c) corrected papers. MAIN OUTCOME MEASURES: (1) Annual publication output; (2) distribution according to subject areas; (3) distribution according to journals; (4) distribution according to country; (5) distribution according to institution; (6) distribution according to institution in China; (7) distribution according to institution that cooperated with Chinese institutions; (8) top-cited articles from 2002 to 2006; (9) top-cited articles from 2007 to 2011. RESULTS: A total of 318 publications on stem cell transplantation for treating Duchenne muscular dystrophy were retrieved from Web of Science from 2002 to 2011, of which almost half derived from American authors and institutes. The number of publications has gradually increased over the past 10 years. Most papers appeared in journals with a focus on gene and molecular research, such as Molecular Therapy, Neuromuscular Disorders, and PLoS One. The 10 most-cited papers from 2002 to 2006 were mostly about different kinds of stem cell transplantation for muscle regeneration, while the 10 most-cited papers from 2007 to 2011 were mostly about new techniques of stem cell transplantation

Ameliorative properties of aqueous extract of Ficus thonningii on erythrocyte osmotic fragility induced by acetaminophen in Rattus norvegicus

Directory of Open Access Journals (Sweden)

Victor Masekaven Ahur

2013-12-01

Full Text Available In vitro antioxidant and erythrocyte protecting activities by aqueous extract of Ficus thonningii leaves on blood cells were studied in acetaminophen treated rats. The extract was safe at limit dose of 5000 mg kg-1body weight. The extract demonstrated dose dependent antihemolytic effect at dose levels between 50 and 200 mg kg-1 body weight. The lowest antihemolytic effect was observed at dose level of 200 mg kg-1 body given the lowest percentage hemolysis of 10.53 ± 1.76%, whereas the highest percentage hemolysis at dose level of 50 mg kg-1 was 29.02 ± 7.45%. Hematology revealed erythrocytosis at dose levels of 100 and 200 mg kg-1 body weight. Hyper-globinemia and lymphocytopenia were observed at dose levels of 100 mg kg-1 and 200 mg kg-1, respectively. The extract effectively showed scavenging activity on a stable oxidative radical diphenylpicrylhydrazyl (DPPH and a significant ferric reducing antioxidant power (FRAP activity. The plausible erythrocyte membrane protective effect may be due to its free radical scavenging activity and hence the extract can be used to improve hematological parameters and ameliorate oxidative stress.

"Who's been a good dog?" - Owner perceptions and motivations for treat giving.

Science.gov (United States)

White, G A; Ward, L; Pink, C; Craigon, J; Millar, K M

2016-09-15

Complex relationships commonly exist between owners and their companion animals, particularly around feeding behaviour with an owner's affection or love for their animal most pronounced through the provision of food. It is notable that the pet food market is experiencing strong year-on-year growth in sales of dog and cat treats. Recognising the impact of treat giving in pet nutrition, the objective of the study was to investigate owner attitudes and motivations towards feeding treats (shop bought and other) to their dogs. A researcher-mediated questionnaire consisting of both quantitative and qualitative questions was used to interview dog owners (n=280) at two locations: an out-of-town retail park and a country park in the East Midlands. Owners almost unanimously viewed the word 'treat' within a nutritional context, as opposed to a new toy or other pleasure. The majority (96%) of owners interviewed reported feeding treats to their dog, with 69% feeding shop-bought treats on a daily basis. A wide range of treats was reportedly given by owners and the majority of owners interviewed fed multiple treat types. No association was found between owner age and frequency of shop-bought treats fed (P=0.659) nor between owner age and frequency of food given to the dog from the owner's plate (P=0.083). A wide range of foods which would not be considered balanced for the animal's nutritional requirements was viewed as a treat by some dog owners. A range of positive and negative views around the feeding of treats were expressed by dog owners, with some citing beneficial effects while others were clearly aware of the association between treat feeding and potential weight gain/obesity. Owner views included themes around positive reinforcement and responsibility but also reflected relational aspects of the human-animal bond. The results of the study show that treat giving is commonplace in feeding regimes and that treats are embedded in the feeding behaviour of many dog owners

Space reactor fuel element testing in upgraded TREAT

International Nuclear Information System (INIS)

Todosow, M.; Bezler, P.; Ludewig, H.; Kato, W.Y.

1993-01-01

The testing of candidate fuel elements at prototypic operating conditions with respect to temperature, power density, hydrogen coolant flow rate, etc., is a crucial component in the development and qualification of nuclear rocket engines based on the Particle Bed Reactor (PBR), NERVA-derivative, and other concepts. Such testing may be performed at existing reactors, or at new facilities. A scoping study has been performed to assess the feasibility of testing PBR based fuel elements at the TREAT reactor. Initial results suggests that full-scale PBR elements could be tested at an average energy deposition of ∼60--80 MW-s/L in the current TREAT reactor. If the TREAT reactor was upgraded to include fuel elements with a higher temperture limit, average energy deposition of ∼100 MW/L may be achievable

Space reactor fuel element testing in upgraded TREAT

Science.gov (United States)

Todosow, Michael; Bezler, Paul; Ludewig, Hans; Kato, Walter Y.

1993-01-01

The testing of candidate fuel elements at prototypic operating conditions with respect to temperature, power density, hydrogen coolant flow rate, etc., is a crucial component in the development and qualification of nuclear rocket engines based on the Particle Bed Reactor (PBR), NERVA-derivative, and other concepts. Such testing may be performed at existing reactors, or at new facilities. A scoping study has been performed to assess the feasibility of testing PBR based fuel elements at the TREAT reactor. Initial results suggests that full-scale PBR elements could be tested at an average energy deposition of ˜60-80 MW-s/L in the current TREAT reactor. If the TREAT reactor was upgraded to include fuel elements with a higher temperture limit, average energy deposition of ˜100 MW/L may be achievable.

High mortality among heart failure patients treated with antidepressants

DEFF Research Database (Denmark)

Veien, Karsten Tang; Videbæk, Lars; Schou, Morten

2011-01-01

This study was designed to assess whether pharmacologically treated depression was associated with increased mortality risk in systolic heart failure (SHF) patients.......This study was designed to assess whether pharmacologically treated depression was associated with increased mortality risk in systolic heart failure (SHF) patients....

Neuromedin and FN-38 Peptides for Treating Psychiatric Diseases

Science.gov (United States)

Methods and compositions for treating psychiatric diseases and disorders are disclosed. The methods provided generally involve the administration of an NMX peptide, an FNX peptide, or an NMX receptor agonist, or analogs or derivatives thereof, to a subject in order to treat psychiatric diseases and ...

Method of treating wells by use of implosive reactions

Energy Technology Data Exchange (ETDEWEB)

Brandon, C W

1968-04-09

A method of well stimulation consists of introducing a fluid medium into the well separate from the treating fluid. A volume is created within the medium of pressure less than that of the medium adjacent to the formation to be treated. This is performed by substantially instantaneously collapsing the created volume, which creates at least one rarefactional wave pulse. This is followed by a compressional wave pulse. The treating fluid is injected into the fluid medium in time sequence with the compressional wave pulse. The rarefactional and compressional pulses are conducted to the formation. (14 claims)

Early-Treated Phenylketonuria: Neuropsychologic Consequences.

Science.gov (United States)

Brunner, Robert L.; And Others

1983-01-01

The neuropsychologic performance of 27 children (about 6 to 13 years old) with early-treated phenylketonuria (PKU) was evaluated and correlated with their serum phenylalanine concentrations at several ages. (Author/SEW) Journal Availability: The Journal of Pediatrics; The C. V. Mosby Company, 11830 Westline Industrial Drive, St. Louis, MO 63141.

Tensile behavior of laser treated Fe-Si-B metallic glass

Energy Technology Data Exchange (ETDEWEB)

Joshi, Sameehan S.; Samimi, Peyman; Ghamarian, Iman; Katakam, Shravana; Collins, Peter C.; Dahotre, Narendra B., E-mail: narendra.dahotre@unt.edu [Department of Materials Science and Engineering, University of North Texas, 1150 Union Circle 305310, Denton, Texas 76203-5017 (United States)

2015-10-28

Fe-Si-B metallic glass foils were treated with a linear laser track using a continuous wave Nd-YAG laser and its effect on the overall tensile behavior was investigated. Microstructure and phase evolutions were evaluated using X-ray diffraction, resistivity measurements, and transmission electron microscopy. Crystallization fraction was estimated via the differential scanning calorimetry technique. Metallic glass foils treated with the lower laser fluences (<0.49 J/mm{sup 2}) experienced structural relaxation, whereas higher laser fluences led to crystallization within the laser treated region. The overall tensile behavior was least impacted by structural relaxation, whereas crystallization severely reduced the ultimate tensile strength of the laser treated metallic glass foils.

Pump-and-treat is not the only solution to aquifer remediation

International Nuclear Information System (INIS)

Odermatt, J.R.

1994-01-01

The Environmental Protection Agency (EPA) recently surveyed remediation technologies used at petroleum-contaminated sites in 22 states. About 96 percent of underground storage tank (UST) corrective action sites used some form of pump-and-treat technology to remediate contaminated groundwater. However, using only pump-and-treat technology is not a cost-effective approach to aquifer remediation. Pump-and-treat may be more appropriate for containing plumes or for use in initial emergency response actions at sites and massive NAPL releases to groundwater. As of 1990, 68 percent of Superfund records of decision selected pump-and-treat as the final remedy for aquifer remediation. However, of 13 sites where the remedial alternative objective was to restore the aquifer to health-based levels, only one pump-and-treat method has succeeded. Except in cases where human health and the environment are threatened, long-term active technologies, such as pump-and-treat, may not be warranted. Groundwater monitoring and possible wellhead treatment may be perceived as time-consuming processes; however, at many sites, this long-term approach may be far less costly and just as effective as other long-term strategies based on exclusive use of pump-and-treat technology

Evaluation of asphalt treated permeable base.

Science.gov (United States)

2013-12-01

III : Tec : hnical : Report Documentation Page : 1. Report No. : 2. Government Accession : No. : 3. Recipient's Catalog No : . : 201 : 3 : - : 09 : - : - : - : - : - : - : 4. Title and Subtitle : 5. Report Date : Evaluation of Asphalt Treated Permeab...

Treating Melanoma Metastases with a Novel Photodynamic Approach

Science.gov (United States)

2017-09-01

AWARD NUMBER: W81XWH-15-1-0270 TITLE: Treating Melanoma Metastases with a Novel Photodynamic Approach PRINCIPAL INVESTIGATOR: Jin Xie...Metastases with a Novel Photodynamic Approach 5a. CONTRACT NUMBER Treating Melanoma Metastases with a Novel Photodynamic Approach 5b. GRANT NUMBER...ligand and after systemic injection, home to tumors in the lung. X-ray of relatively low doses can then be applied externally to the lung area to

Treat mine water using passive methods

International Nuclear Information System (INIS)

Kleinmann, R.L.P.; Hedin, R.S.

1993-01-01

Passive treatment represents an alternative to conventional chemical treatment of coal mine drainage. When successful, passive systems require less investment, less maintenance and usually are less expensive than conventional chemical treatment systems. As a result, during the last seven years, more than 500 passive systems have been constructed in the United States to treat coal mine drainage. Some exist as an alternative to conventional treatment; others serve as an inexpensive pretreatment step than can decrease subsequent chemical requirements. Sulfide minerals present in rock disturbed during mining can oxidize to form an acidic metal-laden solution, commonly known as acid mine drainage (AMD). Alkalinity present in the rock may partially or completely neutralize AMD, but if either acidity or excessive metal contaminants remain, the water must be treated before it can be discharged legally. The principal regulated contaminant metals of coal mine drainage are iron and manganese. Metal mine drainage often contains more toxic metals, such as cadmium, nickel, copper and zinc. Chemical treatment of AMD is estimated to cost America's mining industry more than $1 million a day. Three principal passive technologies are used in the treatment of coal mine drainage: Aerobic wetlands, wetlands constructed with an organic substrate and anoxic limestone drains (ALDS). The selection of the technology or combination of technologies to be used depends on the quality of the water being treated

A Novel Therapeutic Frame for Treating Depression in Group Treating Depression Downhill

Directory of Open Access Journals (Sweden)

Valery Krupnik

2014-02-01

Full Text Available We describe an original protocol Treating Depression Downhill (TDD that was designed as a specific therapy for depression. Evolutionary theories of depression served as a basis for its development. We discuss the rationale for using evolutionary theory and describe the structure and integrative nature of TDD. We then present an observation on TDD’s application to group therapy of active duty military personnel. In the described sample, TDD demonstrated effectiveness and specificity for depression, differentiating it from anxiety and personality disorders.

Method for treating radioactive liquids

International Nuclear Information System (INIS)

Komrow, R.R.; Pritchard, J.F.

1980-01-01

A process for treating and handling radioactive liquids and rendering such liquids safe for handling is disclosed. Transportation and disposal, the process comprises adding thereto a small amount of a water-insoluble alkali salt of an aqueous alkali saponified gelatinized-starch-polyacrylonitrile graft polymer, to form a solid, semi-solid or gel product

To treat or not to treat: puberty suppression in childhood-onset gender dysphoria

OpenAIRE

Costa, Rosalia; Carmichael, Polly; Colizzi, Marco

2016-01-01

Puberty suppression using gonadotropin-releasing-hormone analogues (GnRHa) has become increasingly accepted as an intervention during the early stages of puberty (Tanner stage 2-3) in individuals with clear signs of childhood-onset gender dysphoria. However, lowering the age threshold for using medical intervention for children with gender dysphoria is still a matter of contention, and is more controversial than treating the condition in adolescents and adults, as children with gender dysphor...

effects of magnetically treated water on germination and growth

African Journals Online (AJOL)

Toshiba

This study was conducted to evaluate the effect of magnetically treated water on the survival ... density used was 719 gauss (G) measured inside the pipe. ... of the meristem cells and chlorophyll were ..... Table 4 Tomato stem girth irrigated with magnetically and non–magnetically treated .... Electrical Separation, 7: 77-107.

Case Report: A Non-small Cell Lung Cancer Patient Treated with GcMAF, Sonodynamic Therapy and Tumor Treating Fields.

Science.gov (United States)

Inui, Toshio; Amitani, Haruka; Kubo, Kentaro; Kuchiike, Daisuke; Uto, Yoshihiro; Nishikata, Takahito; Mette, Martin

2016-07-01

Macrophage activating factor (MAF)-based immunotherapy has a wide application for use in treating many diseases via macrophage activation. Sonodynamic therapy (SDT) using low-intensity ultrasound and tumor treating field (TTF) therapy are novel therapeutic modalities. SDT is usually combined with ozone therapy to improve local hypoxia within the tumor environment. We treated a 77-year-old male diagnosed with non-small cell lung cancer ((NSCLC) stage 3B) using second-generation serum GcMAF and oral colostrum MAF-based immunotherapy combined with SDT, TTF and ozone therapies. This case report demonstrates that GcMAF, oral colostrum MAF, SDT, TTF and ozone therapy can be used for NSCLC without adverse effects. This case report suggests a new concept of cancer treatment using local destruction of cancer tissue, in this case conducted with SDT and TTF therapy, to be used in combination with serum GcMAF and colostrum MAF immunotherapy as a systemic treatment. Copyright© 2016 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.

Severe iron intoxication treated with exchange transfusion

DEFF Research Database (Denmark)

Carlsson, Marcella; Cortes, Dina; Jepsen, Søren

2008-01-01

An 18-month-old previous healthy girl who had ingested 442 mg elemental iron/kg was admitted to a paediatric intensive care unit. The child was treated with gastric lavage, whole bowel irrigation and intravenous deferoxamine. After 2 h of standard therapy serum iron had risen threefold to 1362 mi...... microg/dl (244 micromol/l). The child was treated with exchange transfusion (ET; 52 ml/kg) and serum iron fell to 134 microg/dl (24 micromol/l). The patient made an uncomplicated recovery. ET should be considered in severe iron poisoning when standard therapy is inadequate....

Therapies for Treating Diabetic Nerve Pain

Science.gov (United States)

... pain. There is moderate evidence that the drugs oxcarbazepine, lamotrigine, and lacosamide likely do not help treat ... at first, opioids can have less of an effect over time. There is moderate evidence that the ...

How Is Diabetes Treated in Children?

Science.gov (United States)

... Consumers Home For Consumers Consumer Updates How Is Diabetes Treated in Children? Share Tweet Linkedin Pin it ... as diabetes gets worse over time. Type 2 Diabetes Type 2 diabetes is most often diagnosed in ...

Avulsion Fracture: How Is It Treated?

Science.gov (United States)

... way to treat an avulsion fracture in a young athlete? Answers from Edward R. Laskowski, M.D. ... Clinic does not endorse any of the third party products and services advertised. Advertising and sponsorship policy ...

Infantile acne treated with oral isotretinoin

DEFF Research Database (Denmark)

Miller, Iben Marie; Echeverría, Begoña; Torrelo, Antonio

2013-01-01

In contrast to adolescent acne, infantile acne (IA) is a rare condition with only a limited body of available literature. In this descriptive, retrospective study, we reviewed six cases from 2002 to 2010 treated with oral isotretinoin. The average age of onset was 6.16 months (range 0-21 mos......). Consistent with the previous, limited literature, we found predominantly boys are affected, a predilection for the cheeks, and a polymorphic inflammatory morphology. Two patients had a family history of acne. All cases were successfully and safely treated with oral isotretinoin. The suggested treatment...... of childhood acne is similar to that of adolescents (graded according to the severity of the skin disease and risk of scarring). Oral isotretinoin appears to be an effective and safe treatment for severe IA....

Bioengineering Strategies to Treat Female Infertility.

Science.gov (United States)

Kuo, Che-Ying; Baker, Hannah; Fries, Melissa H; Yoo, James J; Kim, Peter C W; Fisher, John P

2017-06-01

Bioengineering strategies have demonstrated enormous potential to treat female infertility as a result of chemotherapy, uterine injuries, fallopian tube occlusion, massive intrauterine adhesions, congenital uterine malformations, and hysterectomy. These strategies can be classified into two broad categories as follows: (i) Transplantation of fresh or cryopreserved organs into the host and (ii) tissue engineering approaches that utilize a combination of cells, growth factors, and biomaterials that leverages the body's inherent ability to regenerate/repair reproductive organs. While whole organ transplant has demonstrated success, the source of the organ and the immunogenic effects of allografts remain challenging. Even though tissue engineering strategies can avoid these issues, their feasibilities of creating whole organ constructs are yet to be demonstrated. In this article we summarize the recent advancements in the applications of bioengineering to treat female infertility.

Repeated-Dose and Reproductive/Developmental Toxicity of NTO (3-Nitro-1,2,4-Triazol-5-One) in the Rat

Science.gov (United States)

2014-03-21

strength, and stereotypes or changes in behavior (e.g., self- mutilation). Pregnant females approaching gestation day 21 were observed more frequently...and stereotypes or abnormal behavior (e.g., self mutilation , walking backwards). All data related to the observation of rats will be detailed and...are the recommended species due to an historical and extensive database. V.3.3. Laboratory animals V.3.3.1. Genus and Species: Rattus norvegicus V

Pengaruh Waktu Fermentasi Teh Kombucha Kadar 50% terhadap Glukosa Darah Tikus Putih

OpenAIRE

TANA, SILVANA; ISDADIYANTO, SRI

2016-01-01

Penelitian ini bertujuan untuk mengetahui pengaruh pemberian teh kombucha kadar 50% terhadap kondisi glukosa darah dengan variasi waktu fermentasi. Teh kombucha termasuk pangan fungsional karena memiliki karakteristik sensori seperti penampakan, warna, tekstur, atau konsistensi dan citarasa yang dapat diterima oleh konsumen. Hewan uji yang dipakai adalah tikus putih (Rattus norvegicus)jantan sebanyak 16 ekor umur 2 bulan, dengan perlakuan teh kombucha yang difermentasi selama 6, 9 dan 12 ha...

Recurred Post-intubation Tracheal Stenosis Treated with Bronchoscopic Cryotherapy

Science.gov (United States)

Jung, Ye-Ryung; Taek Jeong, Joon; Kyu Lee, Myoung; Kim, Sang-Ha; Joong Yong, Suk; Jeong Lee, Seok; Lee, Won-Yeon

2016-01-01

Post-intubation tracheal stenosis accounts for the greatest proportion of whole-cause tracheal stenosis. Treatment of post-intubation tracheal stenosis requires a multidisciplinary approach. Surgery or an endoscopic procedure can be used, depending on the type of stenosis. However, the efficacy of cryotherapy in post-intubation tracheal stenosis has not been validated. Here, we report a case of recurring post-intubation tracheal stenosis successfully treated with bronchoscopic cryotherapy that had previously been treated with surgery. In this case, cryotherapy was effective in treating web-like fibrous stenosis, without requiring more surgery. Cryotherapy can be considered as an alternative or primary treatment for post-intubation tracheal stenosis. PMID:27853078

Differences in Anticipatory Behaviour between Rats (Rattus norvegicus) Housed in Standard versus Semi-Naturalistic Laboratory Environments.

Science.gov (United States)

Makowska, I Joanna; Weary, Daniel M

2016-01-01

Laboratory rats are usually kept in relatively small cages, but research has shown that they prefer larger and more complex environments. The physiological, neurological and health effects of standard laboratory housing are well established, but fewer studies have addressed the sustained emotional impact of a standard cage environment. One method of assessing affective states in animals is to look at the animals' anticipatory behaviour between the presentation of a cue signalling the arrival of a reward and the arrival of that reward. The primary aim of this study was to use anticipatory behaviour to assess the affective state experienced by female rats a) reared and housed long-term in a standard laboratory cage versus a semi-naturalistic environment, and b) before and after treatment with an antidepressant or an anxiolytic. A secondary aim was to add to the literature on anticipatory behaviour by describing and comparing the frequency and duration of individual elements of anticipatory behaviour displayed by rats reared in these two systems. In all experiments, total behavioural frequency was higher in standard-housed rats compared to rats from the semi-naturalistic condition, suggesting that standard-housed rats were more sensitive to rewards and experiencing poorer welfare than rats reared in the semi-naturalistic environment. What rats did in anticipation of the reward also differed between housing treatments, with standard-housed rats mostly rearing and rats from the semi-naturalistic condition mostly sitting facing the direction of the upcoming treat. Drug interventions had no effect on the quantity or form of anticipatory behaviour, suggesting that the poorer welfare experienced by standard-housed rats was not analogous to depression or anxiety, or alternatively that the drug interventions were ineffective. This study adds to mounting evidence that standard laboratory housing for rats compromises rat welfare, and provides further scientific support for

Differences in Anticipatory Behaviour between Rats (Rattus norvegicus Housed in Standard versus Semi-Naturalistic Laboratory Environments.

Directory of Open Access Journals (Sweden)

I Joanna Makowska

Full Text Available Laboratory rats are usually kept in relatively small cages, but research has shown that they prefer larger and more complex environments. The physiological, neurological and health effects of standard laboratory housing are well established, but fewer studies have addressed the sustained emotional impact of a standard cage environment. One method of assessing affective states in animals is to look at the animals' anticipatory behaviour between the presentation of a cue signalling the arrival of a reward and the arrival of that reward. The primary aim of this study was to use anticipatory behaviour to assess the affective state experienced by female rats a reared and housed long-term in a standard laboratory cage versus a semi-naturalistic environment, and b before and after treatment with an antidepressant or an anxiolytic. A secondary aim was to add to the literature on anticipatory behaviour by describing and comparing the frequency and duration of individual elements of anticipatory behaviour displayed by rats reared in these two systems. In all experiments, total behavioural frequency was higher in standard-housed rats compared to rats from the semi-naturalistic condition, suggesting that standard-housed rats were more sensitive to rewards and experiencing poorer welfare than rats reared in the semi-naturalistic environment. What rats did in anticipation of the reward also differed between housing treatments, with standard-housed rats mostly rearing and rats from the semi-naturalistic condition mostly sitting facing the direction of the upcoming treat. Drug interventions had no effect on the quantity or form of anticipatory behaviour, suggesting that the poorer welfare experienced by standard-housed rats was not analogous to depression or anxiety, or alternatively that the drug interventions were ineffective. This study adds to mounting evidence that standard laboratory housing for rats compromises rat welfare, and provides further