WorldWideScience

Sample records for nora richter greer

  1. Nora

    Directory of Open Access Journals (Sweden)

    Ilaria Frontori

    2014-08-01

    Full Text Available L’Università degli Studi di Milano, sotto la direzione scientifica del Prof. G. Bejor, opera a Nora (Pula, Cagliari dal 2002, in un progetto sostenuto da quattro atenei italiani. Oggetto della ricerca sono il settore centrale della penisola e le due fasce abitative collocate sulla costa occidentale e meridionale. Nel quartiere centrale le recenti campagne di scavo stanno portando alla luce l’isolato sottostante le Terme Centrali e le domus mosaicate, dimostrando una continuità di vita dall’età repubblicana fino al periodo tardoantico.

  2. Raising Nora.

    Science.gov (United States)

    Mack, Margo

    1996-01-01

    Describes a creative approach to including Nora, a student with cerebral palsy, in an outdoor adventure--a hilly, seven-mile trek through Eastern Oregon's Ponderosa pine forests. With teachers' and classmates' help, Nora practiced on a simulated horse and saddle, overcame her fear of heights, and eagerly joined classmates on horseback. (MLH)

  3. Nora's Voice.

    Science.gov (United States)

    Rameka, Nora; Stalker, Joyce

    1996-01-01

    The cultural and gender issues raised by a Maori adult educator (Nora Rameka) are framed by the interviewer (Joyce Stalker) who comments on methodological difficulties and compromises that were necessary in order to have Maori perspectives represented in this issue. (SK)

  4. Welcoming nora: a family event.

    Science.gov (United States)

    Walsh, Allison J; Walsh, Paul R; Walsh, Jane M; Walsh, Gavin T

    2011-01-01

    In this column, Allison and Paul Walsh share the story of the birth of Nora, their third baby and their second child to be born at home. Allison and Paul share their individual memories of labor and birth. But their story is only part of the story of Nora's birth. Nora's birth was a family event, with Allison and Paul's other children very much part of the experience. Jane and Gavin share their own memories of their baby sister's birth.

  5. How we treat Richter syndrome

    OpenAIRE

    Parikh, Sameer A.; Kay, Neil E.; Shanafelt, Tait D.

    2014-01-01

    Richter syndrome (RS) is defined as the transformation of chronic lymphocytic leukemia (CLL) into an aggressive lymphoma, most commonly diffuse large B-cell lymphoma (DLBCL). RS occurs in approximately 2% to 10% of CLL patients during the course of their disease, with a transformation rate of 0.5% to 1% per year. A combination of germline genetic characteristics, clinical features (eg, advanced Rai stage), biologic (ζ-associated protein-70+, CD38+, CD49d+) and somatic genetic (del17p13.1 or d...

  6. [A hundred years of Gedeon Richter Ltd].

    Science.gov (United States)

    Pillich, Lajos

    2002-01-01

    The Company founded by Gedeon Richter in 1901 produced formerly medicines for organotherapeutical treatments, later purified hormones were prepared for therapy. The factory from the fifties developed gradually into the biggest pharmaceutical company in Hungary. Richter produces today mainly synthetic drugs and medicines. Its special field is the steroid synthesis on industrial scale. One tenth of the active ingredients of oral contraceptives of the world is made by Richter.

  7. From Phoenician Nora to Punic Nora and Beyond

    Directory of Open Access Journals (Sweden)

    Stefano Finocchi

    2013-11-01

    Full Text Available Sulla base dei risultati conseguiti dalla missione dell’Università della Tuscia a Nora si esaminano i dati circa le più antiche fasi dell’insediamento fenicio di Nora in Sardegna e le prime forme di organizzazione urbana (fine dell’VIII - seconda metà del VI secolo a.C.. Si illustrano quindi gli aspetti urbanistici legati all’affermazione dell’egemonia cartaginese a Nora (dall’ultimo quarto del VI secolo a.C. e le trasformazioni urbanistiche e topografiche che interessano un settore della città, il “Colle di Tanit”, tra l’età ellenistica e le ultime fasi di vita dell’età repubblicana. Grazie ai dati delle ricognizioni territoriali, si esaminano le modalità della diffusione e dello sfruttamento delle relative risorse tra l’età fenicia e punica prima, quella romana repubblicana e imperiale poi e quella di età bizantina e basso medievale in seguito.

  8. Development of Nora Performance and Management System for Creative Economy

    OpenAIRE

    Sriaroon Ruangrit; Prajak Maicharoen; Kla Somtrakool

    2015-01-01

    This research study on “Development of Nora Performance and Management System for Creative Economy” is a qualitative research that aims to study 1) historical background, popular traditions, beliefs and management system of Nora performance; 2) problems encountered pertaining Nora performance and its management system; and 3) an appropriate model for development of Nora performance and management system for the creative economy. The target area of the research is a selection of 6 Nora perform...

  9. Welcoming Nora: A Family Event

    OpenAIRE

    Walsh, Allison J.; Walsh, Paul R.; Walsh, Jane M.; Walsh, Gavin T.

    2011-01-01

    In this column, Allison and Paul Walsh share the story of the birth of Nora, their third baby and their second child to be born at home. Allison and Paul share their individual memories of labor and birth. But their story is only part of the story of Nora’s birth. Nora’s birth was a family event, with Allison and Paul’s other children very much part of the experience. Jane and Gavin share their own memories of their baby sister’s birth.

  10. Gutenberg-Richter law for Internetquakes

    Science.gov (United States)

    Abe, Sumiyoshi; Suzuki, Norikazu

    2003-03-01

    The temporal behavior of the Internet is studied by performing Ping experiments. Sudden drastic changes in the Internet time series of round-trip times of the Ping signals (i.e., congestion of the network) are catastrophic and can be identified as “Internetquakes”. Magnitude of the Internetquakes is defined and the Gutenberg-Richter law is found to hold for the cumulative frequency of the Internetquakes and magnitude. Therefore, earthquakes, financial markets and the Internet share a common scale free nature in their temporal behaviors.

  11. Nora's lesion, a distinct radiological entity?

    International Nuclear Information System (INIS)

    Dhondt, E.; Oudenhoven, L.; Khan, S.; Kroon, H.M.; Hogendoorn, P.C.; Nieborg, A.; Bloem, J.L.; Schepper, A. de

    2006-01-01

    To describe the radiological findings of ''Bizarre parosteal osteochondromatous proliferation''(BPOP) - otherwise known as Nora's lesion, to describe the natural evolution of BPOP and to assess radiologically if BPOP is indeed part of a spectrum of reactive lesions including florid reactive periostitis and turret exostosis. Four experienced musculoskeletal radiologists studied plain radiographs and other imaging documents of histologically-proven Nora's lesions, looking for soft-tissue changes, periosteal reaction/calcification and calcified/ossified pseudotumours, and compared those findings with findings on pathology reviewed by a peer group of pathologists. Twenty-four Nora's lesions originating from a series of 200 consecutive, histologically-verified bone (pseudo)tumours of the hand, seen by the ''Netherlands Committee on Bone Tumours'' for review and second opinion. Nora's lesions have a recognised presentation on radiographs without specific MR characteristics. Natural evolution could be assessed retrospectively in four cases. Recurrent lesions were seen in seven cases and are difficult to differentiate from primary Lesions. (orig.)

  12. Development of Nora Performance and Management System for Creative Economy

    Directory of Open Access Journals (Sweden)

    Sriaroon Ruangrit

    2015-11-01

    Full Text Available This research study on “Development of Nora Performance and Management System for Creative Economy” is a qualitative research that aims to study 1 historical background, popular traditions, beliefs and management system of Nora performance; 2 problems encountered pertaining Nora performance and its management system; and 3 an appropriate model for development of Nora performance and management system for the creative economy. The target area of the research is a selection of 6 Nora performance teams in 3 provinces – Pathalung, Nakhon Sri Thammarat and Trang. The research methods are comprised of documentation studies, observations, interviews, group discussion and workshop. Data analysis was performed through a descriptive analysis. The research findings show that historical background of Nora ensembles are mostly derived and promoted from the families, relatives and other interested group of people. The research also finds that there are 9 elements of Nora performance, which comprise 1 the theater and scenes to be used for Nora performance; 2 the outstanding costumes to be used; 3 the musical instruments; 4 light and sound decoration; 5 the number of performers (20-70; 6 the stories to be performed; 7 the manager; 8 the popular traditions of performance; 9 Nora traditional beliefs. In terms of problems encountered, it was found that the popularity of Nora performance has decreased, since nowadays there is more technological media, thereby decreasing the amount of revenue and the degree of Nora inheritance. The research found that in developing Nora performance and management system for creative economy, the local curriculum should be developed for school use or educational academies. Besides, it may be developed in the form of a website database, books and videos, all of which should be aimed to meet public relations targets and distribution as well as to increase revenue. The local institutions should render cooperation and frequently

  13. Isolated Richter's syndrome in central nervous system: case report Sindrome de Richter isolada em sistema nervoso central: relato de caso

    Directory of Open Access Journals (Sweden)

    Lucilene S.R. Resende

    2005-06-01

    Full Text Available Diffuse large cell non Hodgkin's lymphoma associated with chronic lymphoid leukemia (CLL, or Richter's syndrome, is a rare and serious complication. Isolated Richter's syndrome in the central nervous system is very rare; only 12 cases have been reported. We describe a 74-year-old patient with diffuse large cell non Hodgkin's lymphoma in the right frontal region with the appearance of multiform glioblastoma.Linfoma não Hodgkin difuso de grandes células em paciente portador de leucemia linfóide crônica (LLC, ou síndrome de Richter, é complicação rara e grave nesta leucemia. Síndrome de Richter isolada no sistema nervoso central é muito rara, tendo sido encontrados apenas 12 casos descritos. Descrevemos paciente de 74 anos, que apresentou linfoma não Hodgkin difuso de grandes células em região frontal direita, simulando glioblastoma multiforme.

  14. 75 FR 30044 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2010-05-28

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... (NORA) has been structured to engage partners with each other and/or with NIOSH to advance NORA...

  15. 76 FR 44337 - Comments and Information Relevant to Mid Decade Review of NORA

    Science.gov (United States)

    2011-07-25

    ... NIOSH-244] Comments and Information Relevant to Mid Decade Review of NORA AGENCY: Department of Health...) is conducting a review of the processes of the National Occupational Research Agenda (NORA). In 2006, NORA entered its second decade with an industry sector-based structure. In 2011, as NORA reaches the...

  16. A Summary of NORA Project Results Related to Reactivity Measurements

    International Nuclear Information System (INIS)

    Berg, J.O.; Døderlein, J-M-; Haugset, K

    1969-01-01

    The NORA Project has been an international undertaking within the field of reactor physics, resulting from an agreement signed by the International Atomic Energy Agency and the Norwegian Government in April 1961, and subsequently renewed for three years in 1964 and one year in 1967. A summary of the research performed in the period 1961-1964 has been published in IAEA Technical Report Series no. 67. The Project work carried out through the years 1964-1968 will be covered in a forthcoming IAEA Technical Report. The main experimental facility used in the Project has been the zero-power reactor NORA Reactor kinetics, both experimental end theoretical, has been a major item of research in the NORA Project. The present report will briefly summarize results and conclusions considered relevant to the topic discussed by this Panel. Extensive referencing will be made to the final NORA Project Report

  17. Nora Tully MacAlvay--Her Life in the Theatre.

    Science.gov (United States)

    Webb, Dorothy

    1996-01-01

    Recounts the life and times of a pioneer children's theater playwright and fiction author, Nora Tully MacAlvay (1900-86). Points out that her interest in children's theater and children's literature was lifelong and intense. (PA)

  18. Characterization of Nora Virus Structural Proteins via Western Blot Analysis.

    Science.gov (United States)

    Ericson, Brad L; Carlson, Darby J; Carlson, Kimberly A

    2016-01-01

    Nora virus is a single stranded RNA picorna-like virus with four open reading frames (ORFs). The coding potentials of the ORFs are not fully characterized, but ORF3 and ORF4 are believed to encode the capsid proteins (VP3, VP4a, VP4b, and VP4c) comprising the virion. To determine the polypeptide composition of Nora virus virions, polypeptides from purified virus were compared to polypeptides detected in Nora virus infected Drosophila melanogaster. Nora virus was purified from infected flies and used to challenge mice for the production of antisera. ORF3, ORF4a, ORF4b, and ORF4c were individually cloned and expressed in E. coli; resultant recombinant proteins purified and were used to make monospecific antisera. Antisera were evaluated via Western blot against whole virus particles and Nora virus infected fly lysates. Viral purification yielded two particle types with densities of ~1.31 g/mL (empty particles) and ~1.33 g/mL (complete virions). Comparison of purified virus polypeptide composition to Nora virus infected D. melanogaster lysate showed the number of proteins in infected cell lysates is less than purified virus. Our results suggest the virion is composed of 6 polypeptides, VP3, VP4a, two forms of VP4b, and two forms of VP4c. This polypeptide composition is similar to other small RNA insect viruses.

  19. 77 FR 16840 - Partnerships to Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2012-03-22

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to advance...

  20. 76 FR 25694 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2011-05-05

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to advance...

  1. 76 FR 66071 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2011-10-25

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Occupational Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to...

  2. 77 FR 66619 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2012-11-06

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to advance...

  3. 75 FR 63495 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2010-10-15

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Occupational Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to...

  4. 78 FR 30306 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2013-05-22

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Occupational Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to...

  5. Obturatorhernie af Richter-type, en diagnostisk udfordring

    DEFF Research Database (Denmark)

    Mohammad, Sharafaden Karim; Perdawood, Sharaf

    2005-01-01

    development of symptoms; on laparotomy it was found to be a Richter hernia. CT scanning can be helpful and will typically show an incarcerated small bowel behind the pectineus muscle. Laparoscopy may be necessary for diagnosis, and the hernia can be repaired laparoscopically....... for awareness of the condition is stressed, and the diagnosis of obturator hernia should be strongly suspected in a thin, elderly woman who has small-bowel obstruction and no previous abdominal surgery. Here is a case report of obturator hernia in which the diagnosis was difficult because of the slow...

  6. Effect of Coulomb stress on the Gutenberg-Richter law

    Science.gov (United States)

    Navas-Portella, V.; Corral, A.; Jimenez, A.

    2017-12-01

    Coulomb stress theory has been used for years in seismology to understand how earthquakes trigger each other. Whenever an earthquake occurs, the stress field changes in its neighbourhood, with places with positive values brought closer to failure, whereas negative values distance away that location from failure. Earthquake models that relate rate changes and Coulomb stress after a main event, such as the rate-and-state model, assume negative and positive stress values affect rate changes according to the same functional form. As a first order approximation, under uniform background seismicity before the main event, different values of the b-exponent in the Gutenberg-Richter law would indicate different behaviour for positive and negative stress. In this work, we study the Gutenberg-Richter law in the aftershock sequence of the Landers earthquake (California, 1992, MW=7.3). By using a statistically based fitting method, we discuss whether the sign of Coulomb stresses and the distance to the fault have a significant effect on the value of the b-exponent.

  7. Nora: A Vocabulary Discovery Tool for Concept Extraction.

    Science.gov (United States)

    Divita, Guy; Carter, Marjorie E; Durgahee, B S Begum; Pettey, Warren E; Redd, Andrew; Samore, Matthew H; Gundlapalli, Adi V

    2015-01-01

    Coverage of terms in domain-specific terminologies and ontologies is often limited in controlled medical vocabularies. Creating and augmenting such terminologies is resource intensive. We developed Nora as an interactive tool to discover terminology from text corpora; the output can then be employed to refine and enhance natural language processing-based concept extraction tasks. Nora provides a visualization of chains of words foraged from word frequency indexes from a text corpus. Domain experts direct and curate chains that contain relevant terms, which are further curated to identify lexical variants. A test of Nora demonstrated an increase of a domain lexicon in homelessness and related psychosocial factors by 38%, yielding an additional 10% extracted concepts.

  8. Introduction to four papers on Curt Richter and analysis of his scientific practice.

    Science.gov (United States)

    Smith, Gerard P

    2007-09-01

    Curt Richter was one of the founders of our field. He did outstanding research for over 60 years. Richter did fundamental work in appetite for food and minerals in the 1930s and discovered the homeostatic functions of ingestive behavior. This paper introduces four papers on specific topics of his work by contemporaneous experts. Each of the papers reviews Richter's experiments and then shows how the problem developed since he left it. The papers demonstrate that providing the historical basis for contemporary science is not only instructive, it is also heuristic for the science waiting to be done. In addition to introducing the four papers, I analyze the scientific ideas, values, and men that influenced Richter's scientific practice. I conclude that Claude Bernard, Walter Cannon, Francois Magendie, and Maurice Arthus were important for Richter's scientific ideas and values, but it was the joy of research that explains his experimental success for over 60 years.

  9. Nanotech, blur and tragedy in recent artworks by Gerhard Richter

    DEFF Research Database (Denmark)

    Nielsen, Kristian Hvidtfelt

    2008-01-01

    The author considers Gerhard Richter's work on nanotechnology, highlighting how these pieces continue the artist's ontology on photographic blur and, as such, raise questions about truth and reality with respect to the mass media's visual presentation of nanotechnology. The four works discussed i...... and terrorism, and contrasts Richter's artworks with utopian visions of nano-science in the mass media.......The author considers Gerhard Richter's work on nanotechnology, highlighting how these pieces continue the artist's ontology on photographic blur and, as such, raise questions about truth and reality with respect to the mass media's visual presentation of nanotechnology. The four works discussed...

  10. Fluoroquinolone resistance protein NorA of Staphylococcus aureus is a multidrug efflux transporter.

    OpenAIRE

    Neyfakh, A A; Borsch, C M; Kaatz, G W

    1993-01-01

    The gene of the Staphylococcus aureus fluoroquinolone efflux transporter protein NorA confers resistance to a number of structurally dissimilar drugs, not just to fluoroquinolones, when it is expressed in Bacillus subtilis. NorA provides B. subtilis with resistance to the same drugs and to a similar extent as the B. subtilis multidrug transporter protein Bmr does. NorA and Bmr share 44% sequence similarity. Both the NorA- and Bmr-conferred resistances can be completely reversed by reserpine.

  11. NORA project offers unique reactor research and advanced training opportunities

    International Nuclear Information System (INIS)

    1961-01-01

    An international program for reactor research and advanced training for a period of three years has been established in connection with the Norwegian critical assembly NORA. The aim of the project is to determine, through integral experiments, the basic reactor physics data for lattices moderated with light-water, heavy-water or mixtures of heavy and light water, with fuels of different sizes and spacing, three different enrichments and compositions. The objectives, programme, and facilities are described in details

  12. Second toe swelling: Nora's lesion or glomus tumour, case report and literature review.

    LENUS (Irish Health Repository)

    Mohammad, A

    2012-09-01

    We report a rare case of bizarre parosteal osteochondromatous proliferation (BPOP, Nora\\'s lesion) of the right second toe in a 60-year-old man who presented with painful, bluish and bulbous swelling of the right second toe without any break in the skin.

  13. Nora ehk elu võimalikkusest naisena perekonnas, teatris ja kapitalismis / Anneli Saro

    Index Scriptorium Estoniae

    Saro, Anneli, 1968-

    2008-01-01

    Naistegelasest teatrist järgnevate lavastuste põhjal: Helen Rekkori lavastusest "Nora/Maja" Henrik Ibseni "Nukumaja" järgi Ugala teatris ja Elfriede Jelineki "Mis juhtus pärast seda, kui Nora oma mehe maha oli jätnud ehk Ühiskondade toed" Von Krahli Teatris, lavastaja Rainer Sarnet

  14. Nora Särak: kõige suurem katsumus on iseenda usaldamine / intervjueerinud Katariina Rebane

    Index Scriptorium Estoniae

    Särak, Nora

    2016-01-01

    Kevadel Balti filmi- ja meediakooli magistriõppe lõpetanud Nora Säraku lõputööna valminud lühidokumentaalfilm "Valguseks/Valguseni/Valgusena" Petseris elavatest eestlastest pälvis Eesti Kultuurkapitali Audiovisuaalse kunsti sihtkapitali aastapreemia ning film valiti aasta dokumentaalfilmiks. Intervjuu Nora Särakuga

  15. Expression of multidrug resistance efflux pump gene norA is iron responsive in Staphylococcus aureus.

    Science.gov (United States)

    Deng, Xin; Sun, Fei; Ji, Quanjiang; Liang, Haihua; Missiakas, Dominique; Lan, Lefu; He, Chuan

    2012-04-01

    Staphylococcus aureus utilizes efflux transporter NorA to pump out a wide range of structurally dissimilar drugs, conferring low-level multidrug resistance. The regulation of norA expression has yet to be fully understood although past studies have revealed that this gene is under the control of the global transcriptional regulator MgrA and the two-component system ArlRS. To identify additional regulators of norA, we screened a transposon library in strain Newman expressing the transcriptional fusion norA-lacZ for altered β-galactosidase activity. We identify a transposon insertion in fhuB, a gene that encodes a ferric hydroxamate uptake system permease, and propose that the norA transcription is iron responsive. In agreement with this observation, addition of FeCl(3) repressed the induction of norA-lacZ, suggesting that bacterial iron uptake plays an important role in regulating norA transcription. In addition, a fur (ferric uptake regulator) deletion exhibited compromised norA transcription and reduced resistance to quinolone compared to the wild-type strain, indicating that fur functions as a positive regulator of norA. A putative Fur box identified in the promoter region of norA was confirmed by electrophoretic mobility shift and DNase I footprint assays. Finally, by employing a siderophore secretion assay, we reveal that NorA may contribute to the export of siderophores. Collectively, our experiments uncover some novel interactions between cellular iron level and norA regulation in S. aureus.

  16. Hans Werner Richter - Wolfgang Borchert : zwei Schriftsteller im 2. Weltkrieg ; ihre Kriegseinsätze und die Umsetzung in Literatur

    OpenAIRE

    Brandes, Katrein

    2018-01-01

    Hans Werner Richter und Wolfgang Borchert, zwei der bekanntesten deutschen Nachkriegsschriftsteller, waren selbst auf erbittert umkämpften Schauplätzen des 2. Weltkrieges eingesetzt: Richter in Italien bei Cassino, Borchert an der Ostfront südlich Moskaus. Trotz der Auseinandersetzung mit ihren literarischen Zeugnissen aus dieser Zeit, wie Richters Roman „Die Geschlagenen“ und Borcherts Kurzgeschichten, ist die Frage nach ihrem eigenen Kriegserleben, nach Schuldbewusstsein und dem Niederschla...

  17. Ligand Promiscuity between the Efflux Pumps Human P-Glycoprotein and S. aureus NorA.

    Science.gov (United States)

    Brincat, Jean Pierre; Broccatelli, Fabio; Sabatini, Stefano; Frosini, Maria; Neri, Annalisa; Kaatz, Glenn W; Cruciani, Gabriele; Carosati, Emanuele

    2012-03-08

    Thirty-two diverse compounds were evaluated for their ability to inhibit both Pgp-mediated efflux in mouse T-lymphoma L5178 MDR1 and NorA-mediated efflux in S. aureus SA-1199B. Only four compounds were strong inhibitors of both efflux pumps. Three compounds were found to inhibit Pgp exclusively and strongly, while seven compounds inhibited only NorA. These results demonstrate that Pgp and NorA inhibitors do not necessarily overlap, opening the way to safer therapeutic use of effective NorA inhibitors.

  18. Discovery of novel inhibitors of the NorA multidrug transporter of Staphylococcus aureus.

    Science.gov (United States)

    Brincat, Jean Pierre; Carosati, Emanuele; Sabatini, Stefano; Manfroni, Giuseppe; Fravolini, Arnaldo; Raygada, Jose L; Patel, Diixa; Kaatz, Glenn W; Cruciani, Gabriele

    2011-01-13

    Four novel inhibitors of the NorA efflux pump of Staphylococcus aureus, discovered through a virtual screening process, are reported. The four compounds belong to different chemical classes and were tested for their in vitro ability to block the efflux of a well-known NorA substrate, as well as for their ability to potentiate the effect of ciprofloxacin (CPX) on several strains of S. aureus, including a NorA overexpressing strain. Additionally, the MIC values of each of the compounds individually are reported. A structure-activity relationship study was also performed on these novel chemotypes, revealing three new compounds that are also potent NorA inhibitors. The virtual screening procedure employed FLAP, a new methodology based on GRID force field descriptors.

  19. The Drosophila Nora virus is an enteric virus, transmitted via feces.

    Science.gov (United States)

    Habayeb, Mazen S; Cantera, Rafael; Casanova, Gabriela; Ekström, Jens-Ola; Albright, Shannon; Hultmark, Dan

    2009-04-01

    The biology of the Drosophila viruses has not been intensely investigated. Here we have investigated the biology of the Nora virus, a persistent Drosophila virus. We find that injected Nora virus is able to replicate in the files, reaching a high titer that is maintained in the next generation. There is a remarkable variation in the viral loads of individual flies in persistently infected stocks; the titers can differ by three orders of magnitude. The Nora virus is mainly found in the intestine of infected flies, and the histology of these infected intestines show increased vacuolization. The virus is excreted in the feces and is horizontally transmitted. The Nora virus infection has a very mild effect on the longevity of the flies, and no significant effect on the number of eggs laid and the percent of eggs that develop to adults.

  20. Defamation on facebook: Isparta V Richter 2013 6 SA 529 (GP ...

    African Journals Online (AJOL)

    In this case discussion, a brief overview is given of the few cases already reported, but in the main the case of Isparta v Richter 2013 6 SA 4529 (GP) is discussed. In this case a South African court for the first time awarded damages to the plaintiff for defamatory comments made on Facebook. The questions that confronted ...

  1. Nanotech, blur and tragedy in recent artworks by Gerhard Richter

    DEFF Research Database (Denmark)

    Nielsen, Kristian Hvidtfelt

    2008-01-01

    The author considers Gerhard Richter's work on nanotechnology, highlighting how these pieces continue the artist's ontology on photographic blur and, as such, raise questions about truth and reality with respect to the mass media's visual presentation of nanotechnology. The four works discussed i...

  2. Redox-controlled dinitrosyl formation at the diiron-oxo center of NorA.

    Science.gov (United States)

    Cramm, Rainer; Strube, Katja

    2008-01-01

    In the denitrifying bacterium Ralstonia eutropha H16, the NorA protein is coproduced with the respiratory nitric oxide (NO) reductase. NorA contains a diiron-oxo center, which can form stable adducts with dioxygen and NO. In contrast to other diiron proteins, the formation of NorA-NO requires both fully reduced protein and additional electrons. A minor fraction of in vitro NorA-NO represents a paramagnetic dinitrosyl iron complex (DNIC), while the major fraction is attributed to a DNIC of the structure {Fe(NO)(2)}, which shows no electron paramagnetic resonance. The NorA-DNIC may be formed either upon direct reaction of the protein with NO or upon incubation with nitrite due to an intrinsic nitrite reduction activity of NorA that liberates NO. NorA can be purified rapidly as a six histidine-tagged derivative from overproducing cells of Escherichia coli. This chapter describes procedures for the preparation of different redox forms of NorA for the formation of NorA adducts with NO, dioxygen, and azide, as well as for the quantification of NorA-bound NO.

  3. Osteoporosis practice patterns in 2006 among primary care physicians participating in the NORA study.

    Science.gov (United States)

    Weiss, T W; Siris, E S; Barrett-Connor, E; Miller, P D; McHorney, C A

    2007-11-01

    This study investigated osteoporosis management trends from 1998 to 2006 among 808 primary care physicians involved in the US-based NORA (National Osteoporosis Risk Assessment) study. These results suggest some significant improvements in osteoporosis management over the past eight years. The purpose of this study was to investigate osteoporosis management trends among a large cohort of primary care physicians (PCPs) involved in the US-based NORA (National Osteoporosis Risk Assessment) study. In 2006, we undertook a resurvey of the 2,836 NORA PCPs who completed a baseline survey in 1998. Of the 2,199 PCPs for whom we had current contact information and who were still practicing, we collected usable surveys from 808 (37% response rate). From 1998 to 2006, more than double the percentage of NORA PCPs reported using BMDs "often" (35% vs. 87%). There was a doubling of the percentage of NORA PCPs who reported that a T-score of NORA PCPs who reported using bone turnover markers to screen, diagnosis, or monitor osteoporosis almost tripled (19% vs. 55%). The percentage of patients prescribed or recommended hormone therapy dropped sixfold (67% to 11%), and the percentage of patients prescribed bisphosphonates increased fourfold from 15% to 59%. These results suggest some significant improvements in osteoporosis management over the past eight years.

  4. The Extended Northern ROSAT Galaxy Cluster Survey (NORAS II). I. Survey Construction and First Results

    Energy Technology Data Exchange (ETDEWEB)

    Böhringer, Hans; Chon, Gayoung; Trümper, Joachim [Max-Planck-Institut für Extraterrestrische Physik, D-85748 Garching (Germany); Retzlaff, Jörg [ESO, D-85748 Garching (Germany); Meisenheimer, Klaus [Max-Planck-Institut für Astronomy, Königstuhl 17, D-69117 Heidelberg (Germany); Schartel, Norbert [ESAC, Camino Bajo del Castillo, Villanueva de la Cañada, E-28692 Madrid (Spain)

    2017-05-01

    As the largest, clearly defined building blocks of our universe, galaxy clusters are interesting astrophysical laboratories and important probes for cosmology. X-ray surveys for galaxy clusters provide one of the best ways to characterize the population of galaxy clusters. We provide a description of the construction of the NORAS II galaxy cluster survey based on X-ray data from the northern part of the ROSAT All-Sky Survey. NORAS II extends the NORAS survey down to a flux limit of 1.8 × 10{sup −12} erg s{sup −1} cm{sup −2} (0.1–2.4 keV), increasing the sample size by about a factor of two. The NORAS II cluster survey now reaches the same quality and depth as its counterpart, the southern REFLEX II survey, allowing us to combine the two complementary surveys. The paper provides information on the determination of the cluster X-ray parameters, the identification process of the X-ray sources, the statistics of the survey, and the construction of the survey selection function, which we provide in numerical format. Currently NORAS II contains 860 clusters with a median redshift of z  = 0.102. We provide a number of statistical functions, including the log N –log S and the X-ray luminosity function and compare these to the results from the complementary REFLEX II survey. Using the NORAS II sample to constrain the cosmological parameters, σ {sub 8} and Ω{sub m}, yields results perfectly consistent with those of REFLEX II. Overall, the results show that the two hemisphere samples, NORAS II and REFLEX II, can be combined without problems into an all-sky sample, just excluding the zone of avoidance.

  5. The Extended Northern ROSAT Galaxy Cluster Survey (NORAS II). I. Survey Construction and First Results

    International Nuclear Information System (INIS)

    Böhringer, Hans; Chon, Gayoung; Trümper, Joachim; Retzlaff, Jörg; Meisenheimer, Klaus; Schartel, Norbert

    2017-01-01

    As the largest, clearly defined building blocks of our universe, galaxy clusters are interesting astrophysical laboratories and important probes for cosmology. X-ray surveys for galaxy clusters provide one of the best ways to characterize the population of galaxy clusters. We provide a description of the construction of the NORAS II galaxy cluster survey based on X-ray data from the northern part of the ROSAT All-Sky Survey. NORAS II extends the NORAS survey down to a flux limit of 1.8 × 10 −12 erg s −1 cm −2 (0.1–2.4 keV), increasing the sample size by about a factor of two. The NORAS II cluster survey now reaches the same quality and depth as its counterpart, the southern REFLEX II survey, allowing us to combine the two complementary surveys. The paper provides information on the determination of the cluster X-ray parameters, the identification process of the X-ray sources, the statistics of the survey, and the construction of the survey selection function, which we provide in numerical format. Currently NORAS II contains 860 clusters with a median redshift of z  = 0.102. We provide a number of statistical functions, including the log N –log S and the X-ray luminosity function and compare these to the results from the complementary REFLEX II survey. Using the NORAS II sample to constrain the cosmological parameters, σ 8 and Ω m , yields results perfectly consistent with those of REFLEX II. Overall, the results show that the two hemisphere samples, NORAS II and REFLEX II, can be combined without problems into an all-sky sample, just excluding the zone of avoidance.

  6. [August Gottlieb Richter: urological aspects of his comprehensive operative and scientific work].

    Science.gov (United States)

    Seifert, D

    2013-06-01

    August Gottlieb Richter (1742-1812) was one of the most distinguished surgeons in the second half of the eighteenth century. In this article his life and scientific career during an age shaken by wars and radical changes are described. Particular attention is paid to his achievements as a doctor, teacher and scientific author. The latter activity finds its foremost expression in the"Chirurgische Bibliothek" ("Surgical library"), a practice-oriented scientific journal, as well as in his later work"Anfangsgründe der Wundarzneykunst" ("Elements of wound surgery"). This article concentrates on the urological aspects of his work and compares these aspects with contemporary publications. Particular emphasis is placed on Richter's dispute about fashionable medical trends typical for that era as well as his culture of criticism and self-criticism.

  7. Near-tetraploidy is associated with Richter transformation in chronic lymphocytic leukemia patients receiving ibrutinib.

    Science.gov (United States)

    Miller, Cecelia R; Ruppert, Amy S; Heerema, Nyla A; Maddocks, Kami J; Labanowska, Jadwiga; Breidenbach, Heather; Lozanski, Gerard; Zhao, Weiqiang; Gordon, Amber L; Jones, Jeffrey A; Flynn, Joseph M; Jaglowski, Samantha M; Andritsos, Leslie A; Blum, Kristie A; T Awan, Farrukh; Rogers, Kerry A; Grever, Michael R; Johnson, Amy J; Abruzzo, Lynne V; Hertlein, Erin K; Blachly, James S; Woyach, Jennifer A; Byrd, John C

    2017-08-22

    Ibrutinib is a highly effective targeted therapy for chronic lymphocytic leukemia (CLL). However, ibrutinib must be discontinued in a subset of patients due to progressive CLL or transformation to aggressive lymphoma (Richter transformation). Transformation occurs early in the course of therapy and has an extremely poor prognosis. Thus, identification of prognostic markers associated with transformation is of utmost importance. Near-tetraploidy (4 copies of most chromosomes within a cell) has been reported in various lymphomas, but its incidence and significance in CLL has not been described. Using fluorescence in situ hybridization, we detected near-tetraploidy in 9 of 297 patients with CLL prior to beginning ibrutinib treatment on 1 of 4 clinical trials (3.0%; 95% confidence interval [CI], 1.4%-5.7%). Near-tetraploidy was associated with aggressive disease characteristics: Rai stage 3/4 ( P = .03), deletion 17p ( P = .03), and complex karyotype ( P = .01). Near-tetraploidy was also associated with ibrutinib discontinuation due to Richter transformation ( P transformation with diffuse large B-cell lymphoma. In a multivariable model, near-tetraploidy (hazard ratio [HR], 8.66; 95% CI, 3.83-19.59; P transformation. Our results suggest that near-tetraploidy is a potential prognostic marker for Richter transformation to assess in patients going on ibrutinib.

  8. A Network of Themes: A Qualitative Approach to Gerhard Richter's Text

    Directory of Open Access Journals (Sweden)

    Narvika Bovcon

    2017-07-01

    Full Text Available Gerhard Richter's books Text – a collection of painter's verbal statements about his artistic method – and Atlas – 783 sheets with images, mainly photographs and visual notations – are two archives that complement the understanding of his diverse artistic practice. The paper presents a textual model that experimentally simulates a possible ordering principle for archives. Richter's statements in the book Text are cut up and used as short quotations. Those that relate to multiple aspects of the painter's oeuvre are identified as hubs in the semantic network. The hubs are organized paratactically, as an array of different themes. The paper presents a methodological hypothesis and an experimental model that aim to connect the research of real networks with the paradigms of humanistic interpretation. We have to bear in mind that the network is a result of the researcher's interpretative approach, which is added to the initial archive included in the book Text. The breaking up of Richter's poetics into atoms of quotations is an experimental proposal of a new textuality in art history and humanities, which has its own history. In comparison to digital archives with complex interfaces that often tend to obscure the content, the elements in our experiment appear as specific configurations of the semantic network and are presented in a limited number of linear texts. The method of listing of quotations gathers the fragments into a potential “whole”, i.e. a narrativized gateway to an archive according to the researcher's interpretation.

  9. Influence of breathing exercises using method of Body Flex by Greer Childers on to the selected somatic traits of women with overweight and obesity

    Directory of Open Access Journals (Sweden)

    Maria Radziejowska

    2014-03-01

    Full Text Available Introduction . Overweight and obesity are without any doubts an epidemic of our times, resulting from a change in the living style of the people. Majority of the people reduces the physical activity to the minimum, because of the lack of time they have after the work. That is why we are attacked from time to time by various publications about miraculous methods how to throw away an excessive body weight. In this work is made a close investigation of the method of Greer Childers “Body Flex”, which has become very popular among other in the United States and in Russia, because of the simplicity of exercises to be done and the short time necessary to perform them. The essence of exercises of „‘Body Flex’’ type are the breathing exercises connected with isometric and stretching exercising. The main stress is applied to the lower breathing path with keeping the abdominal muscles tone as well as adding the posture muscles operations, what is as consequence to reduce the body weight, selected body circumferences and to strengthen the muscles exercised. Purpose: The aim of presented work was the comparative assessment of the selected somatic traits of the persons making regularly exercises, at least 5 times a week, using the modified „‘Body Flex’’ method as well as the assessment of effectiveness of the application of those exercises. Material and methods: The examination has covered a group of 25 persons, which was women in the age range 36 – 63, average age amounted to 58,45 +- 8,92 years, including 16 persons of them constituting the tested group and 9 persons being a control group, which has not made regular exercises. In the tested group was separated: 4 persons’ group of women with BMI indicating their obesity, 8 persons’ group of women with BMI indicating overweight and 4 persons’ group of women with BMI within the limits of the norm. Before and after 1 month’s, and for 9 persons – after 2 months’ therapy, their

  10. Nora virus persistent infections are not affected by the RNAi machinery.

    Science.gov (United States)

    Habayeb, Mazen S; Ekström, Jens-Ola; Hultmark, Dan

    2009-05-29

    Drosophila melanogaster is widely used to decipher the innate immune system in response to various pathogens. The innate immune response towards persistent virus infections is among the least studied in this model system. We recently discovered a picorna-like virus, the Nora virus which gives rise to persistent and essentially symptom-free infections in Drosophila melanogaster. Here, we have used this virus to study the interaction with its host and with some of the known Drosophila antiviral immune pathways. First, we find a striking variability in the course of the infection, even between flies of the same inbred stock. Some flies are able to clear the Nora virus but not others. This phenomenon seems to be threshold-dependent; flies with a high-titer infection establish stable persistent infections, whereas flies with a lower level of infection are able to clear the virus. Surprisingly, we find that both the clearance of low-level Nora virus infections and the stability of persistent infections are unaffected by mutations in the RNAi pathways. Nora virus infections are also unaffected by mutations in the Toll and Jak-Stat pathways. In these respects, the Nora virus differs from other studied Drosophila RNA viruses.

  11. Eesti Akadeemiline Farmaatsia Selts ja Gedeon Richter alustasid koostööd / Heikki Sal-Saller

    Index Scriptorium Estoniae

    Sal-Saller, Heikki

    2014-01-01

    Eesti Akadeemiline Farmaatsia Selts ja Gedeon Richter Eesti sõlmisid koostöölepingu fondi loomiseks, millest eraldatakse stipendiume farmatseutilise tehnoloogia erialal kaitstud õppeaasta parima uurimistöö teostanud üliõpilastele

  12. Two intercultural performances: Double Nora and Resurrection Day

    Directory of Open Access Journals (Sweden)

    Mitsuya Mori

    2015-02-01

    Full Text Available I have so far directed two plays of Ibsen as the intercultural performance, that is, the collaboration of the modern theatre with noh, a traditional Japanese theatre, which was established as an artistic theatre form in the 14th century. The first production was Double Nora, based on A Doll’s House, which premiered at a noh theatre in Tokyo in 2005, and the second was Resurrection Day, based on When We Dead Awaken, performed at the Ibsen Festival in Tokyo in 2010. In both productions, professional noh and modern theatre actors appeared together in their own acting styles. At the Ibsen Conference in Tromsø in June 2012, brief scenes of the two productions were shown. But here in the present article the performances are partly described, and the interactive relationship between different acting styles of noh and modern theatre is examined. A new and difficult experiment of Resurrection Day was to try a conversation between the main noh actor and the modern actress. The experiment was possible because the performance took place not on a noh stage in a unique form but on an ordinary stage in a modern theatre. Thus, some problems involved in the intercultural performance of Ibsen are investigated.

  13. Piperine analogs as potent Staphylococcus aureus NorA efflux pump inhibitors

    DEFF Research Database (Denmark)

    Sangwan, Payare L; Koul, Jawahir L; Koul, Surrinder

    2008-01-01

    Based on our recent findings that piperine is a potent Staphylococcus aureus NorA efflux pump inhibitor (EPI), 38 piperine analogs were synthesized and bioevaluated for their EPI activity. Twenty-five of them were found active with potentiating activity equivalent or more than known EPIs like...... reserpine, carsonic acid and verapamil. The inhibitory mechanism of the compounds was confirmed by efflux inhibition assay using ethidium bromide as NorA substrate. The present communication describes the synthesis, bioevaluation and structure related activity of these efflux pump inhibitors....

  14. RICHTER: A Smartphone Application for Rapid Collection of Geo-Tagged Pictures of Earthquake Damage

    Science.gov (United States)

    Skinnemoen, H.; Bossu, R.; Furuheim, K.; Bjorgo, E.

    2010-12-01

    RICHTER (Rapid geo-Images for Collaborative Help Targeting Earthquake Response) is a smartphone version of a professional application developed to provide high quality geo-tagged image communication over challenging network links, such as satellites and poor mobile links. Developed for Android mobile phones, it allows eyewitnesses to share their pictures of earthquake damage easily and without cost with the Euro-Mediterranean Seismological Centre (EMSC). The goal is to engage citizens in the collection of the most up-to-date visual information on local damage for improved rapid impact assessment. RICHTER integrates the innovative and award winning ASIGN protocol initially developed for satellite communication between cameras / computers / satcom terminals and servers at HQ. ASIGN is a robust and optimal image and video communication management solution for bandwidth-limited communication networks which was developed for use particularly in emergency and disaster situations. Contrary to a simple Multimedia Messaging System (MMS), RICHTER allows access to high definition images with embedded location information. Location is automatically assigned from either the internal GPS, derived from the mobile network (triangulation) or the current Wi-Fi domain, in that order, as this corresponds to the expected positioning accuracy. Pictures are compressed to 20-30KB of data typically for fast transfer and to avoid network overload. Full size images can be requested by the EMSC either fully automatically, or on a case-by-case basis, depending on the user preferences. ASIGN was initially developed in coordination with INMARSAT and the European Space Agency. It was used by the Rapid Mapping Unit of the United Nations notably for the damage assessment of the January 12, 2010 Haiti earthquake where more than 700 photos were collected. RICHTER will be freely distributed on the EMSC website to eyewitnesses in the event of significantly damaging earthquakes. The EMSC is the second

  15. Citral derived amides as potent bacterial NorA efflux pump inhibitors

    DEFF Research Database (Denmark)

    Thota, Niranjan; Koul, Surrinder; Reddy, Mallepally V

    2008-01-01

    Monoterpene citral and citronellal have been used as starting material for the preparation of 5,9-dimethyl-deca-2,4,8-trienoic acid amides and 9-formyl-5-methyl-deca-2,4,8-trienoic acid amides. The amides on bioevaluation as efflux pump inhibitors (EPIs) against Staphylococcus aureus 1199 and NorA...

  16. Detecting the Presence of Nora Virus in "Drosophila" Utilizing Single Fly RT-PCR

    Science.gov (United States)

    Munn, Bethany; Ericson, Brad; Carlson, Darby J.; Carlson, Kimberly A.

    2015-01-01

    A single fly RT-PCR protocol has recently been developed to detect the presence of the persistent, horizontally transmitted Nora virus in "Drosophila." Wild-caught flies from Ohio were tested for the presence of the virus, with nearly one-fifth testing positive. The investigation presented can serve as an ideal project for biology…

  17. Virtual screening for novel Staphylococcus Aureus NorA efflux pump inhibitors from natural products.

    Science.gov (United States)

    Thai, Khac-Minh; Ngo, Trieu-Du; Phan, Thien-Vy; Tran, Thanh-Dao; Nguyen, Ngoc-Vinh; Nguyen, Thien-Hai; Le, Minh-Tri

    2015-01-01

    NorA is a member of the Major Facilitator Superfamily (MFS) drug efflux pumps that have been shown to mediate antibiotic resistance in Staphylococcus aureus (SA). In this study, QSAR analysis, virtual screening and molecular docking were implemented in an effort to discover novel SA NorA efflux pump inhibitors. Originally, a set of 47 structurally diverse compounds compiled from the literature was used to develop linear QSAR models and another set of 15 different compounds were chosen for extra validation. The final model which was estimated by statistical values for the full data set (n = 45, Q(2) = 0.80, RMSE = 0.20) and for the external test set (n = 15, R(2) = 0.60, |res|max = 0.75, |res|min = 0.02) was applied on the collection of 182 flavonoides and the traditional Chinese medicine (TCM) database to screen for novel NorA inhibitors. Finally, 33 lead compounds that met the Lipinski's rules of five/three and had good predicted pIC50 values from in silico screening process were employed to analyze the binding ability by docking studies on NorA homology model in place of its unavailable crystal structures at two active sites, the central channel and the Walker B.

  18. Deviations from the Gutenberg–Richter law on account of a random distribution of block sizes

    Energy Technology Data Exchange (ETDEWEB)

    Sibiryakov, B. P., E-mail: sibiryakovbp@ipgg.sbras.ru [Trofimuk Institute of Oil and Gas Geology and Geophysics SB RAS, Novosibirsk, 630090 (Russian Federation); Novosibirsk State University, Novosibirsk, 630090 (Russian Federation)

    2015-10-27

    This paper studies properties of a continuum with structure. The characteristic size of the structure governs the fact that difference relations are nonautomatically transformed into differential ones. It is impossible to consider an infinitesimal volume of a body, to which the major conservation laws could be applied, because the minimum representative volume of the body must contain at least a few elementary microstructures. The corresponding equations of motion are equations of infinite order, solutions of which include, along with usual sound waves, unusual waves with abnormally low velocities without a lower limit. It is shown that in such media weak perturbations can increase or decrease outside the limits. The number of complex roots of the corresponding dispersion equation, which can be interpreted as the number of unstable solutions, depends on the specific surface of cracks and is an almost linear dependence on a logarithmic scale, as in the seismological Gutenberg–Richter law. If the distance between one pore (crack) to another one is a random value with some distribution, we must write another dispersion equation and examine different scenarios depending on the statistical characteristics of the random distribution. In this case, there are sufficient deviations from the Gutenberg–Richter law and this theoretical result corresponds to some field and laboratory observations.

  19. VP3 is crucial for the stability of Nora virus virions.

    Science.gov (United States)

    Sadanandan, Sajna Anand; Ekström, Jens-Ola; Jonna, Venkateswara Rao; Hofer, Anders; Hultmark, Dan

    2016-09-02

    Nora virus is an enteric virus that causes persistent, non-pathological infection in Drosophila melanogaster. It replicates in the fly gut and is transmitted via the fecal-oral route. Nora virus has a single-stranded positive-sense RNA genome, which is translated in four open reading frames. Reading frame three encodes the VP3 protein, the structure and function of which we have investigated in this work. We have shown that VP3 is a trimer that has an α-helical secondary structure, with a functionally important coiled-coil domain. In order to identify the role of VP3 in the Nora virus life cycle, we constructed VP3-mutants using the cDNA clone of the virus. Our results show that VP3 does not have a role in the actual assembly of the virus particles, but virions that lack VP3 or harbor VP3 with a disrupted coiled coil domain are incapable of transmission via the fecal-oral route. Removing the region downstream of the putative coiled coil appears to have an effect on the fitness of the virus but does not hamper its replication or transmission. We also found that the VP3 protein and particularly the coiled coil domain are crucial for the stability of Nora virus virions when exposed to heat or proteases. Hence, we propose that VP3 is imperative to Nora virus virions as it confers stability to the viral capsid. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.

  20. Pharmacophore-Based Repositioning of Approved Drugs as Novel Staphylococcus aureus NorA Efflux Pump Inhibitors.

    Science.gov (United States)

    Astolfi, Andrea; Felicetti, Tommaso; Iraci, Nunzio; Manfroni, Giuseppe; Massari, Serena; Pietrella, Donatella; Tabarrini, Oriana; Kaatz, Glenn W; Barreca, Maria L; Sabatini, Stefano; Cecchetti, Violetta

    2017-02-23

    An intriguing opportunity to address antimicrobial resistance is represented by the inhibition of efflux pumps. Focusing on NorA, the most important efflux pump of Staphylococcus aureus, an efflux pump inhibitors (EPIs) library was used for ligand-based pharmacophore modeling studies. By exploitation of the obtained models, an in silico drug repositioning approach allowed for the identification of novel and potent NorA EPIs.

  1. Homology modeling, molecular dynamics, and virtual screening of NorA efflux pump inhibitors of Staphylococcus aureus.

    Science.gov (United States)

    Bhaskar, Baki Vijaya; Babu, Tirumalasetty Muni Chandra; Reddy, Netala Vasudeva; Rajendra, Wudayagiri

    2016-01-01

    Emerging drug resistance in clinical isolates of Staphylococcus aureus might be implicated to the overexpression of NorA efflux pump which is capable of extruding numerous structurally diverse compounds. However, NorA efflux pump is considered as a potential drug target for the development of efflux pump inhibitors. In the present study, NorA model was constructed based on the crystal structure of glycerol-3-phosphate transporter (PDBID: 1PW4). Molecular dynamics (MD) simulation was performed using NAMD2.7 for NorA which is embedded in the hydrated lipid bilayer. Structural design of NorA unveils amino (N)- and carboxyl (C)-terminal domains which are connected by long cytoplasmic loop. N and C domains are composed of six transmembrane α-helices (TM) which exhibits pseudo-twofold symmetry and possess voluminous substrate binding cavity between TM helices. Molecular docking of reserpine, totarol, ferruginol, salvin, thioxanthene, phenothiazine, omeprazole, verapamil, nalidixic acid, ciprofloxacin, levofloxacin, and acridine to NorA found that all the molecules were bound at the large hydrophobic cleft and indicated significant interactions with the key residues. In addition, structure-based virtual screening was employed which indicates that 14 potent novel lead molecules such as CID58685302, CID58685367, CID5799283, CID5578487, CID60028372, ZINC12196383, ZINC72140751, ZINC72137843, ZINC39227983, ZINC43742707, ZINC12196375, ZINC66166948, ZINC39228014, and ZINC14616160 have highest binding affinity for NorA. These lead molecules displayed considerable pharmacological properties as evidenced by Lipinski rule of five and prophecy of toxicity risk assessment. Thus, the present study will be helpful in designing and synthesis of a novel class of NorA efflux pump inhibitors that restore the susceptibilities of drug compounds.

  2. Capsaicin, a novel inhibitor of the NorA efflux pump, reduces the intracellular invasion of Staphylococcus aureus.

    Science.gov (United States)

    Kalia, Nitin Pal; Mahajan, Priya; Mehra, Rukmankesh; Nargotra, Amit; Sharma, Jai Parkash; Koul, Surrinder; Khan, Inshad Ali

    2012-10-01

    To delineate the role of capsaicin (8-methyl-N-vanillyl-6-nonenamide) as an inhibitor of the NorA efflux pump and its impact on invasion of macrophages by Staphylococcus aureus. Capsaicin in combination with ciprofloxacin was tested for activity against S. aureus SA-1199B (NorA overproducing), SA-1199 (wild-type) and SA-K1758 (norA knockout). The role of NorA in the intracellular invasion of S. aureus and the ability of capsaicin to inhibit this invasion was established in J774 macrophage cell lines. The three-dimensional structure of NorA was predicted using an in silico approach and docking studies of capsaicin were performed. Capsaicin significantly reduced the MIC of ciprofloxacin for S. aureus SA-1199 and SA-1199B. Furthermore, capsaicin also extended the post-antibiotic effect of ciprofloxacin by 1.1 h at MIC concentration. There was a decrease in mutation prevention concentration of ciprofloxacin when combined with capsaicin. Inhibition of ethidium bromide efflux by NorA-overproducing S. aureus SA-1199B confirmed the role of capsaicin as a NorA efflux pump inhibitor (EPI). The most significant finding of this study was the ability of capsaicin to reduce the intracellular invasion of S. aureus SA-1199B (NorA overproducing) in J774 macrophage cell lines by 2 log(10). This study, for the first time, has shown that capsaicin, a novel EPI, not only inhibits the NorA efflux pump of S. aureus but also reduces the invasiveness of S. aureus, thereby reducing its virulence.

  3. Significance of normalized residual activity value (Nora) - the new parameter of isotopic renography - for the diagnosis of patients with obstructive uropathy

    International Nuclear Information System (INIS)

    Juszczyk-Gontaszewska, M.; Gontaszewski, W.; Rogowski, F.

    2005-01-01

    The aim of this research was to establish NORA values typical of patients with compensated and uncompensated obstructive uropathy. 147 results of renoscintigraphies carried out after the application of Tc-99m DTPA with furosemide diuretic test were analyzed. The patients were divided into three groups: the group with compensated obstructive uropathy, the group with uncompensated obstructive uropathy, and the controlled group. NORA-1 and NORA-2 values were calculated in each patient, for each kidney separately. It was established that the mean NORA-1 values in the three groups (the controlled group, the compensated uropathy group, and the uncompensated uropathy group) were significantly different, thus enabling differentiation between them. Based on the examination described above, the following conclusions wee drawn: 1. NORA is an effective differentiation index for compensated and uncompensated uropathy. 2. NORA values should be routinely calculated in every case of isotopic diuretic renography. (author)

  4. Analysis of immune-related genes during Nora virus infection of Drosophila melanogaster using next generation sequencing.

    Science.gov (United States)

    Lopez, Wilfredo; Page, Alexis M; Carlson, Darby J; Ericson, Brad L; Cserhati, Matyas F; Guda, Chittibabu; Carlson, Kimberly A

    2018-01-01

    Drosophila melanogaster depends upon the innate immune system to regulate and combat viral infection. This is a complex, yet widely conserved process that involves a number of immune pathways and gene interactions. In addition, expression of genes involved in immunity are differentially regulated as the organism ages. This is particularly true for viruses that demonstrate chronic infection, as is seen with Nora virus. Nora virus is a persistent non-pathogenic virus that replicates in a horizontal manner in D. melanogaster . The genes involved in the regulation of the immune response to Nora virus infection are largely unknown. In addition, the temporal response of immune response genes as a result of infection has not been examined. In this study, D. melanogaster either infected with Nora virus or left uninfected were aged for 2, 10, 20 and 30 days. The RNA from these samples was analyzed by next generation sequencing (NGS) and the resulting immune-related genes evaluated by utilizing both the PANTHER and DAVID databases, as well as comparison to lists of immune related genes and FlyBase. The data demonstrate that Nora virus infected D. melanogaster exhibit an increase in immune related gene expression over time. In addition, at day 30, the data demonstrate that a persistent immune response may occur leading to an upregulation of specific immune response genes. These results demonstrate the utility of NGS in determining the potential immune system genes involved in Nora virus replication, chronic infection and involvement of antiviral pathways.

  5. Effect of Promoter Region Mutations and mgrA Overexpression on Transcription of norA, Which Encodes a Staphylococcus aureus Multidrug Efflux Transporter

    OpenAIRE

    Kaatz, Glenn W.; Thyagarajan, Rama V.; Seo, Susan M.

    2005-01-01

    NorA is a Staphylococcus aureus multidrug transporter that confers resistance to structurally distinct compounds. The MgrA global regulatory protein is reported to augment norA expression when mgrA is overexpressed from an undefined plasmid-based promoter. Further details about norA regulatory mechanisms are scant. A chromosomal norA::lacZ transcriptional fusion was constructed in different S. aureus strains, and allele replacement was used to define the relevance of promoter region sequences...

  6. Extension of Gutenberg-Richter distribution to MW -1.3, no lower limit in sight

    Science.gov (United States)

    Boettcher, Margaret S.; McGarr, A.; Johnston, Malcolm

    2009-05-01

    With twelve years of seismic data from TauTona Gold Mine, South Africa, we show that mining-induced earthquakes follow the Gutenberg-Richter relation with no scale break down to the completeness level of the catalog, at moment magnitude M W -1.3. Events recorded during relatively quiet hours in 2006 indicate that catalog detection limitations, not earthquake source physics, controlled the previously reported minimum magnitude in this mine. Within the Natural Earthquake Laboratory in South African Mines (NELSAM) experiment's dense seismic array, earthquakes that exhibit shear failure at magnitudes as small as M W -3.9 are observed, but we find no evidence that M W -3.9 represents the minimum magnitude. In contrast to previous work, our results imply small nucleation zones and that earthquake processes in the mine can readily be scaled to those in either laboratory experiments or natural faults.

  7. A Percolation Perspective for Gutenburg-Richter Scaling and b-values for Fracking Assocated Seismicity

    Science.gov (United States)

    Norris, J. Q.

    2016-12-01

    Published 60 years ago, the Gutenburg-Richter law provides a universal frequency-magnitude distribution for natural and induced seismicity. The GR law is a two parameter power-law with the b-value specifying the relative frequency of small and large events. For large catalogs of natural seismicity, the observed b-values are near one, while fracking associated seismicity has observed b-values near two, indicating relatively fewer large events. We have developed a computationally inexpensive percolation model for fracking that allows us to generate large catalogs of fracking associated seismicity. Using these catalogs, we show that different power-law fitting procedures produce different b-values for the same data set. This shows that care must be taken when determining and comparing b-values for fracking associated seismicity.

  8. Briefe aus dem Morgenland - Otto Friedrich von Richters Forschungsreise in den Jahren 1814-1816 / Vladimir Sazonov

    Index Scriptorium Estoniae

    Sazonov, Vladimir, 1979-

    2013-01-01

    Arvustus: Briefe aus dem Morgenland - Otto Friedrich von Richters Forschungsreise in den Jahren 1814-1816, hrsg. von Indrek Jürjo, Sergei Stadnikov, Hamburger Beiträge zur Geschichte des östlichen Europa, Bd. 20. Hamburg: Verlag Dr. Kovač 2013, 313 lk.

  9. Optimized efflux assay for the NorA multidrug efflux pump in Staphylococcus aureus.

    Science.gov (United States)

    Zimmermann, Saskia; Tuchscherr, Lorena; Rödel, Jürgen; Löffler, Bettina; Bohnert, Jürgen A

    2017-11-01

    Real-time fluorescent efflux assays are commonly used for measuring the efflux of bacterial pumps. Here we describe an optimized protocol for the NorA efflux pump in S. aureus using DiOC 3 instead of ethidium bromide. Glucose and sodium formate were tested as energy carriers. This novel method is fast and reproducible. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Differential gene expression related to Nora virus infection of Drosophila melanogaster.

    Science.gov (United States)

    Cordes, Ethan J; Licking-Murray, Kellie D; Carlson, Kimberly A

    2013-08-01

    Nora virus is a recently discovered RNA picorna-like virus that produces a persistent infection in Drosophila melanogaster, but the antiviral pathway or change in gene expression is unknown. We performed cDNA microarray analysis comparing the gene expression profiles of Nora virus infected and uninfected wild-type D. melanogaster. This analysis yielded 58 genes exhibiting a 1.5-fold change or greater and p-value less than 0.01. Of these genes, 46 were up-regulated and 12 down-regulated in response to infection. To validate the microarray results, qRT-PCR was performed with probes for Chorion protein 16 and Troponin C isoform 4, which show good correspondence with cDNA microarray results. Differential regulation of genes associated with Toll and immune-deficient pathways, cytoskeletal development, Janus Kinase-Signal Transducer and Activator of Transcription interactions, and a potential gut-specific innate immune response were found. This genome-wide expression profile of Nora virus infection of D. melanogaster can pinpoint genes of interest for further investigation of antiviral pathways employed, genetic mechanisms, sites of replication, viral persistence, and developmental effects. Copyright © 2013. Published by Elsevier B.V.

  11. Inhibition of the NorA multi-drug transporter by oxygenated monoterpenes.

    Science.gov (United States)

    Coêlho, Mayara Ladeira; Ferreira, Josie Haydée Lima; de Siqueira Júnior, José Pinto; Kaatz, Glenn W; Barreto, Humberto Medeiros; de Carvalho Melo Cavalcante, Ana Amélia

    2016-10-01

    The aim of this study was to investigate intrinsic antimicrobial activity of three monoterpenes nerol, dimethyl octanol and estragole, against bacteria and yeast strains, as well as, investigate if these compounds are able to inhibit the NorA efflux pump related to fluoroquinolone resistance in Staphylococcus aureus. Minimal inhibitory concentrations (MICs) of the monoterpenes against Staphylococcus aureus, Escherichia coli and Candida albicans strains were determined by micro-dilution assay. MICs of the norfloxacin against a S. aureus strain overexpressing the NorA protein were determined in the absence or in the presence of the monoterpenes at subinhibitory concentrations, aiming to verify the ability of this compounds act as efflux pump inhibitors. The monoterpenes were inactive against S. aureus however the nerol was active against E. coli and C. albicans. The addition of the compounds to growth media at sub-inhibitory concentrations enhanced the activity of norfloxacin against S. aureus SA1199-B. This result shows that bioactives tested, especially the nerol, are able to inhibit NorA efflux pump indicating a potential use as adjuvants of norfloxacin for therapy of infections caused by multi-drug resistant S. aureus strains. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Quantitative structure activity relationship (QSAR) of piperine analogs for bacterial NorA efflux pump inhibitors.

    Science.gov (United States)

    Nargotra, Amit; Sharma, Sujata; Koul, Jawahir Lal; Sangwan, Pyare Lal; Khan, Inshad Ali; Kumar, Ashwani; Taneja, Subhash Chander; Koul, Surrinder

    2009-10-01

    Quantitative structure activity relationship (QSAR) analysis of piperine analogs as inhibitors of efflux pump NorA from Staphylococcus aureus has been performed in order to obtain a highly accurate model enabling prediction of inhibition of S. aureus NorA of new chemical entities from natural sources as well as synthetic ones. Algorithm based on genetic function approximation method of variable selection in Cerius2 was used to generate the model. Among several types of descriptors viz., topological, spatial, thermodynamic, information content and E-state indices that were considered in generating the QSAR model, three descriptors such as partial negative surface area of the compounds, area of the molecular shadow in the XZ plane and heat of formation of the molecules resulted in a statistically significant model with r(2)=0.962 and cross-validation parameter q(2)=0.917. The validation of the QSAR models was done by cross-validation, leave-25%-out and external test set prediction. The theoretical approach indicates that the increase in the exposed partial negative surface area increases the inhibitory activity of the compound against NorA whereas the area of the molecular shadow in the XZ plane is inversely proportional to the inhibitory activity. This model also explains the relationship of the heat of formation of the compound with the inhibitory activity. The model is not only able to predict the activity of new compounds but also explains the important regions in the molecules in quantitative manner.

  13. Posttranslational modification influences the effects of MgrA on norA expression in Staphylococcus aureus.

    Science.gov (United States)

    Truong-Bolduc, Que Chi; Ding, Yanpeng; Hooper, David C

    2008-11-01

    MgrA is a global regulator in Staphylococcus aureus. Differences in the effects of MgrA on norA expression have been reported for different strains, which varied in rsbU, a gene that affects the expression of sigB, which encodes an alternative sigma factor involved in stress responses. We hypothesized that MgrA was modified by sigB-dependent factors that affected its ability to control the expression of the norA efflux pump. Heterologously expressed MgrA purified from Escherichia coli was incubated with crude extracts (CE) from strains RN6390 (rsbU) and SH1000 (rsbU(+)) and tested for binding to the norA promoter. Purified MgrA exhibited greater binding to norA promoter DNA after being incubated with SH1000 CE than MgrA incubated with the RN6390 CE. Phosphorylation of MgrA occurring in cell extracts caused it to lose the ability to bind norA promoter DNA. Overexpression of pknB, encoding a candidate serine/threonine kinase, produced increased phospho-MgrA and led to a fivefold increase in the transcript level of norA for both RN6390 and SH1000, as well as a fourfold increase in the MICs of norfloxacin and ciprofloxacin for these two strains. The levels of expression of pknB in RN6390 and SH1000, however, indicated that additional factors related to rsbU or sigB contribute to the differential regulatory effects of MgrA on norA expression.

  14. Defamation On Facebook: Isparta V Richter 2013 6 Sa 529 (GP

    Directory of Open Access Journals (Sweden)

    Anneliese Roos

    2014-12-01

    Full Text Available Litigation involving social media is still very new in South Africa and only a few reported cases can be found. In this case discussion, a brief overview is given of the few cases already reported, but in the main the case of Isparta v Richter 2013 6 SA 4529 (GP is discussed. In this case a South African court for the first time awarded damages to the plaintiff for defamatory comments made on Facebook. The questions that confronted the judge were whether the alleged defamatory statements did indeed relate to the plaintiff and whether the comments, individually or collectively, could be considered defamatory. The issue whether the "tagging" of another user of Facebook makes that user liable for the defamatory comments of the tagger is also addressed in the case. The case discussion concludes with a reference to other issues that could play a role in litigation involving Facebook, namely the Electronic Communications and Transactions Act 25 of 2002 and foreign law.

  15. Southern San Andreas Fault seismicity is consistent with the Gutenberg-Richter magnitude-frequency distribution

    Science.gov (United States)

    Page, Morgan T.; Felzer, Karen

    2015-01-01

    The magnitudes of any collection of earthquakes nucleating in a region are generally observed to follow the Gutenberg-Richter (G-R) distribution. On some major faults, however, paleoseismic rates are higher than a G-R extrapolation from the modern rate of small earthquakes would predict. This, along with other observations, led to formulation of the characteristic earthquake hypothesis, which holds that the rate of small to moderate earthquakes is permanently low on large faults relative to the large-earthquake rate (Wesnousky et al., 1983; Schwartz and Coppersmith, 1984). We examine the rate difference between recent small to moderate earthquakes on the southern San Andreas fault (SSAF) and the paleoseismic record, hypothesizing that the discrepancy can be explained as a rate change in time rather than a deviation from G-R statistics. We find that with reasonable assumptions, the rate changes necessary to bring the small and large earthquake rates into alignment agree with the size of rate changes seen in epidemic-type aftershock sequence (ETAS) modeling, where aftershock triggering of large earthquakes drives strong fluctuations in the seismicity rates for earthquakes of all magnitudes. The necessary rate changes are also comparable to rate changes observed for other faults worldwide. These results are consistent with paleoseismic observations of temporally clustered bursts of large earthquakes on the SSAF and the absence of M greater than or equal to 7 earthquakes on the SSAF since 1857.

  16. Formation of a dinitrosyl iron complex by NorA, a nitric oxide-binding di-iron protein from Ralstonia eutropha H16.

    Science.gov (United States)

    Strube, Katja; de Vries, Simon; Cramm, Rainer

    2007-07-13

    In Ralstonia eutropha H16, two genes, norA and norB, form a dicistronic operon that is controlled by the NO-responsive transcriptional regulator NorR. NorB has been identified as a membrane-bound NO reductase, but the physiological function of NorA is unknown. We found that, in a NorA deletion mutant, the promoter activity of the norAB operon was increased 3-fold, indicating that NorA attenuates activation of NorR. NorA shows limited sequence similarity to the oxygen carrier hemerythrin, which contains a di-iron center. Indeed, optical and EPR spectroscopy of purified NorA revealed the presence of a di-iron center, which binds oxygen in a similar way as hemerythrin. Diferrous NorA binds two molecules of NO maximally. Unexpectedly, binding of NO to the diferrous NorA required an external reductant. Two different NorA-NO species could be resolved. A minor species (up to 20%) showed an S = (1/2) EPR signal with g( perpendicular) = 2.041, and g( parallel) = 2.018, typical of a paramagnetic dinitrosyl iron complex. The major species was EPR-silent, showing characteristic signals at 420 nm and 750 nm in the optical spectrum. This species is proposed to represent a novel dinitrosyl iron complex of the form Fe(2+)-[NO](2)(2-), i.e. NO is bound as NO(-). The NO binding capacity of NorA in conjunction with its high cytoplasmic concentration (20 mum) suggests that NorA regulates transcription by lowering the free cytoplasmic concentration of NO.

  17. Novel structural analogues of piperine as inhibitors of the NorA efflux pump of Staphylococcus aureus

    DEFF Research Database (Denmark)

    Kumar, Ashwani; Khan, Inshad Ali; Koul, Surrinder

    2008-01-01

    OBJECTIVES: Evaluation of novel synthetic analogues of piperine as inhibitors of multidrug efflux pump NorA of Staphylococcus aureus. METHODS: A library of piperine-derived compounds was evaluated for their potential to inhibit ethidium bromide efflux in NorA-overexpressing S. aureus SA 1199B...... inhibitors of the NorA efflux pump. These inhibitors acted in a synergistic manner with ciprofloxacin, by substantially increasing its activity against both NorA-overexpressing and wild-type S. aureus isolates. These analogues were 2- to 4-fold more potent than piperine at a significantly lower minimal...... of ciprofloxacin through the inhibition of the NorA efflux pump. These molecules may prove useful in augmenting the antibacterial activities of fluoroquinolones in a clinical setting....

  18. A Study of the Historical Earthquake Catalog and Gutenberg-richter Parameter Values of the Korean Peninsula

    International Nuclear Information System (INIS)

    Seo, Jeong Moon; Choi, In Kil; Rhee, Hyun Me

    2010-01-01

    The KIER's Korean historical earthquake catalog was revised for MMI≥VI events recorded from the years 27 A.D. to 1904. The magnitude of each event was directly determined from the criteria suggested by Seo. The criteria incorporated the damage phenomena of the Japanese historical earthquake catalog, recent seismological studies, and the results of tests performed on ancient structures in Korea. Thus, the uncertainty of the magnitudes of the Korean historical earthquakes can be reduced. Also, the Gutenberg-Richter parameter values were estimated based on the revised catalog of this study. It was determined that the magnitudes of a maximum inland and minimum offshore event were approximately 6.3 and 6.5, respectively. The Gutenberg-Richter parameter pairs of the historical earthquake catalog were estimated to be a=5.32±0.21, b=0.95±0.19, which were somewhat lower than those obtained from recent complete instrumental earthquakes. No apparent change in the Gutenberg-Richter parameter is observed for the 16 th -17 th centuries of the seismically active period

  19. Using Network Oriented Research Assistant (NORA) Technology to Compare Digital Photographic With In-Person Assessment of Acne Vulgaris.

    Science.gov (United States)

    Singer, Hannah M; Almazan, Timothy; Craft, Noah; David, Consuelo V; Eells, Samantha; Erfe, Crisel; Lazzaro, Cynthia; Nguyen, Kathy; Preciado, Katy; Tan, Belinda; Patel, Vishal A

    2018-02-01

    Teledermatology has undergone exponential growth in the past 2 decades. Many technological innovations are becoming available without necessarily undergoing validation studies for specific dermatologic applications. To determine whether patient-taken photographs of acne using Network Oriented Research Assistant (NORA) result in similar lesion counts and Investigator's Global Assessment (IGA) findings compared with in-person examination findings. This pilot reliability study enrolled consecutive patients with acne vulgaris from a single general dermatology practice in Los Angeles, California, who were able to use NORA on an iPhone 6 to take self-photographs. Patients were enrolled from January 1 through March 31, 2016. Each individual underwent in-person and digital evaluation of his or her acne by the same dermatologist. A period of at least 1 week separated the in-person and digital assessments of acne. All participants were trained on how to use NORA on the iPhone 6 and take photographs of their face with the rear-facing camera. Reliability of patient-taken photographs with NORA for acne evaluation compared with in-person examination findings. Acne assessment measures included lesion count (total, inflammatory, noninflammatory, and cystic) and IGA for acne severity. A total of 69 patients (37 male [54%] and 32 female [46%]; mean [SD] age, 22.7 [7.7] years) enrolled in the study. The intraclass correlation coefficients of in-person and photograph-based acne evaluations indicated strong agreement. The intraclass correlation coefficient for total lesion count was 0.81; for the IGA, 0.75. Inflammatory lesion count, noninflammatory lesion count, and cyst count had intraclass correlation coefficients of 0.72, 0.72, and 0.82, respectively. This study found agreement between acne evaluations performed in person and from self-photographs with NORA. As a reliable telehealth technology for acne, NORA can be used as a teledermatology platform for dermatology research and can

  20. Is the Societal burden of fatal occupational injury different among NORA industry sectors?

    Science.gov (United States)

    Biddle, Elyce Anne

    2015-01-01

    Problem Since the implementation of the Occupational Safety and Health Act, safety and health in the work environment has seen marked improvement. Although these improvements are laudable, workplace hazards continue to plague the American worker. Understanding the economic burden of fatalities by industry sector is important to setting broad occupational safety and health research priorities. Cost estimates provide additional information about how fatal injuries affect society and hence can improve injury prevention program planning, policy analysis, evaluation, and advocacy. Method This study estimated the total, mean, and median societal costs by worker and case characteristic in 2003–2006 for the industry sectors identified in the National Institute for Occupational Safety and Health National Occupational Research Agenda (NORA). Analyses were conducted with restricted access to the Bureau of Labor Statistics Census of Fatal Occupational Injuries data. These data exclude military personnel, decedents with unknown age or sex, and fatalities occurring in New York City. Societal costs were estimated using the cost-of-illness approach, which combines direct and indirect costs to yield an overall cost of an fatal occupational injury. Results During this period, the cost of the 22,197 fatal occupational injuries exceeded $21 billion. The mean and median costs of these fatalities were $960,000 and $944,000 respectively. Total societal costs by NORA sector ranged from a high of $5.8 billion in Services to a low of $530 million in Healthcare and Social Assistance with mean costs ranging from the nearly $800,000 in Agriculture, Forestry, and Fishing to almost $1.1 million in Mining. Discussion The societal costs—total, mean, and median costs—of case and worker characteristics for occupational fatal injuries varied within each NORA sector. Impact on Industry To have the greatest societal impact, these costs can be used to target resources for public and private sector

  1. Is the societal burden of fatal occupational injury different among NORA industry sectors?

    Science.gov (United States)

    Biddle, Elyce Anne

    2013-02-01

    Since the implementation of the Occupational Safety and Health Act, safety and health in the work environment has seen marked improvement. Although these improvements are laudable, workplace hazards continue to plague the American worker. Understanding the economic burden of fatalities by industry sector is important to setting broad occupational safety and health research priorities. Cost estimates provide additional information about how fatal injuries affect society and hence can improve injury prevention program planning, policy analysis, evaluation, and advocacy. This study estimated the total, mean, and median societal costs by worker and case characteristic in 2003-2006 for the industry sectors identified in the National Institute for Occupational Safety and Health National Occupational Research Agenda (NORA). Analyses were conducted with restricted access to the Bureau of Labor Statistics Census of Fatal Occupational Injuries data. These data exclude military personnel, decedents with unknown age or sex, and fatalities occurring in New York City. Societal costs were estimated using the cost-of-illness approach, which combines direct and indirect costs to yield an overall cost of an fatal occupational injury. During this period, the cost of the 22,197 fatal occupational injuries exceeded $21 billion. The mean and median costs of these fatalities were $960,000 and $944,000 respectively. Total societal costs by NORA sector ranged from a high of $5.8 billion in Services to a low of $530 million in Healthcare and Social Assistance with mean costs ranging from the nearly $800,000 in Agriculture, Forestry, and Fishing to almost $1.1 million in Mining. The societal costs-total, mean, and median costs-of case and worker characteristics for occupational fatal injuries varied within each NORA sector. To have the greatest societal impact, these costs can be used to target resources for public and private sector research by industry. Published by Elsevier Ltd.

  2. Drosophila Nora virus capsid proteins differ from those of other picorna-like viruses.

    Science.gov (United States)

    Ekström, Jens-Ola; Habayeb, Mazen S; Srivastava, Vaibhav; Kieselbach, Thomas; Wingsle, Gunnar; Hultmark, Dan

    2011-09-01

    The recently discovered Nora virus from Drosophila melanogaster is a single-stranded RNA virus. Its published genomic sequence encodes a typical picorna-like cassette of replicative enzymes, but no capsid proteins similar to those in other picorna-like viruses. We have now done additional sequencing at the termini of the viral genome, extending it by 455 nucleotides at the 5' end, but no more coding sequence was found. The completeness of the final 12,333-nucleotide sequence was verified by the production of infectious virus from the cloned genome. To identify the capsid proteins, we purified Nora virus particles and analyzed their proteins by mass spectrometry. Our results show that the capsid is built from three major proteins, VP4A, B and C, encoded in the fourth open reading frame of the viral genome. The viral particles also contain traces of a protein from the third open reading frame, VP3. VP4A and B are not closely related to other picorna-like virus capsid proteins in sequence, but may form similar jelly roll folds. VP4C differs from the others and is predicted to have an essentially α-helical conformation. In a related virus, identified from EST database sequences from Nasonia parasitoid wasps, VP4C is encoded in a separate open reading frame, separated from VP4A and B by a frame-shift. This opens a possibility that VP4C is produced in non-equimolar quantities. Altogether, our results suggest that the Nora virus capsid has a different protein organization compared to the order Picornavirales. Copyright © 2011 Elsevier B.V. All rights reserved.

  3. The Transformations of the Central Area of Nora: the Reconstruction of the Houses

    Directory of Open Access Journals (Sweden)

    Elena Belgiovine

    2013-11-01

    Full Text Available La ricostruzione tridimensionale delle abitazioni presenti nel Quartiere Centrale della città di Nora è stata elaborata mediante l’uso del software Revit Architecture ed è stata concepita per mostrare le trasformazioni avvenute nell’area durante le fasi di II-III secolo d.C. e in età tardo antica. I modelli tridimensionali delle singole abitazioni, che si basano sulla documentazione di scavo, sono confluiti in un progetto di ricostruzione dell’intero isolato, in modo da ricrearne l’aspetto volumetrico e rendere immediatamente percepibili i vari aspetti di questo articolato contesto urbano.

  4. Measurement of reactor parameters of the 'Nora' reactor by noise analysis method - power spectral density

    International Nuclear Information System (INIS)

    Jovanovic, S.; Stormark, E.

    1966-01-01

    Measurements of reactor parameters the Nora reactor by Power Spectral Density (PSD) method are described. In case of critical reactor this method was applied for direct measurement of β/l ratio, β is the effective yield of delayed neutrons and l is the neutron lifetime. In case of subcritical reactor values of α+β-ρ/l were measured, ρ is the negative reactivity. Out coming PSD was measured by a filter or by ISAC. PSD was registered by ISAC as well as the auto-correlation function [sr

  5. The Elusive Search for Nora Luca: Tony Gatlif's Adventures in Gypsy Land

    OpenAIRE

    Sylvie Eve Blum-Reid

    2005-01-01

    This essay examines Gypsy filmmaker Tony Gatlif and his 1997 film Gadjo Dilo (The Crazy Foreigner). The film ventures on the icy roads of Romania and casts a young French man in search for Nora Luca’s voice, a woman taped by his musicologist father. The young man is adopted by a Romanian Gypsy community and initiated to Gypsy culture. The film reverts stereotypes associated to Gypsies and questions the place of the white traveler in late 20th century Europe. Questions of otherness and exotici...

  6. DCS Terrain for Greer County, Oklahoma, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Terrain data, as defined in FEMA Guidelines and Specifications, Appendix M: Data Capture Standards, describes the digital topographic data that was used to create...

  7. Inhibition of the NorA efflux pump of Staphylococcus aureus by synthetic riparins.

    Science.gov (United States)

    Costa, L M; de Macedo, E V; Oliveira, F A A; Ferreira, J H L; Gutierrez, S J C; Peláez, W J; Lima, F C A; de Siqueira Júnior, J P; Coutinho, H D M; Kaatz, G W; de Freitas, R M; Barreto, H M

    2016-11-01

    The goal of this study was to increase knowledge about the antimicrobial activity of some synthetic Riparin-derived compounds, alone or in combination with fluoroquinolone antibiotics, against a strain of Staphylococcus aureus resistant to fluoroquinolone by way of overexpression of the NorA efflux pump. Microdilution tests showed that Riparins A and B did not show any significant antibacterial activity against Staph. aureus strains. On the other hand, the intrinsic antibacterial activity increased with increasing lipophilicity of the compounds, in the following order: Riparin-D (MIC 256 μg ml -1 ; Log P 2·95) NorA-overexpressing test strain. Riparin-B, which has two methoxyl groups at the phenethyl moiety, showed the best modulatory effect. Riparin-E is a good anti-staphylococci agent, while Riparin-B functions as a NorA efflux pump inhibitor. Our data suggest the possibility of using Riparin-B in combination with norfloxacin or ciprofloxacin for therapy of infections caused by multi-drug resistant Staph. aureus. © 2016 The Society for Applied Microbiology.

  8. Nora Virus Transmission in "Drosophila Melanogaster": An Investigation to Teach Viral Infection and Prophylaxis to Biology Students

    Science.gov (United States)

    Weatherred, Wayland; Carlson, Darby J.; Carlson, Kimberly A.

    2014-01-01

    Proper hand hygiene accompanied with environmental surface disinfection provides a comprehensive approach to control and prevent respiratory and gastrointestinal illness in schools, hospitals, work environments, and the home. The persistent non-pathogenic Nora virus common in "Drosophila melanogaster" provides a horizontally transmitted…

  9. Successful Treatment of Richter Transformation with Ibrutinib in a Patient with Chronic Lymphocytic Leukemia following Allogeneic Hematopoietic Stem Cell Transplant

    Directory of Open Access Journals (Sweden)

    Samip Master

    2017-06-01

    Full Text Available Patients with chronic lymphocytic leukemia (CLL who progress to Richter transformation (RT have a poor prognosis. Multi-agent chemotherapy regimens do not have good response rates. There are few case reports on the use of ibrutinib in RT. Here, we present a patient who was heavily pretreated for CLL, including allogeneic stem cell transplant, and progressed to RT. She had a mixed response to multi-agent chemotherapy and was started on ibrutinib. She had a complete response for 16 months on single-agent ibrutinib with minimal toxicity.

  10. Novel inhibitory activity of the Staphylococcus aureus NorA efflux pump by a kaempferol rhamnoside isolated from Persea lingue Nees.

    Science.gov (United States)

    Holler, Jes Gitz; Christensen, S Brøgger; Slotved, Hans-Christian; Rasmussen, Hasse B; Gúzman, Alfonso; Olsen, Carl-Erik; Petersen, Bent; Mølgaard, Per

    2012-05-01

    To isolate a plant-derived compound with efflux inhibitory activity towards the NorA transporter of Staphylococcus aureus. Bioassay-guided isolation was used, with inhibition of ethidium bromide efflux via NorA as a guide. Characterization of activity was carried out using MIC determination and potentiation studies of a fluoroquinolone antibiotic in combination with the isolated compound. Everted membrane vesicles of Escherichia coli cells enriched with NorA were prepared to study efflux inhibitory activity in an isolated manner. The ethanolic extract of Persea lingue was subjected to bioassay-guided fractionation and led to the isolation of the known compound kaempferol-3-O-α-L-(2,4-bis-E-p-coumaroyl)rhamnoside (compound 1). Evaluation of the dose-response relationship of compound 1 showed that ethidium bromide efflux was inhibited, with an IC(50) value of 2 μM. The positive control, reserpine, was found to have an IC(50) value of 9 μM. Compound 1 also inhibited NorA in enriched everted membrane vesicles of E. coli. Potentiation studies revealed that compound 1 at 1.56 mg/L synergistically increased the antimicrobial activity of ciprofloxacin 8-fold against a NorA overexpresser, and the synergistic activity was exerted at a fourth of the concentration necessary for reserpine. Compound 1 was not found to exert a synergistic effect on ciprofloxacin against a norA deletion mutant. The 2,3-coumaroyl isomer of compound 1 has been shown previously not to cause acute toxicity in mice at 20 mg/kg/day. Our results show that compound 1 acts through inhibition of the NorA efflux pump. Combination of compound 1 with subinhibitory concentrations of ciprofloxacin renders a wild-type more susceptible and a NorA overexpresser S. aureus susceptible.

  11. Measurements of Void Effects in the Zero-Power Critical Facility NORA; Mesures de l'Effet Cavitaire dans l'Ensemble Critique NORA de Puissance Zero; Izmerenie vliyaniya pustot v kriticheskoj ustanovke nulevoj moshchnosti NORA; DeterminaciOn de los Efectos de CavitaciOn en el Conjunto Critico NORA de Potencia Nula

    Energy Technology Data Exchange (ETDEWEB)

    Bryhn-Ingebrigtsen, K.; Eriksen, V. O.; Schatvet, J.; Ukkestad, A.; Wood, J. I.; Ofjord, K. [Kjeller Research Establishment (Norway)

    1964-02-15

    Reactivity effects of voids in a reactor core is of particular importance in boiling-water reactors. Non-uniform distributions of voids make it desirable to know and understand the spatial dependence of the void reactivity effect. An experimental study of void effects under physically clean conditions has been undertaken in NORA. Shrouds surrounding each individual fuel stringer define annular regions which are voided by introduction of air under pressure. For single-rod experiments reactivity effects are so small that it is preferable to oscillate the void volume periodically and analyse the corresponding modulation of power to obtain reactivity equivalents. Multiple-rod experiments are done statically. The experimental technique is described together with examples of its use to measure single-rod void effects, voided rod interactions, and full-voided core effects. (author) [French] L'effet cavitaire revet une importance particuliere dans les reacteurs a eau bouillante. Etant donne que les cavites ne sont pas uniformement reparties, il est souhaitable de connaitre et de comprendre les variations de l'effet cavitaire dans l'espace. L'etude experimentale de l'effet cavitaire dans un ensemble non empoisonne a ete entreprise dans l'ensemble critique NORA. Dans les regions tubulaires comprises entre les barres de combustible et leurs enveloppes, on cree des cavites par injection d'air comprime. Dans les experiences portant sur une seule barre, l'effet est si faible qu'il vaut mieux faire varier periodiquement le volume cavitaire et analyser la modulation de puissance correspondante pour mesurer la reactivite equivalente. Les experiences sur plusieurs barres sont faites dans des conditions statiques. Les auteurs decrivent la methode experimentale et donnent des exemples de son emploi pour mesurer l'effet cavitaire pour une seule barre, l'interaction de battes autour desquelles on a cree des cavites et l'effet des cavites creees dans tout le coeur. (author) [Spanish] La

  12. Studies on 2-phenylquinoline Staphylococcus aureus NorA efflux pump inhibitors: New insights on the C-6 position.

    Science.gov (United States)

    Felicetti, Tommaso; Cannalire, Rolando; Nizi, Maria Giulia; Tabarrini, Oriana; Massari, Serena; Barreca, Maria Letizia; Manfroni, Giuseppe; Schindler, Bryan D; Cecchetti, Violetta; Kaatz, Glenn W; Sabatini, Stefano

    2018-06-06

    The alarming and rapid spread of antimicrobial resistance among bacteria represents a high risk for global health. Targeting factors involved in resistance to restore the activity of failing antibiotics is a promising strategy to overcome this urgent medical need. Efflux pump inhibitors are able to increase antibiotic concentrations in bacteria, thus they can be considered true antimicrobial resistance breakers. In this work, continuing our studies on inhibitors of the Staphylococcus aureus NorA pump, we designed, synthesized and biologically evaluated novel 2-phenylquinoline derivatives starting from our hits 1 and 2. Two of the synthesized compounds (6 and 7) bearing a C-6 benzyloxy group showed the best NorA inhibition activity, thereby providing an excellent starting point to direct future chemical optimizations. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  13. Chalcone inhibitors of the NorA efflux pump in Staphylococcus aureus whole cells and enriched everted membrane vesicles.

    Science.gov (United States)

    Holler, Jes Gitz; Slotved, Hans-Christian; Mølgaard, Per; Olsen, Carl Erik; Christensen, Søren Brøgger

    2012-07-15

    A library of 117 chalcones was screened for efflux pump inhibitory (EPI) activity against NorA mediated ethidium bromide efflux. Five of the chalcones (5-7, 9, and 10) were active and two chalcones (9 and 10) were equipotent to reserpine with IC(50)-values of 9.0 and 7.7 μM, respectively. Twenty chalcones were subsequently proved to be inhibitors of the NorA efflux pump in everted membrane vesicles. Compounds 5, 7, and 9 synergistically increased the effect of ciprofloxacin on Staphylococcus aureus. Our results suggest that chalcones might be developed into drugs for overcoming multidrug resistance based on efflux transporters of microorganisms. Copyright © 2012 Elsevier Ltd. All rights reserved.

  14. Aminoguanidine hydrazones (AGH's) as modulators of norfloxacin resistance in Staphylococcus aureus that overexpress NorA efflux pump.

    Science.gov (United States)

    Dantas, Natalina; de Aquino, Thiago Mendonça; de Araújo-Júnior, João Xavier; da Silva-Júnior, Edeildo; Gomes, Ednaldo Almeida; Gomes, Antoniel Augusto Severo; Siqueira-Júnior, José Pinto; Mendonça Junior, Francisco Jaime Bezerra

    2018-01-25

    One of the promising fields for improving the effectiveness of antimicrobial agents is their combination with efflux pump inhibitors (EPIs), which besides expanding the use of existing antibiotics. The goal of this research was to evaluate a series of aminoguanidine hydrazones (AGH's, 1-19) as antibacterial agents and NorA efflux pump inhibitors in Staphylococcus aureus strain SA-1199B. Molecular modeling and docking studies were also performed in order to explain at the molecular level the interactions of the compounds with the generated NorA efflux pump model. The MICs of the antibiotic and ethidium bromide were determined by microdilution assay in absence or presence of a subinhibitory concentration of aminoguanidine hydrazones and macrophages viability was determined through MTT assay. Bioinformatic software Swiss-Model and AutoDock 4.2 were used to perform modeling and docking studies, respectively. As results, all AGH's were able to potentiate the action for the antibiotic norfloxacin, causing MIC's reduction of 16-fold and 32-fold to ethidium bromide. In the cell viability test, the concentration of 10 μg/mL showed better results than 90% and the concentration of 1000 μg/mL showed the lowest viability, reaching a maximum of 50% for the analyzed aminoguanidine hydrazones. Molecular docking studies showed that both norfloxacin and derivative 13 were recognized by the same binding site of NorA pump, suggesting a competitive mechanism. The present work demonstrated for the first time that AGH derivatives have potential to be putative inhibitors of NorA efflux pump, showing a promising activity as an antibacterial drug development. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Improved Potency of Indole-Based NorA Efflux Pump Inhibitors: From Serendipity toward Rational Design and Development.

    Science.gov (United States)

    Buonerba, Federica; Lepri, Susan; Goracci, Laura; Schindler, Bryan D; Seo, Susan M; Kaatz, Glenn W; Cruciani, Gabriele

    2017-01-12

    The NorA efflux pump is a potential drug target for reversal of resistance to selected antibacterial agents, and recently we described indole-based inhibitor candidates. Herein we report a second class of inhibitors derived from them but with significant differences in shape and size. In particular, compounds 13 and 14 are very potent inhibitors in that they demonstrated the lowest IC 50 values (2 μM) ever observed among all indole-based compounds we have evaluated.

  16. A New Natural Product Analog of Blasticidin S Reveals Cellular Uptake Facilitated by the NorA Multidrug Transporter.

    Science.gov (United States)

    Davison, Jack R; Lohith, Katheryn M; Wang, Xiaoning; Bobyk, Kostyantyn; Mandadapu, Sivakoteswara R; Lee, Su-Lin; Cencic, Regina; Nelson, Justin; Simpkins, Scott; Frank, Karen M; Pelletier, Jerry; Myers, Chad L; Piotrowski, Jeff; Smith, Harold E; Bewley, Carole A

    2017-06-01

    The permeation of antibiotics through bacterial membranes to their target site is a crucial determinant of drug activity but in many cases remains poorly understood. During screening efforts to discover new broad-spectrum antibiotic compounds from marine sponge samples, we identified a new analog of the peptidyl nucleoside antibiotic blasticidin S that exhibited up to 16-fold-improved potency against a range of laboratory and clinical bacterial strains which we named P10. Whole-genome sequencing of laboratory-evolved strains of Staphylococcus aureus resistant to blasticidin S and P10, combined with genome-wide assessment of the fitness of barcoded Escherichia coli knockout strains in the presence of the antibiotics, revealed that restriction of cellular access was a key feature in the development of resistance to this class of drug. In particular, the gene encoding the well-characterized multidrug efflux pump NorA was found to be mutated in 69% of all S. aureus isolates resistant to blasticidin S or P10. Unexpectedly, resistance was associated with inactivation of norA , suggesting that the NorA transporter facilitates cellular entry of peptidyl nucleosides in addition to its known role in the efflux of diverse compounds, including fluoroquinolone antibiotics. Copyright © 2017 American Society for Microbiology.

  17. Novel structural analogues of piperine as inhibitors of the NorA efflux pump of Staphylococcus aureus.

    Science.gov (United States)

    Kumar, Ashwani; Khan, Inshad Ali; Koul, Surrinder; Koul, Jawahir Lal; Taneja, Subhash Chandra; Ali, Intzar; Ali, Furqan; Sharma, Sandeep; Mirza, Zahid Mehmood; Kumar, Manoj; Sangwan, Pyare Lal; Gupta, Pankaj; Thota, Niranjan; Qazi, Ghulam Nabi

    2008-06-01

    Evaluation of novel synthetic analogues of piperine as inhibitors of multidrug efflux pump NorA of Staphylococcus aureus. A library of piperine-derived compounds was evaluated for their potential to inhibit ethidium bromide efflux in NorA-overexpressing S. aureus SA 1199B. The active compounds were then individually combined with ciprofloxacin to study the potentiation of ciprofloxacin's activity. Based on the efflux inhibition assay, a library of 200 compounds was screened. Three piperine analogues, namely SK-20, SK-56 and SK-29, were found to be the most potent inhibitors of the NorA efflux pump. These inhibitors acted in a synergistic manner with ciprofloxacin, by substantially increasing its activity against both NorA-overexpressing and wild-type S. aureus isolates. These analogues were 2- to 4-fold more potent than piperine at a significantly lower minimal effective concentration. Furthermore, these inhibitors also significantly suppressed the in vitro emergence of ciprofloxacin-resistant S. aureus. A newly identified class of compounds derived from a natural amide, piperine, is more potent than the parent molecule in potentiating the activity of ciprofloxacin through the inhibition of the NorA efflux pump. These molecules may prove useful in augmenting the antibacterial activities of fluoroquinolones in a clinical setting.

  18. Phosphorylation of MgrA and its effect on expression of the NorA and NorB efflux pumps of Staphylococcus aureus.

    Science.gov (United States)

    Truong-Bolduc, Que Chi; Hooper, David C

    2010-05-01

    MgrA is a global regulator in Staphylococcus aureus that controls the expression of diverse genes encoding virulence factors and multidrug resistance (MDR) efflux transporters. We identified pknB, which encodes the (Ser/Thr) kinase PknB, in the S. aureus genome. PknB was able to autophosphorylate as well as phosphorylate purified MgrA. We demonstrated that rsbU, which encodes a Ser/Thr phosphatase and is involved in the activation of the SigB regulon, was able to dephosphorylate MgrA-P but not PknB-P. Serines 110 and 113 of MgrA were found to be phosphorylated, and Ala substitutions at these positions resulted in reductions in the level of phosphorylation of MgrA. DNA gel shift binding assays using norA and norB promoters showed that MgrA-P was able to bind the norB promoter but not the norA promoter, a pattern which was the reverse of that for unphosphorylated MgrA. The double mutant MgrA(S110A-S113A) bound to the norA promoter but not the norB promoter. The double mutant led to a 2-fold decrease in norA transcripts and a 2-fold decrease in the MICs of norfloxacin and ciprofloxacin in strain RN6390. Thus, phosphorylation of MgrA results in loss of binding to the norA promoter, but with a gain of the ability to bind the norB promoter. Loss of the ability to phosphorylate MgrA by Ala substitution resulted in increased repression of norA expression and in reductions in susceptibilities to NorA substrates.

  19. The 95ΔG mutation in the 5'untranslated region of the norA gene increases efflux activity in Staphylococcus epidermidis isolates.

    Science.gov (United States)

    García-Gómez, Elizabeth; Jaso-Vera, Marcos E; Juárez-Verdayes, Marco A; Alcántar-Curiel, María D; Zenteno, Juan C; Betanzos-Cabrera, Gabriel; Peralta, Humberto; Rodríguez-Martínez, Sandra; Cancino-Díaz, Mario E; Jan-Roblero, Janet; Cancino-Diaz, Juan C

    2017-02-01

    In the Staphylococcus aureus ATCC25923 strain, the flqB mutation in the 5'untranslated region (5'UTR) of the norA gene causes increased norA mRNA expression and high efflux activity (HEA). The involvement of the norA gene 5'UTR in HEA has not been explored in S. epidermidis; therefore, we examined the function of this region in S. epidermidis clinical isolates. The selection of isolates with HEA was performed based on ethidium bromide (EtBr) MIC values and efflux efficiency (EF) using the semi-automated fluorometric method. The function of the 5'UTR was studied by quantifying the levels of norA expression (RT-qPCR) and by identifying 5'UTR mutations by sequence analysis. Only 10 isolates from a total of 165 (6.1%) had HEA (EtBr MIC = 300 μg/ml and EF ranged from 48.4 to 97.2%). Eight of 10 isolates with HEA had the 5'UTR 95 Δ G mutation. Isolates carrying the 95 Δ G mutation had higher levels of norA expression compared with those that did not. To corroborate that the 95 Δ G mutation is involved in HEA, a strain adapted to EtBr was obtained in vitro. This strain also presented the 95 Δ G mutation and had a high level of norA expression and EF, indicating that the 95 Δ G mutation is important for the HEA phenotype. The 95 Δ G mutation produces a different structure in the Shine-Dalgarno region, which may promote better translation of norA mRNA. To our knowledge, this is the first report to demonstrate the participation of the 5'UTR 95 Δ G mutation of the norA gene in the HEA phenotype of S. epidermidis isolates. Here, we propose that the efflux of EtBr is caused by an increment in the transcription and/or translation of the norA gene. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Evaluation of expression of NorA efflux pump in ciprofloxacin resistant Staphylococcus aureus against hexahydroquinoline derivative by real-time PCR.

    Science.gov (United States)

    Pourmand, Mohammad Reza; Yousefi, Masoud; Salami, Seyed Alireza; Amini, Mohsen

    2014-01-01

    Staphylococcus aureus causes a wide variety of infections worldwide. Methicillin-resistant S. aureus is one of most common causes of nosocomial and community acquired infections. The fluoroquinolones are an important class of antibiotics that used to treat infections caused by S. aureus. Today, a significant increase in the rate of ciprofloxacin resistance in methicillin-resistant S. aureus strains is concerning. The norA efflux pump is considered as contributors to antibiotic resistance. Here, we aimed to evaluate the expression of norA efflux pump in the presence of hexahydroquinoline derivative in methicillin and ciprofloxacin resistant S. aureus. We were determined minimum inhibitory concentration of ciprofloxacin and hexahydroquinoline derivative and their combination by broth microdilution method against ciprofloxacin resistant S. aureus. The expression of the norA efflux pump gene was evaluated by quantitative Real-time PCR. This study showed that minimum inhibitory concentrations of ciprofloxacin in the presence of hexahydroquinoline derivative in comparison to ciprofloxacin were decreased. Quantitative Real-time PCR identified the increased expression of norA efflux pump gene in methicillin and ciprofloxacin resistant S. aureus strain. The increased expression of norA efflux pump gene may have resulted in the effort of S. aureus to survive. The results showed that the hexahydroquinoline derivative enhanced the antibacterial effect of ciprofloxacin against methicillin and ciprofloxacin resistant S. aureus. Therefore, the derivatives may be used as inhibitors of antibiotic resistance for combination therapy.

  1. Evaluation report of the Nordic emergency exercise Nora - January 14, 1993

    International Nuclear Information System (INIS)

    Salo, A.; Singer, K.; Aakesson, T.; Valfells, A.; Backe, S.; Kallhagen, B.

    1993-01-01

    Nordic countries are signatories to the Convention on Early Notification of a Nuclear Accident and to the Convention on Assistance in Case of a Nuclear Accident or Radiological Emergency. In addition to these international conventions the states, except Iceland, have bilateral agreements on early notification and exchange of information with each other and with neighbouring countries. The bilateral agreements also require notification if levels of radionuclide contamination are observed which prompt information to the public or activation of the emergency organization or part of it. The main objective of the exercise NORA was to test and harmonize the overall decision making in the responsible Nordic approach to the emergency response, to improve co-operation in assessing rumour-, threat- and accident-situations, to improve co-operation in making decisions on intervention levels and on interventions in a Nordic perspective, to enhance harmony in information policy concerning information to the public in order to avoid ''double messages'', to improve information exchange between the Nordic countries and internationally. The objectives of the exercise were considered to have been met satisfactorily and the exercise made a valuable contribution to further develop the Nordic co-operation. (EG)

  2. NorA efflux pump inhibitory activity of coumarins from Mesua ferrea.

    Science.gov (United States)

    Roy, Somendu K; Kumari, Neela; Pahwa, Sonika; Agrahari, Udai C; Bhutani, Kamlesh K; Jachak, Sanjay M; Nandanwar, Hemraj

    2013-10-01

    The purpose of this investigation was to study the modulator and efflux pump inhibitor activity of coumarins isolated from Mesua ferrea against clinical strains as well as NorA-over expressed strain of Staphylococcus aureus 1199B. Seven coumarins were tested for modulator activity using ethidium bromide (EtBr) as a substrate. Compounds 1, 4-7 modulated the MIC of EtBr by ≥ 2 fold against wild type clinical strains of S. aureus 1199 and S. aureus 1199B, whereas compounds 4-7 modulated the MIC of EtBr by ≥ 16 fold against MRSA 831. Compounds 1, 4-7 also reduced the MIC of norfloxacin by ≥ 8 fold against S. aureus 1199B, and 4-6 reduced the MIC of norfloxacin by ≥ 8 fold against MRSA 831 at half of their MICs. Inhibition of EtBr efflux by NorA-overproducing S. aureus 1199B and MRSA 831 confirmed the role of compounds 4-6 as NorA efflux pump inhibitors (EPI). Dose-dependent activity at sub-inhibitory concentration (6.25 μg/mL) suggested that compounds 4 and 5 are promising EPI compared to verapamil against 1199B and MRSA 831 strains. © 2013.

  3. The Elusive Search for Nora Luca: Tony Gatlif's Adventures in Gypsy Land

    Directory of Open Access Journals (Sweden)

    Sylvie Eve Blum-Reid

    2005-08-01

    Full Text Available This essay examines Gypsy filmmaker Tony Gatlif and his 1997 film Gadjo Dilo (The Crazy Foreigner. The film ventures on the icy roads of Romania and casts a young French man in search for Nora Luca’s voice, a woman taped by his musicologist father. The young man is adopted by a Romanian Gypsy community and initiated to Gypsy culture. The film reverts stereotypes associated to Gypsies and questions the place of the white traveler in late 20th century Europe. Questions of otherness and exoticism are raised amidst the Western urge to preserve and collect other cultures. The essay is informed by current Gypsies studies on Gypsy law that locate the interaction Rom cultures have had with non-Rom cultures. The film may be seen as a trilingual road movie set in Eastern Europe, yet Gatlif, a man for whom “the road is his country” stretches the limits of the genre, usually situated in the vast open spaces of North America. Gender is important in the analysis of the film as Rom women encountered act as mediators between two different cultures and spaces. Last, the essay reconsiders the place of Tony Gatlif, a now recognized French filmmaker, a spokesperson for Gypsies who delocalised the story and traveled to Eastern Europe. An analysis of the reception of the film adds to the discussion of a filmmaker, born in Algeria, of Berber and Andalusian descent.

  4. Amino acid amides of piperic acid (PA) and 4-ethylpiperic acid (EPA) as NorA efflux pump inhibitors of Staphylococcus aureus.

    Science.gov (United States)

    Wani, Naiem Ahmad; Singh, Samsher; Farooq, Saleem; Shankar, Sudha; Koul, Surrinder; Khan, Inshad Ali; Rai, Rajkishor

    2016-09-01

    A total of eighteen piperic acid (PA) and 4-ethylpiperic acid (EPA) amides (C1-C18) with α-, β- and γ-amino acids were synthesized, characterized and evaluated for their efflux pump inhibitory activity against ciprofloxacin resistant Staphylococcus aureus. The amides were screened against NorA overexpressing S. aureus SA-1199B and wild type S. aureus SA-1199 using ethidium bromide as NorA efflux pump substrate. EPI C6 was found to be most potent and reduced the MIC of ciprofloxacin by 16 fold followed by C18 which showed 4 fold reduction of MIC. Ethidium bromide efflux inhibition and accumulation assay proved these compounds as NorA inhibitors. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. The "racemic approach" in the evaluation of the enantiomeric NorA efflux pump inhibition activity of 2-phenylquinoline derivatives.

    Science.gov (United States)

    Carotti, Andrea; Ianni, Federica; Sabatini, Stefano; Di Michele, Alessandro; Sardella, Roccaldo; Kaatz, Glenn W; Lindner, Wolfgang; Cecchetti, Violetta; Natalini, Benedetto

    2016-09-10

    Among the mechanisms adopted by bacteria, efflux pumps (EPs) have been recognized as being significantly involved in contributing to resistance to commonly used antibacterial agents. However, little is known about their three-dimensional structures or the steric requirements for their inhibition. Lack of such knowledge includes NorA, one of the most studied Staphylococcus aureus EPs. In the present study, the use of two commercialized Cinchona alkaloid-based zwitterionic chiral stationary phases allowed the enantioseparation of four 2-((2-(4-propoxyphenyl)quinolin-4-yl)oxy)alkylamines 1-4 previously found to be potent S. aureus NorA efflux pump inhibitors when tested as racemates. In the identified optimal polar-ionic conditions (MeOH/THF/H2O-49/49/2 (v/v/v)+25mM formic acid, 12.5mM diethylamine), repeated consecutive injections of 1 allowed the isolation of sufficient amount of its enantiomers (2.6mg and 2.8mg, for (R)-1 and (S)-1, respectively) and then to evaluate their ability to inhibit the S. aureus NorA efflux pump. The biological evaluation highlighted the main contribution of the (R)-1 enantiomer to both the EtBr efflux inhibition and synergistic effect with against SA-1199B (norA+/A116E GrlA) respect to the racemate activity. The comparison between the experimental electronic circular dichroism and the time-dependent density functional theory calculations spectra of the two isolated enantiomeric fractions allowed for all compounds a clear and easy assignment of the enantiomeric elution order. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. Investigation of noble metal deposition behaviour in boiling water reactors. The NORA project

    International Nuclear Information System (INIS)

    Ritter, Stefan; Karastoyanov, Vasil; Abolhassani-Dadras, Sousan; Guenther-Leopold, Ines; Kivel, Niko

    2010-01-01

    NobleChem trademark is a technology developed by General Electric to reduce stress corrosion cracking (SCC) in reactor internals and recirculation pipes of boiling water reactors (BWRs) while preventing the negative side effects of classic hydrogen water chemistry. Noble metals (Pt, Rh) acting as electrocatalysts for the recombination of O 2 and H 2 O 2 with H 2 to H 2 O and thus reducing the corrosion potential more efficiently are injected into the feedwater during reactor shutdown (classic method) or on-line during power operation. They are claimed to deposit as very fine metallic particles on all water-wetted surfaces, including the most critical regions inside existing cracks, and to stay electrocatalytic over long periods of time. The effectiveness of this technology in plants still remains to be demonstrated. Based on highly credible laboratory experiments down to the sub-μg . kg -1 Pt concentration range, SCC mitigation may be expected, provided that a stoichiometric excess of H 2 and a sufficient surface coverage with very fine Pt particles exist simultaneously at the critical locations [1]. Very little is known about the deposition and (re-)distribution behaviour of the Pt in the reactor. For the validation of this technique the research project NORA (noble metal deposition behaviour in BWRs) has been started at the Paul Scherrer Institute (PSI) with two main objectives: (i) to gain phenomenological insights and a better basic understanding of the Pt distribution and deposition behaviour in BWRs; (ii) to develop and qualify a non-destructive technique to characterise the size and distribution of the Pt particles and the local concentration of Pt on reactor components. This paper presents the objectives of the project, the planned work and a brief description of the status of the project. (orig.)

  7. Investigation of the noble metal deposition behaviour in boiling water reactors - the NORA project

    International Nuclear Information System (INIS)

    Ritter, S.; Karastoyanov, V.; Abolhassani-Dadras, S.; Guenther-Leopold, I.; Kivel, N.

    2010-01-01

    NobleChem™ is a technology developed by General Electric to reduce stress corrosion cracking (SCC) in reactor internals and recirculation pipes of boiling water reactors (BWRs) while preventing the negative side effects of classical hydrogen water chemistry. Noble metals (Pt, Rh) acting as electrocatalysts for the recombination of O 2 and H 2 O 2 with H 2 to H 2 O and thus reducing the corrosion potential more efficiently are injected into the feed water during reactor shut-down (classical method) or on-line during power operation. They are claimed to deposit as very fine metallic particles on all water-wetted surfaces including the most critical regions inside existing cracks and to stay electrocatalytic over long periods of time. The effectiveness of this technology in plants remains still to be demonstrated. Based on highly credible laboratory experiments down to the sub-ppb Pt concentration range, SCC mitigation may be expected, provided that a stoichiometric excess of H 2 and a sufficient surface coverage with very fine Pt particles exist simultaneously at the critical locations. Very little is known about the deposition and (re-)distribution behaviour of the Pt in the reactor. For the validation of this technique the research project NORA (noble metal deposition behaviour in BWRs) has been started at PSI with two main objectives: (i) to gain phenomenological insights and a better basic understanding of the Pt distribution and deposition behaviour in BWRs; (ii) to develop and qualify a non-destructive technique to characterise the size and distribution of the Pt particles and its local concentration on reactor components. This paper presents the objectives of the project, the planned work and a brief description of the status of the project. (author)

  8. The Gutenberg-Richter b value: Precursors to the M9-class 2011 Tohoku and 2004 Sumatra quakes

    Science.gov (United States)

    Nanjo, K.; Hirata, N.; Obara, K.; Kasahara, K.

    2011-12-01

    The Gutenberg-Richter frequency-magnitude law of earthquakes is long established in seismology. This law states that the cumulative number (N) of earthquakes with magnitudes larger than or equal to M is well approximated by the relation: logN=A-bM, where the constant A is a measure of the fertility of earthquakes and the other constant b characterizes their size distribution. The b value is typically close to 1, but spatial and temporal changes in b are also known to reflect the state of stress in the Earth's crust and to be associated with asperities and frictional properties. Laboratory experiments predicted systematic decrease in b toward the end of a seismic cycle. In this context, we investigated b values over an extensive range of space and time for the 11 March 2011 Mw9.0 Tohoku earthquake and 26 December 2004 Mw9.1 Sumatra earthquake. In this presentation, we show that significant decade-scale decrease in b is a common precursor to both mega-quakes around their hypocenters. This is the first time to confirm predicted change in b from laboratory experiment for M9-class quakes. We propose that b value can be an important indicator to infer a next great earthquake, showing the great potential for a future large quake off the Pacific coast of Hokkaido district. The results demonstrate that the use of b helps to improve probabilistic seismic hazard assessment. Along this line, we present a progress report on b value analysis conducted for greater Tokyo and discuss future directions of this research toward moving to a new generation of the capital's earthquake hazards. This is supported by the Special Project for Earthquake Disaster Mitigation in Tokyo Metropolitan Area.

  9. Richter transformation driven by Epstein-Barr virus reactivation during therapy-related immunosuppression in chronic lymphocytic leukaemia.

    Science.gov (United States)

    García-Barchino, Maria J; Sarasquete, Maria E; Panizo, Carlos; Morscio, Julie; Martinez, Antonio; Alcoceba, Miguel; Fresquet, Vicente; Gonzalez-Farre, Blanca; Paiva, Bruno; Young, Ken H; Robles, Eloy F; Roa, Sergio; Celay, Jon; Larrayoz, Marta; Rossi, Davide; Gaidano, Gianluca; Montes-Moreno, Santiago; Piris, Miguel A; Balanzategui, Ana; Jimenez, Cristina; Rodriguez, Idoia; Calasanz, Maria J; Larrayoz, Maria J; Segura, Victor; Garcia-Muñoz, Ricardo; Rabasa, Maria P; Yi, Shuhua; Li, Jianyong; Zhang, Mingzhi; Xu-Monette, Zijun Y; Puig-Moron, Noemi; Orfao, Alberto; Böttcher, Sebastian; Hernandez-Rivas, Jesus M; Miguel, Jesus San; Prosper, Felipe; Tousseyn, Thomas; Sagaert, Xavier; Gonzalez, Marcos; Martinez-Climent, Jose A

    2018-05-01

    The increased risk of Richter transformation (RT) in patients with chronic lymphocytic leukaemia (CLL) due to Epstein-Barr virus (EBV) reactivation during immunosuppressive therapy with fludarabine other targeted agents remains controversial. Among 31 RT cases classified as diffuse large B-cell lymphoma (DLBCL), seven (23%) showed EBV expression. In contrast to EBV - tumours, EBV + DLBCLs derived predominantly from IGVH-hypermutated CLL, and they also showed CLL-unrelated IGVH sequences more frequently. Intriguingly, despite having different cellular origins, clonally related and unrelated EBV + DLBCLs shared a previous history of immunosuppressive chemo-immunotherapy, a non-germinal centre DLBCL phenotype, EBV latency programme type II or III, and very short survival. These data suggested that EBV reactivation during therapy-related immunosuppression can transform either CLL cells or non-tumoural B lymphocytes into EBV + DLBCL. To investigate this hypothesis, xenogeneic transplantation of blood cells from 31 patients with CLL and monoclonal B-cell lymphocytosis (MBL) was performed in Rag2 -/- IL2γc -/- mice. Remarkably, the recipients' impaired immunosurveillance favoured the spontaneous outgrowth of EBV + B-cell clones from 95% of CLL and 64% of MBL patients samples, but not from healthy donors. Eventually, these cells generated monoclonal tumours (mostly CLL-unrelated but also CLL-related), recapitulating the principal features of EBV + DLBCL in patients. Accordingly, clonally related and unrelated EBV + DLBCL xenografts showed indistinguishable cellular, virological and molecular features, and synergistically responded to combined inhibition of EBV replication with ganciclovir and B-cell receptor signalling with ibrutinib in vivo. Our study underscores the risk of RT driven by EBV in CLL patients receiving immunosuppressive therapies, and provides the scientific rationale for testing ganciclovir and ibrutinib in EBV + DLBCL. Copyright © 2018 Pathological

  10. C2 Arylated Benzo[b]thiophene Derivatives as Staphylococcus aureus NorA Efflux Pump Inhibitors.

    Science.gov (United States)

    Liger, François; Bouhours, Pascale; Ganem-Elbaz, Carine; Jolivalt, Claude; Pellet-Rostaing, Stéphane; Popowycz, Florence; Paris, Jean-Marc; Lemaire, Marc

    2016-02-04

    An innovative and straightforward synthesis of second-generation 2-arylbenzo[b]thiophenes as structural analogues of INF55 and the first generation of our laboratory-made molecules was developed. The synthesis of C2-arylated benzo[b]thiophene derivatives was achieved through a method involving direct arylation, followed by simple structural modifications. Among the 34 compounds tested, two of them were potent NorA pump inhibitors, which led to a 16-fold decrease in the ciprofloxacin minimum inhibitory concentration (MIC) against the SA-1199B strain at concentrations of 0.25 and 0.5 μg mL(-1) (1 and 1.5 μm, respectively). This is a promising result relative to that obtained for reserpine (MIC=20 μg mL(-1)), a reference compound amongst NorA pump inhibitors. These molecules thus represent promising candidates to be used in combination with ciprofloxacin against fluoroquinolone-resistant strains. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. First identification of boronic species as novel potential inhibitors of the Staphylococcus aureus NorA efflux pump.

    Science.gov (United States)

    Fontaine, Fanny; Hequet, Arnaud; Voisin-Chiret, Anne-Sophie; Bouillon, Alexandre; Lesnard, Aurélien; Cresteil, Thierry; Jolivalt, Claude; Rault, Sylvain

    2014-03-27

    Overexpression of efflux pumps is an important mechanism of bacterial resistance that results in the extrusion of antimicrobial agents outside the bacterial cell. Inhibition of such pumps appears to be a promising strategy that could restore the potency of existing antibiotics. The NorA efflux pump of Staphylococcus aureus confers resistance to a wide range of unrelated substrates, such as hydrophilic fluoroquinolones, leading to a multidrug-resistance phenotype. In this work, approximately 150 heterocyclic boronic species were evaluated for their activity against susceptible and resistant strains of S. aureus. Twenty-four hit compounds, although inactive when tested alone, were found to potentiate ciprofloxacin activity by a 4-fold increase at concentrations ranging from 0.5 to 8 μg/mL against S. aureus 1199B, which overexpresses NorA. Boron-free analogues showed no biological activity, thus revealing that the boron atom is crucial for biological activity. This work describes the first reported efflux pump inhibitory activity of boronic acid derivatives.

  12. Machine learning-, rule- and pharmacophore-based classification on the inhibition of P-glycoprotein and NorA.

    Science.gov (United States)

    Ngo, T-D; Tran, T-D; Le, M-T; Thai, K-M

    2016-09-01

    The efflux pumps P-glycoprotein (P-gp) in humans and NorA in Staphylococcus aureus are of great interest for medicinal chemists because of their important roles in multidrug resistance (MDR). The high polyspecificity as well as the unavailability of high-resolution X-ray crystal structures of these transmembrane proteins lead us to combining ligand-based approaches, which in the case of this study were machine learning, perceptual mapping and pharmacophore modelling. For P-gp inhibitory activity, individual models were developed using different machine learning algorithms and subsequently combined into an ensemble model which showed a good discrimination between inhibitors and noninhibitors (acctrain-diverse = 84%; accinternal-test = 92% and accexternal-test = 100%). For ligand promiscuity between P-gp and NorA, perceptual maps and pharmacophore models were generated for the detection of rules and features. Based on these in silico tools, hit compounds for reversing MDR were discovered from the in-house and DrugBank databases through virtual screening in an attempt to restore drug sensitivity in cancer cells and bacteria.

  13. Patterns of practice of regional nodal irradiation in breast cancer: results of the European Organization for Research and Treatment of Cancer (EORTC) NOdal Radiotherapy (NORA) survey

    NARCIS (Netherlands)

    Belkacemi, Y.; Kaidar-Person, O.; Poortmans, P.; Ozsahin, M.; Valli, M.-C.; Russell, N.; Kunkler, I.; Hermans, J.; Kuten, A.; van Tienhoven, G.; Westenberg, H.

    2015-01-01

    Predicting outcome of breast cancer (BC) patients based on sentinel lymph node (SLN) status without axillary lymph node dissection (ALND) is an area of uncertainty. It influences the decision-making for regional nodal irradiation (RNI). The aim of the NORA (NOdal RAdiotherapy) survey was to examine

  14. The evolution of the Gutenberg-Richter, b-value, throughout periodic and aperiodic stick-slip cycles

    Science.gov (United States)

    Bolton, D. C.; Riviere, J.; Marone, C.; Johnson, P. A.

    2017-12-01

    The Gutenberg-Richter earthquake size statistic, b value, is a useful proxy for documenting the state of stress on a fault and understanding precursory phenomena preceding dynamic failure. It has been shown that the b value varies systematically as a function of position within the seismic cycle. Frictional studies on intact rock samples with saw-cut faults have shown that b value decreases continuously preceding failure. For intact rock samples, the spatiotemporal changes in b value are thought to be related to the evolution of asperities and micro-cracks. However, few studies have shown how b value evolves spatially and temporally for fault zones containing gouge and wear materials. We hypothesize that the micromechanical mechanisms acting within fault gouge, such as creation and destruction of force chains, grain rolling, sliding, jamming and fracturing play an important role in the evolution of b value and that they may have distinct signatures during periodic and aperiodic cycles of stick-slip frictional motion. We report results from experiments conducted on simulated fault gouge using a biaxial deformation apparatus in a double-direct shear configuration. Acoustic emissions (AEs) are recorded at 4 MHz from 36 P-polarized piezoelectric transducers, which are embedded in steel blocks located adjacent to the fault zone. We compute the frequency-magnitude distribution of detected AEs using a moving window in events where each window is overlapped by 75%. We report on the evolution of b value as a function of normal stress and gouge layer thickness. For periodic slip events, b value reaches a maximum value immediately after a slip event and decreases continuously until the next failure. Aperiodic slip events show similar trends in b-value initially, however unlike periodic slip events, b value reaches a steady state value before failure occurs. In addition, for periodic slip events the magnitude of the change in b value scales inversely with gouge layer thickness

  15. Tomographic and analog 3-D simulations using NORA. [Non-Overlapping Redundant Image Array formed by multiple pinholes

    Science.gov (United States)

    Yin, L. I.; Trombka, J. I.; Bielefeld, M. J.; Seltzer, S. M.

    1984-01-01

    The results of two computer simulations demonstrate the feasibility of using the nonoverlapping redundant array (NORA) to form three-dimensional images of objects with X-rays. Pinholes admit the X-rays to nonoverlapping points on a detector. The object is reconstructed in the analog mode by optical correlation and in the digital mode by tomographic computations. Trials were run with a stick-figure pyramid and extended objects with out-of-focus backgrounds. Substitution of spherical optical lenses for the pinholes increased the light transmission sufficiently that objects could be easily viewed in a dark room. Out-of-focus aberrations in tomographic reconstruction could be eliminated using Chang's (1976) algorithm.

  16. Testing of a De Nora polymer electrolyte fuel cell stack of 1 kW for naval applications

    Science.gov (United States)

    Schmal, D.; Kluiters, C. E.; Barendregt, I. P.

    In a previous study calculations were carried out for a navy frigate with respect to the energy consumption of a propulsion/electricity generation system based on fuel cells. The fuel consumption for the 'all-fuel cell' ship was compared with the consumption of the current propulsion/electricity generation system based on gas turbines and diesel engines; it showed potential energy savings of a fuel cell based system amounting from 25 to 30%. On the basis of these results and taking into account various military aspects it was decided to start tests with a polymer electrolyte fuel cell (PEFC) stack. For this purpose a De Nora 1 kW PEFC was chosen. Results of the first tests after installation are satisfying.

  17. Magnetic spectra and Richter aftereffect relaxation in Ce{sub x}Y{sub 3−x}Fe{sub 5}O{sub 12} ferrites

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Fu; Wang, Xian; Feng, Zekun, E-mail: fengzekun@mail.hust.edu.cn [School of Optical and Electric Information, Huazhong University of Science and Technology, Wuhan, 430074 (China); Chen, Yajie; Harris, Vincent G. [Center for Microwave Magnetic Materials and Integrated Circuits, and Department of Electrical and Computer Engineering, Northeastern University, Boston, MA 02115 (United States)

    2016-05-15

    The static and dynamic magnetic properties of cerium (Ce) doped yttrium iron garnet Ce{sub x}Y{sub 3−x}Fe{sub 5}O{sub 12} (x=0, 0.05, 0.1, 0.15, 0.2) ferrites (YIG) have been reported in this work. The ferrites were fabricated by the traditional solid-state reaction method. All ferrite samples reveal pure garnet structure identified by x-ray diffraction (XRD). The substitution of cerium not only enhances the saturation magnetization of the samples, but also regulates the magnetocrystalline anisotropy constant K{sub 1}. Obvious differences in permeability spectra over a frequency of 1 MHz - 1 GHz can be observed. It is verified that the permeability dispersion and magnetic losses of Ce-doped YIG ferrite contain the contribution of Richter aftereffect relaxation due to the existence of Fe{sup 2+} ions. The fitting results of the permeability spectra applied three-mechanism model is in good agreement with experimental data, which successfully explains the mechanisms of magnetic losses observed at 1 MHz to 1 GHz for Ce-doped YIG ferrite. In addition, the frequency shift of Richter aftereffect has also been discussed.

  18. The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'

    International Nuclear Information System (INIS)

    1961-01-01

    The text of the Supply Agreement between the Agency and the Governments of Norway and of the United States of America, and the text of the related Project Agreement between the Agency and the Government of Norway concerning an Agency project for cooperation in carrying out a joint program of research in reactor physics with the zero power reactor 'NORA', are reproduced in this document for the information of all Members of the Agency

  19. The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1961-06-22

    The text of the Supply Agreement between the Agency and the Governments of Norway and of the United States of America, and the text of the related Project Agreement between the Agency and the Government of Norway concerning an Agency project for cooperation in carrying out a joint program of research in reactor physics with the zero power reactor 'NORA', are reproduced in this document for the information of all Members of the Agency.

  20. Searching for Novel Inhibitors of the S. aureus NorA Efflux Pump: Synthesis and Biological Evaluation of the 3-Phenyl-1,4-benzothiazine Analogues.

    Science.gov (United States)

    Felicetti, Tommaso; Cannalire, Rolando; Burali, Maria Sole; Massari, Serena; Manfroni, Giuseppe; Barreca, Maria Letizia; Tabarrini, Oriana; Schindler, Bryan D; Sabatini, Stefano; Kaatz, Glenn W; Cecchetti, Violetta

    2017-08-22

    Bacterial resistance to antimicrobial agents has become an increasingly serious health problem in recent years. Among the strategies by which resistance can be achieved, overexpression of efflux pumps such as NorA of Staphylococcus aureus leads to a sub-lethal concentration of the antibacterial agent at the active site that in turn may predispose the organism to the development of high-level target-based resistance. With an aim to improve both the chemical stability and potency of our previously reported 3-phenyl-1,4-benzothiazine NorA inhibitors, we replaced the benzothiazine core with different nuclei. None of the new synthesized compounds showed any appreciable intrinsic antibacterial activity, and, in particular, 2-(3,4-dimethoxyphenyl)quinoline (6 c) was able to decrease, in a concentration-dependent manner, the ciprofloxacin MIC against the norA-overexpressing strains S. aureus SA-K2378 (norA++) and SA-1199B (norA+/A116E GrlA). © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. From phenothiazine to 3-phenyl-1,4-benzothiazine derivatives as inhibitors of the Staphylococcus aureus NorA multidrug efflux pump.

    Science.gov (United States)

    Sabatini, Stefano; Kaatz, Glenn W; Rossolini, Gian Maria; Brandini, David; Fravolini, Arnaldo

    2008-07-24

    Overexpression of efflux pumps is an important mechanism by which bacteria evade effects of substrate antimicrobial agents and inhibition of such pumps is a promising strategy to circumvent this resistance mechanism. NorA is a Staphylococcus aureus multidrug efflux pump, the activity of which confers decreased susceptibility to many structurally unrelated agents, including fluoroquinolones, resulting in a multidrug resistant (MDR) phenotype. In this work, a series of 1,4-benzothiazine derivatives were designed and synthesized as a minimized structural template of phenothiazine MDR efflux pump inhibitors (EPIs) in an effort to identify more potent S. aureus NorA EPIs. Almost all derivatives evaluated showed good activity in combination with ciprofloxacin against S. aureus ATCC 25923; some were capable of completely restoring ciprofloxacin activity in a norA-overexpressing strain (SA-K2378). Compounds 6k and 7j displayed good activity against SA-1199B, a strain that also overexpresses norA, in an ethidium bromide (EtBr) efflux inhibition assay.

  2. Non-antibiotic agent ginsenoside 20(S)-Rh2 enhanced the antibacterial effects of ciprofloxacin in vitro and in vivo as a potential NorA inhibitor.

    Science.gov (United States)

    Zhang, Jingwei; Sun, Yuan; Wang, Yaoyao; Lu, Meng; He, Jichao; Liu, Jiali; Chen, Qianying; Zhang, Xiaoxuan; Zhou, Fang; Wang, Guangji; Sun, Xianqiang

    2014-10-05

    The aim of this study is to explore the potential enhancing effect of ginsenoside 20(S)-Rh2 (Rh2) towards ciprofloxacin (CIP) against Staphylococcus aureus (S. aureus) infection in vitro and in vivo, and analyze the possible mechanisms through NorA inhibition from a target cellular pharmacokinetic view. In combination with non-toxic dosage of Rh2, the susceptibilities of S. aureus strains to CIP were significantly augmented, and the antibacterial kinetics of CIP in the S. aureus strains were markedly promoted. This enhancing effect of Rh2 towards CIP was also observed in S. aureus infected peritonitis mice, with elevated survival rate and reduced bacteria counts in blood. However, Rh2 did not influence the plasma concentrations of CIP. Further analysis indicated that Rh2 significantly promoted the accumulations of CIP in S. aureus, and inhibited the NorA mediated efflux of pyronin Y. The expressions of NorA gene on S. aureus were positively correlated with the enhancing effect of Rh2 with CIP. This is the first report of the enhancing effect of Rh2 with CIP for S. aureus infection in vitro and in vivo, of which it is probably that Rh2 inhibited NorA-mediated efflux and promoted the accumulation of CIP in the bacteria. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Attaching NorA efflux pump inhibitors to methylene blue enhances antimicrobial photodynamic inactivation of Escherichia coli and Acinetobacter baumannii in vitro and in vivo.

    Science.gov (United States)

    Rineh, Ardeshir; Bremner, John B; Hamblin, Michael R; Ball, Anthony R; Tegos, George P; Kelso, Michael J

    2018-02-24

    Resistance of bacteria to antibiotics is a public health concern worldwide due to the increasing failure of standard antibiotic therapies. Antimicrobial photodynamic inactivation (aPDI) is a promising non-antibiotic alternative for treating localized bacterial infections that uses non-toxic photosensitizers and harmless visible light to produce reactive oxygen species and kill microbes. Phenothiazinium photosensitizers like methylene blue (MB) and toluidine blue O are hydrophobic cations that are naturally expelled from bacterial cells by multidrug efflux pumps, which reduces their effectiveness. We recently reported the discovery of a NorA efflux pump inhibitor-methylene blue (EPI-MB) hybrid compound INF55-(Ac)en-MB that shows enhanced photodynamic inactivation of the Gram-positive bacterium methicillin-resistant Staphylococcus aureus (MRSA) relative to MB, both in vitro and in vivo. Here, we report the surprising observation that INF55-(Ac)en-MB and two related hybrids bearing the NorA efflux pump inhibitors INF55 and INF271 also show enhanced aPDI activity in vitro (relative to MB) against the Gram-negative bacteria Escherichia coli and Acinetobacter baumannii, despite neither species expressing the NorA pump. Two of the hybrids showed superior effects to MB in murine aPDI infection models. The findings motivate wider exploration of aPDI with EPI-MB hybrids against Gram-negative pathogens and more detailed studies into the molecular mechanisms underpinning their activity. Copyright © 2018 Elsevier Ltd. All rights reserved.

  4. Evolution from a natural flavones nucleus to obtain 2-(4-Propoxyphenyl)quinoline derivatives as potent inhibitors of the S. aureus NorA efflux pump.

    Science.gov (United States)

    Sabatini, Stefano; Gosetto, Francesca; Manfroni, Giuseppe; Tabarrini, Oriana; Kaatz, Glenn W; Patel, Diixa; Cecchetti, Violetta

    2011-08-25

    Overexpression of efflux pumps is an important mechanism by which bacteria evade the effects of substrate antimicrobial agents. Inhibition of such pumps is a promising strategy to circumvent this resistance mechanism. NorA is a Staphylococcus aureus efflux pump that confers reduced susceptibility to many structurally unrelated agents, including fluoroquinolones, resulting in a multidrug resistant phenotype. In this work, a series of 2-phenyl-4(1H)-quinolone and 2-phenyl-4-hydroxyquinoline derivatives, obtained by modifying the flavone nucleus of known efflux pump inhibitors (EPIs), were synthesized in an effort to identify more potent S. aureus NorA EPIs. The 2-phenyl-4-hydroxyquinoline derivatives 28f and 29f display potent EPI activity against SA-1199B, a strain that overexpresses norA, in an ethidium bromide efflux inhibition assay. The same compounds, in combination with ciprofloxacin, were able to completely restore its antibacterial activity against both S. aureus SA-K2378 and SA-1199B, norA-overexpressing strains. © 2011 American Chemical Society

  5. 1-(1H-indol-3-yl)ethanamine derivatives as potent Staphylococcus aureus NorA efflux pump inhibitors.

    Science.gov (United States)

    Hequet, Arnaud; Burchak, Olga N; Jeanty, Matthieu; Guinchard, Xavier; Le Pihive, Emmanuelle; Maigre, Laure; Bouhours, Pascale; Schneider, Dominique; Maurin, Max; Paris, Jean-Marc; Denis, Jean-Noël; Jolivalt, Claude

    2014-07-01

    The synthesis of 37 1-(1H-indol-3-yl)ethanamine derivatives, including 12 new compounds, was achieved through a series of simple and efficient chemical modifications. These indole derivatives displayed modest or no intrinsic anti-staphylococcal activity. By contrast, several of the compounds restored, in a concentration-dependent manner, the antibacterial activity of ciprofloxacin against Staphylococcus aureus strains that were resistant to fluoroquinolones due to overexpression of the NorA efflux pump. Structure-activity relationships studies revealed that the indolic aldonitrones halogenated at position 5 of the indole core were the most efficient inhibitors of the S. aureus NorA efflux pump. Among the compounds, (Z)-N-benzylidene-2-(tert-butoxycarbonylamino)-1-(5-iodo-1H-indol-3-yl)ethanamine oxide led to a fourfold decrease of the ciprofloxacin minimum inhibitory concentration against the SA-1199B strain when used at a concentration of 0.5 mg L(-1) . To the best of our knowledge, this activity is the highest reported to date for an indolic NorA inhibitor. In addition, a new antibacterial compound, tert-butyl (2-(3-hydroxyureido)-2-(1H-indol-3-yl)ethyl)carbamate, which is not toxic for human cells, was also found. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Enrico Fermi Awards Ceremony for Dr. Mildred S. Dresselhaus and Dr. Burton Richter, May 2012 (Presentations, including remarks by Energy Secretary, Dr. Steven Chu)

    International Nuclear Information System (INIS)

    Chu, Steven

    2012-01-01

    The Fermi Award is a Presidential award and is one of the oldest and most prestigious science and technology honors bestowed by the U.S. Government. On May 7, 2012 it was conferred upon two exceptional scientists: Dr. Mildred Dresselhaus, 'for her scientific leadership, her major contributions to science and energy policy, her selfless work in science education and the advancement of diversity in the scientific workplace, and her highly original and impactful research,' and Dr. Burton Richter, 'for the breadth of his influence in the multiple disciplines of accelerator physics and particle physics, his profound scientific discoveries, his visionary leadership as SLAC Director, his leadership of science, and his notable contributions in energy and public policy.' Dr. John Holder, Director of the White House Office of Science and Technology Policy, opened the ceremony, and Dr. Bill Brinkman, Director of DOE's Office of Science introduced the main speaker, Dr. Steven Chu, U.S. Energy Secretary.

  7. A local earthquake coda magnitude and its relation to duration, moment M sub O, and local Richter magnitude M sub L

    Science.gov (United States)

    Suteau, A. M.; Whitcomb, J. H.

    1977-01-01

    A relationship was found between the seismic moment, M sub O, of shallow local earthquakes and the total duration of the signal, t, in seconds, measured from the earthquakes origin time, assuming that the end of the coda is composed of backscattering surface waves due to lateral heterogenity in the shallow crust following Aki. Using the linear relationship between the logarithm of M sub O and the local Richter magnitude M sub L, a relationship between M sub L and t, was found. This relationship was used to calculate a coda magnitude M sub C which was compared to M sub L for Southern California earthquakes which occurred during the period from 1972 to 1975.

  8. On the Probability Density Functions of Forster-Greer-Thorbecke ...

    African Journals Online (AJOL)

    Distributional properties of poverty indices are generally unknown due to the fact that statistical inference for poverty measures are mostly ignored in the field of poverty analysis where attention is usually based on identification and aggregation problems. This study considers the possibility of using Pearson system of ...

  9. Evaluation of the tannic acid inhibitory effect against the NorA efflux pump of Staphylococcus aureus.

    Science.gov (United States)

    Tintino, Saulo R; Oliveira-Tintino, Cícera D M; Campina, Fábia F; Silva, Raimundo L P; Costa, Maria do S; Menezes, Irwin R A; Calixto-Júnior, João T; Siqueira-Junior, José P; Coutinho, Henrique D M; Leal-Balbino, Tereza C; Balbino, Valdir Q

    2016-08-01

    During the early periods of antibiotic usage, bacterial infections were considered tamed. However, widespread antibiotic use has promoted the emergence of antibiotic-resistant pathogens, including multidrug resistant strains. Active efflux is a mechanism for bacterial resistance to inhibitory substances, known simply as drug efflux pumps. The bacterium Staphylococcus aureus is an important pathogenic bacterium responsible for an array of infections. The NorA efflux pump has been shown to be responsible for moderate fluoroquinolone resistance of S. aureus. The inhibition of the efflux pump was assayed using a sub-inhibitory concentration of standard efflux pump inhibitors and tannic acid (MIC/8), where its capacity to decrease the MIC of Ethidium bromide (EtBr) and antibiotics due to the possible inhibitory effect of these substances was observed. The MICs of EtBr and antibiotics were significantly reduced in the presence of tannic acid, indicating the inhibitory effect of this agent against the efflux pumps of both strains causing a three-fold reduction of the MIC when compared with the control. These results indicate the possible usage of tannic acid as an adjuvant in antibiotic therapy against multidrug resistant bacteria (MDR). Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Novel insight into antimicrobial resistance and sensitivity phenotypes associated to qac and norA genotypes in Staphylococcus aureus.

    Science.gov (United States)

    Marchi, Emmanuela; Furi, Leonardo; Arioli, Stefania; Morrissey, Ian; Di Lorenzo, Valeria; Mora, Diego; Giovannetti, Luciana; Oggioni, Marco Rinaldo; Viti, Carlo

    2015-01-01

    Staphylococcus aureus strains harboring QacA, QacB, QacC, QacG transporters and norA promoter up-regulating mutations were characterized by phenotype microarray (PM), standard methods for susceptibility testing, and ethidium bromide efflux assays, in order to increase knowledge on phenotypes associated to efflux pumps and their substrates. PM data and standard susceptibility testing lead to the identification of new potential efflux targets, such as guanidine hydrochloride or 8-hydroxyquinoline for QacA and QacC pumps, respectively. The identification of compounds to which the presence of efflux pumps induced increased susceptibility opens new perspectives for potential adjunct anti-resistance treatment (i.e. strains bearing QacB transporters showed increased susceptibility to thioridazine, amitriptyline and orphenadrine). Although the tested isolates were characterized by high degree of heterogeneity, a hallmark of clinical isolates, direct ethidium bromide efflux assays were effective in highlighting differences in efflux efficiency among strains. These data add to characterization of substrate specificity in the different classes of staphylococcal multidrug efflux systems conferring specific substrate profiles and efflux features to each of them. Copyright © 2014 Elsevier GmbH. All rights reserved.

  11. Biological Characteristics and Medical Treatment of Breast Cancer in Young Women—A Featured Population: Results from the NORA Study

    Directory of Open Access Journals (Sweden)

    P. Pronzato

    2011-01-01

    Full Text Available Background. The present paper described the biological characteristics and clinical behavior of young women in the cohort NORA study Patients and Methods. From 2000–2002, patients (>3500 were enrolled at 77 Italian hospitals. Women aged ≤50 years (=1013 were stratified into age groups (≤35, 36–40, 41–45, and 46–50 years. The relationship between age and patient characteristics, cancer presentation, and treatment was analyzed. Results. Younger women more frequently had tumors with ER/PgR-negative(2=7.07; =.008, HER2 amplification (2=5.76; =.01, and high (≥10% Ki67 labelling index (2=9.53; =.002. Positive nodal status, large tumors, and elevated Ki67 all associated with the choice for chemotherapy followed by endocrine therapy in hormone receptor-positive patients (40 versus ≤40, <.0001, resp.. At multivariate analysis, after adjustment for significant clinical and pathological factors, age remains a significant prognostic variable (HR=0.93, =.0021. Conclusion. This cohort study suggests that age per sè is an important prognostic factor. The restricted role of early diagnosis and the aggressive behavior of cancer in this population make necessary the application of targeted medical strategies crucial.

  12. Biological Characteristics and Medical Treatment of Breast Cancer in Young Women-A Featured Population: Results from the Nora Study

    International Nuclear Information System (INIS)

    Pronzato, P.; Mustacchi, G.; De Matteis, A.; Di Costanzo, F.; Rulli, E.; Floriani, I; Cazzaniga, M.E.

    2011-01-01

    Background. The present paper described the biological characteristics and clinical behavior of young women in the cohort NORA study Patients and Methods. From 2000-2002, patients (N>3500) were enrolled at 77 Italian hospitals. Women aged =50 years (N=1013) were stratified into age groups (=35, 36-40, 41-45, and 46-50 years). The relationship between age and patient characteristics, cancer presentation, and treatment was analyzed. Results. Younger women more frequently had tumors with ER/PgR-negative(x 2 =7.07; P=.008), HER2 amplification (x 2 =5.76; P=.01), and high (≤10%) Ki67 labelling index (x 2 =9.53; P=.002). Positive nodal status, large tumors, and elevated Ki67 all associated with the choice for chemotherapy followed by endocrine therapy in hormone receptor-positive patients (P 40 versus =40, P<.0001, resp.). At multivariate analysis, after adjustment for significant clinical and pathological factors, age remains a significant prognostic variable (HR=0.93, P=.0021). Conclusion. This cohort study suggests that age per se is an important prognostic factor. The restricted role of early diagnosis and the aggressive behavior of cancer in this population make necessary the application of targeted medical strategies crucial. human epidermal growth factor receptor

  13. Boronic species as promising inhibitors of the Staphylococcus aureus NorA efflux pump: study of 6-substituted pyridine-3-boronic acid derivatives.

    Science.gov (United States)

    Fontaine, Fanny; Héquet, Arnaud; Voisin-Chiret, Anne-Sophie; Bouillon, Alexandre; Lesnard, Aurélien; Cresteil, Thierry; Jolivalt, Claude; Rault, Sylvain

    2015-05-05

    In response to the extensive use of antibiotics, bacteria have evolved numerous mechanisms of defense against antimicrobial agents. Among them, extrusion of the antimicrobial agents outside the bacterial cell through efflux pumps is a major cause of concern. At first limited to one or few structurally-related antibiotics, bacterial resistance have then progressed towards cross-resistance between different classes of antibiotics, leading to multidrug-resistant microorganisms. Emergence of these pathogens requires development of novel therapeutic strategies and inhibition of efflux pumps appears to be a promising strategy that could restore the potency of existing antibiotics. NorA is the most studied chromosomal efflux pump of Staphylococcus aureus; it is known to be implied in resistance of Methicillin-resistant S. aureus (MRSA) strains against a wide range of unrelated substrates, including hydrophilic fluoroquinolones. Starting from 6-benzyloxypyridine-3-boronic acid I that we previously identified as a potential inhibitor of the NorA efflux pump against the NorA-overexpressing S. aureus 1199B strain (SA1199B), we describe here the synthesis and biological evaluation of a series of 6-(aryl)alkoxypyridine-3-boronic acids. 6-(3-Phenylpropoxy)pyridine-3-boronic acid 3i and 6-(4-phenylbutoxy)pyridine-3-boronic acid 3j were found to potentiate ciprofloxacin activity by a 4-fold increase compared to the parent compound I. In addition, it has been shown that both compounds promote Ethidium Bromide (EtBr) accumulation in SA1199B, thus corroborating their potential mode of action as NorA inhibitors. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  14. Synergistic effects of baicalein with ciprofloxacin against NorA over-expressed methicillin-resistant Staphylococcus aureus (MRSA) and inhibition of MRSA pyruvate kinase.

    Science.gov (United States)

    Chan, Ben C L; Ip, Margaret; Lau, Clara B S; Lui, S L; Jolivalt, Claude; Ganem-Elbaz, Carine; Litaudon, Marc; Reiner, Neil E; Gong, Huansheng; See, Raymond H; Fung, K P; Leung, P C

    2011-09-01

    Baicalein, the active constituent derived from Scutellaria baicalensis Georgi., has previously been shown to significantly restore the effectiveness of β-lactam antibiotics and tetracycline against methicillin-resistant Staphylococcus aureus (MRSA). With multiple therapeutic benefits, the antibacterial actions of baicalein may also be involved in overcoming other bacterial resistance mechanisms. The aim of the present study was to further investigate antibacterial activities of baicalein in association with various antibiotics against selected Staphylococcus aureus strains with known specific drug resistance mechanisms. A panel of clinical MRSA strains was used for further confirmation of the antibacterial activities of baicalein. The effect of baicalein on inhibiting the enzymatic activity of a newly discovered MRSA-specific pyruvate kinase (PK), which is essential for Staphylococcus aureus growth and survival was also examined. In the checkerboard dilution test and time-kill assay, baicalein at 16 μg/ml could synergistically restore the antibacterial actions of ciprofloxacin against the NorA efflux pump overexpressed SA-1199B, but not with the poor NorA substrate, pefloxacin. Moreover, synergistic effects were observed when baicalein was combined with ciprofloxacin against 12 out of 20 clinical ciprofloxacin resistant strains. For MRSA PK studies, baicalein alone could inhibit the enzymatic activity of MRSA PK in a dose-dependent manner. Our results demonstrated that baicalein could significantly reverse the ciprofloxacin resistance of MRSA possibly by inhibiting the NorA efflux pump in vitro. The inhibition of MRSA PK by baicalein could lead to a deficiency of ATP which might further contribute to the antibacterial actions of baicalein against MRSA. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  15. Dithiazole thione derivative as competitive NorA efflux pump inhibitor to curtail multi drug resistant clinical isolate of MRSA in a zebrafish infection model.

    Science.gov (United States)

    Lowrence, Rene Christena; Raman, Thiagarajan; Makala, Himesh V; Ulaganathan, Venkatasubramanian; Subramaniapillai, Selva Ganesan; Kuppuswamy, Ashok Ayyappa; Mani, Anisha; Chittoor Neelakantan, Sundaresan; Nagarajan, Saisubramanian

    2016-11-01

    Multi drug resistant (MDR) pathogens pose a serious threat to public health since they can easily render most potent drugs ineffective. Efflux pump inhibitors (EPI) can be used to counter the MDR phenotypes arising due to increased efflux. In the present study, a series of dithiazole thione derivatives were synthesized and checked for its antibacterial and efflux pump inhibitory (EPI) activity. Among 10 dithiazole thione derivatives, real-time efflux studies revealed that seven compounds were potent EPIs relative to CCCP. Zebrafish toxicity studies identified four non-toxic putative EPIs. Both DTT3 and DTT9 perturbed membrane potential and DTT6 was haemolytic. Among DTT6 and DTT10, the latter was less toxic as evidenced by histopathology studies. Since DTT10 was non-haemolytic, did not affect the membrane potential, and was least toxic, it was chosen further for in vivo study, wherein DTT10 potentiated effect of ciprofloxacin against clinical strain of MRSA and reduced bacterial burden in muscle and skin tissue of infected zebrafish by ~ 1.7 and 2.5 log fold respectively. Gene expression profiling of major efflux transport proteins by qPCR revealed that clinical isolate of MRSA, in the absence of antibiotic, upregulated NorA, NorB and MepA pump, whereas it downregulates NorC and MgrA relative to wild-type strain of Staphylococcus aureus. In vitro studies with NorA mutant strains and substrate profiling revealed that at higher concentrations DTT10 is likely to function as a competitive inhibitor of NorA efflux protein in S. aureus, whereas at lower concentrations it might inhibit ciprofloxacin efflux through NorB and MepA as implied by docking studies. A novel non-toxic, non-haemolytic dithiazole thione derivative (DTT10) was identified as a potent competitive inhibitor of NorA efflux pump in S. aureus using in silico, in vitro and in vivo studies. This study also underscores the importance of using zebrafish infection model to screen and evaluate putative EPI for

  16. Midlatitude Cirrus Clouds Derived from Hurricane Nora: A Case Study with Implications for Ice Crystal Nucleation and Shape.

    Science.gov (United States)

    Sassen, Kenneth; Arnott, W. Patrick; O'C. Starr, David; Mace, Gerald G.; Wang, Zhien; Poellot, Michael R.

    2003-04-01

    Hurricane Nora traveled up the Baja Peninsula coast in the unusually warm El Niño waters of September 1997 until rapidly decaying as it approached southern California on 24 September. The anvil cirrus blowoff from the final surge of tropical convection became embedded in subtropical flow that advected the cirrus across the western United States, where it was studied from the Facility for Atmospheric Remote Sensing (FARS) in Salt Lake City, Utah, on 25 September. A day later, the cirrus shield remnants were redirected southward by midlatitude circulations into the southern Great Plains, providing a case study opportunity for the research aircraft and ground-based remote sensors assembled at the Clouds and Radiation Testbed (CART) site in northern Oklahoma. Using these comprehensive resources and new remote sensing cloud retrieval algorithms, the microphysical and radiative cloud properties of this unusual cirrus event are uniquely characterized.Importantly, at both the FARS and CART sites the cirrus generated spectacular halos and arcs, which acted as a tracer for the hurricane cirrus, despite the limited lifetimes of individual ice crystals. Lidar depolarization data indicate widespread regions of uniform ice plate orientations, and in situ particle replicator data show a preponderance of pristine, solid hexagonal plates and columns. It is suggested that these unusual aspects are the result of the mode of cirrus particle nucleation, presumably involving the lofting of sea salt nuclei in strong thunderstorm updrafts into the upper troposphere. This created a reservoir of haze particles that continued to produce halide-salt-contaminated ice crystals during the extended period of cirrus cloud maintenance. The inference that marine microbiota are embedded in the replicas of some ice crystals collected over the CART site points to the longevity of marine effects. Various nucleation scenarios proposed for cirrus clouds based on this and other studies, and the

  17. Promoter methylation patterns in Richter syndrome affect stem-cell maintenance and cell cycle regulation and differ from de novo diffuse large B-cell lymphoma.

    Science.gov (United States)

    Rinaldi, Andrea; Mensah, Afua Adjeiwaa; Kwee, Ivo; Forconi, Francesco; Orlandi, Ester M; Lucioni, Marco; Gattei, Valter; Marasca, Roberto; Berger, Françoise; Cogliatti, Sergio; Cavalli, Franco; Zucca, Emanuele; Gaidano, Gianluca; Rossi, Davide; Bertoni, Francesco

    2013-10-01

    In a fraction of patients, chronic lymphocytic leukaemia (CLL) can transform to Richter syndrome (RS), usually a diffuse large B-cell lymphoma (DLBCL). We studied genome-wide promoter DNA methylation in RS and clonally related CLL-phases of transformed patients, alongside de novo DLBCL (of non-germinal centre B type), untransformed-CLL and normal B-cells. The greatest differences in global DNA methylation levels were observed between RS and DLBCL, indicating that these two diseases, although histologically similar, are epigenetically distinct. RS was more highly methylated for genes involved in cell cycle regulation. When RS was compared to the preceding CLL-phase and with untransformed-CLL, RS presented a higher degree of methylation for genes possessing the H3K27me3 mark and PRC2 targets, as well as for gene targets of TP53 and RB1. Comparison of the methylation levels of individual genes revealed that OSM, a stem cell regulatory gene, exhibited significantly higher methylation levels in RS compared to CLL-phases. Its transcriptional repression by DNA methylation was confirmed by 5-aza-2'deoxycytidine treatment of DLBCL cells, determining an increased OSM expression. Our results showed that methylation patterns in RS are largely different from de novo DLBCL. Stem cell-related genes and cell cycle regulation genes are targets of DNA methylation in RS. © 2013 John Wiley & Sons Ltd.

  18. Diffuse large B-cell lymphoma (Richter syndrome) in patients with chronic lymphocytic leukaemia (CLL): a cohort study of newly diagnosed patients.

    Science.gov (United States)

    Parikh, Sameer A; Rabe, Kari G; Call, Timothy G; Zent, Clive S; Habermann, Thomas M; Ding, Wei; Leis, Jose F; Schwager, Susan M; Hanson, Curtis A; Macon, William R; Kay, Neil E; Slager, Susan L; Shanafelt, Tait D

    2013-09-01

    Nearly all information about patients with chronic lymphocytic leukaemia (CLL) who develop diffuse large B-cell lymphoma [Richter syndrome (RS)] is derived from retrospective case series or patients treated on clinical trials. We used the Mayo Clinic CLL Database to identify patients with newly diagnosed CLL between January 2000 and July 2011. Individuals who developed biopsy-proven RS during follow-up were identified. After a median follow-up of 4 years, 37/1641 (2·3%) CLL patients developed RS. The rate of RS was approximately 0·5%/year. Risk of RS was associated with advanced Rai stage at diagnosis (P CLL (1%/year). Stereotyped B-cell receptors (odds-ratio = 4·2; P = 0·01) but not IGHV4-39 family usage was associated with increased risk of RS. Treatment with combination of purine analogues and alkylating agents increased the risk of RS three-fold (odds-ratio = 3·26, P = 0·0003). Median survival after RS diagnosis was 2·1 years. The RS prognosis score stratified patients into three risk groups with median survivals of 0·5 years, 2·1 years and not reached. Both underlying characteristics of the CLL clone and subsequent CLL therapy influence the risk of RS. Survival after RS remains poor and new therapies are needed. © 2013 John Wiley & Sons Ltd.

  19. Attaching the NorA Efflux Pump Inhibitor INF55 to Methylene Blue Enhances Antimicrobial Photodynamic Inactivation of Methicillin-Resistant Staphylococcus aureus in Vitro and in Vivo.

    Science.gov (United States)

    Rineh, Ardeshir; Dolla, Naveen K; Ball, Anthony R; Magana, Maria; Bremner, John B; Hamblin, Michael R; Tegos, George P; Kelso, Michael J

    2017-10-13

    Antimicrobial photodynamic inactivation (aPDI) uses photosensitizers (PSs) and harmless visible light to generate reactive oxygen species (ROS) and kill microbes. Multidrug efflux systems can moderate the phototoxic effects of PSs by expelling the compounds from cells. We hypothesized that increasing intracellular concentrations of PSs by inhibiting efflux with a covalently attached efflux pump inhibitor (EPI) would enhance bacterial cell phototoxicity and reduce exposure of neighboring host cells to damaging ROS. In this study, we tested the hypothesis by linking NorA EPIs to methylene blue (MB) and examining the photoantimicrobial activity of the EPI-MB hybrids against the human pathogen methicillin-resistant Staphylococcus aureus (MRSA). Photochemical/photophysical and in vitro microbiological evaluation of 16 hybrids carrying four different NorA EPIs attached to MB via four linker types identified INF55-(Ac)en-MB 12 as a lead. Compound 12 showed increased uptake into S. aureus cells and enhanced aPDI activity and wound healing effects (relative to MB) in a murine model of an abrasion wound infected by MRSA. The study supports a new approach for treating localized multidrug-resistant MRSA infections and paves the way for wider exploration of the EPI-PS hybrid strategy in aPDI.

  20. The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'. Modification of the Supply Agreement

    International Nuclear Information System (INIS)

    1961-01-01

    Pursuant to Section 15 of the 'Contract for the Lease of Enriched Uranium' for the NORA reactor, the United States Atomic Energy Commission has reduced, with effect from 1 January 1962, the rates of the Use Charge specified in Section II(a) and of the Consumption Charge specified in Section II(b)

  1. Arvo Pärt: Kui kannatab üks inimene, siis kannatab kogu maailm! / Arvo Pärt, Nora Pärt ; intervjueerinud Yana Toom, Maarja-Liis Arujärv, Aleksandr Zukerman ; kommenteerinud Edgar Savisaar

    Index Scriptorium Estoniae

    Pärt, Arvo, 1935-

    2010-01-01

    Arvo Pärt ja tema abikaasa Nora Pärt andsid Türgis enne Pärdi uudisteose "Aadama itk" esiettekannet intervjuu, kus rääkisid nii nende raskustest Läände elama asumisel kui uudisteose sügavamast mõttest

  2. The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Programme of Research with the Zero Power Reactor 'NORA'. Text of a Supplementary Agreement

    International Nuclear Information System (INIS)

    1962-01-01

    The text of a Supplementary Agreement to amend the Supply Agreement concerning the NORA project, which Supplementary Agreement was approved by the Board of Governors on 18 June 1962 and which entered into force on 3 September 1962, is reproduced in this document for the information of all Members of the Agency

  3. Re-evolution of the 2-phenylquinolines: ligand-based design, synthesis, and biological evaluation of a potent new class of Staphylococcus aureus NorA efflux pump inhibitors to combat antimicrobial resistance.

    Science.gov (United States)

    Sabatini, Stefano; Gosetto, Francesca; Iraci, Nunzio; Barreca, Maria Letizia; Massari, Serena; Sancineto, Luca; Manfroni, Giuseppe; Tabarrini, Oriana; Dimovska, Mirjana; Kaatz, Glenn W; Cecchetti, Violetta

    2013-06-27

    Overexpression of efflux pumps is an important mechanism by which bacteria evade the effects of antimicrobial agents that are substrates. NorA is a Staphylococcus aureus efflux pump that confers reduced susceptibility to many structurally unrelated agents, including fluoroquinolones, biocides, and dyes, resulting in a multidrug resistant (MDR) phenotype. In this work, a series of 2-phenylquinoline derivatives was designed by means of ligand-based pharmacophore modeling in an attempt to identify improved S. aureus NorA efflux pump inhibitors (EPIs). Most of the 2-phenylquinoline derivatives displayed potent EPI activity against the norA overexpressing strain SA-1199B. The antibacterial activity of ciprofloxacin, when used in combination with some of the synthesized compounds, was completely restored in SA-1199B and SA-K2378, a strain overexpressing norA from a multicopy plasmid. Compounds 3m and 3q also showed potent synergistic activity with the ethidium bromide dye in a strain overexpressing the MepA MDR efflux pump.

  4. Rib fracture as a predictor of future fractures in young and older postmenopausal women: National Osteoporosis Risk Assessment (NORA)

    Science.gov (United States)

    Sajjan, S. G.; Barrett-Connor, E.; McHorney, C. A.; Miller, P. D.; Sen, S. S.; Siris, E.

    2013-01-01

    Summary A rib fracture history after age 45 was associated with a 5.4-fold increase in new rib fracture risk and a 2.4-fold increase in risk of any new clinical fracture in 155,031 postmenopausal women. A rib fracture history suggests osteoporosis and should be considered when evaluating patients for interventions to prevent fractures. Introduction Until recently, little attention was paid to rib fracture as an osteoporosis marker. Emerging evidence suggests rib fracture may be an osteoporotic fracture in men and women. We report the 5-year independent association between baseline rib fracture histories and self-reported future fractures by age (decade) in the NORA cohort (155,031 postmenopausal women, 50–99 years). Methods Participants reported fracture history and responded to follow-up surveys at years 1, 3, or 6. Women with a baseline rib fracture history without other fractures were compared with women with no fracture. Results At baseline, 4,758 (3.07%) women reported a rib fracture history without other fractures; 6,300 women reported 6,830 new clinical fractures, including wrist (2,271), rib (1,891), spine (1,136), hip (941), and forearm (591). Adjusted relative risk (ARR) values (95% confidence interval [CI]) for future fractures in women with rib fracture history versus women with no fracture history were 5.4 (4.8–6.1) at the rib, 2.1 (1.7–2.6) at the spine, and 1.4 (1.1–1.7) at the wrist, and not significant for forearm or hip fractures. Future fracture risk was at least doubled in women with a rib fracture history in all ages: ARR (95% CI) 3.4 (2.8–4.0) for ages 50–59, 2.5 (2.1–3.0) for ages 60–69, 2.0 (1.7–2.3) for ages 70–79, and 2.0 (1.6–2.6) for ages >80. Conclusions Rib fracture, the second most common clinical fracture in women (after wrist fracture), predicted future fractures of the rib, wrist, and spine at all ages. Women presenting with rib fractures should be evaluated for appropriate management to prevent future

  5. Patterns of practice of regional nodal irradiation in breast cancer: results of the European Organization for Research and Treatment of Cancer (EORTC) NOdal Radiotherapy (NORA) survey.

    Science.gov (United States)

    Belkacemi, Y; Kaidar-Person, O; Poortmans, P; Ozsahin, M; Valli, M-C; Russell, N; Kunkler, I; Hermans, J; Kuten, A; van Tienhoven, G; Westenberg, H

    2015-03-01

    Predicting outcome of breast cancer (BC) patients based on sentinel lymph node (SLN) status without axillary lymph node dissection (ALND) is an area of uncertainty. It influences the decision-making for regional nodal irradiation (RNI). The aim of the NORA (NOdal RAdiotherapy) survey was to examine the patterns of RNI. A web-questionnaire, including several clinical scenarios, was distributed to 88 EORTC-affiliated centers. Responses were received between July 2013 and January 2014. A total of 84 responses were analyzed. While three-dimensional (3D) radiotherapy (RT) planning is carried out in 81 (96%) centers, nodal areas are delineated in only 51 (61%) centers. Only 14 (17%) centers routinely link internal mammary chain (IMC) and supraclavicular node (SCN) RT indications. In patients undergoing total mastectomy (TM) with ALND, SCN-RT is recommend by 5 (6%), 53 (63%) and 51 (61%) centers for patients with pN0(i+), pN(mi) and pN1, respectively. Extra-capsular extension (ECE) is the main factor influencing decision-making RNI after breast conserving surgery (BCS) and TM. After primary systemic therapy (PST), 49 (58%) centers take into account nodal fibrotic changes in ypN0 patients for RNI indications. In ypN0 patients with inner/central tumors, 23 (27%) centers indicate SCN-RT and IMC-RT. In ypN1 patients, SCN-RT is delivered by less than half of the centers in patients with ypN(i+) and ypN(mi). Twenty-one (25%) of the centers recommend ALN-RT in patients with ypN(mi) or 1-2N+ after ALND. Seventy-five (90%) centers state that age is not considered a limiting factor for RNI. The NORA survey is unique in evaluating the impact of SLNB/ALND status on adjuvant RNI decision-making and volumes after BCS/TM with or without PST. ALN-RT is often indicated in pN1 patients, particularly in the case of ECE. Besides the ongoing NSABP-B51/RTOG and ALLIANCE trials, NORA could help to design future specific RNI trials in the SLNB era without ALND in patients receiving or not PST.

  6. N,N'-disubstituted cinnamamide derivatives potentiate ciprofloxacin activity against overexpressing NorA efflux pump Staphylococcus aureus 1199B strains.

    Science.gov (United States)

    Radix, Sylvie; Jordheim, Anne Doléans; Rocheblave, Luc; N'Digo, Serge; Prignon, Anne-Laure; Commun, Carine; Michalet, Serge; Dijoux-Franca, Marie-Geneviève; Mularoni, Angélique; Walchshofer, Nadia

    2018-04-25

    A multi-step procedure has been described which afforded satisfactory yields of N,N'-disubstituted cinnamamides derived from N-Boc-protected amino acids (Boc-Gly, Boc-Val, Boc-Phe). The key step of this synthesis was a regioselective RedAl reduction of an amide function in presence of a carbamate group. Next, these cinnamamides were evaluated in co-admnistration with ciprofloxacin as efflux pump inhibitors against two S. aureus strains, NorA overexpressing SA1199B and wild type SA1199. In parallel, their intrinsic toxicity was appreciated on human lung fibroblast MRC5 cells. Therefore, the cinnamamide combining both carbamate and indol-3-yl groups, was found to be the most active and one of the less toxic EPI and constituted a promising hit. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  7. Assessment of the risk of African swine fever introduction into Finland using NORA-a rapid tool for semiquantitative assessment of the risk.

    Science.gov (United States)

    Kyyrö, J; Sahlström, L; Lyytikäinen, T

    2017-12-01

    The NORA rapid risk assessment tool was developed for situations where there is a change in the disease status of easily transmissible animal diseases in neighbouring countries or in countries with significant interactions with Finland. The goal was to develop a tool that is quick to use and will provide consistent results to support risk management decisions. The model contains 63 questions that define the potential for entry and exposure by nine different pathways. The magnitude of the consequences is defined by 23 statements. The weight of different pathways is defined according to the properties of the assessed disease. The model was built as an Excel spreadsheet and is intended for use by animal health control administrators. As an outcome, the model gives the possible pathways of disease entry into the country, an overall approximation for the probability of entry and the subsequent exposure, an overall estimate for the consequences and a combined overall risk estimate (probability multiplied by magnitude of consequences). Model validity was assessed by expert panels. Outside Africa, African swine fever is currently established in Russia and Sardinia. In addition, there have been cases in both wild boar and domestic pigs in Latvia, Lithuania, Poland and Estonia. Finland has frequent contacts with Russia and Estonia, especially through passengers. The risk of African swine fever (ASF) introduction into Finland was tested with NORA for the situation in December 2015, when ASF was endemic in many parts of Russia, Africa and Sardinia and was present in Baltic countries and in Poland. African swine fever was assessed to have a high probability of entry into Finland, with high consequences and therefore a high overall risk. © 2017 Blackwell Verlag GmbH.

  8. Boeravinone B, A Novel Dual Inhibitor of NorA Bacterial Efflux Pump of Staphylococcus aureus and Human P-Glycoprotein, Reduces the Biofilm Formation and Intracellular Invasion of Bacteria.

    Science.gov (United States)

    Singh, Samsher; Kalia, Nitin P; Joshi, Prashant; Kumar, Ajay; Sharma, Parduman R; Kumar, Ashok; Bharate, Sandip B; Khan, Inshad A

    2017-01-01

    This study elucidated the role of boeravinone B, a NorA multidrug efflux pump inhibitor, in biofilm inhibition. The effects of boeravinone B plus ciprofloxacin, a NorA substrate, were evaluated in NorA-overexpressing, wild-type, and knocked-out Staphylococcus aureus (SA-1199B, SA-1199, and SA-K1758, respectively). The mechanism of action was confirmed using the ethidium bromide accumulation and efflux assay. The role of boeravinone B as a human P -glycoprotein ( P -gp) inhibitor was examined in the LS-180 (colon cancer) cell line. Moreover, its role in the inhibition of biofilm formation and intracellular invasion of S. aureus in macrophages was studied. Boeravinone B reduced the minimum inhibitory concentration (MIC) of ciprofloxacin against S. aureus and its methicillin-resistant strains; the effect was stronger in SA-1199B. Furthermore, time-kill kinetics revealed that boeravinone B plus ciprofloxacin, at subinhibitory concentration (0.25 × MIC), is as equipotent as that at the MIC level. This combination also had a reduced mutation prevention concentration. Boeravinone B reduced the efflux of ethidium bromide and increased the accumulation, thus strengthening the role as a NorA inhibitor. Biofilm formation was reduced by four-eightfold of the minimal biofilm inhibitory concentration of ciprofloxacin, effectively preventing bacterial entry into macrophages. Boeravinone B effectively inhibited P -gp with half maximal inhibitory concentration (IC 50 ) of 64.85 μM. The study concluded that boeravinone B not only inhibits the NorA-mediated efflux of fluoroquinolones but also considerably inhibits the biofilm formation of S. aureus. Its P -gp inhibition activity demonstrates its potential as a bioavailability and bioefficacy enhancer.

  9. A Study of Nora and Eliza from the Perspective of Feminism%女性主义视角下娜拉与伊莉莎的对比思考

    Institute of Scientific and Technical Information of China (English)

    卢青青

    2012-01-01

    易卜生笔下《玩偶之家》中的娜拉和萧伯纳《格梅利翁》中的伊莉莎生活背景迥然不同,但她们有着极其相似的经历,她们都有很强的觉醒意识,是追求独立自主、平等和谐的女性代言人。从女性主义视角走进娜拉和伊莉莎的世界,探索在男权社会中女性的人生和命运,以寻求现代女性在家庭、社会中如何关注个体发展,形成自己的独立人格,实现真正的自强自立。%The protagonists Nora in A Doll ' s House and Eliza in Pygmalion have quite different living background, but they possess similar experience. Both of them, having strong self-awareness, are the spokespersons who pursue self-independent, free and harmony life. From the perspective of feminism, it goes into the world of Nora and Eliza to explore the life and of the females in the situation of patriarchy. From the, modern women may have a better and right judgment of how to pay attention to their individual development and their family and social roles, by which they can develop their own independent personalities and truly achieve self-improvement and self-support and self-reliance in modern society.

  10. The Sam and Nora Stories.

    Science.gov (United States)

    Nijim, Basheer; Nijim, Germana

    1992-01-01

    Presents a series of five short stories for children that incorporate geographic concepts. Includes the concepts of region, boundaries, and grids. Suggests that the stories will help children master challenging concepts and vocabulary that in turn will increase their knowledge and self-esteem. (DK)

  11. Whose Ethics? Which Wittgenstein? | Richter | Philosophical Papers

    African Journals Online (AJOL)

    . I argue that we should distinguish not only between Wittgenstein's personal opinions and his philosophy, but also, within his philosophical work, between broadly methodological remarks and what Wittgenstein might call genuinely ...

  12. ISPARTA v RICHTER 2013 6 SA 529 (GP)

    African Journals Online (AJOL)

    10332324

    corporations for marketing purposes,7 but also by individuals for social networking. (It should be ... Facebook is used by 93% of major brands. See World .... her and the second one was malicious and was aimed at damaging her reputation as.

  13. Riigikaitseõpetajad käisid seminaril / Gunnar Richter

    Index Scriptorium Estoniae

    Richter, Gunnar

    2005-01-01

    Riigikaitseõpetajatele korraldatud seminarist Viimsis Laidoneri Muuseumis, kus arutati riigikaitseõpetuse vajalikkust ja olulisust koolides. Ettekandega esines teiste seas ka Riigikogu liige Mart Laar

  14. ISPARTA v RICHTER 2013 6 SA 529 (GP)

    African Journals Online (AJOL)

    10332324

    In order to follow the reasoning of the court, the discussion starts off with a brief overview ..... It was therefore easy to identify to whom the first defendant was ..... defendant made defamatory comments about the plaintiff's business to a company.

  15. The structure of the desiccated Richtersius coronifer (Richters, 1903)

    Czech Academy of Sciences Publication Activity Database

    Czerneková, Michaela; Jönsson, K. I.; Chajec, Ł.; Student, S.; Poprawa, I.

    2017-01-01

    Roč. 254, č. 3 (2017), s. 1367-1377 ISSN 0033-183X Institutional support: RVO:67985823 Keywords : anhydrobiosis * cryptobiosis * tardigrades * tun * ultrastructure Subject RIV: ED - Physiology OBOR OECD: Cell biology Impact factor: 2.870, year: 2016

  16. Miss Willie and Nora Bonesteel: Teaching in Cyberspace.

    Science.gov (United States)

    Atwell, Nedra Wheeler

    Two of the author's favorite Appalachian women serve as thought mentors to help see the practical and educational opportunities available in cyberspace for meeting the critical shortage of teachers serving the Appalachian women and children of today. In classrooms and homes throughout Appalachia, women and children are logging on to computers to…

  17. Integrative redescription of a common Arctic water bear Pilatobius recamieri (Richters, 1911)

    Czech Academy of Sciences Publication Activity Database

    Gasiorek, P.; Zawierucha, Krzystof; Stec, D.; Michalczyk, L.

    2017-01-01

    Roč. 40, č. 11 (2017), s. 2239-2252 ISSN 0722-4060 Institutional support: RVO:67985904 Keywords : biodiversity * hypsibiidae * microfauna Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.949, year: 2016

  18. Antigen receptors and somatic hypermutation in B-cell chronic lymphocytic leukemia with Richter's transformation

    NARCIS (Netherlands)

    Smit, Laura A.; van Maldegem, Febe; Langerak, Anton W.; van der Schoot, C. Ellen; de Wit, Mireille J.; Bea, Silvia; Campo, Elias; Bende, Richard J.; van Noesel, Carel J. M.

    2006-01-01

    BACKGROUND AND OBJECTIVES: Activation-induced cytidine deaminase is essential for somatic hypermutation and class switch recombination of the immunoglobulin genes in B cells. It has been proposed that aberrant targeting of the somatic hypermutation machinery is instrumental in initiation and

  19. Nobel laureate Burton Richter to speak about future of particle physics

    CERN Multimedia

    2007-01-01

    "Particle physics is about to transform our thinking once again. Experiments of the last 15 years suggest new forms of matter, new forces of nature and perhas even new dimensions of space and time. Pinning down the new ideas will require more data from larger and more expensive machines - at a time when funding is more difficult than ever to secure." (1,5 page)

  20. Magnitude X on the Richter Scale: Welfare Cost of Business Cycles in Developing Countries

    OpenAIRE

    Stephane Pallage; Michel Robe

    2000-01-01

    Economic fluctuations are much stronger in developing countries than in the United States. Yet, while a large literature debates what constitutes a reasonable estimate of the welfare cost of business cycles in the US, it remains an open question how large that cost is in developing countries. Using several model economies, we provide such a measure for a large number of low--income countries. Our first main result is that the welfare cost of output fluctuations per se is far from trivial in t...

  1. O Beethoven de DeNora: o contexto está no texto DeNora's Beethoven: the context is in the text

    Directory of Open Access Journals (Sweden)

    Marcos Câmara de Castro

    2012-12-01

    Full Text Available Estudo sobre a repercussão do livro de DENORA (1995, e discussão sobre os conceitos que vêm à tona, a partir de uma abordagem sociológica do fenômeno do "gênio criador"; do surgimento do conceito de "música séria"¹ em oposição ao entretenimento; das estratégias de ocupação de um determinado campo cultural e suas aplicações em novos contextos. Todos os fatores que elegeram Beethoven são inoperantes num mundo em que novas regras se impõem na produção artística, tanto quanto na produção de mercadorias em geral: essa a principal contribuição do livro, que passou despercebida pela maioria das resenhas publicadas à época de sua publicação. Os esquissos do projeto da música dita "séria" são facilmente detectáveis na obra de Beethoven, em que sua busca de profundidade, em oposição à música leve, atinge novos patamares pari passu com sua posição social como compositor.Study on the impact of the DENORA's book (1995 and discussion of the concepts that come to light, from a sociological approach to the phenomenon of "creative genius"; the emergence of the concept of "serious music" as opposed to entertainment; strategies of occupation of a particular cultural field and its applications in new contexts. All factors that elected Beethoven are inoperative in a world where new rules are imposed on artistic production, as much as on the production of goods in general: this is the main contribution of this book, which remained unnoticed by most of the reviews published at the time of his publication. The sketches of the music project called "serious" are easily detectable in the work of Beethoven, and in his quest for depth, as opposed to pleasingness as a value, reaches new heights pari passu with his social position as a composer.

  2. Global patterns of organic carbon export and sequestration in the ocean (Arne Richter Award for Outstanding Young Scientists)

    Science.gov (United States)

    Henson, S.; Sanders, R.; Madsen, E.; Le Moigne, F.; Quartly, G.

    2012-04-01

    A major term in the global carbon cycle is the ocean's biological carbon pump which is dominated by sinking of small organic particles from the surface ocean to its interior. Here we examine global patterns in particle export efficiency (PEeff), the proportion of primary production that is exported from the surface ocean, and transfer efficiency (Teff), the fraction of exported organic matter that reaches the deep ocean. This is achieved through extrapolating from in situ estimates of particulate organic carbon export to the global scale using satellite-derived data. Global scale estimates derived from satellite data show, in keeping with earlier studies, that PEeff is high at high latitudes and low at low latitudes, but that Teff is low at high latitudes and high at low latitudes. However, in contrast to the relationship observed for deep biomineral fluxes in previous studies, we find that Teff is strongly negatively correlated with opal export flux from the upper ocean, but uncorrelated with calcium carbonate export flux. We hypothesise that the underlying factor governing the spatial patterns observed in Teff is ecosystem function, specifically the degree of recycling occurring in the upper ocean, rather than the availability of calcium carbonate for ballasting. Finally, our estimate of global integrated carbon export is only 50% of previous estimates. The lack of consensus amongst different methodologies on the strength of the biological carbon pump emphasises that our knowledge of a major planetary carbon flux remains incomplete.

  3. Who to Blame: Irrational Decision-Makers or Stupid Modelers? (Arne Richter Award for Outstanding Young Scientists Lecture)

    Science.gov (United States)

    Madani, Kaveh

    2016-04-01

    Water management benefits from a suite of modelling tools and techniques that help simplifying and understanding the complexities involved in managing water resource systems. Early water management models were mainly concerned with optimizing a single objective, related to the design, operations or management of water resource systems (e.g. economic cost, hydroelectricity production, reliability of water deliveries). Significant improvements in methodologies, computational capacity, and data availability over the last decades have resulted in developing more complex water management models that can now incorporate multiple objectives, various uncertainties, and big data. These models provide an improved understanding of complex water resource systems and provide opportunities for making positive impacts. Nevertheless, there remains an alarming mismatch between the optimal solutions developed by these models and the decisions made by managers and stakeholders of water resource systems. Modelers continue to consider decision makers as irrational agents who fail to implement the optimal solutions developed by sophisticated and mathematically rigours water management models. On the other hand, decision makers and stakeholders accuse modelers of being idealist, lacking a perfect understanding of reality, and developing 'smart' solutions that are not practical (stable). In this talk I will have a closer look at the mismatch between the optimality and stability of solutions and argue that conventional water resources management models suffer inherently from a full-cooperation assumption. According to this assumption, water resources management decisions are based on group rationality where in practice decisions are often based on individual rationality, making the group's optimal solution unstable for individually rational decision makers. I discuss how game theory can be used as an appropriate framework for addressing the irrational "rationality assumption" of water resources management models and for better capturing the social aspects of decision making in water management systems with multiple stakeholders.

  4. Trilli-Rilli : [lasteluuletused] / Heljo Mänd ; eesti keelest tõlkinud Nora Javorskaja

    Index Scriptorium Estoniae

    Mänd, Heljo

    2000-01-01

    Sisu: Trilli-Rilli ; Veliki li rebjatishki? ; Otkroite dveri ; Utro ; Kto tshto nossit ; Lessenka bozhei korovki ; Pessenka sredi travõ. Orig.: Mere taga, metsa taga... ; Tehke lahti värav ; Hommik : "Väiksed linnud harutavad..." ; Mida keegi kannab ; Lepatriinu trepp ; Rohulaul

  5. Las desventuras de Nora en el Río de la Plata

    Directory of Open Access Journals (Sweden)

    Tania Diz

    2012-04-01

    Full Text Available En este artículo se analizan dos obras teatrales: Dos mujeres- El amo del mundo (1927, de Alfonsina Storni, y Las descentradas (1929, de Salvadora Medina Onrubia. En sendas obras, las autoras oponen las formas de la subjetividad femenina hegemónica y contra hegemónica, hipotetizando sobre las causas y consecuencias que afectan a los personajes femeninos transgresores. Desde este punto de partida, se indaga acerca de los procedimientos que ponen en evidencia una lógica feminista, capaz de transgredir los estereotipos sexuados del falogocentrismo.

  6. Getting and Keeping Nora on Board: A Novice Elementary ESOL Student Teacher's Practices for Lesson Engagement

    Science.gov (United States)

    Waring, Hansun Zhang; Hruska, Barbara L.

    2011-01-01

    This study describes how a novice ESOL (English to Speakers of Other Languages) student teacher successfully navigates an instructional path in a one-on-one tutoring session with a second grade student. We document the student teacher's strategies to both engage and disengage her student, who alternately resists and cooperates throughout the…

  7. Adoption of 4G Mobile Services from the Female Student's Perspective: Case of Princess Nora University

    Science.gov (United States)

    Rawashdeh, Awni

    2015-01-01

    The aim this study was to examine the relationship between the perceived usefulness, perceived ease of use, perceived entertainment, attitude and the users' intention toward using the fourth-generation (4G) wireless mobile services. Data of this study were collected by survey with a cross sectional approach. The data were analyzed with factor…

  8. NORA-2, a model for creep deformation and rupture of zircaloy at high temperatures

    International Nuclear Information System (INIS)

    Raff, S.; Meyder, R.

    1983-01-01

    A model has been developed to describe Zircaloy cladding behaviour under LOCA and small leak conditions within specified temperature range and strain rates. The deformation model consists of a strain rate equation with two components representing strain rate controlled contributions from different deformation mechanisms. Transition from one mechanism to the other produces the strain rate dependence of the stress exponent of steady state creep. During transient creep the change of creep mechanisms produces a flow softening behaviour which induces unstable creep. Together with a strain hardening model, the strain history can be described for low and high strain values. The influence of oxidation is taken into account by modelling hardening due to solid solution of oxygen, cracking of the brittle oxide and oxygen stabilised α-phase layers, and by an oxidation-induced creep component in steam atmosphere. The rupture criterion is based on a strain fraction rule whose variables are temperature, strain rate or applied stress, and oxygen content. (author)

  9. Tannic Acid as a Potential Modulator of Norfloxacin Resistance in Staphylococcus Aureus Overexpressing norA.

    Science.gov (United States)

    Diniz-Silva, Helena Taina; Cirino, Isis Caroline da Silva; Falcão-Silva, Vivyanne Dos Santos; Magnani, Marciane; de Souza, Evandro Leite; Siqueira-Júnior, José P

    2016-01-01

    Tannins have shown inhibitory effects against pathogenic bacteria, and these properties make tannins potential modifying agents in bacterial resistance. The minimum inhibitory concentration (MIC) of tannic acid (TA), gallic acid (GA) and norfloxacin (Nor) against Staphylococcus aureus SA-1119 (NorA-effluxing strain) was determined using broth microdilution tests. To assess the modulation of antibiotic resistance, the MIC of Nor was determined in growth media with or without TA or GA at a subinhibitory concentration (1/4 MIC). The checkerboard method was performed to obtain the fractional inhibitory concentration index (FICI) for the combined application of TA and Nor. TA displayed a weak inhibitory effect (MIC 512 μg/ml) against S. aureus SA-1119, while no inhibitory effect was displayed by GA (MIC >512 μg/ml). However, when TA was tested at a subinhibitory concentration in combination with Nor, the MIC of Nor against S. aureus SA-1119 decreased from 128 to 4 μg/ml (32-fold); this effect was not observed for GA. In the checkerboard assay, the MIC of TA and Nor decreased from 512 to 128 μg/ml (4-fold) and from 128 to 8 μg/ml (16-fold), respectively. The combination of TA and Nor presented an FICI as low as 0.31, which indicates a synergistic interaction. TA is a potential agent for increasing the clinical efficacy of Nor to control resistant S. aureus. © 2016 S. Karger AG, Basel.

  10. MR imaging features of bizarre parosteal osteochondromatous proliferation of bone (Nora's lesion)

    International Nuclear Information System (INIS)

    Torreggiani, William C.; Munk, Peter L.; Al-Ismail, Khalid; O'Connell, John X.; Nicolaou, Savvas; Lee, Mark J.; Masri, Bassam A.

    2001-01-01

    The purpose of this study was to review the imaging findings of three patients with bizarre parosteal osteochrondromatous proliferation of bone (BPOP). The plain radiographs and MRI images of three patients with BPOP were obtained and retrospectively reviewed. In two cases, BPOP involved the feet. In one case BPOP involved the hand. In all three cases, plain radiographs showed a well-defined calcium containing mass adjacent to the cortical surface of the adjacent bone. The underlying bone appeared normal in all cases. On MRI, the lesion was of low signal intensity on T1 weighted sequences in all cases. On FSE T2 weighted and STIR sequences, the lesion was of high signal in all cases. The cortex, medullary cavity and adjacent soft tissues appeared normal in all cases. While BPOP is rare and often confused with a variety of both benign and malignant lesions, there are specific radiological findings that may help to distinguish BPOP from many of its mimickers

  11. Dynamic modelling of a De Nora fuel cell intended for the electric vehicle

    International Nuclear Information System (INIS)

    Poirot-Crouvezier, J.-P.; Baurens, P.; Levrard, D.

    2000-01-01

    Recent progress in fuel cells (proton membrane exchange) has gained interest in the electricity generation in particular for electric vehicles. So far the vehicles demonstrate the feasibility of the technique. After a limited number of demonstrations, the energy source will be indispensable. In general, one cannot speak about a single cell, but a stacking of cells. The system must be able to be supplied with reactants, evacuate products, and produce heat and usable electricity. A fuel cell is inevitably a system of many components that interact with one another. The overall operation of the assembly depends on the associated sub-systems. In the case of the application to automobiles, the driving behaviour must be analysed to ensure the system function can be simulated to obtain the correct characteristics. For instance, an essential study would be the dynamic function of successive accelerations and decelerations

  12. The Effects of Hurricane Nora on Eomorphic Characteristics of Yuma Wash, Yuma Proving Ground, Arizona

    National Research Council Canada - National Science Library

    Wohl, Ellen

    1999-01-01

    .... Repeat surveys conducted in January 1998 were compared to the 1995 survey to measure areas of cross-sectional scour and fill, net change in channel area, and change in thalweg depth along the channel...

  13. Recht an der Grenze: Flüchtlingssteuerung und Schutzkooperation in Europa / Anuscheh Farahat, Nora Markard

    Index Scriptorium Estoniae

    Farahat, Anuscheh

    2017-01-01

    Kohtuasjadest, mis puudutavad erakorralist ränevoogu Vahemere piirkonnas, nn Dublini III määrust ja isikute üle piiri liikumist (C 646/16 ; C-490/16 ; C-643/15 ; C-647/15). Seisukohast, et piiriäärsete riikide Itaalia ja Kreeka pagulaste kohustuslik ümberjagamine on seaduslik. Vaata la lk. 1102-1119

  14. Võõrkeeleoskuse sertifikaat koolist kaasa / Nora Mals, Oleg Kravtšenko

    Index Scriptorium Estoniae

    Mals, Nora

    2006-01-01

    Tallinna Reaalkooli ja Keelekeskuse Puškin koostööst, mis annab võimaluse abiturientidele sooritada eri tasemega rahvusvahelisi teste, mille alusel keelekeskus väljastab riiklikud sertifikaadid, mida rahvusvaheliselt tunnustatakse

  15. 76 FR 2412 - Notice of Intent To Amend the Grand Junction Resource Management Plan, Prepare an Environmental...

    Science.gov (United States)

    2011-01-13

    ... initiates a Notice of Realty Action (NORA) to assist the BLM in determining whether granting the requested..., RMP Amendment, and NORA. DATES: Comments on this project, the NORA, or the proposed transfer of title...

  16. New highly active oxygen reduction electrode for PEM fuel cell and Zn/air battery applications (NORA). Final report

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, D.; Zuettel, A.

    2008-04-15

    This illustrated final report for the Swiss Federal Office of Energy (SFOE) presents the results of a project concerning a new, highly active oxygen reduction electrode for PEM fuel cell and zinc/air battery applications. The goal of this project was, according to the authors, to increase the efficiency of the oxygen reduction reaction by lowering the activation polarisation through the right choice of catalyst and by lowering the concentration polarisation. In this work, carbon nanotubes are used as support material. The use of these nanotubes grown on perovskites is discussed. Theoretical considerations regarding activation polarisation are discussed and alternatives to the use of platinum are examined. The results of experiments carried out are presented in graphical and tabular form. The paper is completed with a comprehensive list of references.

  17. The Launch of a Joint Library/Writing Centre Online Course on Academic Integrity. A Review of: Greer, K., Swanberg, S., Hristova, M., Switzer, A. T., Daniel, D., & Perdue, S. W. (2012. Beyond the web tutorial: Development and implementation of an online, self-directed academic integrity course at Oakland University. The Journal of Academic Librarianship, 38(5, 251-258.

    Directory of Open Access Journals (Sweden)

    Cari Merkley

    2013-06-01

    Full Text Available Objective – To outline the collaborative development of an online course addressing academic integrity by a university’s library system and writing centre.Design – Case study.Setting – A public research university in the Midwestern United States.Subjects – 1650 students who completed the online module.Methods – Oakland University (OU Libraries and the Writing Centre began to collaborate on the development of a new online course on academic integrity in 2011. It was felt that an existing online library tutorial on plagiarism no longer met the needs of students and faculty. The development of the course was informed by the Association of College and Research Libraries’ Information Literacy Competency Standards for Higher Education (2000 as well as a research study investigating students’ use of sources in their scholarly writing across several institutions. Moodle, the institution’s learning management system (LMS, was used to develop the learning object.Main Results – OU Libraries and the Writing Centre launched the six-part online course entitled “Using and Citing Sources” in January 2012. They developed modules around learning outcomes in five broad categories: defining academic integrity and plagiarism; the use of sources in academic writing; paraphrasing; quoting; and citation. The final module provided students with an opportunity to practise lessons learned in the first five modules. The use of the LMS to design and host the course limited the tutorial to registered students, but provided developers with access to additional course functionality without labour-intensive coding. It also allowed Writing Centre staff to access students’ performance data on the modules prior to their appointments. Improvements over the previous online tutorial included expanded content on academic ethics and referencing, more active learning elements, video content, and the opportunity for students to choose discipline-specific examples. In the first four months of its availability, 1650 students completed the course, with 3330 attempts overall.Conclusion – The diverse perspectives and expertise that individuals from OU Libraries and the Writing Center brought to their collaboration greatly informed the development of the course. The time and effort saved by using the university’s existing LMS to develop interactive content and the focus on providing students with opportunities for active learning within the course contributed to the project’s success.

  18. Effects of cortisol on cognition in major depressive disorder, posttraumatic stress disorder and borderline personality disorder - 2014 Curt Richter Award Winner.

    Science.gov (United States)

    Wingenfeld, Katja; Wolf, Oliver T

    2015-01-01

    Stress hormones influence a wide range of cognitive functions, including memory performance and executive function. It is well established that glucocorticoids enhance memory consolidation but impair memory retrieval. While most of the effects have been attributed to glucocorticoid receptors (GR), the importance of mineralocorticoid receptors (MR) has been also emphasized. Dysfunctions in hypothalamic-pituitary-adrenal (HPA) axis have been reported for several mental disorders. While major depressive disorder (MDD) as well as borderline personality disorder (BPD) seem to be characterized by enhanced cortisol release in concert with a reduced feedback sensitivity of the HPA axis, in posttraumatic stress disorder (PTSD) a contrary picture has been reported. Despite the fact that altered GR function has been discussed for these disorders only very few studies have investigated the effects of glucocorticoids on cognitive performance in these patients so far. In a series of studies, we investigated the effects of glucocorticoids on cognition (i.e. declarative memory, working memory and response inhibition) in different mental disorders such as MDD, PTSD and BPD. While in patients with MDD cortisol administration failed to effect memory retrieval, patients with PTSD and BPD showed enhanced rather than impaired memory retrieval after cortisol administration. These results indicate an altered sensitivity to cortisol in these disorders. Results from one of our recent studies in the field of social cognition underline the importance of the MR. We found that emotional empathy was enhanced through stimulation of the MR via fludrocortisone in healthy participants and women with BPD. This review aims to integrate these findings and discuss potential mechanisms and implications. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Remember Gerhard Richter in the Thunderstorm of Beethoven: The Influence of Cross-Sensory Coupling on Memory, Intercultural Communication, and the Verbalization of Paintings and Sounds

    OpenAIRE

    Martinez Emilie

    2014-01-01

    This interdisciplinary study focuses on the perception and verbalization of messages conveyed through instrumental music, soundscapes, and contemporary paintings. International young-adult university students learning German participated in a series of experiments conducted at Friedrich Schiller University in Jena, Germany. To incorporate globalization and cultural difference into this analysis, the author compared the reactions of Western and Asian participants to auditory and visual stimuli...

  20. Chronic subordinate colony housing paradigm: A mouse model for mechanisms of PTSD vulnerability, targeted prevention, and treatment-2016 Curt Richter Award Paper.

    Science.gov (United States)

    Reber, Stefan O; Langgartner, Dominik; Foertsch, Sandra; Postolache, Teodor T; Brenner, Lisa A; Guendel, Harald; Lowry, Christopher A

    2016-12-01

    There is considerable individual variability in vulnerability for developing posttraumatic stress disorder (PTSD); evidence suggests that this variability is related in part to genetic and environmental factors, including adverse early life experience. Interestingly, recent studies indicate that induction of chronic low-grade inflammation may be a common mechanism underlying gene and environment interactions that increase the risk for development of PTSD symptoms, and, therefore, may be a target for novel interventions for prevention or treatment of PTSD. Development of murine models with face, construct, and predictive validity would provide opportunities to investigate in detail complex genetic, environmental, endocrine, and immunologic factors that determine vulnerability to PTSD-like syndromes, and furthermore may provide mechanistic insight leading to development of novel interventions for both prevention and treatment of PTSD symptoms. Here we describe the potential use of the chronic subordinate colony housing (CSC) paradigm in mice as an adequate animal model for development of a PTSD-like syndrome and describe recent studies that suggest novel interventions for the prevention and treatment of PTSD. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Integrating surface and mantle constraints for palaeo-ocean evolution: a tour of the Arctic and adjacent regions (Arne Richter Award for Outstanding Young Scientists Lecture)

    Science.gov (United States)

    Shephard, Grace E.

    2016-04-01

    Plate tectonic reconstructions heavily rely on absolute motions derived from hotspot trails or palaeomagnetic data and ocean-floor magnetic anomaies and fracture-zone geometries to constrain the detailed history of ocean basins. However, as oceanic lithosphere is progressively recycled into the mantle, kinematic data regarding the history of these now extinct-oceans is lost. In order to better understand their evolution, novel workflows, which integrate a wide range of complementary yet independent geological and geophysical datasets from both the surface and deep mantle, must be utilised. In particular, the emergence of time-dependent, semi or self-consistent geodynamic models of ever-increasing temporal and spatial resolution are revealing some critical constraints on the evolution and fate of oceanic slabs. The tectonic evolution of the circum-Arctic is no exception; since the breakup of Pangea, this enigmatic region has seen major plate reorganizations and the opening and closure of several ocean basins. At the surface, a myriad of potential kinematic scenarios including polarity, timing, geometry and location of subduction have emerged, including for systems along continental margins and intra-oceanic settings. Furthermore, recent work has reignited a debate about the origins of 'anchor' slabs, such as the Farallon and Mongol-Okhotsk slabs, which have been used to refine absolute plate motions. Moving to the mantle, seismic tomography models reveal a region peppered with inferred slabs, however assumptions about their affinities and subduction location, timing, geometry and polarity are often made in isolation. Here, by integrating regional plate reconstructions with insights from seismic tomography, satellite derived gravity gradients, slab sinking rates and geochemistry, I explore some Mesozoic examples from the palaeo-Arctic, northern Panthalassa and western margin of North America, including evidence for a discrete and previously undescribed slab under present-day Greenland. While regional in focus, the methods and insights described have global applications and illustrate the power of an integrated approach.

  2. Reparación, restauración y reciclaje de la Casa Richter en Frutillar. Una intervención crítica sustentable

    Directory of Open Access Journals (Sweden)

    Edward Rojas

    2009-08-01

    Esta recuperación se realiza mediante una operación de "intervención crítica", que involucra no solo la reparación y tecnificación del viejo edificio de madera, sino que también la restauración que le devolverá la dignidad de antaño, así como el reciclaje de algunos espacios para adecuarlos a los requerimientos de su nuevo destino.

  3. 75 FR 30372 - Foreign-Trade Zone 38-Spartanburg County, SC; Application for Reorganization/Expansion under...

    Science.gov (United States)

    2010-06-01

    ... total)--International Transport Center, Victor Hill Rd., Greer, and Gateway International Business... operators/users located within a grantee's ``service area'' in the context of the Board's standard 2,000...., Laurens; Site 6 (20 acres)--Lakeside Business Center, 2355 Hwy. 101 South, Greer; Site 7 (19 acres)--ZF...

  4. The increase in cohabitation and the role of union status in family policies: A comparison of 12 European countries / Nora Sánchez Gassen, Brienna Perelli-Harris

    Index Scriptorium Estoniae

    Sánchez Gassen, Nora

    2015-01-01

    Artiklis käsitletakse koos elavate, kuid abielus mitteolevate inimeste arvukust, nende õigusi/õigusetust 12 Euroopa riigis (sh Eesti), aluseks Euroopa sotsiaaluuringu andmed ning autorite moodustatud poliitika andmebaas

  5. Inhibition of the essential oil from Chenopodium ambrosioides L. and α-terpinene on the NorA efflux-pump of Staphylococcus aureus.

    Science.gov (United States)

    de Morais Oliveira-Tintino, Cícera Datiane; Tintino, Saulo Relison; Limaverde, Paulo W; Figueredo, Fernando G; Campina, Fábia F; da Cunha, Francisco A B; da Costa, Roger H S; Pereira, Pedro Silvino; Lima, Luciene F; de Matos, Yedda M L S; Coutinho, Henrique Douglas Melo; Siqueira-Júnior, José P; Balbino, Valdir Q; da Silva, Teresinha Gonçalves

    2018-10-01

    This study was carried out to test the essential oil from C. ambrosioides leaves and its main constituent, α-Terpinene, in an antibacterial activity assay. As well, it was evaluated ability reduce resistance to norfloxacin and ethidium bromide was compared the Staphylococcus aureus 1199B whith 1199 wild type strain. The MIC of the C. ambrosioides essential oil and α-Terpinene were determined by microdilution method. The MIC of the essential oil and α-Terpinene presented a value ≥ 1024 μg/mL. However, when associated with antibacterials, the essential oil from C. ambrosioides leaves significantly reduced the MIC of antibiotics and ethidium bromide, characterizing an efflux pump inhibition. The C. ambrosioides essential oil, despite having no direct antibacterial activity against the S. aureus 1199B strain, showed a potentiating action when associated with antibacterial agents, this being attributed to an inhibition of efflux pumps. Copyright © 2018 Elsevier Ltd. All rights reserved.

  6. Nora's Daughters Have Grown Up. Women in Public Life in the Federal Republic of Germany. Special Analysis. Sozial-Report 7-82(e)

    Science.gov (United States)

    Kischke, Martina I.

    German women have achieved much of which their mothers only dreamed; however, there is still plenty of work to be done in the fight to secure equal rights. Women are becoming more involved in politics. For example, today 8.6% of parliament is female compared to 7.1% in 1949. German women are not drafted for military service, but they can now…

  7. Present Situation of Field Training for the Students of Accounting in Saudi Universities: A Field Study on Female Students of the Accounting Department – Princess Nora University

    Directory of Open Access Journals (Sweden)

    Mhasen Ali Khalil Alhaj

    2017-12-01

    Full Text Available This study aimed to explore the present situation of field training for the students of the accounting education in Saudi Universities, so as to raise its level and make the best use of it to gain practical experience and professional skills in accounting and other relevant field skills. To achieve this, a field study was conducted on trainee students of the Accounting Department – Princess Nourah University. To collect data for the study, a questionnaire consisting of two parts was used and distributed to groups of female students who were selected through the stratified random method. The sample represented students who were expected to graduate from the department, and who were registered in the Field Training Program. The sample involved students from different three academic levels, and various training days. The results showed statistically significant differences at (α =0.05 in the type of training for building accounting knowledge and skills of the students in the accounting department. This is attributed to the different training institutions. The results also revealed that writing graduation research simultaneously with the training program, whose allotted time is inadequate, would reduce the chance of gaining the desired experiences of field training. It was also clear that discontinuous training would hinder the students from getting the appropriate training opportunities, and that conducting training during the summer semester seemed sufficient and appropriate. Keywords: Accounting education, Field training.

  8. The ghost of Nora Batty: A qualitative exploration of the impact of footwear, bandaging and hosiery interventions in chronic wound care.

    Science.gov (United States)

    Madden, Mary

    2015-09-01

    To explore the impact of footwear, bandaging and hosiery interventions in the everyday lives of women and men undergoing treatment for chronic, complex wounds in a city in England, UK. This study draws on data generated in semi-structured interviews with patients exploring outcomes and impacts of undergoing treatment for leg and foot ulcers undertaken as part of a UK National Institute for Health Research funded study. Footwear, bandaging and hosiery are explored here as aspects of material culture, not only in functional terms as a treatment supporting or hindering healing but also as part of the means by which people receiving treatment for two of the most common complex, chronic wounds, leg ulcers and foot ulcers, negotiate and understand their embodied selves in everyday life. Physical and social discomfort associated with interventions can lead to ambivalence about effectiveness. Not being able to dress appropriately impacts on the ability of people to feel comfortable and take part in special occasions and everyday events. In this context, the removal of bandaging or refusal to wear support hosiery which may be viewed as 'non-compliance' by a health professional may feel like a strategy of self-care or self-preservation from a patient perspective. The study of material culture explores how inanimate objects work and how they are worked with in carrying out social functions, regulating social relations and giving symbolic meaning to human activity. The interviews show some of the ways in which footwear, hosiery and bandaging play a role in controlling the boundaries between the private (wounded and potentially socially unacceptable smelly, leaky, embodied), self and the public presentation of self. © The Author(s) 2015.

  9. Publications - GMC 234 | Alaska Division of Geological & Geophysical

    Science.gov (United States)

    following North Slope wells: Itkillik River Unit #1, Nora Fed #1, Toolik Fed #1, Kemik Unit #1, Lupine Unit following North Slope wells: Itkillik River Unit #1, Nora Fed #1, Toolik Fed #1, Kemik Unit #1, Lupine Unit

  10. 76 FR 9814 - Proposed Collection, Comment Request

    Science.gov (United States)

    2011-02-22

    ... 25, 2011. ADDRESSES: Send comments to Nora Kincaid, BLS Clearance Officer, Division of Management... INFORMATION CONTACT: Nora Kincaid, BLS Clearance Officer, at 202-691-7628 (this is not a toll free number...

  11. 78 FR 50449 - Proposed Collection, Comment Request

    Science.gov (United States)

    2013-08-19

    ... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS...

  12. 78 FR 29383 - Proposed Collection, Comment Request

    Science.gov (United States)

    2013-05-20

    ... comments to Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics... by fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora...

  13. 76 FR 2149 - Proposed Collection, Comment Request

    Science.gov (United States)

    2011-01-12

    ... comments to Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics... by fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora...

  14. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Process Funding Priorities Research Training News & Events News Nora's Blog NIDA in the News NIDA Notes Podcasts ... of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director The Link ...

  15. 77 FR 11593 - Proposed Collection, Comment Request

    Science.gov (United States)

    2012-02-27

    ... in the Addresses section of this notice on or before April 27, 2012. ADDRESSES: Send comments to Nora... (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS Clearance Officer...

  16. Living with Hearing Loss

    Science.gov (United States)

    ... version of this page please turn Javascript on. Nora Woodruff and her family, including dad Bob, have ... hearing, balance, smell, taste, voice, speech, and language. Nora Woodruff, daughter of ABC newsman Bob Woodruff and ...

  17. 77 FR 36296 - Proposed Collection, Comment Request

    Science.gov (United States)

    2012-06-18

    ... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS...

  18. 75 FR 55612 - Proposed Collection, Comment Request

    Science.gov (United States)

    2010-09-13

    ... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid...

  19. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects Contact the ... News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects National Drug & ...

  20. US Navy Transfers Research Vessel to Philippine Navy > U.S. Pacific Command

    Science.gov (United States)

    , 2016 EMAIL PRINT Photos 1 of 1 SAN DIEGO (April 27, 2016) - Vice Adm. Nora Tyson, left, commander of Philippines oceanographic research and study capabilities. SAN DIEGO (April 27, 2016) - Vice Adm. Nora Tyson part in that relationship," said Vice Adm. Nora Tyson, commander, U.S. 3rd Fleet. "Today, we

  1. Reliability and construct validity for scale of rejection of Christianity.

    Science.gov (United States)

    Robbins, Mandy; Francis, Leslie J; Bradford, Amanda

    2003-02-01

    A sample of 16 male and 30 female undergraduates completed the Greer and Francis Scale of Rejection of Christianity. The data support the internal consistency reliability and construct validity of the scale for this sample.

  2. Inequality and Education

    Science.gov (United States)

    Lasch, Christopher

    1973-01-01

    Reviews a book by Christopher Jencks et al., examining a number of statistical correlations between income and schooling; and also books by Katz, Spring, and Greer respectively, examining the historical development of the American public school. (JM)

  3. Redefining U.S. Arctic Strategy

    Science.gov (United States)

    2015-05-15

    responsibility shifts 21 Barno, David and Nora Bensahel. The Anti-Access Challenge you’re not thinking...International Affairs 85, no. 6 (2009). 38 Barno, David and Nora Bensahel. THE ANTI-ACCESS CHALLENGE YOU’RE NOT THINKING ABOUT, 05 May 2015...and Rescue in the Arctic, 22 June 2011. Arctic Council Secretariat. About the Arctic Council, Arctic Council, 2011. Barno, David and Nora

  4. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Funding Opportunities Clinical Research Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's ...

  5. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Opportunities Clinical Research Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog ...

  6. Building and Maintaining Organizational Infrastructure to Attain Clinical Excellence.

    Science.gov (United States)

    Lebak, Kelly; Lane, Jason; Taus, Richard; Kim, Hansol; Stecker, Michael S; Hall, Michael; Lane-Fall, Meghan B; Weiss, Mark S

    2017-12-01

    Active maintenance of highly functional teams is critical to ensuring safe, efficient patient care in the non-operating room anesthesia (NORA) suite. In addition to developing collaborative relationships and patient care protocols, individual and team training is needed. For anesthesiologists, this training must begin during residency. The training should be supplemented with continuing education in this field for providers who find themselves working in the NORA space. As NORA continues to grow, robust NORA-specific quality assurance and improvement programs will empower anesthesiologists with the tools they need to best care for these patients. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Second Announcement - ESO/ST-ECF Workshop on NICMOS and the VLT: A New Era of High-Resolution Near-Infrared Imaging and Spectroscopy - May 26-27, 1998 - Hotel Baia di Nora, Pula, Sardinia, Italy

    Science.gov (United States)

    1998-03-01

    ST-ECF and ESO are organising in collaboration with the NICMOS IDT and STScI a workshop on near infrared imaging from space and ground. The purpose of the workshop is to review what has been achieved with the Near Infrared and Multi Object Spectrograph (NICMOS) on board of HST, what can be achieved in the remaining lifetime of the instrument, and how NICMOS observations can be optimised taking into account the availability of IR imaging and spectroscopy on ESO's Very large Telescope (VLT) in the near future. The meeting will be held in May 1998, about one year after science observations started with NICMOS, and about half a year before the Infrared Spectrometer and Array Camera (ISAAC) starts to operate on the VLT. Currently, it is expected that NICMOS will operate until the end of 1998.

  8. Publications - GMC 155 | Alaska Division of Geological & Geophysical

    Science.gov (United States)

    : Brontosaur U.S. #1, Northstar #1, Nora Fed #1, OCS Y-0180-1 (Seal Island A-4), OCS Y-0338-1, Beli Unit #1 following seven North Slope wells: Brontosaur U.S. #1, Northstar #1, Nora Fed #1, OCS Y-0180-1 (Seal Island

  9. Convergent evolution of argonaute-2 slicer antagonism in two distinct insect RNA viruses.

    NARCIS (Netherlands)

    Mierlo, J.T. van; Bronkhorst, A.W.; Overheul, G.J.; Sadanandan, S.A.; Ekstrom, J.O.; Heestermans, M.; Hultmark, D.; Antoniewski, C.; Rij, R.P. van

    2012-01-01

    RNA interference (RNAi) is a major antiviral pathway that shapes evolution of RNA viruses. We show here that Nora virus, a natural Drosophila pathogen, is both a target and suppressor of RNAi. We detected viral small RNAs with a signature of Dicer-2 dependent small interfering RNAs in Nora virus

  10. Publications - GMC 183 | Alaska Division of Geological & Geophysical

    Science.gov (United States)

    materials: AK State C #1, Bush Federal #1, Echooka Unit #1, Fin Creek Unit #1, E. De K. Leffingwell #1, Nora materials: AK State C #1, Bush Federal #1, Echooka Unit #1, Fin Creek Unit #1, E. De K. Leffingwell #1, Nora

  11. Publications - GMC 164 | Alaska Division of Geological & Geophysical

    Science.gov (United States)

    Staines St. 10-09-23, Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 , Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 (Orion #1), OCS Y-0334

  12. New data on the Lower Cambrian trilobites of Cortijos de Malagon (Spain

    Directory of Open Access Journals (Sweden)

    Jago, J. B.

    1989-04-01

    Full Text Available A Small trilobite fauna from the late Lower Cambrian Sanstones from Los Cortijos de Malagon of Southem Spain is described herein. This fauna ineludes the following taxa: Realaspis (? sp.; Kingaspis (? sp.; cf. Latoucheia sp. and Lusatiops afI. ribotanusd, Richter and Richter, 1948.En este trabajo se describe la fauna de trilobites del Cámbrico inferior de las areniscas de los Cortijos de Malagón en el SE español. Comprende Realaspis (? sp., Kingaspis (? sp.; cf. Latoucheia sp. y Lusatiops afI. ribotanus. Richter y Richter, 1948.

  13. Antibacterial activity of berberine-NorA pump inhibitor hybrids with a methylene ether linking group.

    Science.gov (United States)

    Samosorn, Siritron; Tanwirat, Bongkot; Muhamad, Nussara; Casadei, Gabriele; Tomkiewicz, Danuta; Lewis, Kim; Suksamrarn, Apichart; Prammananan, Therdsak; Gornall, Karina C; Beck, Jennifer L; Bremner, John B

    2009-06-01

    Conjugation of the NorA substrate berberine and the NorA inhibitor 5-nitro-2-phenyl-1H-indole via a methylene ether linking group gave the 13-substituted berberine-NorA inhibitor hybrid, 3. A series of simpler arylmethyl ether hybrid structures were also synthesized. The hybrid 3 showed excellent antibacterial activity (MIC Staphylococcus aureus, 1.7 microM), which was over 382-fold more active than the parent antibacterial berberine, against this bacterium. This compound was also shown to block the NorA efflux pump in S. aureus.

  14. Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (80th, Chicago, Illinois, July 30-August 2, 1997): Communication Theory and Methodology.

    Science.gov (United States)

    Association for Education in Journalism and Mass Communication.

    The Communication Theory and Methodology section of the Proceedings contains the following 17 papers: "Extra! Extra! Read All About It: Attention and Memory for Deviant and Imagistic Headlines" (Jennifer Borse and others); "Refining a Uses and Gratification Scale for Television Viewing" (Jennifer Greer, Cyndi Frisby, and David…

  15. Fattening Up without Overeating

    OpenAIRE

    Watts, Jennifer L.

    2008-01-01

    When food becomes scarce, animals undergo distinct metabolic, behavioral, and physiological changes that allow them to survive. In this issue, Greer et al. (2008) take advantage of the relatively simple and well-characterized nervous system of C. elegans to elucidate a neural circuit regulating feeding behavior and fat storage.

  16. Metacognition, Motivation, and Emotions: Contribution of Self-Regulated Learning to Solving Mathematical Problems

    Science.gov (United States)

    Tzohar-Rozen, Meirav; Kramarski, Bracha

    2014-01-01

    Mathematical problem solving is one of the most valuable aspects of mathematics education. It is also the most difficult for elementary-school students (Verschaffel, Greer, & De Corte, 2000). Students experience cognitive and metacognitive difficulties in this area and develop negative emotions and poor motivation, which hamper their efforts…

  17. The pollination of Canavalia virosa by Xylocopid and Magachilid bees

    Directory of Open Access Journals (Sweden)

    C. H. Stirton

    1977-11-01

    Full Text Available The floral morphology of Canavalia virosa (Roxb. Wight & Arn. is discussed in relation to pollination by Xylocopa flavorufa De Greer and  Megachile combusta Sm. It was found that the relationship between size of flower and bee influenced the type of pollinating strategy and its success. Bees smaller than M. combusta proved ineffective pollinators.

  18. Measuring the Impact of the Micronegotiation Technique on Team Member Satisfaction and Team Performance

    Science.gov (United States)

    Kaufman, Jeffery David

    2013-01-01

    Conflict is not an uncommon element of team interactions and processes; however, if unchecked it can cause issues in the ability of the team to achieve maximum performance. Research on task conflict and relationship conflict by de Wit, Greer, and Jehn (2012) found that while in many cases task conflict and relationship conflict within teams can…

  19. Fiscal Year 2014 United States Army Corps of Engineers -Civil Works Annual Financial Report: Maintaining Readiness Through Fiscal Responsibility

    Science.gov (United States)

    2014-01-01

    most prevalent deficiencies are vegetation, encroachments, and culverts; however, the largest risk drivers are flaws in the foundation and growing...Supply Hartwell Lake, GA & SC; Beaver Lake, AR; Greers Ferry Dam and Lake, AR; Willamette River Basin Review, OR (Coast Fork); and Sulphur River Basin, TX

  20. Intentional Unilateral Epidural Block for Surgery in a Pregnant Patient

    African Journals Online (AJOL)

    Kuczkowski KM. The safety of anaesthetics in pregnant women .Expert Opin Drug Saf. 2006. Mar;5(2):251-64. Review. 6. Steinberg ES, Santos AC: Surgical anesthesia during pregnancy. IntAnesthesiolClin1990;28:58-66. 7. Duncan PG, Pope WD, Cohen MM, Greer N: Fetal risk of anesthesia and surgery duringpregnancy.

  1. 78 FR 4162 - Endangered Species; Receipt of Applications for Permit

    Science.gov (United States)

    2013-01-18

    ...) Those supported by quantitative information or studies; and (2) Those that include citations to, and..., Greer, SC; PRT-89822A The applicant requests a permit to import a sport-hunted trophy of two male... import the sport- hunted trophy of one male bontebok (Damaliscus pygargus pygargus) culled from a captive...

  2. Poverty Analysis of Children in Child Headed Households in Addis ...

    African Journals Online (AJOL)

    This study attempts to analyse the economic and social situation of children living in child‐headed households using a poverty analysis framework. The study used family of indexes developed by Foster, Greer and Thorbecke (1984) commonly known as FGT measures to measure aggregate poverty and micro‐econometric ...

  3. Human cathelicidin LL-37 – Does it influence the homeostatic ...

    Indian Academy of Sciences (India)

    70

    37; pulmonary tuberculosis; schizophrenia. 1. Introduction. Cathelicidins are ..... higher LL-37 levels in the cerebrospinal fluid and serum of children with ... found to be lower in cultured epidermal cells taken from biopsies of diabetic foot ulcers .... Greer A, Zenobia C and Darveau RP 2013 Defensins and LL-37: a review of ...

  4. Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (82nd, New Orleans, Louisiana, August 3-8, 1999). Magazine and Visual Communication Divisions.

    Science.gov (United States)

    Association for Education in Journalism and Mass Communication.

    The Magazine and Visual Communication Divisions section of the Proceedings contains the following 8 papers: "Beefcake, Breadwinner, or Babysitter: A Content Analysis of Male Images in Female-Targeted Magazine Advertising, 1978-1998" (Mikalee Dahle and Jennifer Greer); "The Impact of Larry Flynt: An Overview of One Publisher's Legal…

  5. Situation Creator: A Pedagogical Agent Creating Learning Opportunities

    NARCIS (Netherlands)

    Miao, Yongwu; Hoppe, Ulrich; Pinkwart, Niels

    2007-01-01

    Miao, Y., Hoppe, H. U., & Pinkwart, N. (2007). Situation Creator: A Pedagogical Agent Creating Learning Opportunities. In R. Luckin, K. Koedinger & J. Greer (Eds.), Proceedings of the 13th International Conference on Artificial Intelligence in Education (pp. 614-617). Amsterdam, The Netherlands: IOS

  6. Tobacco advertising in South Africa with specific reference to ...

    African Journals Online (AJOL)

    Tobacco advertising in South Africa with specific reference to magazines. Derek Yach, Greer Paterson. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  7. Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (81st, Baltimore, Maryland, August 5-8, 1998). Advertising.

    Science.gov (United States)

    Association for Education in Journalism and Mass Communication.

    The Advertising section of the Proceedings contains the following 18 papers: "The Birth of Adwatches: Political Advertising Becomes Front-Page News" (Jennifer Greer); "A Cross-Cultural Comparison of the Effects of Source Credibility on Attitudes and Behavioral Intentions" (Kak Yoon, Choong Hyun Kim, and Min-Sun Kim);…

  8. Evaluation of the contributions of selected non-timber forest products ...

    African Journals Online (AJOL)

    Evaluation of the contributions of selected non-timber forest products to food security and income generation, in Imo State, Nigeria. ... Data were analyzed using descriptive statistics, Z-test and Foster-Greer-Thorbecke (FGT) metric. The result revealed that 98% of the respondents consumed the three NTFPs as food and ...

  9. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Research Reports Mind Over Matter Science of Addiction Funding Funding Opportunities Clinical Research Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog ...

  10. Lahkumata hüvasti jättes / Urmas Petti

    Index Scriptorium Estoniae

    Petti, Urmas, 1965-2016

    2013-01-01

    Baltisaksa Kultuuri Seltsi kultuuripäevadest Mare Balticum Helsingis 2012. a. ; autor kommenteerib Baltisaksa Kultuuri Selts esimeest Frank von Auerit ja Läti Baltisaksa Keskuse Domus Rigensis juhatajat Nora Rutke't

  11. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Director of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director The ... their peers to prevent the spread of this disease. NIDA's public service announcements depict the devastating consequences ...

  12. Uuslavastused Ugalas / Helle Leppik

    Index Scriptorium Estoniae

    Leppik, Helle

    2007-01-01

    Ugalas käib töö nelja uuslavastusega : Ott Aardam lavastab "Börs ja Börsitar", Helen Rekkor toob lavale "Nora/Maja", Peeter Tammearu suvelavastus on "Sirelikassid" ja Margus Vaher lavastab suvelavastuse "Naabri Mari"

  13. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects Contact the Press Office Meetings & Events Media ...

  14. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects Contact the Press Office Meetings & Events Media ...

  15. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... their lives , but now their night out always will be associated with HIV/AIDS. The “d’cisions” ... for breaking the harmful links between them, we will continue to update this Web site. Sincerely, Nora ...

  16. Why Are Drugs So Hard to Quit?

    Medline Plus

    Full Text Available ... Autoplay When autoplay is enabled, a suggested video will automatically play next. Up next Drugs: Shatter The ... Nora Volkow on Addiction: A Disease of Free Will - Duration: 21:12. National Institute on Drug Abuse ( ...

  17. Why Are Drugs So Hard to Quit?

    Medline Plus

    Full Text Available ... Get YouTube Red. Working... Not now Try it free Find out why Close Why Are Drugs So ... Dr. Nora Volkow on Addiction: A Disease of Free Will - Duration: 21:12. National Institute on Drug ...

  18. Environmental risk factors for oesophageal cancer in Malawi: A case ...

    African Journals Online (AJOL)

    Firewood cooking, cigarette smoking, and use of white maize flour all had ... Environmental exposures may be important risk factors ... Correspondence to: Nora E. Rosenberg ..... including in southern Africa.29 To our knowledge, this is the ...

  19. 78 FR 65302 - Notice of Public Meetings for the Draft Environmental Impact Statement/Overseas Environmental...

    Science.gov (United States)

    2013-10-31

    ... FURTHER INFORMATION CONTACT: Ms. Nora Macariola-See, Naval Facilities Engineering Command, Pacific. Attention: MITT EIS/OEIS, 258 Makalapa Drive, Suite 100, Building 258, Floor 3, Pearl Harbor, Hawaii 96860...

  20. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's ... syndrome). AIDS is a disease of the immune system for which there is treatment, but no cure, ...

  1. Hooaeg, mis kadus pildilt / Krista Kaldvee

    Index Scriptorium Estoniae

    Kaldvee, Krista

    2008-01-01

    Ugala teatri hooajast 2007/2008. Peatutakse etendustel "Nora/Maja", "Runar ja Kyllikki", "Põhjas", "Kolm meest paadis", "Kunst", "Ühes Eesti teises linnas", "Kolm õde", "Linnapea" ja nende kajastamisel eesti meedias

  2. Why Are Drugs So Hard to Quit?

    Medline Plus

    Full Text Available ... views 10:34 Dr. Nora Volkow on NIDA's Neuroscience Research - Duration: 4:05. National Institute on Drug ... Language: English Location: United States Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators ...

  3. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... from the Director of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director ... D. Volkow, M.D. Director National Institute on Drug Abuse Collaborators Thanks to Those Who Have Helped Raise ...

  4. The Case for Quality Book Selection.

    Science.gov (United States)

    Bob, Murray C.

    1982-01-01

    This essay on library book selection critiques Nora Rawlinson's article on practices at the Baltimore County Public Library which appeared in Library Journal, November 15, 1981, p. 2188, and discusses library circulation statistics in relation to book selection. (EJS)

  5. Influência das avós na alimentação de lactentes: o que dizem suas filhas e noras Influencia de las abuelas en la alimentación de lactantes Influence of grandmothers on infant feeding: what they say to their daughters and granddaughters

    Directory of Open Access Journals (Sweden)

    Fabiana de Medeiros Gross

    2011-01-01

    Full Text Available OBJETIVO: Identificar as práticas de primíparas sobre a alimentação de crianças lactentes aprendidas com a mãe e/ou sogra. MÉTODOS: Trata-se de pesquisa qualitativa, do tipo descritiva. Os sujeitos foram 11 primíparas, usuárias do Sistema Único de Saúde de Palmeira das Missões/RS. Os dados foram coletados por entrevista semiestruturada e analisados por meio da análise temática. RESULTADOS: Emergiram três temas: práticas de alimentação transmitidas pelas avós; influência das avós na alimentação do lactente; sentimentos das primíparas em relação às ações das avós relativas à alimentação do lactente. CONCLUSÕES: As avós são importantes no que diz respeito à transmissão de conhecimentos, saberes e experiências relativas à alimentação do lactente. Para que a assistência de enfermagem priviligie a autonomia dos sujeitos que envolve corresponsabilidade e congruência cultural, o enfermeiro deve considerar as interações do grupo familiar que, em seu movimento dialético, modulam e são moduladas pela cultura.OBJETIVO: Identificar las prácticas de primigestas sobre la alimentación de niños lactantes aprendidas con la madre y/o suegra. MÉTODOS: Se trata de una investigación cualitativa, de tipo descriptiva. Los sujetos fueron 11 primigestas, usuarias del Sistema Único de Salud de Palmeira das Missões/RS. Los datos fueron recolectados por entrevista semiestructurada y analizados por medio del análisis temático. RESULTADOS: Emergieron tres temas: prácticas de alimentación transmitidas por las abuelas; influencia de las abuelas en la alimentación del lactante; sentimientos de las primigestas en relación a las acciones de las abuelas relativas a la alimentación del lactante. CONCLUSIONES: Las abuelas son importantes en lo referente a la transmisión de conocimientos, saberes y experiencias relativas a la alimentación del lactante. Para que la asistencia de enfermería privilegie la autonomía de los sujetos que involucra corresponsabilidad y congruencia cultural, el enfermero debe considerar las interacciones del grupo familiar que, en su movimiento dialéctico, modulan y son moduladas por la cultura.OBJECTIVE: To identify practices of primiparas about infant feeding of infants learned from the mother and/or grandmother. METHODS: This was a qualitative, descriptive research study. The subjects were 11 primiparas, who used the Unified Health System of Palmeira das Missões/ RS. Data were collected through semi-structured interviews and analyzed using thematic analysis. RESULTS: Three themes emerged: practices of infant feeding transmitted by grandmothers; influence of grandmothers on infant feeding; feelings of primiparas in regard to the actions of grandmothers on infant feeding. CONCLUSIONS: The grandmothers are important with regard to the transmission of knowledge, wisdom and experiences related to infant feeding. For nursing care focused on the subjects' autonomy and responsibility that involves cultural congruence, the nurse should consider that the interactions of the family group, in its dialectical movement, modulate and are modulated by their culture.

  6. Relational conflict is not too bad for employees when they have developed their emotional intelligence skills

    OpenAIRE

    Benitez, Miriam; Serrano-Ortega, Juan Antonio

    2017-01-01

    Team conflict constitutes one of the most prevalent team processes in the workplace (Benítez et al., 2011; De Dreu, 2010), especially in competitive organizational contexts, such as, university organizations (Matthiesen & Einarsen, 2007). De Wit, Greer, & Jehn (2012) 's methanalysis showed that, team conflict is not always negative for employees well-being. Its effects are depending on the conflict type and conflict contexts. In this sense, research has shown that, task conflict could be posi...

  7. The relationship between task conflict, task performance and team member satisfaction: the mediating role of relationship conflict

    OpenAIRE

    Hansen, Rebecca

    2015-01-01

    Task conflict and its potential positive effect on team outcomes has been questioned over the years. The findings have been inconsistent, with different studies indicating that task conflict can be positively related, negatively related or unrelated to measures of team outcomes. This study is a response to the request presented in de Wit, Greer and Jehn s (2012) recent meta-analysis, to further investigate the effect relationship conflict can have on the association between task conflict and...

  8. Analysis of a Rapidly Solidified High-Phosphorus Austenitic Steel Containing an Amorphous Phase.

    Science.gov (United States)

    1981-12-01

    electrodeposited nickel by a combination of Jet electro- polishing and ion-beam milling. Specimens were observed in a Vacuum Generators HB-5 scanning...the cell walls in these powders is one of suppressed crystal growth rather than nucleation , since the glass is formed in direct contact with the...Cohen, this Symposium. 5. T. F. Kelly, Ph.D. Thesis , MIT, February 1982. 6. C. V. Thompson, A. L. Greer, and A. J. Drehman, Proc. 4th Intl. Conf

  9. Loglines. May-June 2014

    Science.gov (United States)

    2014-06-01

    Kathleen T. Rhem Editor: Jacob Boyer Layout/Design: Paul Henry Crank Writers: Beth Reece Sara Moore Amanda Neumann Loglines is prepared...www.logisticsinformationservice.dla.mil dla.tng@dla.mil Jake Logan , a maintenance employee from the U.S. Army Corps of Engineers’ Greers Ferry Project...of their expertise. “The Joint Petroleum Seminar is designed to gather joint petroleum Defense, both incoming and incumbent, and expose them to

  10. Will we ever see their like again? Departing directors at the top US physics laboratories leave a discipline in search of inspired leadership

    CERN Multimedia

    1998-01-01

    Burt Richter stands down next August as director of the Stanford Linear Accelerator Centre. His departure follows that of Nick Samios from Brookhaven National Laboratory and the retirement next year of John Peoples from Fermilab.

  11. Electrocardiographic features of patients with earthquake related posttraumatic stress disorder

    OpenAIRE

    İlhan, Erkan; Kaplan, Abdullah; Güvenç, Tolga Sinan; Biteker, Murat; Karabulut, Evindar; Işıklı, Serhan

    2013-01-01

    AIM: To analyze electrocardiographic features of patients diagnosed with posttraumatic stress disorder (PTSD) after the Van-Erciş earthquake, with a shock measuring 7.2 on the Richter scale that took place in Turkey in October 2011.

  12. Cardiovascular disease risk factors in 5-year-old urban South ...

    African Journals Online (AJOL)

    Cardiovascular disease risk factors in 5-year-old urban South African children the birth to ten study. Krisela Steyn, Thea de Wet, Linda Richter, Noel Cameron, Naomi S Levitt, Christopher Morrell ...

  13. V strane piramid : zhizn i trudõ Otto Friedricha von Richtera / Sergei Stadnikov ; tõlk. Veronika Einberg

    Index Scriptorium Estoniae

    Stadnikov, Sergei, 1956-

    2003-01-01

    Vastse-Kuustest pärit egüptoloogist Otto Friedrich von Richter'ist (1791-1816). Richteri ja Lindmani Egiptuse-Nuubia ekspeditsioonist, Tartu Ülikooli Muinasteaduse muuseumile annetatud kollektsioonist

  14. Earthquake Recurrence and the Resolution Potential of Tectono‐Geomorphic Records

    KAUST Repository

    Zielke, Olaf

    2018-01-01

    combination consistently reproduces the above‐mentioned field observations. Doing so, I find that neither a purely characteristic earthquake (CE) nor a Gutenberg–Richter (GR) earthquake recurrence model is able to consistently reproduce those field

  15. Gendered differences in AIDS and AIDS-related cause of death ...

    African Journals Online (AJOL)

    Nicole De Wet

    2016-10-14

    Oct 14, 2016 ... et al., 2004; Phakathi, Van Rooyen, Fritz, & Richter, 2011). Despite the ..... AIDS mortality than their male counterparts (Clark, Collinson,. Kahn ... death notification data in South Africa: 1997-2004 (Report No. 03-09-05). Pre-.

  16. Oceanographic profile Zooplankton biomass measurements collected using net in the Arctic Ocean from 1991 to 1995 (NODC Accession 0000970)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Mumm, Nicolai, H. Auel, H. Hanssen, W. Hagen, C. Richter, and H.J. Hirche. 1998. Breaking the ice: large-scale distribution of mesozooplankton after a decade of...

  17. Risk-taking under progressive taxation

    OpenAIRE

    Bamberg, Günter

    1988-01-01

    Risk-taking under progressive taxation : 3 partial effects / Günter Bamberg ; Wolfram R. Richter. - In: Measurement in economics / ed. by Wolfgang Eichhorn. - Heidelberg : Physica-Verl., 1988. - S. 479-497

  18. Does systematic variation improve the reproducibility of animal experiments?

    NARCIS (Netherlands)

    Jonker, R.M.; Guenther, A.; Engqvist, L.; Schmoll, T.

    2013-01-01

    Reproducibility of results is a fundamental tenet of science. In this journal, Richter et al.1 tested whether systematic variation in experimental conditions (heterogenization) affects the reproducibility of results. Comparing this approach with the current standard of ensuring reproducibility

  19. The United States Air Force and Humanitarian Airlift Operations 1947-1994

    Science.gov (United States)

    1998-01-01

    Ecuador . Aftershocks in southern Ecuador on December 10 compounded the destruction in cities and villages such as Loja , Cariamango, Celica, and Alamor... Ecuador . Date(s): August 10–19, 1949. Emergency: An earthquake measuring 7.5 on the Richter scale struck central Ecuador . Air Force Organization(s...Operations: A severe earthquake registering 7.5 on the Richter scale struck the high valleys of central Ecuador in the Andes on Thursday, August 4

  20. Nine Years of Cooperation: The US-German Memorandum of Understanding (MoU) on Helicopter Aeromechanics 2003-2012

    Science.gov (United States)

    2013-12-01

    qualities of side-stick controlled helicopters was given the “Ian Cheeseman Best Paper Award” at the Eu - ropean Rotorcraft Forum 2012. ii    As...Forum of the AHS, Phoenix, 2006 35    [22] Gardner, Anthony D., Richter, Kai, Rosemann, Henning : Simulation of Oscillat- ing Airfoils and Moving Flaps...Numerical Methods, 65th Annual Forum of the AHS, Grape- vine, TX, 2009 [26] Gardner, Anthony D., Richter, Kai, Rosemann, Henning : Numerical Investiga

  1. Conodonta, Trilobita, and Anthozoa near the Late Frasnian Upper Kellwasser Event of the Geipel Quarry section in Schleiz, Thuringian Mountains (Germany

    Directory of Open Access Journals (Sweden)

    D. Weyer

    2003-01-01

    Full Text Available New recoveries of Trilobita, Anthozoa and Conodonta from the linguiformis Zone close to the Frasnian/Famennian boundary and Immediately preceding the Upper Kellwasser Event level at Schleiz (Thuringia are investigated. The trilobites species are Harpes neogracilis Richter & Richter, 1924, Palpebralia cf. brecciae (Richter, 1913 and Acuticryphops acuticeps (Kayser, 1889, the latter is represented by several morphs with different numbers of eye-lenses; the trend to eye-reduction is discussed. The Rugosa fauna that was nearly unknown from the psychrospheric facies worldwide, comprise six taxa of the Cyathaxoniina. The rich conodont faunas permit tracing the exact boundary between the top of the Late Palmatolepis rhenana Zone and the Palmatolepis linguiformis Zone. Im Niveau der Frasnium/Famennium-Grenze werden neue Fossilfunde der letzten Trilobita, Anthozoa und Conodonta aus der linguiformis-Zone (vor dem Oberen Kellwasser-Event mitgeteilt. Harpes neogracilis Richter & Richter, 1924, Palpebralia cf. brecciae (Richter, 1913 und Acuticryphops acuticeps (Kayser, 1889 wurden beobachtet; bei letzterem wird an Hand verschiedener Morphen mit unterschiedlicher Linsenzahl der Trend zur Augenreduktion diskutiert. Von der Rugosa-Fauna, die weltweit aus solcher psychrosphaerischer Fazies fast unbekannt blieb, sind sechs Taxa der Cyathaxoniina skizziert. Die reichen Condonta-Faunen erlauben eine präzise Grenzziehung zwischen dem Top der Late Palmatolepis rhenana-Zone und der Palmatolepis linguiformis-Zone. doi:10.1002/mmng.20030060104

  2. Substituted dihydronaphthalenes as efflux pump inhibitors of Staphylococcus aureus

    DEFF Research Database (Denmark)

    Thota, Niranjan; Reddy, Mallepally V; Kumar, Ashwani

    2010-01-01

    A new series of 3-(substituted-3,4-dihydronaphthyl)-2-propenoic acid amides has been prepared through convergent synthetic strategies and tested in combination with ciprofloxacin against NorA overexpressing Staphylococcus aureus 1199B as test strain for potentiating of the drug activity. Out of 24...... compounds evaluated, 12 compounds potentiated the activity of ciprofloxacin and resulted in 2-16 fold reduction in the MIC (4-0.5 microg/mL) of the drug. The failure of these efflux pump inhibitors (EPIs) to potentiate the activity of ciprofloxacin when tested against NorA knock out S. aureus SA-K1758...

  3. AcEST: BP913708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ial protein cyt-4 OS=Neurospora c... 32 1.3 sp|P23975|SC6A2_HUMAN Sodium-dependent nora...drenaline transporter... 30 4.9 sp|O55192|SC6A2_MOUSE Sodium-dependent noradrenaline transporter... 29...+ Sbjct: 237 LLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFV 273 >sp|O55192|SC6A2_MOUSE Sodium-dependent nora...RERHA-------KTLANI 982 Query: 183 N--NKALFQALV 212 + N+ + QALV Sbjct: 983 DGRNELILQALV 994 >sp|P23975|SC6A2_...HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens GN=SLC6A2 PE=1 S

  4. Implementation and Use of Anesthesia Information Management Systems for Non-operating Room Locations.

    Science.gov (United States)

    Bouhenguel, Jason T; Preiss, David A; Urman, Richard D

    2017-12-01

    Non-operating room anesthesia (NORA) encounters comprise a significant fraction of contemporary anesthesia practice. With the implemention of an aneshtesia information management system (AIMS), anesthesia practitioners can better streamline preoperative assessment, intraoperative automated documentation, real-time decision support, and remote surveillance. Despite the large personal and financial commitments involved in adoption and implementation of AIMS and other electronic health records in these settings, the benefits to safety, efficacy, and efficiency are far too great to be ignored. Continued future innovation of AIMS technology only promises to further improve on our NORA experience and improve care quality and safety. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. Lesnoi tsvetok : [luuletused] / Anna Haava ; lühibiograafia: O. K. [Oskar Kruus

    Index Scriptorium Estoniae

    Haava, Anna, pseud., 1864-1957

    1999-01-01

    Sisu: Lesnoi tsvetok 1-2 / tlk. Bronislav Kezhun ; Net, stih ne vetrõ navevajut / tlk. Nora Javorskaja ; Odin lish raz ljubov bõvajet / tlk. B. Kezhun ; "Zabotõ svoi shoronila..." / tlk. Marina Tervonen ; Sodom i Gomorra / tlk. V. Sokolov ; Oh, rodina ; Vetra, tshto mansardu moju produvali / tlk. Nora Javorskaja. Orig.: Nõmmelill 1-2 ; Ei tule luule tuulest ; Üks ainus kord ; Mu mured kõik matsin ma maha ; Sina, Soodom ja Gomorra ; Oh kodumaa ; Kui puhus mu katusekambri tuul

  6. Vetsherneje : [luuletused] / Johannes Semper ; lühibiograafia: T. L. [Toomas Liiv

    Index Scriptorium Estoniae

    Semper, Johannes, 1892-1970

    1999-01-01

    Sisu: Vetshernjeje ; Golod / tlk. Nora Javorskaja ; Pod ekvatorom / tlk. S. Olender ; Pribrezhnõje sosnõ / tlk. Z. Mirkina ; Kak bõ smog tõ zhit? / tlk. Leon Toom ; Kakoje eto tshudo / tlk. J. Gordijenko. Orig.: Õhtune ; Nälg ; Ekvaatori all ; Rannamännid ; Kuidas elaksid? ; On liigutavalt tore

  7. Investigating Students' Attitudes towards Private Sector Work during Study in Saudi Arabia

    Science.gov (United States)

    Al-asqah, Amnah

    2018-01-01

    Purpose: The purpose of this paper is to identify the students' attitudes towards private sector work during study. Design/methodology/approach: This study used a comprehensive social survey (including questionnaire and interviewing) distributed to experts in departments and colleges in King Saud University and Princess Nora University. Findings:…

  8. Presidendi teenetemärgi pälvis viis spordiinimest

    Index Scriptorium Estoniae

    2008-01-01

    Vt. ka Linnaleht : Tartu 7. veebr., lk. 7. Eesti riigile osutatud teenete eest pälvisid president Toomas Hendrik Ilveselt teenetemärgi viis spordieluga seotud inimest: jalgpallikoondise ekstreenerid Jelle Goes ja Arno Pijpers, kergejõustikutreener Vésteinn Hafsteinsson, sõudetreener Tatjana Jaanson ning spordielu edendaja Nora Kutti. Juuresoleval fotol Jelle Goes

  9. Viljandi kultuuriakadeemia tudengid lajatasid kolme tükiga / Andres Keil

    Index Scriptorium Estoniae

    Keil, Andres, 1974-

    2007-01-01

    Janusz Glowacki "Fortinbras jõi end täis" Viljandi Kultuuriakadeemia teatrikunsti eriala 6. lennu esituses, lavastaja Kalju Komissarov ja Sven Heiberg ; Ott Aardami "Börs ja börsitar" ja Henrik Ibseni "Nora/Maja", lavastaja Helen Rekkor

  10. Viljandi paugutab kolme esietendusega / Andres Keil

    Index Scriptorium Estoniae

    Keil, Andres, 1974-

    2007-01-01

    Janusz Glowacki "Fortinbras jõi end täis" Viljandi Kultuuriakadeemia teatrikunsti eriala 6. lennu esituses, lavastaja Kalju Komissarov ja Sven Heiberg ; Ott Aardami "Börs ja börsitar" ja Henrik Ibseni "Nora/Maja", lavastaja Helen Rekkor

  11. Development of a deformation and failure model for Zircaloy at high temperatures for light water reactor loss-of-coolant-accident investigations

    International Nuclear Information System (INIS)

    Raff, S.

    1982-11-01

    To describe Zircaloy-4 deformation and failure behaviour at high temperatures (600 to 1400 0 C), the phenomenological model NORA was developed and verified against numerous experimental results. The model can be applied to the calculation of fuel rod cladding deformation during small and large break loss-of-coolant-accidents. (orig./RW) [de

  12. Heritage management and sustainable development in perspective: theory, law, and practice

    NARCIS (Netherlands)

    Veldpaus, L.

    2015-01-01

    Books reviewed: Heritage Planning: Principles and Process by Harold Kalman, Routledge, 2014, 344 pp., £36.99, ISBN 978-1-13-801792-4; Conserving Cultural Landscapes: Challenges and New Directions by Ken Taylor, Archer St. Clair, Nora J. Mitchell (eds.), Routledge, 2015, 394 pp., £90.00, ISBN

  13. Ser mujer no es suficiente

    Directory of Open Access Journals (Sweden)

    Fernando González Cajíao

    1991-09-01

    Full Text Available Voces en escena, antologías de dramaturgas latinoamericanas. Nora Eidelberg y María Mercedes Jaramillo (antologistas. Universidad de Antioquía, Medellín, 1991, 506 págs, 8 láminas.

  14. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Twitter YouTube Flickr RSS Menu Home Drugs of Abuse Commonly Abused Drugs Charts Emerging Trends and Alerts Alcohol Club Drugs ... from the Director of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director ...

  15. Ilves andis üle tänavused hariduspreemiad

    Index Scriptorium Estoniae

    2008-01-01

    President Toomas Hendrik Ilves andis 3. oktoobril 2008 üle Vabariigi Presidendi Kultuurirahastu hariduspreemiad. Premeeritud pedagoog Nora Mals on Tallinna Reaalkooli vene keele õpetaja, Ülle Liiber koolitab Tartu Ülikoolis geograafiaõpetajaid ja Urve Krause töötab Pärnu Kuninga tänava põhikooli direktorina

  16. Teaching in the Restorative Window: Authenticity, Conviction, and Critical-Restorative Pedagogy in the Work of One Teacher-Leader

    Science.gov (United States)

    Fine, Sarah M.

    2018-01-01

    In this article, Sarah M. Fine uses portraiture to explore the undertheorized question of what it means to teach in ways that align with the values of the restorative justice framework. The piece centers around the work of Nora, a veteran teacher-leader who explored this question in the context of her own classroom and, as a result, shifted her…

  17. Like, Love, Delete: Social Media's Influence on College Choice

    Science.gov (United States)

    Turner, Marcia Layton

    2017-01-01

    Ten years ago, NACAC published a report showing that 61 percent of college admission offices were using social media to recruit prospective students. The authors--and many people in college admission--could see the writing on the wall: Social media was becoming indispensable. One of the study's authors, Nora Ganim Barnes, recently observed,…

  18. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Educators Children & Teens Search Connect with NIDA : Facebook LinkedIn Twitter YouTube Flickr RSS Menu Home Drugs of ... Director of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director The ...

  19. Small arcs of larger circles framing through other patterns​​

    CERN Document Server

    Bateson, Nora

    2016-01-01

    This is an important first collection of essays, reflections and poems by Nora Bateson, the noted research designer, film-maker, writer and lecturer. She is the daughter of Gregory Bateson, president of the International Bateson Institute (IBI) and an adviser to numerous bodies at international and governmental level.

  20. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Learn the Link campaign uses TV, print, and Web public service announcements (PSAs), as well as posters, e-cards, ... to misuse drugs. The Learn the Link public service campaign is just one ... site. Sincerely, Nora D. Volkow, M.D. Director ...

  1. Õpetajate päeva eel autasustatakse õpetajaid : aasta õpetajad 2008

    Index Scriptorium Estoniae

    2008-01-01

    Vabariigi presidendi kultuurirahastu hariduspreemiad said tänavu Tallinna reaalkooli vene keele õpetaja Nora Mals, Tartu Ülikooli õppejõud, geograafiaõpikute autor ja metoodika arendaja, Eesti võistkonna juhendaja rahvusvahelistel geograafiaolümpiaadidel Ülle Liiber ja Pärnu Kuninga tänava põhikooli direktor Urve Krause

  2. IMTU Medical Journal - Vol 6, No 1 (2015)

    African Journals Online (AJOL)

    Child sexual abuse and possible health consequences among secondary school students in urban Tanzania · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Felix Kisanga, David Urassa, Nora Hogan, Jessie Mbwambo, 46-53 ...

  3. Obstacles to Scientific Research in Light of a Number of Variables

    Science.gov (United States)

    Algadheeb, Nourah A.; Almeqren, Monira A.

    2014-01-01

    The present study aimed to identify the scientific research obstacles facing faculty members in the College of Education at Princess Nora bint Abdul Rahman University (PNU) and to determine the differences in the obstacles according to age, academic rank, scientific specialty, marital status, number of completed studies, and time since the last…

  4. 76 FR 31010 - Iowa Northern Railway Company-Trackage Rights Exemption-Dakota, Minnesota & Eastern Railroad...

    Science.gov (United States)

    2011-05-27

    ..., and milepost 116.70 at the connection with CP's Mason City Subdivision, a distance of approximately 20.80 miles; (2) milepost 116.70 at the connection with CP's Mason City Subdivision and milepost 107.30... and Nora Jct.; and (3) milepost 116.70 at the connection with CP's Mason City Subdivision and milepost...

  5. To Leave, or Not to Leave: That Is the Problem in "A Doll's House" and "Candida"

    Science.gov (United States)

    Varghaiyan, Naghmeh

    2015-01-01

    This paper explores representation of "Woman Question" in Henrik Ibsen's "A Doll's House" and George Bernard Shaw's "Candida." The paper argues that unlike many studies that have read Candida and Nora as two disparate characters, they can be considered as the same "New Woman" represented only from different…

  6. To Leave, or not to Leave: That Is the Problem in A Doll’s House and Candida

    Directory of Open Access Journals (Sweden)

    Naghmeh Varghaiyan

    2015-06-01

    Full Text Available This paper explores representation of Woman Question in Henrik Ibsen’s A Doll’s House and George Bernard Shaw’s Candida. The paper argues that unlike many studies that have read Candida and Nora as two disparate characters, they can be considered as the same New Woman represented only from different perspectives. In the previous studies, Candida is usually labelled a philistine who chooses to stay at home in order to defend blindly the convention of marriage bond while Nora is commonly called a rebel who chooses to abandon the conventional matrimonial life in order to find her true identity. This study, nonetheless, holds that both female characters’ ensuing decisions, although in different forms, similarly make their husbands reflect deeply on their situation in a way that in general the relation between them changes considerably afterwards. The female characters’ socio-familial states, nevertheless, may not change considerably in the near future. Thus, the textual analysis in the present study reveals that there is no basis for establishing a dualism when discussing Candida and Nora, the former standing for conspiracy against her own gender while the latter being a symbol of female redemption. Instead, it could be argued that their seemingly different final decisions are different solutions to one problem without implying a certificate of authenticity at the end.  Keywords: Problem Play, Woman Question, New Woman, Nora, Candida

  7. Report of the AACRAO Professional Competencies and Proficiencies Working Group

    Science.gov (United States)

    American Association of Collegiate Registrars and Admissions Officers (AACRAO), 2015

    2015-01-01

    Interest on the part of the American Association of Collegiate Registrars and Admissions Officers (AACRAO) Board of Directors in the development of a set of descriptions of the core competencies for AACRAO professions goes back several years, with more active discussion beginning in 2011 under the leadership of AACRAO President Nora McLaughlin. At…

  8. Avgang 2017: Sommerkonsert i Aulaen

    OpenAIRE

    2017-01-01

    Avgangsstudenter fra MA2 opera og studenter fra MA1 holder konsert med sang fra operaer, lieder og fra operetter. MA2 sangere: Hanne Korsbrekke Askeland, Dagfinn Andersen, Sara Aasen. MA1 sangere: Eilert Egil Taugbøl Hasseldal, Marcela Randem, Nora Oleanne Sårheim, Tina Therese Tuven

  9. 78 FR 76854 - Notice of Realty Action: Non-Competitive (Direct) Sale of Public Land in Sheridan County, WY

    Science.gov (United States)

    2013-12-19

    ... Department of the Interior and the BLM. The Maintenance Plan Change updated the land disposal map and... publication of this NORA, and until completion of the sale, the BLM is no longer accepting land use... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLWYP070000; L14300000.EU0000; WYW-168342...

  10. Plasma cortisol and noradrenalin concentrations in pigs: automated sampling of freely moving pigs housed in PigTurn versus manually sampled and restrained pigs

    Science.gov (United States)

    Minimizing the effects of restraint and human interaction on the endocrine physiology of animals is essential for collection of accurate physiological measurements. Our objective was to compare stress-induced cortisol (CORT) and noradrenalin (NorA) responses in automated versus manual blood sampling...

  11. Sophiatown as lieu de mémoire

    NARCIS (Netherlands)

    Knevel, P.

    2015-01-01

    Sophiatown has often been presented as a symbol of a vibrant interracial urban culture that was destroyed by the racial segregationist policy of the apartheid regime. In reality, however, there are many ‘Sophiatowns’. By using Pierre Nora's well-known concept of lieux de mémoire and the related

  12. The Siege / Lauri Saaber

    Index Scriptorium Estoniae

    Saaber, Lauri

    1999-01-01

    Mängufilm "Sõjaseisukord" ("The Siege") : režissöör Edward Zwick : Ameerika Ühendriigid 1998 : Mängufilm "Sulle on sõnum" ("Youþve Got Mail") : Stsenarist ja režissöör Nora Ephron : Ameerika Ühendriigid 1998

  13. Kes see möllab köögis? / Kaisa Karu

    Index Scriptorium Estoniae

    Karu, Kaisa

    2009-01-01

    Nora Ephroni filmist "Julie ja Julia" (USA 2009), mille stsenaariumi kirjutas ta kokku Julia Childi autobiograafia "My Life in France" ja Julie Powelli blogist raamatuks vormunud teose "Julie & Julia: 365 Days, 524 Recipes, 1 Tiny Apartment Kitchen" põhjal. Julia Childi rollis Meryl Streep. Lisaks Kairit Tsäro kommentaarid "Meryli maagia" ja "Süües saledaks"

  14. On aeg, mil vajame enam leiba kui lilli / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-2016

    2009-01-01

    Marge Monko isikunäitus "Leib ja lilled" Tallinnas Draakoni Galeriis 21. märtsini. Eksponeeritud fotod ja video "Nora õed". Kunstnik on majanduses ja tööhõives asetleidvaid muutusi uurides aluseks võtnud Narva Kreenholmi Manufaktuuri näited

  15. A System-Wide Approach to Physician Efficiency and Utilization Rates for Non-Operating Room Anesthesia Sites.

    Science.gov (United States)

    Tsai, Mitchell H; Huynh, Tinh T; Breidenstein, Max W; O'Donnell, Stephen E; Ehrenfeld, Jesse M; Urman, Richard D

    2017-07-01

    There has been little in the development or application of operating room (OR) management metrics to non-operating room anesthesia (NORA) sites. This is in contrast to the well-developed management framework for the OR management. We hypothesized that by adopting the concept of physician efficiency, we could determine the applicability of this clinical productivity benchmark for physicians providing services for NORA cases at a tertiary care center. We conducted a retrospective data analysis of NORA sites at an academic, rural hospital, including both adult and pediatric patients. Using the time stamps from WiseOR® (Palo Alto, CA), we calculated site utilization and physician efficiency for each day. We defined scheduling efficiency (SE) as the number of staffed anesthesiologists divided by the number of staffed sites and stratified the data into three categories (SE 1). The mean physician efficiency was 0.293 (95% CI, [0.281, 0.305]), and the mean site utilization was 0.328 (95% CI, [0.314, 0.343]). When days were stratified by scheduling efficiency (SE 1), we found differences between physician efficiency and site utilization. On days where scheduling efficiency was less than 1, that is, there are more sites than physicians, mean physician efficiency (95% CI, [0.326, 0.402]) was higher than mean site utilization (95% CI, [0.250, 0.296]). We demonstrate that scheduling efficiency vis-à-vis physician efficiency as an OR management metric diverge when anesthesiologists travel between NORA sites. When the opportunity to scale operational efficiencies is limited, increasing scheduling efficiency by incorporating different NORA sites into a "block" allocation on any given day may be the only suitable tactical alternative.

  16. Comparison of the intradermal irritant threshold concentrations of nine allergens from two different manufacturers in clinically nonallergic dogs in the USA.

    Science.gov (United States)

    Foust-Wheatcraft, Desirae A; Dell, Darin L; Rosenkrantz, Wayne S; Griffin, Craig E

    2017-12-01

    The intradermal irritant threshold concentration for many allergens is unknown. To determine the intradermal irritant threshold concentration (ITC) of nine allergens from two different manufacturers. Twenty privately owned clinically nonallergic dogs. Alternaria, cat dander, Dermatophagoides farinae, Chenopodium album (lamb's quarter), Xanthium strumarium (cocklebur), Prosopis glandulosa (mesquite), Morus alba (white mulberry), Cynodon dactylon (Bermuda grass) and Phleum pretense (Timothy grass) from two manufacturers (ALK; Round Rock, TX, USA and Greer ® Laboratories; Lenoir, NC, USA) were injected intradermally at two dilutions and at 15 and 30 min evaluated subjectively (1-4) and objectively (horizontal wheal diameter) by two blinded investigators. A subjective score of 3 or 4 by either investigator at either timed reading was considered positive. If both concentrations resulted in positive reactions, two additional dilutions were performed. The ITC was defined as the lowest tested concentration that elicited a positive reaction in ≥10% of animals. The ITCs were Alternaria >2,000 PNU/mL; cat dander 750 PNU/mL (ALK) and 2,000 PNU/mL (Greer ® ); D. farinae strumarium <6,000 PNU/mL; P. glandulosa <500 PNU/mL; M. alba <6,000 PNU/mL; C. dactylon <10,000 PNU/mL (ALK) and <6,000 PNU/mL (Greer ® ); and P. pretense <6,000 PNU/mL. There were significant differences in subjective scoring and objective measurement between manufacturers for Alternaria, cat dander and P. pretense. Results revealed significant positive correlation between subjective scoring and objective measurement for each time, investigator and manufacturer separately. © 2017 ESVD and ACVD.

  17. Creciendo en la adversidad. Una revisión del proceso de adaptación al diagnóstico de cáncer y el crecimiento postraumático (Growing through adversity. Analysis of the process of adaptation to a diagnosis of cancer and subsequent posttraumatic growth. A review

    Directory of Open Access Journals (Sweden)

    María del Mar Campos-Ríos

    2013-04-01

    Full Text Available The aim of this paper was to examine adjustment to a diagnosis of cancer, cancer as trauma, and the posttraumatic growth process by reviewing the scientific literature. We first present Folkman & Greer's (2000 adjustment to cancer model updated by Holland (2002 and then review cancer as a possible cause of posttraumatic stress. Finally, we describe Tedeschi & Calhoun's (2004 Posttraumatic Growth construct. The review is concluded with a sample of different points of view about posttraumatic growth related to cancer, and with some suggestions about future researches.

  18. Proceedings of the Workshop on Meteorological and Environmental Inputs to Aviation Systems (6th) Held at the University of Tennessee Space Institute on 26-28 October 1982,

    Science.gov (United States)

    1983-04-01

    20. Tom Greer 60. Robert Bonner 100. Frank Van Demark 21. John Klehr 61. Tommy Trimble 101. Art Hansen 22. Terrell Wilson 62. Wen Painter 102, Ossi...information provided to him. ARF is planned as an enhancement to the auto- matic flight service station program. The FOLLOW-UP RESPONSE: Terrell ...204 1975). FS 409 (June 1g8l). (8 409ns (June "D o o(21) "Aircraft Wake Vortices: A State-of-the- (8) Haynes, Ann , "Description of a Program Art

  19. Establishing books as conditioned reinforcers for preschool children as a function of an observational intervention.

    Science.gov (United States)

    Singer-Dudek, Jessica; Oblak, Mara; Greer, R Douglas

    2011-01-01

    We tested the effects of an observational intervention (Greer & Singer-Dudek, 2008) on establishing children's books as conditioned reinforcers using a delayed multiple baseline design. Three preschool students with mild language and developmental delays served as the participants. Prior to the intervention, books did not function as reinforcers for any of the participants. The observational intervention consisted of a situation in which the participant observed a confederate being presented with access to books contingent on correct responses and the participant received nothing for correct responses. After several sessions of this treatment, the previously neutral books acquired reinforcing properties for maintenance and acquisition responses for all three participants.

  20. Dielectric Constant of Undercooled Water.

    Science.gov (United States)

    1981-09-01

    can or radiation shield, and the experimental stage. The two cans are evacu- -3 ated to about 10 3 mm Hg. The outer can is made of aluminum and is...wrapped with aluminum tubing through which a commercial circulator-cooler pumps a circulating fluid with its tempera- ture controlled to 20 mK between...Control and Measurement System" Strem, R.B., Das, B.K., and Greer, S.C., Rev. Sci. Instrum., in press. 17 Type S-1, Thermometrics , Inc., Ediaon, N.J. 183

  1. Die Rolle des Gerichtsdolmetschers - Experte oder notwendiges Übel?

    DEFF Research Database (Denmark)

    Christensen, Tina Paulsen

    2012-01-01

    Die Zahl der gedolmetschten Gerichtsverhandlungen steigt weiterhin in vielen Rechtssystemen, weshalb es immer wichtiger wird, dass Rechtssysteme über qualifizierte Dolmetscher verfügen. In Dänemark begegnen Richter, die Rezipienten von Gerichtsdolmetschleistungen sind, sowohl professionellen als...... auch nicht- oder semi-professionellen Gerichtsdolmetschern. Dies lässt vermuten, dass die Richter in der Praxis Dolmetschleistungen von sehr unterschiedlicher Qualität erleben und vermutlich kein einheitliches Bild von der Rolle des Gerichtsdolmetschers haben. Ziel der Studie, die ich in diesem Beitrag...

  2. Communicating knowledge in science, science journalism and art

    DEFF Research Database (Denmark)

    Nielsen, Kristian Hvidtfelt

    Richter. The specialized knowledge about the image is communicated in three very different contexts with three very different outcomes. The paper uses Niklas Luhmann's system theory to describe science, science journalism, and art as autonomous social subsystems of communication. Also, Luhmann's notions...... of irritation and interference are employed to frame an interpretation of the complex relations between communicating knowledge about the image in science, science journalism, and art. Even though the functional differentiation between the communication systems of science, science journalism, and art remains...... that Richter's Erster Blick ends up questioning the epistemological and ontological grounds for communication of knowledge in science and in science journalism....

  3. Amartya Sen y el estudio de la desigualdad económica y la pobreza monetaria. Colombia: 1978-1997 The contributions of Amartya Sen to the study of inequality and poverty. Colombia 1978-1997

    Directory of Open Access Journals (Sweden)

    Aguilar Ana

    1998-12-01

    Full Text Available Este artículo presenta el Índice de Pobreza y desigualdad de Amartya Sen, la familia de indicadores de Foster-Greer-Thorbecke y la forma en que se pueden utilizar uno y otra para determinar la magnitud de la pobreza y desigualdad en Colombia. Propone, además, que estos indicadores se utilicen para evaluar el incremento o la disminución de la desigualdad y la pobreza y para ajustar permanentemente las políticas económicas y sociales.This article presents Arnartya Sen's poverty and inequality index and the family of Foster-Greer-Thorbecke indicators, and the way in which they can be used to determine the magnitude of poverty and inequality in Colombia. In addition, it proposes that these indicators be used to evaluate the impact of social and economic policies on the poor population, to measure the increase or decrease in inequality and poverty, and to permanently adjust economic and social policies.

  4. Is there any relationship between decreased AgNOR protein synthesis and human hair loss?

    Science.gov (United States)

    Eroz, R; Tasdemir, S; Dogan, H

    2012-11-01

    Argyrophilic nucleolar organizing region associated proteins (AgNORs) play roles in cell proliferation and a variety of diseases. We attempted to determine whether decreased NOR protein synthesis causes human hair loss. We studied 21 healthy males who suffered hair loss on the frontal/vertex portion of the head. Hair root cells from normal and hair loss sites were stained for AgNOR. One hundred nuclei per site were evaluated and the AgNOR number and NORa/TNa proportions of individual cells were determined using a computer program. The cells from normal sites had significantly higher AgNOR counts than those from hair loss sites. Also, the cells from the normal sites had significantly higher NORa/TNa than cells from the hair loss sites. In the normal sites, the cells demonstrated more NOR protein synthesis than cells in hair loss sites. Therefore, decreased NOR protein synthesis appears to be related to hair loss in humans.

  5. Performative Environments

    DEFF Research Database (Denmark)

    Thomsen, Bo Stjerne

    2008-01-01

    The paper explores how performative architecture can act as a collective environment localizing urban flows and establishing public domains through the integration of pervasive computing and animation techniques. The NoRA project introduces the concept of ‘performative environments,' focusing on ...... of local interactions and network behaviour, building becomes social infrastructure and prompts an understanding of architectural structures as quasiobjects, which can retain both variation and recognisability in changing social constellations.......The paper explores how performative architecture can act as a collective environment localizing urban flows and establishing public domains through the integration of pervasive computing and animation techniques. The NoRA project introduces the concept of ‘performative environments,' focusing...

  6. Effect of single and combined treatment with gamma rays and some chemical mutagens in rice

    International Nuclear Information System (INIS)

    Lyong Van Hin; Mekhandzhiev, A.; Murzova, P.; Chilikov, I.

    1991-01-01

    Dry rice seeds of 3 cvs and 2 lines have been irradiated (Co 60 , 10 krad) and treated with 0.0012% sodium azide (NaN 3 ) and 0.2% ethylmethanesulfonate (EMS) in definite combinations. It is found that chlorophyll mutations are less frequent after single gamma irradiation. Sodium azide produces a higher percentage of mutations than EMS. Highest mutation frequency has been observed following combined treatment with gamma rays and chemical mutagens. The combined treatment has resulted in a considerably higher mutation effect than the theoretically expected one in the lines Nora and Mega, and in cv. Krasnodarski 424. Highest mutation spectrum has been found in cv. Krasnodarski 424 and in Nora line following combined treatment. 1 tab., 5 figs., 20 refs

  7. Mr. Wolfgang Petritsch, Austrian Ambassador

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Dr.Peter Schmid/CERN/EP, Dr.Wolfgang Petritsch, Austrian Ambassador, Permanent representative at UN, Mrs.Nora Petritsch, Dr.Kurt Hubner/CERN/AC, Mrs. Frederike Klaus-Salesin, Adviser, Mrs.Andrea Strohmeier, Secretary of the Ambassador, Mr.Heinz Klaus, Attaché, Dr.Theodor Tortschanoff/CERN/LHC, Mr.Peter Storer, Advisor. Dr.Peter Schmid/CERN/EP, Dr.Wolfgang Petritsch, Austrian Ambassador, Permanent representative at UN, Mrs.Nora Petritsch, Dr.Kurt Hubner/CERN/AC, Mrs. Frederike Klaus-Salesin, Adviser, Mrs.Andrea Strohmeier, Secretary of the Ambassador, Mr.Heinz Klaus, Attaché, Dr.Theodor Tortschanoff/CERN/LHC, Mr.Peter Storer, Advisor.

  8. Nuclear magnetic relaxation in picolines solutions in carbon tetrachloride

    International Nuclear Information System (INIS)

    Jurga, J.; Pajak, Z.; Jurga, K.; Jurga, S.

    1973-01-01

    Spin-lattice relaxation times of the ring and CH 3 group have been measured in order to establish the temperature dependence of the longitudinal relaxation times for picolins in carbon tetrachloride solutions. The information concerning the intramolecular contribution to the relaxation times have been obtained. The high resolution NPR spectrometer operating at 25 MHz has been used. The measurements have been performed in the temperature range from -60degC to 80degC. The experimental results are compared to the predictions given by the Nora Hill and Debye models and it has been found that the Nora Hill model fits the experimental data better than the Debye model. (S.B.)

  9. Impact of the water symmetry factor on humidification and cooling strategies for PEM fuel cell stacks

    Energy Technology Data Exchange (ETDEWEB)

    Picot, D; Metkemeijer, R; Bezian, J J; Rouveyre, L [Centre d` Energetique, Ecole des Mines de Paris, 06 - Sophia Antipolis (France)

    1998-10-01

    In this paper, experimental water and thermal balances with three proton exchange membrane fuel cells (PEMFC) are proposed. On the test facility of Ecole des Mines de Paris, three De Nora SPA fuel cell stacks have been successfully studied: An 1 kW{sub e} prototype using Nafion {sup trademark} 117, a 5 and 10 kW{sub e} module using Nafion {sup trademark} 115. The averaged water symmetry factor determines strategies to avoid drying membrane. So, we propose analytical solutions to find compromises between humidification and cooling conditions, which determines outlet temperatures of gases. For transport applications, the space occupied by the power module must be reduced. One of the main efforts consists in decreasing the operative pressure. Thus, if adequate cooling power is applied, we show experimentally and theoretically the possibility to use De Nora PEM fuel cells with low pressure, without specific external humidification. (orig.)

  10. Impacts of the MERCOSUR Agreement on the Uruguayan Economy

    Science.gov (United States)

    1994-06-01

    Carlos, Comercio con Argentina y Brasil: Uno o Dos Patrones de Insercion Regional? Sextas Jornadas Anuales de Economia , Banco Central del Uruguay...lornadas Anuales de Economia , BCU, Montevideo. 1990. "Rolds, Jorge, MERCOSUR, Pohtica Comercial Optima?, Boletin Ceres •(), Montevideo. 1991. 4" Also...34 Quintas Jornadas Anuales de Economia , BCU, 1990. Berreta, Nora and Paolino, Carlos, "Comercio con Argentina y Brasil: uno o dos patrones de inserci6n

  11. Development of Personalized Cancer Therapy for Men with Advanced Prostate Cancer

    Science.gov (United States)

    2017-10-01

    AWARD NUMBERS: W81XWH-14-1-0554 TITLE: Development of Personalized Cancer Therapy for Men with Advanced Prostate Cancer PRINCIPAL INVESTIGATOR...Dr. Nora M. Navone CONTRACTING ORGANIZATION: The University of Texas MD Anderson Cancer Center 1515 Holcombe Blvd. Houston, TX 77030-4009...COVERED 09/22/2016-09/21/2017 4. TITLE AND SUBTITLE 5a. CONTRACT NUMBER N/A Development of Personalized Cancer Therapy for Men with Advanced

  12. Narrative Journalism in the Age of the Internet. New Ways to Create Authenticity in Online Literary Reportages

    Directory of Open Access Journals (Sweden)

    Nora Berning

    2011-11-01

    Full Text Available Online literary reportages represent an imperative counterweight to conventional journalism that is essential both for our emotional and intellectual survival. Using Paula Delgado-Kling’s online literary reportage Child Soldiers: Homero and Mark Bowden’s multimedia text The Desert One Debacle as examples, Nora Berning explores issues of multimediality and authenticity in online narrative journalism. Berning’s case studies open up discussions, both theoretical and practical, about the future of digital media literacy.

  13. Discusiones sobre el realismo en la narrativa argentina contemporánea

    Directory of Open Access Journals (Sweden)

    Sandra Contreras

    2005-11-01

    Full Text Available From recent readings on Argentine realism of, mainly, Martín Kohan, Graciela Speranza, Nora Avaro and Analía Capdevila, hypotheses around the following axes are thought and discussed: 1. scope and present situation of the category of realism in relation to the current Argentine narrative; 2. scope and limits of a new reading of Lukács theory today; 3. problem of the definition of the realist type; 4. realist variations in contemporary Argentine narrative.

  14. Effect of time in the evaluation of F+20 and F0 diuretic renography

    International Nuclear Information System (INIS)

    Donoso, G.; Piepsz, A.; Ham, H.

    2002-01-01

    F0 diuretic renography starts gaining popularity especially because of the practical convenient of avoiding one intravenous injection. Using F0 however, the most adequate parameters for evaluating renal output are still to be determined. Aim: to evaluate which parameter of F0 and F+20 procedures gives rise to the best possible renal drainage. Methods: In this retrospective study we compared F0 and F20 quantitative parameters obtained in 36 clinically stable children, aged 10 days to 17 years, with unilateral (25) or bilateral (11)hydronephrosis, in whom both tests were performed. The mean time interval between the two tests was 17 months. F0 and F+20 Tc-99m MAG3 diuretic renography were carried out using the usual procedure. In all cases, a late image (PM) was acquired after micturition and after changing the position of the patient. The mean time at which this image was acquired was 80 min(SD : 33) for the F+20 test and 48 min(SD : 30) for the F0 test. Following parameters were calculated : Time to the maximum of the basic renogram (Tmax); normalized residual activity (NORA) and output efficiency (OE) at the end of the 20- min renogram, at the end of furosemide test (35 min) and on the post micturition image (NORA 20, NORA 35, NORA PM, OE 20, OE35 and OE PM). On the basis of all available parameters, each of the 47 hydronephrotic kidneys were classified either as 'good drainage' or as 'partial or bad drainage'. All parameters were then evaluated according to this reference. Conclusions: For both the F+20 and the F0 tests, the PM image had obviously a higher performance rate than all the other parameters, underlying the mandatory character of this acquisition. The higher performance of the PM image on F+20 is clearly related to the significantly different time at which the PM image was acquired, underlying the need of standardization of the acquisition time

  15. Evaluation of fuel rod damage in LWR under accident conditions using SSYST

    International Nuclear Information System (INIS)

    Meyder, R.

    1982-01-01

    After a short outline of the recent SSYST-development, the creep rupture model NORA 2 is presented. The effect of temperature and oxygen on Zircaloy 4 creep behaviour is shown. Examples on the effect of azimuthal varying gap width and wall thickness are given. Remarks on the extension of a single rod analysis on a bundle and the stepwise application of SSYST for investigation of fuel rod failure conclude the paper. (orig.) [de

  16. Additional considerations to the model of musical empathic engagement: Empathy facets, preferences, and openness. Comment on "Music, empathy, and cultural understanding" by E. Clarke et al.

    Science.gov (United States)

    Greenberg, David M.

    2015-12-01

    Recent research has shown that empathy plays an important role in musical experience including perception, preference, and performance [9,11,13,16,17]. Clarke, DeNora, and Vuoskoski's [4] timely review extends this work by establishing a framework for how ;music empathic engagement; can facilitate cultural understanding. In this commentary I raise attention to some additional factors that may be at play in their model.

  17. El paisaje urbano de la Ciudad de León

    Directory of Open Access Journals (Sweden)

    Eduardo Rodríguez Vásquez

    2004-02-01

    Full Text Available Cuando se aborda el tema del paisaje, es fácil asociarlo al que nos ofrece la naturaleza de los ríos, lagos, montañas, fauna y nora; sin embargo, actualmente el término paisaje abarca también al medio construido por el hombre, en forma de espacios urbanos de distintos tamaños, llámese pueblo, barrio, reparto, villa, parque, ciudad, etc.

  18. A psychopharmacological aspects of human emotional memory for emotional material.

    OpenAIRE

    Brignell, C. M.

    2004-01-01

    It is often assumed that emotional events are remembered in great clarity and detail. This thesis begins with a review of the literature on memory enhancement by emotional material. This enhancement may involve mechanisms that are psychologically and neurobiologically distinct from the mechanisms usually employed in memory for neutral material, such as modulation of consolidation by emotional arousal via noradrenaline action in the amygdala. Theoretically, pharmacological manipulation of nora...

  19. Actinic keratosis associated with squamous and basal cell carcinomas: an evaluation of neoplastic progression by a standardized AgNOR analysis

    Directory of Open Access Journals (Sweden)

    G Giuffrè

    2009-08-01

    Full Text Available In an attempt to investigate the neoplastic progression in different stages of actinic keratosis (AK, a standardized AgNOR analysis was performed in 94 cases of AK, 35 of which were associated with squamous cell carcinoma (SCC or basal cell carcinoma (BCC, and in 31 cases of SCC and 22 cases of BCC. The cases were subdivided into low- and high- AgNOR-expressing (AgNOR status AK by using the mean area of AgNORs per cell (NORA value (3.996 ?m2 as the cut-off. In AK samples, a progressive increase of the mean NORA value from Stage I to Stage IV was encountered. In addition, a significantly higher mean NORA value was found in the AK cases associated with SCC, in comparison to those without SCC; by contrast, no significant differences in the mean NORA value were noted between AK cases with or without BCC. A highly significant association between a high AgNOR quantity and the coexistence of SCC was encountered in AK; no association was appreciable between the AgNOR quantity and the co-occurrence of BCC. Moreover, when the co-existence of SCC in AK was considered as the reference point, the AK cases associated with SCC mostly (95.5% presented a high AgNOR quantity (high sensitivity, but only 57.6% of cases without SCC displayed a low AgNOR quantity (low specificity. Additionally, our data document that the standardised AgNOR analysis represents a strong negative predictor for the association between SCC and AK. Indeed, a low AgNOR quantity mostly is associated with AK cases without SCC.

  20. Investigating the Correlation between Food Prices and University Students Awareness of the Effects of Fast Food Consumption on their Health

    OpenAIRE

    Al-Aklabi, Nouf; Al-Dowsari, Wejdan; Andrioti, Despena

    2016-01-01

    Background: The price of a given food product is an indicative measure of its nutritious value. Forthis reason, people belonging to low-income groups are specifically vulnerable to malnutrition. Thisstudy aims to identify nutritional patterns among students at the Princess Nora University, Riyadh,Saudi Arabia, quantify students’ level of awareness of health risks associated with fast food consumption,examine how price affects their choice of food, and provide general guidelines for improving ...

  1. The Role of Angiopoietin-like 4 in Lipid Homeostasis

    OpenAIRE

    Gray, Nora

    2012-01-01

    AbstractThe Role of Angiopoietin-like 4 in Lipid HomeostasisbyNora Elizabeth Forbes GrayDoctor of Philosophy in Molecular and Biochemical NutritionUniversity of California, BerkeleyProfessor Jen-Chywan Wang, ChairAlterations in the regulation of lipid homeostasis are major causes of metabolic diseases like obesity, insulin resistance and the metabolic syndrome. These diseases affect millions of people and therefore constitute a pressing public health concern. The mobilization of lipids is a k...

  2. Knowledge of Saudi female university students regarding cervical cancer and acceptance of the human papilloma virus vaccine

    OpenAIRE

    Al-Shaikh, Ghadeer K.; Almussaed, Eman M.; Fayed, Amel A.; Khan, Farida H.; Syed, Sadiqa B.; Al-Tamimi, Tahani N.; Elmorshedy, Hala N.

    2014-01-01

    Objectives: To assess the level of knowledge regarding cervical cancer and the acceptance of the human papilloma virus (HPV) vaccine among Saudi female students in health colleges. Methods: This cross-sectional study of a convenient sample encompassed 1400 students in Health Colleges at Princess Nora Bint Abdul Rahman University, Riyadh, Saudi Arabia was conducted between December 2013 and February 2014. A self-administrated questionnaire was distributed to all participants. Data collected in...

  3. Asylansøgeres muligheder for at komme i arbejde: Asylum seekers opportunities to enter the labour market

    OpenAIRE

    Al-Adhami, Adnan Ibrahim; Thøgersen, Dicte Bjarup; Mikkelsen, Laura Barfoed; Robrahn, Pernille Viola

    2015-01-01

    The purpose of this paper is to highlight the challenges that asylum seekers meet in the asylum system, when they want to enter the labour market. Furthermore, this paper wants to examine the issues that are connected to these challenges, and whether it has an impact on the integration, when asylum seekers are left outside of the labor market. To investigate our research question we have primarily used interviews, including a qualitative research interview with an asylum seeker, Nora, and two...

  4. Palmse viinaköögi manifest

    Index Scriptorium Estoniae

    1996-01-01

    Manifest. Tõlkijate seminari puhul 17. mail 1996 Palmse viinaköögis Juta Bedia, Eric Dickens, Gyözö Fehérvári, Guntars Godinsh, Maima Grinberga, Irja Grönholm, Leif Hannibal, Cornelius Hasselblatt, Pirkko Huurto, Ivo Iliste, Nora Javorskaja, Gisbert Jänicke, Kaisu Lahikainen, Enel Melberg, Vera Ruber, Arnold Tamm, Leili Tamm, Jonatan Tomesh, Lilia Velic'kova, Marianne Vogel. Inglise k.: Estonian Literary Magazine, autumn 1996, nr. 3

  5. The Next Supreme Leader: Succession in the Islamic Republic Of Iran

    Science.gov (United States)

    2011-01-01

    E. Thaler, Nora Bensahel, Kim Cragin, Jerrold D. Green, Dalia Dassa Kaye, Nadia Oweidat, and Jennifer Li , Dangerous But Not Omnipotent: Exploring...Janeshin Namayand e Vali e Faghih dar Sepah, ya Sokhanguy e Hezb e Siyasi Neza- mian ? [The Deputy Representative of the Supreme Leader in the Guards...Dassa Kaye, Nadia Oweidat, and Jennifer Li , Dangerous But Not Omnipotent: Exploring the Reach and Limitations of Iranian Power in the Middle East, Santa

  6. Download this PDF file

    African Journals Online (AJOL)

    Of Nigerians, albinos, satanists and anecdotes. A critical review of the HSRC report on human trafficking cgould@issafrica.org, marlise.richter@gmail.com, ... The deluge of news articles about human trafficking in South Africa, and the media preoccupation with trafficking in ..... There is also no discussion about the ethical.

  7. From phonon confinement to phonon splitting in flat single nanostructures: A case of VO2@V2O5 core–shell nano-ribbons

    CSIR Research Space (South Africa)

    Mwakikunga, BW

    2012-07-01

    Full Text Available ) as explained by Eklund's group for surface phonons and (d) our own modification based on the transformation from the spherical coordinates in the Richter equation to Cartesian coordinates; the latter being in keeping with the ribbon geometry. The change...

  8. Optical and microstructural investigations of porous silicon

    Indian Academy of Sciences (India)

    Unknown

    (Canham 1990, 1992; Cullis and Canham 1991). .... R Prabakaran, R Kesavamoorthy and Alok Singh. 222. [. ] [ ] ,d. 5.0. )( ),0(. 4. )( .... 291 cm–1 peak position and 43 cm–1 FWHM. .... Richter H, Wang Z P and Ley L 1981 Solid State Commun.

  9. An exploration of student perceptions of the risks and protective ...

    African Journals Online (AJOL)

    opperwjj

    uantwerpen.be. ..... creates (Corwin & Olafson, 1993; Schechter, Brunelli, Cunningham, Brown & Baba, 2002). Though issues of ..... system: data from the Teddy Bear Clinic. In L. Richter, A, ... Child Abuse & Neglect, 30(2), 127–143. Krueger, R.A. ...

  10. Reference: 279 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ork, N.Y.) Bandyopadhyay Anindita|Blakeslee Joshua|Gaxiola Roberto|Gilroy Simon|Khodakovskaya Mariya|Krizek ...Beth|Li Jisheng|Murphy Angus S|Peer Wendy Ann|Richards Elizabeth L|Richter Gregory|Titapiwantakun Boosaree|Undurraga Soledad|Yang Haibing

  11. Activation of mTor Signaling by Gene Transduction to Induce Axon Regeneration in the Central Nervous System Following Neural Injury

    Science.gov (United States)

    2014-03-01

    association with transported herpes simplex virus particles.11 In this study, we tested the efficacy of these axon-targeting motifs to target the fluorophore...Richter D, Kindler S. Identification of a cis-acting dendritic targeting element in the mRNA encoding the alpha subunit of Ca2þ /calmodulin-dependent

  12. Symposium in honour of Ugo Amaldi's 60th birthday

    CERN Document Server

    Myatt, Gerald; Ellis, Jonathan Richard; Kalmus, George Ernest; Llewellyn Smith, Christopher Hubert; Matthiae, Giorgio; Richter, Burton; Wiik, Bjørn Haavard; Winter, Klaus; CERN. Geneva

    1994-12-07

    Ugo Amaldi,a man of science , G Myattpp total cross section, G Matthiae Neutrino physics, K Winter DELPHI & LEP physics, G Kalmus Supersymmetry, J EllisElectron-proton physics, B WiikLinear colliders, B Richter Closing address, C Llewellyn Smith -

  13. Gerhard Richter’s Critical Artistic Strategies: Politics, Terrorism and War

    Directory of Open Access Journals (Sweden)

    Van Schepen Randall K.

    2017-08-01

    Full Text Available The present paper analyzes two artistic strategies employed by Gerhard Richter to deal with painful recent cultural memory. Two works in particular reveal the relative success of Richter’s varied artistic strategies addressing contemporary political events: 18. Oktober 1977 (1988 and War Cut (2004. In his series of paintings on the Baader-Meinhof terrorist group, Richter effectively employs his “photopainting” style to address the profoundly disturbing deaths of the Baader-Meinhof group in the 1970s. Richter chose mundane photographic sources for his imagery, denying a hierarchy of “correct” memories of the events and turning photographic indexicality against itself by employing a painterly medium, tinged with nostalgia, to represent it. Richter’s photopaintings of Baader-Meinhof thus use the “factual” nature of the photograph while also utilizing an elegiac painterly mist through which an indistinct emotional memory of the past seems to emerge. Richter’s blurring of images can thus be understood as a fulcrum on which the undecidability of history itself must be represented. Richter constructs War Cut (2004, on the other hand, as a work and aesthetic experience decidedly at odds with the iconicity of his Baader-Meinhof images by employing arbitrariness and conceptual abstraction.

  14. Use of X-Ray Diffraction, Molecular Simulations, and Spectroscopy to Determine the Molecular Packing in a Polymer-Fullerene Bimolecular Crystal

    Science.gov (United States)

    2012-09-05

    Richter , M. F. Toney , M. Heeney , I. McCulloch , ACS Nano 2009 , 3 , 780 . [ 19 ] H. W. Spiess , Macromolecules 43 , 5479 . [ 20 ] K...Schmidt-Rohr , H. W. Spiess , Multidimensional Solid-State NMR and Polymers , Academic Press , London 1994 . [ 21 ] C. Yang , J. G. Hu

  15. Author Details

    African Journals Online (AJOL)

    Richter, M. Vol 103, No 4 (2013) - Articles Characteristics, sexual behaviour and risk factors of female, male and transgender sex workers in South Africa Abstract PDF. ISSN: 0256-95749. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  16. Author Details

    African Journals Online (AJOL)

    Abstract PDF · Vol 16, No 4 (2013) - Articles Using a Locum Tenens in a Private Practice Abstract PDF · Vol 17, No 4 (2014) - Articles Reformation from criminal to lawyer: is such redemption possible? Abstract PDF · Vol 17, No 6 (2014) - Articles Defamation on facebook: Isparta V Richter 2013 6 SA 529 (GP) Abstract PDF.

  17. TJOG Vol 25 No 2.cdr

    African Journals Online (AJOL)

    Some other emergency contraceptive preparations which do not contain norethisterone such as Postinor-2. 5,6. (Gedeon Richter) and Norlevo (Cipla) have. A study was therefore undertaken to form. investigate into the use of Primolut N Tablet. Clients who called at the pharmacy as a pre-coital contraceptive by women in.

  18. Jak to bylo s fúzí - část čtvrtá

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    Leden (2016) Institutional support: RVO:61389021 Keywords : Fusion * Argentina * Ronald Richter * Proyecto Huemu Subject RIV: BL - Plasma and Gas Discharge Physics http://www.3pol.cz/cz/rubriky/jaderna-fyzika-a-energetika/1771-jak-to-bylo-s-fuzi-cast-ctvrta

  19. Non extensivity and frequency magnitude distribution of earthquakes

    International Nuclear Information System (INIS)

    Sotolongo-Costa, Oscar; Posadas, Antonio

    2003-01-01

    Starting from first principles (in this case a non-extensive formulation of the maximum entropy principle) and a phenomenological approach, an explicit formula for the magnitude distribution of earthquakes is derived, which describes earthquakes in the whole range of magnitudes. The Gutenberg-Richter law appears as a particular case of the obtained formula. Comparison with geophysical data gives a very good agreement

  20. Download this PDF file

    African Journals Online (AJOL)

    chifaou.amzat

    Natal. Tawanda Makusha* ... 9. Makusha.pmd. 17/12/2012, 18:02. 127. Page 2. 128. Africa Development, Vol. XXXVII, No. 3, 2012 ... Page 3. 129. Makusha, Richter and Bhana: Children's Experiences of Support Received mothers and fathers ...

  1. The Forgotten Disaster Victim: Reducing Responder Injury

    Science.gov (United States)

    2017-03-01

    Approved by: Anke Richter Thesis Advisor Michael Petrie EMS Bureau, County of Monterey Second Reader Erik Dahl Associate Chair for Instruction...RESPONDERS IN DISASTERS .............20 1. Oklahoma City Bombing .............................................................20 2. World Trade Center...Categories, 2008–2014..................................................................................................19 Figure 4. Oklahoma City Bombing

  2. Stand and individual tree growth response to treatments in young natural hardwoods

    Science.gov (United States)

    Daniel J. Robison; Tracy San Filipo; Charlie Lawrence III; Jamie L. Schuler; Bryan J. Berenguer

    2012-01-01

    Young even-aged upland Piedmont mixed hardwood and pine stands were treated with a variety of fertilizer and release (competition control) treatments. The sites studied are on the NC State University Hill Demonstration Forest in central North Carolina, and are characterized by formerly highly eroded agricultural sites (Richter et al. 2000) now in their third rotation...

  3. The creation of the Argentine Atomic Energy Commission

    International Nuclear Information System (INIS)

    Marzorati, Zulema del V.

    2000-01-01

    After a mention to the Argentine regulation of 1945 concerning the export of uranium ores and a short description of the 'Richter affair', the decree 10936 of 1950, that creates the Argentine Atomic Energy Commission (CNEA) , is analyzed. The activities of the CNEA between the years 1952 - 1955 are also outlined

  4. 76 FR 64076 - Performance Review Board (PRB)

    Science.gov (United States)

    2011-10-17

    ..., Chief Financial Officer, United States Patent and Trademark Office. John B. Owens II, Chief Information Officer, United States Patent and Trademark Office. Bernard J. Knight Jr., General Counsel, United States... Trademark Office. Patricia M. Richter, Chief Administrative Officer, United States Patent and Trademark...

  5. 75 FR 63147 - Performance Review Board (PRB)

    Science.gov (United States)

    2010-10-14

    .... Patricia M. Richter, Chief Administrative Officer, United States Patent and Trademark Office. Robert L..., Commissioner for Trademarks, United States Patent and Trademark Office. Anthony P. Scardino, Chief Financial Officer, United States Patent and Trademark Office. John B. Owens II, Chief Information Officer, United...

  6. Haiti and the Earthquake: Examining the Experience of Psychological Stress and Trauma

    Science.gov (United States)

    Risler, Ed; Kintzle, Sara; Nackerud, Larry

    2015-01-01

    For approximately 35 seconds on January 10, 2010, an earthquake measuring 7.0 on the Richter scale struck the small Caribbean nation of Haiti. This research used a preexperimental one-shot posttest to examine the incidence of posttraumatic stress disorder (PTSD) and associated trauma symptomatology from the earthquake experienced by a sample of…

  7. Browse Title Index

    African Journals Online (AJOL)

    Togo), Abstract. E Padaro, I.M.D. Kueviakoe, K.J. Guedenon, H Magnang, K Mawussi, Y Layibo, A Vovor, A.Y. Segbena. Vol 13, No 1 (2011): Serie D, Hernie de richter revelee par un abces inguinal droit, Abstract. KK Kanassoua, K Amegbor, ED ...

  8. ARTICLES / SAGGI

    African Journals Online (AJOL)

    laws and take measures to deal with the growing influx of foreigners. ... gained major visibility in the Italian literary context. ... foreign-born writers who write in Italian and by Italian writers who .... Richter notes that the “increasing circulation of subjects in intercultural .... The city becomes the refraction of global processes of.

  9. Organic Molecules and Water in the Inner Disks of T Tauri Stars

    Science.gov (United States)

    2011-05-11

    603 Knez, C., et al. 2007, BAAS , 211, 5005 Kruger, A. J., Richter, M. J., Carr, J. S., Najita, J. R., Doppmann, G. W., & Seifahrt, A. 2011, ApJ, 729...Close, L. M., Hinz, P. M., Hoffmann, W. F., Greene, T. P., Males, J. R., & Beck , T. L. 2010, ApJ, 711, 1280 Tappe, A., Lada, C. J., Black, J. H

  10. 76 FR 59773 - Endangered and Threatened Wildlife and Plants; Designation of Critical Habitat for Mississippi...

    Science.gov (United States)

    2011-09-27

    ... habitat areas we are proposing, including managing for the potential effects of climate change, and (d... recent taxonomic treatment for reptiles and amphibians is dusky gopher frog (Crother et al. 2003, p. 197..., abandoned mammal burrows, and holes in and under old stumps (Richter et al. 2001, p. 318). Frequent fires...

  11. Rahvusvaheline mees Maximilian Schell / Jüri Laulik

    Index Scriptorium Estoniae

    Laulik, Jüri, 1959-

    2008-01-01

    Filmirežissöörist Maximilian Schellist ja tema filmidest "Jalakäija" ("Der Fussgänger" : Šveitsi - Saksamaa - Iisrael, 1973) ja "Kohtunik ja tema timukas" ("Der Richter und sein Henker" : Šveits - Saksamaa, 1975)

  12. Dvě výročí Ronalda Richtra – rodáka ze Sokolova

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    2011-01-01

    Roč. 59, č. 23 (2011), s. 28-28 ISSN 0040-1064 Institutional research plan: CEZ:AV0Z20430508 Keywords : fusion * Huemul Project * Juan Peron * Matterhorn * Dmitrij Sacharov * Jevgenij Tamm * Lyman Spitzer * Ronald Richter Subject RIV: BL - Plasma and Gas Discharge Physics

  13. Correlation between hydrocarbon reservoir properties and induced seismicity in the Netherlands

    NARCIS (Netherlands)

    Eijs, R.M.H.E. van; Mulders, F.M.M.; Nepveu, M.; Kenter, C.J.; Scheffers, B.C.

    2006-01-01

    Earthquakes induced by gas production are a social concern in the Netherlands. Over the last two decades, a total of about 350 such earthquakes have been recorded, with magnitudes ranging up to 3.5 on Richter's scale. The new Dutch mining law prescribes the operators to give a quantitative

  14. Language, cultural brokerage and informed consent – will ...

    African Journals Online (AJOL)

    2014-05-14

    May 14, 2014 ... focus of recent debate around ethical issues relating to the standard of care and ... Forty-one key words relevant to computer terminology and concepts required to gain informed consent for a .... patients did not understand the meaning of the word 'consent' and .... [24] Lindegger and Richter[25] looked at.

  15. Environmental Degradation, Social Marginalization and the ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    On 8 October 2005, an earthquake registering 7.6 on the Richter scale struck northeast Pakistan. Although concentrated in a small area, the damage was severe. At least 73 000 people were killed, 70 000 were injured, and 2.8 million were left homeless and susceptible to further injury. So far, little attention has been paid to ...

  16. HTS Teologiese Studies / Theological Studies - Vol 12, No 2 (1956)

    African Journals Online (AJOL)

    H . W . Hertzberg , Die Bücher Josua, Richter, Ruth übe rs etzt und erk lárt . Das Alte Testament Deutsch, Teilband 9. Göttingen, Vandenhoeck u. Ruprecht. 1953. S.281 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B Gemser, 80-81 ...

  17. South African Crime Quarterly - Vol 32 (2010)

    African Journals Online (AJOL)

    Of Nigerians, albinos, satanists and anecdotes: A critical review of the HSRC report on human trafficking · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C Gould, M Richter, I Palmery, 37-45. http://dx.doi.org/10.17159/2413-3108/2010/v0i32a883 ...

  18. Seismotektonik dan Potensi Kegempaan Wilayah Jawa

    Directory of Open Access Journals (Sweden)

    A. Soehaimi

    2014-06-01

    Full Text Available http://dx.doi.org/10.17014/ijog.vol3no4.20085A seismogenetic study shows the Jawa Island Arc and its subduction zone system belong to a highly active seismotectonic arc unit (west Jawa and Sumatera and an active seismotectonic arc unit (western part of West Jawa – Central Jawa – East Jawa. In general, these regions are part of the Indonesian Earthquake Hazard Zones No. VI, VII, VII and IX. The regions are characterized by the presence of rare earthquake of magnitude > 8.5 Richter Scale (western part of Java, frequent magnitude of 7 Richter Scale and common 5 - 6 Richter Scale (Southern part of Java. The potential hazardous earthquake in Jawa that is > 5,6 Richter Scale of magnitude and shallow depth (< 30 km is due to a subduction zone earthquake. Epicenter distance, magnitude, geological site conditions, population, and infrastructure are the index of earthquake hazard and risk in these regions. The earthquake hazard mitigation programme in the near future is a risk assesment based on macro and microzonation of earthquake hazard and risk. These macrozonation and microzonation assessments are essentially needed for provinces, districts, and cities.    

  19. Nordic nuclear emergency exercises. Final report

    International Nuclear Information System (INIS)

    Bennerstedt, T.; Stranden, E.; Salo, A.

    1995-01-01

    In all Nordic countries, nuclear emergency provisions have been revised following the Chernobyl accident. Local and national exercises are carried out regularly in each country. Several actions have been taken to harmonize the emergency approaches of the Nordic countries. In order to further promote consistent decisions in an emergency situation, two Nordic exercises were conducted in 1993. It was important to see if all five countries (Denmark, Finland, Iceland, Norway and Sweden) responded in a similar way to a given situation, as far as risk assessment and protective measures were concerned. The exercises were mainly aimed at decision makers and advisers of the five national emergency organizations. Thus, the exercises did not include comparison of underlying calculations on, e.g., atmospheric trajectories or transfer of radioactive material from air to ground. Such functions were tested separately in drills that also formed part of the Nordic emergency preparedness program. The exercises included an acute-phase situation (NORA), and a late-phase situation (ODIN). The Nordic exercises aroused international interest, and hence observers from IAEA, OECD/NEA and the European Union were invited to the exercises. NORA was observed by representatives from IAEA (in Finland) and OECD/NEA (in Sweden). ODIN was attended by IAEA (in Sweden) and the European Union (in Norway). Generally speaking, regional exercises such as NORA and ODIN help improve national emergency preparedness planning, organization and operations as well as international coordination. (EG)

  20. Dual-scale phase-field simulation of Mg-Al alloy solidification

    International Nuclear Information System (INIS)

    Monas, A; Shchyglo, O; Tegeler, M; Steinbach, I; Höche, D

    2015-01-01

    Phase-field simulations of the nucleation and growth of primary α-Mg phase as well as secondary, β-phase of a Mg-Al alloy are presented. The nucleation model for α- and β-Mg phases is based on the “free growth model” by Greer et al.. After the α-Mg phase solidification we study a divorced eutectic growth of α- and β-Mg phases in a zoomed in melt channel between α-phase dendrites. The simulated cooling curves and final microstructures of α-grains are compared with experiments. In order to further enhance the resolution of the interdendritic region a high-performance computing approach has been used allowing significant simulation speed gain when using supercomputing facilities. (paper)

  1. Environmental income improves household-level poverty assessments and dynamics

    DEFF Research Database (Denmark)

    Walelign, Solomon Zena; Charlery, Lindy Callen; Smith-Hall, Carsten

    2016-01-01

    Household-level poverty assessments and analyses of poverty dynamics in developing countries typically do not include environmental income. Using household (n = 427 in 2006, 2009 and 2012) total income panel data sets, with and without environmental income, from Nepal, we analysed the importance...... of environmental income in household-level poverty assessments (Foster-Greer-Thorbecke indices) and dynamics (movements in the Poverty Transition Matrix). Random effects logit and ordered logit models were applied to estimate variables covarying with poverty categories and compared for annual household incomes...... with and without environmental income. Using the without environmental income data set significantly changed the number of households classified as poor, as well as rates of movements in and out of poverty. Excluding household-level environmental income also distorted estimation of covariates of poverty incidence...

  2. Tourism Contribution to Poverty Alleviation in Kenya: A Dynamic Computable General Equilibrium Analysis

    Science.gov (United States)

    Njoya, Eric Tchouamou; Seetaram, Neelu

    2017-01-01

    The aim of this article is to investigate the claim that tourism development can be the engine for poverty reduction in Kenya using a dynamic, microsimulation computable general equilibrium model. The article improves on the common practice in the literature by using the more comprehensive Foster-Greer-Thorbecke (FGT) index to measure poverty instead of headcount ratios only. Simulations results from previous studies confirm that expansion of the tourism industry will benefit different sectors unevenly and will only marginally improve poverty headcount. This is mainly due to the contraction of the agricultural sector caused the appreciation of the real exchange rates. This article demonstrates that the effect on poverty gap and poverty severity is, nevertheless, significant for both rural and urban areas with higher impact in the urban areas. Tourism expansion enables poorer households to move closer to the poverty line. It is concluded that the tourism industry is pro-poor. PMID:29595836

  3. Sally Mann, La chair toute nue

    Directory of Open Access Journals (Sweden)

    Lisa Rossi

    2010-02-01

    Full Text Available Il y a trente ans de cela, la féministe Margaret Walters remarquait qu’il subsistait une distinction tenace entre « le Sexe-qui-regarde » et le « Sexe-qui-est-regardé » dans les conventions de la représentation du nu. Une vingtaine d’années plus tard, Germaine Greer réaffirmait cette assertion et déplorait que toute transgression de cet état de fait provoquât la controverse, ou pire, n’éveillât aucun intérêt (The Beautiful Boy, 2003. Si le mouvement féministe des années 1970 a vu des artiste...

  4. OPORTUNITIES PROGRAM IN MEXICO AND SONORA: IMPACT, EFFICIENCY AND EFFECTIVENESS

    Directory of Open Access Journals (Sweden)

    Irasema Lilian Mancillas-Alvarez

    2015-07-01

    Full Text Available The concept of poverty is based on the monetary approach, which is measured by the method of poverty lines (Foster, Greer and Thoerbecke, 1984; Sen, 1976; while the static microsimulation technique (Bourguignon and Spadaro, 2006 helps quantify the impact of Oportunities in reducing poverty in Mexico and Sonora during the years 2010-2012. The information for this study is obtained from the National Survey of Income and Expenditure Household INEGI (2010, 2012.Lower percentages of poverty were found in Sonora in comparison with the country and no significant impact from the program; the greatest impact was seen in the country since food poverty was reduced (-2.14%, capabilities poverty (- 1.86% and patrimonial poverty (-0.81%. In regards to targeting of the program, in the country there is a slight improvement in efficiency but not in effectiveness and Sonora experienced a significant improvement in efficiency and effectiveness.

  5. Uranium favorability of southwestern Oklahoma and north-central Texas

    International Nuclear Information System (INIS)

    Stanton, G.D.; Brogdon, L.D.; Quick, J.V.; Thomas, N.G.; Martin, T.S.

    1977-10-01

    Results are presented of a project to identify and delineate units and (or) facies that are favorable for uranium in the Upper Pennsylvanian and Lower Permian strata of north-central Texas and southwestern Oklahoma. To aid in this evaluation, an assessment of the probable uranium rocks (Wichita and Arbuckle Mountains) was necessary. Surface samples were collected from igneous and sedimentary rocks. Stream-sediment samples were also collected. However, the main emphasis of the investigation of the sedimentary units was on the identification of sedimentary facies trends in the subsurface and an evaluation of the uranium favorability within units studied. The area investigated centers along the Red River, the boundary between Texas and Oklahoma. The project area encompasses approximately 17,000 sq. mi. It includes all or parts of Cooke, Montague, Clay, Wichita, Wilbarger, Hardeman, Baylor, Knox, and Archer Counties in Texas and Love, Jefferson, Cotton, Tillman, Jackson, Stephens, Carter, Comanche, Harmon, and Greer Counties in Oklahoma

  6. Off-farm employment and income poverty in favourable agro-climatic areas of Tanzania

    DEFF Research Database (Denmark)

    Msinde, John Victor; Urassa, Justin K.; Nathan, Iben

    2016-01-01

    Income poverty in Tanzania as elsewhere in developing countries is predominantly a rural phenomenon and affects largely households relying on subsistence farming. This is despite the fact that poverty reduction strategies have devoted increasing attention on the role farm employment in enhancing...... household income. This paper argues that, off-farm employment may have potential to contribute to reduction of rural households’ income poverty. Hence the main objective of the paper is set to examine effects of off-farm employment on income poverty. Data was collected from a random sample of 309 households...... in the first quarter of 2014 in five villages of Kilombero Valley, Tanzania using a structured questionnaire. Income poverty was analysed using the Foster-Greer-Thorbecke (FGT) poverty index and two stage least square (2SLS) regression. Households with off-farm employment income were found to be less poor...

  7. Julgamento Pelos Media: Policiamento, Ambiente Mediatico das Noticias 24/7 e a Politica da Indignacao (Portuguese translation of 'Trial By Media: Policing, The 24-7 News Mediasphere, And The Politics Of Outrage')

    OpenAIRE

    Greer, C.; McLaughlin, E.

    2012-01-01

    Este artigo analisa a natureza em mudança das relações entre os meios de comunicação social e a chefia da polícia. Com base em estudos prévios (Greer & McLaughlin, 2010), usamos os conceitos de «estrutura inferencial» (Lang & Lang, 1955) e «hierarquia da credibilidade» (Becker, 1967) para analisar o «julgamento pelos media» do antigo comissário do Serviço da Polícia Metropolitana (MPS), Sir Ian Blair. Centramo-nos na reação coletiva e fundamentalmente hostil por parte dos media à declaração d...

  8. «Julgamento pelos media»: policiamento, ambiente mediático das notícias 24/7 e a «política da indignação»

    OpenAIRE

    Greer, Chris; McLaughlin, Eugene

    2012-01-01

    Este artigo analisa a natureza em mudança das relações entre os meios de comunicação social e a chefia da polícia. Com base em estudos prévios (Greer & McLaughlin, 2010), usamos os conceitos de «estrutura inferencial» (Lang & Lang, 1955 e «hierarquia da credibilidade» (Becker, 1967) para analisar o «julgamento pelos media» do antigo comissário do Serviço da Polícia Metropolitana (MPS), Sir Ian Blair. Centramo-nos na reação coletiva e fundamentalmente hostil por parte dos media à declaração de...

  9. Preternatural Claims, Precarious Workers: The Content and Distribution of the Most Successfully Crowdfunded Documentary

    Directory of Open Access Journals (Sweden)

    Dugan Nichols

    2014-10-01

    Full Text Available This article examines the raced, gendered, and classed world of UFO-related media with the intention of assessing its potential as a form of resistance. I use as a case study the largest crowdsourced documentary of all time, Sirius (2013, which explores exotic technologies and the exploits of ufologist, Dr. Steven Greer. Sirius’s affiliates conducted immaterial, post-Fordist labor to distribute the environmentally conscious film online, yet despite their progressive, utopian bent, they indicate that any technologies associated with the film will operate under market logic. Moreover, Sirius recycles racially fraught tropes of UFO culture, such as reflecting white ufologists’ desire to experience the Other or subject to understanding a gray race of beings they fear has challenged their racially privileged status.

  10. Cognitive and emotional predictors of episodic and dispositional forgiveness

    Directory of Open Access Journals (Sweden)

    Mróz Justyna

    2017-06-01

    Full Text Available The study examined the importance of cognitive (positive orientation, basic hope and emotional (positive and negative affectivity, emotional control variables for state and trait forgiveness. One hundred and thirty nine participants completed six inventories in Polish version: HFS (Thompson et al., 2005, TRIM (McCullough et al., 1998, P-Scale (Caprara et al., 2012, BHI-12 (Trzebiński & Zięba, 2003a, SUPIN (Polish version of PANAS; Watson, Clark, & Tellegen, 1988, CECS (Watson & Greer, 1983. Results showed that dispositional forgiveness (general and positive was associated with cognitive and emotional predictors, whereas episodic forgiveness primarily with certain emotional variables. In addition, the results indicated that emotional predictors merely participate in the process of reducing unforgiveness, whereas cognitive and emotional variables were shown to be necessary for full forgiveness.

  11. A review of recommendations for sequencing receptive and expressive language instruction.

    Science.gov (United States)

    Petursdottir, Anna Ingeborg; Carr, James E

    2011-01-01

    We review recommendations for sequencing instruction in receptive and expressive language objectives in early and intensive behavioral intervention (EIBI) programs. Several books recommend completing receptive protocols before introducing corresponding expressive protocols. However, this recommendation has little empirical support, and some evidence exists that the reverse sequence may be more efficient. Alternative recommendations include teaching receptive and expressive skills simultaneously (M. L. Sundberg & Partington, 1998) and building learning histories that lead to acquisition of receptive and expressive skills without direct instruction (Greer & Ross, 2008). Empirical support for these recommendations also is limited. Future research should assess the relative efficiency of receptive-before-expressive, expressive-before-receptive, and simultaneous training with children who have diagnoses of autism spectrum disorders. In addition, further evaluation is needed of the potential benefits of multiple-exemplar training and other variables that may influence the efficiency of receptive and expressive instruction.

  12. Tourism Contribution to Poverty Alleviation in Kenya: A Dynamic Computable General Equilibrium Analysis.

    Science.gov (United States)

    Njoya, Eric Tchouamou; Seetaram, Neelu

    2018-04-01

    The aim of this article is to investigate the claim that tourism development can be the engine for poverty reduction in Kenya using a dynamic, microsimulation computable general equilibrium model. The article improves on the common practice in the literature by using the more comprehensive Foster-Greer-Thorbecke (FGT) index to measure poverty instead of headcount ratios only. Simulations results from previous studies confirm that expansion of the tourism industry will benefit different sectors unevenly and will only marginally improve poverty headcount. This is mainly due to the contraction of the agricultural sector caused the appreciation of the real exchange rates. This article demonstrates that the effect on poverty gap and poverty severity is, nevertheless, significant for both rural and urban areas with higher impact in the urban areas. Tourism expansion enables poorer households to move closer to the poverty line. It is concluded that the tourism industry is pro-poor.

  13. Thin film structures and phase stability

    International Nuclear Information System (INIS)

    Clemens, B.M.; Johnson, W.L.

    1990-01-01

    This was a two day symposium, with invited and contributed papers as well as an evening poster session. The first day concentrated on solid state reactions with invited talks by Lindsay Greer from the University of Cambridge, King Tu from IBM Yorktown Heights, and Carl Thompson from MIT. Professor Greer observed that the diffusion of Zr is 10 6 times slower than that of Ni in amorphous NiZr, confirming that Ni is the mobile species in solid state amorphization. King Tu explained the formation of metastable phases in this film diffusion couples by the concept of maximum rate of free energy change. Carl Thompson discussed the formation of amorphous phases in metal silicon systems, and discussed a two stage nucleation and growth process. The contributed papers also generated discussion on topics such as phase segregation, amorphous silicide formation, room temperature oxidation of silicon, and nucleation during ion beam irradiation. There was a lively poster session on Monday evening with papers on a wide variety of topics covering the general area of thin film science. The second day had sessions Epitaxy and Multilayer Structure I and II, with the morning focussing on epitaxial and heteroepitaxial growth of thin films. Robin Farrow of IBM Almaden led off with an invited talk where he reported on some remarkable success he and his co-workers have had in growing single crystal epitaxial thin films and superlattices of silver, iron, cobalt and platinum on GaAs. This was followed by several talks on epitaxial growth and characterization. The afternoon focused on interfaces and structure of multilayered materials. A session on possible stress origins of the supermodulus effect was highlighted by lively interaction from the audience. Most of the papers presented at the symposium are presented in this book

  14. Políticas públicas, distribuição de renda e pobreza no meio rural brasileiro no período de 1995 a 2005

    Directory of Open Access Journals (Sweden)

    Renata Couto Moreira

    2009-12-01

    Full Text Available O presente trabalho buscou discutir o papel das políticas públicas no processo histórico de concentração de renda e pobreza no meio rural brasileiro. Com base nas informações das pessoas acima de 10 anos residentes nas áreas rurais das Pesquisas Nacionais por Amostra de Domicílios (PNAD, para o período de 1995 a 2005, calcularam-se os índices de desigualdade de Gini, de Theil (R e L e os índices de pobreza de Foster-Greer-Thorbecke (1984 e de Datt (1998. Os dados e resultados indicam para a existência da relação entre a persistente condição de pobreza da população rural e as políticas agrária e econômica adotadas no período.The objective of the present work is to discuss about the role of public policies in the historic process of income concentration and poverty in the Brazilian rural territory. With basis in information about persons up to 10 years residents in rural areas from the National Research of Domiciles Sample (PNDA for the period from 1995 to 2005, there was calculated the Gini and Theil (R and L inequality Index, and the Foster-Greer-Thorbecke (1984 and Datt (1998 poverty Index. The data and results bring the indication of the existence of the relation between the persistent condition of poverty of the rural population and the agrarian and economic policies adopted in the period.

  15. Magnitude determination for large underground nuclear explosions

    Energy Technology Data Exchange (ETDEWEB)

    Porter, Lawrence D [Lawrence Radiation Laboratory, University of California, Livermore, CA (United States)

    1970-05-15

    A method is presented for determining the local magnitudes for large underground nuclear explosions. The Gutenberg-Richter nomograph is applied to the peak amplitudes for 24 large underground nuclear explosions that took place in Nevada. The amplitudes were measured at 18 California Wood-Anderson stations located 150-810 km from the explosion epicenter. The variation of the individual station magnitudes and magnitude corrections and the variation of the average and rms error estimates in the magnitude determinations are examined with respect to distance, azimuth, and event location. The magnitude prediction capability of the Gutenberg-Richter nomograph is examined on the basis of these two criteria, and certain corrections are suggested. The azimuthal dependence of the individual station magnitudes is investigated, and corrections for the California stations are calculated. Statistical weighting schemes for two-component data are employed, and the assumptions and limitations in the use of peak amplitudes are discussed. (author)

  16. Earthquake at 40 feet

    Science.gov (United States)

    Miller, G. J.

    1976-01-01

    The earthquake that struck the island of Guam on November 1, 1975, at 11:17 a.m had many unique aspects-not the least of which was the experience of an earthquake of 6.25 Richter magnitude while at 40 feet. My wife Bonnie, a fellow diver, Greg Guzman, and I were diving at Gabgab Beach in teh outer harbor of Apra Harbor, engaged in underwater phoyography when the earthquake struck. 

  17. Fundamental questions of earthquake statistics, source behavior, and the estimation of earthquake probabilities from possible foreshocks

    Science.gov (United States)

    Michael, Andrew J.

    2012-01-01

    Estimates of the probability that an ML 4.8 earthquake, which occurred near the southern end of the San Andreas fault on 24 March 2009, would be followed by an M 7 mainshock over the following three days vary from 0.0009 using a Gutenberg–Richter model of aftershock statistics (Reasenberg and Jones, 1989) to 0.04 using a statistical model of foreshock behavior and long‐term estimates of large earthquake probabilities, including characteristic earthquakes (Agnew and Jones, 1991). I demonstrate that the disparity between the existing approaches depends on whether or not they conform to Gutenberg–Richter behavior. While Gutenberg–Richter behavior is well established over large regions, it could be violated on individual faults if they have characteristic earthquakes or over small areas if the spatial distribution of large‐event nucleations is disproportional to the rate of smaller events. I develop a new form of the aftershock model that includes characteristic behavior and combines the features of both models. This new model and the older foreshock model yield the same results when given the same inputs, but the new model has the advantage of producing probabilities for events of all magnitudes, rather than just for events larger than the initial one. Compared with the aftershock model, the new model has the advantage of taking into account long‐term earthquake probability models. Using consistent parameters, the probability of an M 7 mainshock on the southernmost San Andreas fault is 0.0001 for three days from long‐term models and the clustering probabilities following the ML 4.8 event are 0.00035 for a Gutenberg–Richter distribution and 0.013 for a characteristic‐earthquake magnitude–frequency distribution. Our decisions about the existence of characteristic earthquakes and how large earthquakes nucleate have a first‐order effect on the probabilities obtained from short‐term clustering models for these large events.

  18. Questionnaire-based evaluation of everyday competence in older adults

    OpenAIRE

    Kalisch, Tobias

    2011-01-01

    Tobias Kalisch1, Julia Richter3, Melanie Lenz1, Jan-Christoph Kattenstroth2, Izabela Kolankowska2, Martin Tegenthoff1, Hubert R Dinse21Department of Neurology, BG-Kliniken Bergmannsheil, 2Neural Plasticity Lab, Institute for Neuroinformatics, Department of Theoretical Biology, 3Faculty of Psychology, Department of Methods, Diagnostics and Evaluation, Ruhr-University Bochum, GermanyBackground: Gerontological research aims at understanding factors that are crucial for mediating “succe...

  19. Renforcement de la résilience des collectivités de montagne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Un puissant séisme de magnitude 7,8 sur l'échelle de Richter a frappé le centre du Népal le 25 avril 2015, causant plus de 8 700 pertes de vie et plus de 22 000 blessés. Des centaines de milliers de maisons ont été réduites en ruines, quelque 15 000 immeubles gouvernementaux et 288 797 immeubles résidentiels ont ...

  20. Air Force Civil Engineer, Volume 9, Number 2, Summer 2001

    Science.gov (United States)

    2001-01-01

    and massive concrete slabs with protruding steel segments were partially hidden by an overgrowth of vegetation . The three-story structure, which was...terms of the job you get afterward. Capt Bill Kale came to AFIT from Lajes Field, Azores, where he was the base architect with the 65th CES. Q. Why did...meet Air Force civil engineer needs. Speaking of AFIT � Capt Manuel Fernandez Capt Bill Kale Capt Laurie Richter Interviews with current and former

  1. Reframing the photograph: confronting the Nazi past through artistic performance strategies since the 1960s

    OpenAIRE

    Allwork, Larissa

    2015-01-01

    Working in a period when the western modernist focus on the originality of the artist, painterly form and composition had given way to more post Duchampian practices such as reappropriation, performance and the role of the spectator in creating artistic meaning, this paper will focus on works by Gerhard Richter, Anselm Kiefer and Gustav Metzger. This paper will evaluate how these artists perform the photograph in three divergent yet distinctly post-Duchampian ways in order to articulate chall...

  2. The Exploitation of the Electric Contributions in Infrared Power Generation

    Science.gov (United States)

    2016-02-02

    temperature, i.e., cook food and heat-up beverages . Similarly, through laser radiation it is possible to increase temperature, even with na...2015. [13] C.-P. Richter, S. Rajguru, R. Stafford, and S. R. Stock, Radiant energy during infrared neural stimulation at the target structure, Proc...Currie). -> Lodging and food for G. Scarel’s travel to NRL on August 17-19, 2015: $ 655.82 (•) Miscellaneous: —> Bruker HeNe laser module to support

  3. Response of mycorrhizal grapevine to Armillaria mellea inoculation: disease development and polyamines.

    OpenAIRE

    Nogales, A. (Amaia); Aguirreolea, J. (Jone); Santa-Maria, E. (Eva); Camprubi, A. (Amalia); Calvet, C. (Cinta)

    2009-01-01

    A study was conducted with the vine rootstock Richter 110 (Vitis berlandieri Planch. x Vitis rupestris L.) in order to assess whether the colonisation by the arbuscular mycorrhizal fungus (AMF) Glomus intraradices (BEG 72) can delay the disease development in plants inoculated with the root-rot fungus Armillaria mellea (Vahl:Fr) Kummer, and to elucidate if the levels of polyamines (PAs) are modified in response to G. intraradices, A. mellea or by the dual infection. Four treatments were consi...

  4. 1983 Borah Peak earthquake and INEL structural performance

    International Nuclear Information System (INIS)

    Gorman, V.W.; Guenzler, R.C.

    1983-12-01

    At 8:06 a.m. Mountain Daylight Time on October 28, 1983 an earthquake registering 7.3 on the Richter Magnitude scale occurred about 30 km northwest of the town of Mackay, in central Idaho. This report describes the event and associated effects and the responses of facilities at Idaho National Engineering Laboratory (INEL), located approximately 100 km. from the epicenter, to ground motion. 21 references, 36 figures, 5 tables

  5. Nondestructive Evaluation of Aircraft Composites Using Terahertz Time Domain Spectroscopy

    Science.gov (United States)

    2008-12-10

    silicon or silicon dioxide in polypropylene . 50 THz NDE is also being proposed as a method of inspecting the adhesive bond- line of space...weave the overlapping pattern used in the composite. The polyimide resin is added and permeates throughout the individual glass fiber strands. The...dx.doi.org/10.1117/12.590301 65. Rutz, F., Hasek, T., Koch, M., Richter, H., Ewert, U. (2006). Terahertz birefringence of liquid crystal polymers

  6. US Cub Scouts visit CERN

    CERN Multimedia

    2001-01-01

    A group of young American Cub Scouts from Den 10, Pack 130 (based in Geneva) at the Microcosm last Saturday. On their trip to CERN, which included the first Visits Service tour of the ATLAS construction site, the scouts were able to satisfy most of the requirements for the Cub Scout engineering badge. From left to right: Edouard Vincent, Ariel Litke, Alexander Richter, Antoine Vidal de Saint Phalle, Jason Iredale and Daniel Reghelini.

  7. 1959 - 1969 Ten years in the life of a machine

    CERN Multimedia

    1969-01-01

    Operation and development of the PS have brought a dramatic improvement in its capabilities. This article describes the years of getting to know the machine and of developing its potential, picking out some major landmarks on the way. The article was put together with the help of P.H. Standley (PS Division Head), C.S. Taylor (Linac), G. Plass, W. Richter (Mam Ring), M. Georgijevic (Power Supply), J.H.B. Madsen (Operation), and G.L. Munday (Experimental Areas).

  8. The moment magnitude Mw and the energy magnitude Me: common roots and differences

    OpenAIRE

    2010-01-01

    Abstract Starting from the classical empirical magnitude-energy relationships, in this article, the derivation of the modern scales for moment magnitude Mw and energy magnitude Me is outlined and critically discussed. The formulas for Mw and Me calculation are presented in a way that reveals, besides the contributions of the physically defined measurement parameters seismic moment M0 and radiated seismic energy ES, the role of the constants in the classical Gutenberg?Richter magnit...

  9. Dégradation de l'environnement, marginalisation sociale et ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    6 sur l'échelle de Richter a frappé le nord-est du Pakistan. La région touchée était peu étendue, mais d'importants dommages ont été causés : au moins 73 000 personnes ont péri, 70 000 ont été blessées et 2,8 millions ont perdu leur foyer, ...

  10. Roostocks/Scion/Nitrogen Interactions Affect Secondary Metabolism in the Grape Berry

    OpenAIRE

    Habran, Aude; Commisso, Mauro; Helwi, Pierre; Hilbert, Ghislaine; Negri, Stefano; Ollat, Nathalie; Gom?s, Eric; van Leeuwen, Cornelis; Guzzo, Flavia; Delrot, Serge

    2016-01-01

    ABSTRACT : The present work investigates the interactions between soil content, rootstock and scion by focusing on the effects of roostocks and nitrogen supply on grape berry content. Scions of Cabernet Sauvignon (CS) and Pinot Noir (PN) varieties were grafted either on Riparia Gloire de Montpellier (RGM) or 110 Richter (110R) rootstock. The 4 rooststock/scion combinations were fertilized with 3 different levels of nitrogen after fruit set. Both in 2013 and 2014, N supply increased N uptake ...

  11. Aerophytic Cyanobacteria as a Factor in the Biodegradation of Technical Materials on External Building Walls

    Science.gov (United States)

    Piontek, Marlena; Lechów, Hanna

    2014-12-01

    A study conducted at the Institute of Environmental Engineering, University of Zielona Góra showed the presence of 4 species of aerophytic cyanobacteria in the biological material sampled from the external building wall with visible biocorrosion: Gloeocapsa montana Kützing, Phormidium calcareum Kützing, Aphanothece saxicola Nägeli, Gloeothece caldariorum (P. Richter) Hollerbach. High levels of moisture were detected in the places of biofilm occurrence.

  12. Aerophytic Cyanobacteria as a Factor in the Biodegradation of Technical Materials on External Building Walls

    Directory of Open Access Journals (Sweden)

    Piontek Marlena

    2014-12-01

    Full Text Available A study conducted at the Institute of Environmental Engineering, University of Zielona Góra showed the presence of 4 species of aerophytic cyanobacteria in the biological material sampled from the external building wall with visible biocorrosion: Gloeocapsa montana Kützing, Phormidium calcareum Kützing, Aphanothece saxicola Nägeli, Gloeothece caldariorum (P. Richter Hollerbach. High levels of moisture were detected in the places of biofilm occurrence.

  13. Management Consultancy As Practice: A Study Of The Duality Of The Management Consultants' Role

    OpenAIRE

    Hartley, Jeanette

    2017-01-01

    The central question addressed in this research is: “How do practicing management consultants cope with the duality of their role?” Management consultants are often responsible for internal business leadership roles as well as developing business, people and knowledge alongside client delivery (Richter et al., 2008). The research sought to understand the nature of the potentially conflicting demands of their client-facing and consultancy-facing roles on management consultants, how conflicts a...

  14. A Comparative Study of Various Electric Propulsion Systems and their Impact on a Nominal Ship Design

    Science.gov (United States)

    1987-06-01

    Permanent Magnet Motors ," Advanced Mechanical Technology, Inc., 1983. 20. Marshall, McMurray, Richter, Webster, and...December 1977. 21. Triezenbarg, Greene, Hannan, and Dvorsky, "Study of Permanent Magnet Motors for Naval Propulsion," Westinghcuse Research Report 80=9B2...34 Paper 71 CP 155-PWR, IEEE Winter Power Meeting, New York, February 1971. 34. Ireland, James R., Ceramic Permanent - Magnet Motors , McGraw-Hill, New York, 1968. 206

  15. Monthly Report No. 7/2008

    OpenAIRE

    Leon Podkaminer; Sandor Richter; Marton Szabó

    2008-01-01

    Hungarian agriculture - starting the fifth year within the European Union (by M. Szabó, pp. 1-7) Keywords agriculture, international trade Countries covered Hungary Topics Agriculture and Food Industry; International Trade and Competitiveness Migration from and to Hungary (by S. Richter, pp. 8-15) Keywords migration, labour force Countries covered Hungary Topics Labour and Migration The international role of the euro prospects of dethroning the dollar as the leading international currency sti...

  16. Events and incidents in 2011; Hendingar og uhell i 2011

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-11-01

    11. March 2011 Japan was hit by an earthquake measuring 9.0 on the Richter scale.The earthquake was followed by a massive tsunami. In all four Japanese nuclear power plants were affected of these events. The nuclear plant Fukushima Daiichi was hit hardest. In addition to Fukushima accident, 2011 was a year with several events, bow fires at nuclear waste facilities, icebreakers and submarines, which NRPA had to deal with. (eb)

  17. The Fukushima-incident; Fukushima-ulykken

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-11-01

    11. March 2011 Japan was hit by an earthquake measuring 9.0 on the Richter scale.The earthquake was followed by a massive tsunami. In all four Japanese nuclear power plants were affected of these events. The nuclear plant Fukushima Daiichi was hit hardest. As the Secretariat for the Crisis Committee for Nuclear Preparedness NRPA followed the situation in Japan closely. In retrospect, the NRPA shared experiences from the Chernobyl accident with Japan. (eb)

  18. Defense Standardization Program Journal. July/December 2010

    Science.gov (United States)

    2010-12-01

    benefited both DoD and SC7. About the Authors Karen Richter is a senior analyst and project leader with the Strategy, Forces, and Resources Division... benefits of a proactive parts management approach. Among the accomplishments in this area are presentations at PSMC conferences: de- velopment of a...of a part’s authenticity. I A franchisee ! distributor has a contractual agreement with the OCM to buy, stock, repackage, sell, and distribute its

  19. Reinnervation of Paralyzed Muscle by Nerve-Muscle-Endplate Band Grafting

    Science.gov (United States)

    2015-10-01

    Antoniadis G, Braun V, Rath SA, Richter HP. Evaluation of iatrogenic lesions in 722 surgically treated cases of peripheral nerve trauma. J Neurosurg...achieved by end-to-end approximation: review of 2,181 nerve lesions . Microsurgery. 1993;14(4):244- 246. 18 25. McAllister RM, Gilbert SE, Calder JS...innervation through irreparable damage to its nerve . DNI has been used for selective reinnervation of paralyzed laryngeal and facial muscles [15,16] as well

  20. Muscle Weakness Is Associated With an Increase of Left Ventricular Mass Through Excessive Blood Pressure Elevation During Exercise in Patients With Hypertension.

    Science.gov (United States)

    Kamada, Yumi; Masuda, Takashi; Tanaka, Shinya; Akiyama, Ayako; Nakamura, Takeshi; Hamazaki, Nobuaki; Okubo, Michihito; Kobayashi, Naoyuki; Ako, Junya

    2017-08-03

    Autonomic imbalance in hypertension induces excessive blood pressure (BP) elevation during exercise, thereby increasing left ventricular mass (LVM). Although muscle weakness enhances autonomic imbalance by stimulating muscle sympathetic activity during exercise, it is unclear whether muscle weakness is associated with an increase of LVM in patients with hypertension. This study aimed to investigate the relationships between muscle weakness, BP elevation during exercise, and LVM in these patients. Eighty-six hypertensive patients aged 69 ± 8 years with controlled resting BP (ie, exercise test performed at moderate intensity (ΔNORA and ΔPWV, respectively). A difference between baseline and peak systolic BP during the exercise test was defined as BP elevation during exercise (ΔSBP). Relationships between muscle strength, ΔNORA, ΔPWV, ΔSBP, BNP, and LVMI were analyzed, and significant factors increasing LVM were identified using univariate and multivariate regression analyses. Muscle strength was negatively correlated with ΔNORA (r = -0.202, P = 0.048), ΔPWV (r = -0.328, P = 0.002), ΔSBP (r = -0.230, P = 0.033), BNP (r = -0.265, P = 0.014), and LVMI (r = -0.233, P = 0.031). LVMI was positively correlated with ΔPWV (r = 0.246, P = 0.023) and ΔSBP (r = 0.307, P = 0.004). Muscle strength was a significant independent factor associated with LVMI (β = -0.331, P = 0.010). Our findings suggest that muscle weakness is associated with an increase of LVM through excessive BP elevation during exercise in patients with hypertension.

  1. Experimental and numerical study of flows in PEM fuel cell stacks for traction applications; Etude numerique et experimentale des ecoulements dans une pile a combustible de type PEM adaptable aux applications embarquees

    Energy Technology Data Exchange (ETDEWEB)

    Picot, D

    1998-07-01

    The problems with the optimization and design of proton exchange membrane fuel cells (PEMFC) are mainly based on the mastery of water and heat transfers inside the active cells. A theoretical and experimental discussion about this topic is proposed. The average sharing coefficients of the generated water are measured for 3 Nora fuel cells (1, 5 and 10 kW). The values obtained with nafion 117 are in agreement with the data of the literature, while the 40% generated water recovered inside the anode compartment with nafion 115 are unexpected. The difficulty to obtain a physical formulation of electro-osmosis does not allow to quantify this coefficient and leads to justify the limitations of use of the numerical codes on this topic. However, by separating the intrinsic parameters of the electrodes/membrane system and the global operation parameters of a cell, it is possible to extrapolate realistic humidification strategies. In the framework of the European project 'Fever', a systemic model of a 30 kW module for electric-powered vehicle has been developed. For an optimum energy integration of Nora fuel cells in volume-limited applications, it is necessary to separate the humidification sections of these modules. In the case where air is used as oxidant, the presence of nitrogen inside the anode compartment has been evidenced both in close and recirculation modes. In agreement with the literature data about nafion permeability, the nitrogen migration through the electrolyte is explained by the diffusion theory. A discussion about the interest of using both operational modes to maximize the energy efficiency is proposed. Finally, a simple-phase and double-phase numerical study with interface reconstruction is carried out using the resolution of Navier-Stokes equations in Eulerian formalism in order to consider the problems linked with the internal flows inside the collectors of Nora cells. (J.S.)

  2. Some comments on the Shiva spaceframe earthquake damage

    International Nuclear Information System (INIS)

    Hurley, C.A.

    1980-01-01

    On January 24, 1980, at 11:00 a.m., an earthquake, measuring 5.5 on the Richter scale, shook the Livermore Valley. There were three very pronounced shocks, the first at 5.5 followed by two, one at 5.2 and the other at 4.8, on the Richter scale. The Shiva spaceframe was shaken out of alignment. Shiva consists of two frames, a laser frame and a target frame. Components on each frame stayed within alignment with respect to each other, but the target frame moved with respect to the laser frame. Shearing of the seismic anchor bolts on the target frame was responsible for this misalignment. This was the third in a series of earthquakes for Shiva, the first occurring on June 20, 1977 at a magnitude of 4.7 on the Richter scale and an epicenter 2 miles away. The second quake was on August 6, 1979, with a magnitude of 5.9 and the epicenter 60 miles away. There was no damage or misalignment due to these first two earthquakes. The third however, severely tested the Shiva system and will be the subject of this report. Accelerometers were not in operation on the system so we do not know what the acceleration forces were. Our subsequent investigation, however, gives us some indication of these forces

  3. Biografija : [luuletused] / Viivi Luik ; tlk. Svetlan Semenenko, lühibiograafia: T. L. [Toomas Liiv

    Index Scriptorium Estoniae

    Luik, Viivi, 1946-

    1999-01-01

    Sisu: Biografija ; "Smeisja, smeisja, davai smejatsja..." ; Rodnoi dom / tlk. Nora Javorskaja ; Molba ; "Ja skazhu: kol ne ja..." ; Starõi gorod ; V dorogu ; "Togo uzh ne naiti, kto zaplutal v meteli..." ; Ona skazala vsjo ; Bolshije doma ; Snova ; "Neprestanno krov vo mne zhurtshit..." / tlk. Svetlan Semenenko. Orig.: Elulugu ; "Naera, naera, naerame võidu..." ; Kodu ; Palve ; "Mõtlen: kui mitte mina...", "Ei jäta jälgi see, kes eksis sadudesse..." ; Ta on kõik öelnud ; Uued suured majad ; Jälle

  4. Musical outgroups and the paradox of social bonding. Comment on "Music, empathy and cultural understanding" by E. Clark et al.

    Science.gov (United States)

    Overy, Katie

    2015-12-01

    Clarke, DeNora and Vuoskoski's valuable review paper [2] raises the proposition that passive musical listening experiences can increase 'dispositional empathy' in individuals and consequently lead to increased positive feeling towards other cultural groups. The challenge of integrating relevant ideas and evidence from neuroscience, philosophy, psychology, sociology and community music is met convincingly, alongside the presentation of empirical data and a new model of empathic music listening. The resulting discussion brings social, motor and emotional aspects of musical behavior to the forefront and sparks a number of ideas and questions.

  5. Confronting a Divided Past for a Shared Future: The Lieux de Mémoire of the Altab Ali Park in London

    OpenAIRE

    Vékony, Dániel

    2017-01-01

    This paper deals with the Altab Ali Park and its significance in regards to the Muslim community in the London borough of Tower Hamlets. Using Pierre Nora’s concept of lieux de Mémoire, I would like to demonstrate how the Bangladeshi Muslim minority and the rest of the community of Tower Hamlets construct their collective memory through the transformation of the park. The article argues that the Altab Ali Park is in Pierre Nora's term a lieu de Mémoire with a multiple layers, which has been d...

  6. High-voltage transistor converter for pulsed x-ray sources

    International Nuclear Information System (INIS)

    Krasil'nikov, S.B.; Kristalinskii, A.L.; Lozovoi, L.N.; Markov, S.N.; Sindalovskii, E.I.

    1986-01-01

    A 24-V/12-kV converter for MIRA-2D and NORA pulsed x-ray sources is described. When the low-voltage supply varies within 20-26 V, the frequency stability of the x-ray pulses is higher by a factor of 3 ≅ 3 than when the PRIMA converter is used. For 14-24 V, the average output power of the converter is independent of the load impedance and increases linearly with an increase in supply voltage. The efficiency of the converter reaches 60%. The converter operates in the temperature range of -40 to +60 0 C

  7. Bizarre parosteal osteochondromatous proliferation of bone

    International Nuclear Information System (INIS)

    Bandiera, S.; Bacchini, P.; Bertoni, F.

    1998-01-01

    A 47-year-old man presented with a painless mass of 7 months' duration, on the plantar aspect of the great toe of the right foot. Radiographs and CT images initially suggested an osteochondroma arising from the proximal phalanx of the great toe but there was no continuity between the medullary canal of the phalanx and the lesion. The mass was excised and a histological diagnosis of bizarre parosteal osteochondromatous proliferation of bone (Nora's disease) was made. The aggressive growth of this lesion may clinically suggest a neoplasm. Histological features, however, are those of a reactive lesion. (orig.)

  8. Bizarre parosteal osteochondromatous proliferation of the proximal humerus: case report

    International Nuclear Information System (INIS)

    Bush, J.B.; Meyer, Mark S.; Reith, John D.

    2007-01-01

    Bizarre parosteal osteochondromatous proliferation (BPOP), or Nora's lesion, is a rare lesion of bone occurring predominantly in the long bones of the hands and feet. It exists as a puzzling clinical entity of uncertain origins and high recurrence rates after surgical resection. To our knowledge, this clinical entity has not been reported in the proximal aspect of the humerus. An interesting report of a lesion occurring in the proximal humerus, which initially was misinterpreted as a parosteal osteosarcoma, is discussed outlining the clinical, radiographic and pathologic features of the BPOP lesion. (orig.)

  9. Improving Battery Reactor Core Design Using Optimization Method

    International Nuclear Information System (INIS)

    Son, Hyung M.; Suh, Kune Y.

    2011-01-01

    The Battery Omnibus Reactor Integral System (BORIS) is a small modular fast reactor being designed at Seoul National University to satisfy various energy demands, to maintain inherent safety by liquid-metal coolant lead for natural circulation heat transport, and to improve power conversion efficiency with the Modular Optimal Balance Integral System (MOBIS) using the supercritical carbon dioxide as working fluid. This study is focused on developing the Neutronics Optimized Reactor Analysis (NORA) method that can quickly generate conceptual design of a battery reactor core by means of first principle calculations, which is part of the optimization process for reactor assembly design of BORIS

  10. Comparison of models discribing cladding deformations during LOCA

    International Nuclear Information System (INIS)

    Chakraborty, A.K.; Zipper, R.

    1981-05-01

    This report compares the important models for the determination of cladding deformations during LOCA. In addition to the comparisons of underlying assumptions of different models the same is done for the coefficients applied for the models. In order to assess the predictive capability of the models the calculated results are compared with the experimental results of the individual claddings. It was found out that the results of temperature ramp tests could be calculated better than that of the pressure ramp tests. The calculations revealed that even with the simplified assumption of the model used in TESPA the agreement of the calculated results with those of model NORA was relatively good. (orig.) [de

  11. Research on reactor physics data

    International Nuclear Information System (INIS)

    1961-01-01

    In the early years of nuclear reactor research, each national program tended to develop its own reactor physics information. The Government of Norway proposed to the Agency the undertaking of a joint program in reactor physics utilizing the facilities and staff of its zero power reactor NORA then under construction. Following the approval by the Board of Governors in February, the Agency invited Member States to submit the names and qualifications of scientists they wished to suggest for the project. All the results and information gained through the program, which is expected to last about three years, will be placed at the disposal of the Agency's Member States

  12. Respiration rate of gamma irradiation carnation cut flowers

    International Nuclear Information System (INIS)

    Kikuchi, Olivia Kimiko; Wiendl, Frederico Maximiliano; Todoriki, Setsuko; Nakahara, Kazuhiko; Haysahi, Toru

    1996-01-01

    The present paper presents the CO 2 production of the carnation cut flowers gamma-irradiated with a single dose of 750 Gy. The cut flowers were soaked in preservative solutions, containing germicides or germicides plus 2% sucrose. The irradiation did not change the CO 2 production and did not cause any visible flower damage. The sucrose exogenous supply extended the vase-life of both irradiated and non-irradiated carnations. These results indicated that Nora carnation cut flower can be irradiated with 750 Gy without commercial viability loss and that it is possible to use the radiation to disinfect this fresh product. (author)

  13. Administrative Structure of the Second Empire: The Case of Imperial Administration in Sonora

    Directory of Open Access Journals (Sweden)

    Zulema Trejo

    2008-04-01

    Full Text Available Among the many different aspects that made up Mexico's Second Empire, this work seeks to describe and analyze its administra­tive structure, both at the national and departmental levels. For analyzing the departmental level, the author chose the case of So­nora, focusing on conflicts between Sonoran imperial officials and the commissioner of the Eighth Territorial division, in order to stress the pragmatism and autonomy that characterized Sonoran officials all along the nineteenth century,  regardless of the type of government adopted at the national level.

  14. Entre a filosofia e a sociologia: matrizes teóricas das discussões atuais sobre história e memória

    Directory of Open Access Journals (Sweden)

    Schmidt, Benito Bisso

    2006-01-01

    Full Text Available O objetivo deste texto é situar as matrizes teóricas dos trabalhos de alguns autores que servem como referência para boa parte dos estudos contemporâneos sobre as relações entre história e memória: Bergson, Halbwachs, Pollak, Nora e Ricoeur. Seus estudos dialogam, de maneira direta ou indireta, com duas matrizes: a sociológica-objetivista e a fenomenológica-intuicionista. Elas se estabeleceram no âmbito da disputa entre a sociologia e a filosofia pelo direcionamento das ciências humanas nascentes no século XIX

  15. La construcción de un lugar de memoria en la Provincia de Buenos Aires. Mansión Seré, Morón, 1983-2007

    OpenAIRE

    Dolores San Julián

    2014-01-01

    En este trabajo reconstruimos sintéticamente el proceso de constitución de Mansión Seré como un lugar de memoria (Nora, 1984). Durante los primeros años de la última dictadura militar en Argentina (1976-1983), esta casona funcionó como centro de tortura y desaparición de personas. En el año 2000, el Estado local junto a organismos de Derechos Humanos decidieron convertirla en un espacio de rememoración y transmisión de lo ocurrido bajo el terrorismo de Estado. A partir de documentos y entrevi...

  16. Bizarre parosteal osteochondromatous proliferation of the proximal humerus: case report

    Energy Technology Data Exchange (ETDEWEB)

    Bush, J.B.; Meyer, Mark S. [Ochsner Clinic Foundation, Department of Orthopedics, New Orleans, LA (United States); Reith, John D. [University of Florida College of Medicine, Departments of Pathology, Immunology and Laboratory Medicine and Orthopaedics and Rehabilitation, Gainesville, Florida (United States)

    2007-06-15

    Bizarre parosteal osteochondromatous proliferation (BPOP), or Nora's lesion, is a rare lesion of bone occurring predominantly in the long bones of the hands and feet. It exists as a puzzling clinical entity of uncertain origins and high recurrence rates after surgical resection. To our knowledge, this clinical entity has not been reported in the proximal aspect of the humerus. An interesting report of a lesion occurring in the proximal humerus, which initially was misinterpreted as a parosteal osteosarcoma, is discussed outlining the clinical, radiographic and pathologic features of the BPOP lesion. (orig.)

  17. A Contrastive Study of the Heroines in A Doll’s House and Macbeth

    Institute of Scientific and Technical Information of China (English)

    TANG Lu

    2015-01-01

    A Doll’s House and Macbeth obviously belong to different categories in content. However, the two heroines in these two plays, Nora Helmer and Lady Macbeth, demonstrate similar feminist qualities. By staging an overall contrastive analysis on the personality and tragic life of two protagonists from the perspective of feminism, it is founded that both of them are victims op⁃pressed by the patriarchal system and they all have feminine consciousness against this system. Nevertheless, their distinctive com⁃plex personalities and different story settings make the reasons for their rebellion differ in many ways and they end up with differ⁃ent endings.

  18. Avgang 2017: Don Giovanni i Operaen

    OpenAIRE

    2017-01-01

    Opera av W.A. Mozart, med våre MA-studenter og gjester. Medvirkende: Dagfinn Andersen (MA2), Emil Havold Næshagen (MA1), Hanne Korsbrekke Askeland (MA2), Nora Oleanne Sårheim (MA2?), Sara Aasen (MA2), Marcela Randem (MA1), Eilert Hasseldal (MA1). Gjester: Eirik Grøtvedt, Per Lindström, Pavels Trofimiks. Kostymer: Fredrik Straum Floen. Dessuten medvirker kor (NMH), strykere (Ensemble Allegri) og blåsere (Stabsmusikken i Oslo)

  19. Berberine-INF55 (5-Nitro-2-Phenylindole) Hybrid Antimicrobials: Effects of Varying the Relative Orientation of the Berberine and INF55 Components ▿

    Science.gov (United States)

    Tomkiewicz, Danuta; Casadei, Gabriele; Larkins-Ford, Jonah; Moy, Terence I.; Garner, James; Bremner, John B.; Ausubel, Frederick M.; Lewis, Kim; Kelso, Michael J.

    2010-01-01

    Hybrid antimicrobials containing an antibacterial linked to a multidrug resistance (MDR) pump inhibitor make up a promising new class of agents for countering efflux-mediated bacterial drug resistance. This study explores the effects of varying the relative orientation of the antibacterial and efflux pump inhibitor components in three isomeric hybrids (SS14, SS14-M, and SS14-P) which link the antibacterial alkaloid and known substrate for the NorA MDR pump berberine to different positions on INF55 (5-nitro-2-phenylindole), an inhibitor of NorA. The MICs for all three hybrids against wild-type, NorA-knockout, and NorA-overexpressing Staphylococcus aureus cells were found to be similar (9.4 to 40.2 μM), indicating that these compounds are not effectively effluxed by NorA. The three hybrids were also found to have similar curing effects in a Caenorhabditis elegans live infection model. Each hybrid was shown to accumulate in S. aureus cells to a greater extent than either berberine or berberine in the presence of INF55, and the uptake kinetics of SS14 were found to differ from those of SS14-M and SS14-P. The effects on the uptake and efflux of the NorA substrate ethidium bromide into S. aureus cells in the presence or absence of the hybrids were used to confirm MDR inhibition by the hybrids. MDR-inhibitory activity was confirmed for SS14-M and SS14-P but not for SS14. Molecular dynamics simulations revealed that SS14 prefers to adopt a conformation that is not prevalent in either SS14-M or SS14-P, which may explain why some properties of SS14 diverge from those of its two isomers. In summary, subtle repositioning of the pump-blocking INF55 moiety in berberine-INF55 hybrids was found to have a minimal effect on their antibacterial activities but to significantly alter their effects on MDR pumps. PMID:20498327

  20. The wind sea and swell waves climate in the Nordic seas

    Science.gov (United States)

    Semedo, Alvaro; Vettor, Roberto; Breivik, Øyvind; Sterl, Andreas; Reistad, Magnar; Soares, Carlos Guedes; Lima, Daniela

    2015-02-01

    A detailed climatology of wind sea and swell waves in the Nordic Seas (North Sea, Norwegian Sea, and Barents Sea), based on the high-resolution reanalysis NORA10, developed by the Norwegian Meteorological Institute, is presented. The higher resolution of the wind forcing fields, and the wave model (10 km in both cases), along with the inclusion of the bottom effect, allowed a better description of the wind sea and swell features, compared to previous global studies. The spatial patterns of the swell-dominated regional wave fields are shown to be different from the open ocean, due to coastal geometry, fetch dimensions, and island sheltering. Nevertheless, swell waves are still more prevalent and carry more energy in the Nordic Seas, with the exception of the North Sea. The influence of the North Atlantic Oscillation on the winter regional wind sea and swell patterns is also presented. The analysis of the decadal trends of wind sea and swell heights during the NORA10 period (1958-2001) shows that the long-term trends of the total significant wave height (SWH) in the Nordic Seas are mostly due to swell and to the wave propagation effect.

  1. Integration of infrared thermography and high-frequency electromagnetic methods in archaeological surveys

    International Nuclear Information System (INIS)

    Carlomagno, Giovanni Maria; Meola, Carosena; Di Maio, Rosa; Fedi, Maurizio

    2011-01-01

    This work is focused on the integration of infrared thermography and ground penetrating radar for the inspection of architectonic structures. First, laboratory tests were carried out with both techniques by considering an ad hoc specimen made of concrete and with the insertion of anomalies of a different nature and at different depths. Such tests provided helpful information for ongoing inspections in situ, which were later performed in two important Italian archaeological sites, namely Pompeii (Naples) and Nora (Cagliari). In the first site, the exploration was devoted to the analysis of the wall paintings of Villa Imperiale with the aim of evaluating the state of conservation of frescoes as well of the underneath masonry structure. As main findings, the applied techniques allowed outlining some areas, which were damaged by ingression in-depth of moisture and/or by disaggregation of the constituent materials, and also for recognition of previous restoration. In the archaeological area of Nora, instead, the attention was driven towards the evaluation of the state of degradation of the theatre remnants. Our prospections show that the front side of the theatre, being more strongly affected by degradation, needs a massive restoration work. As a general result, we demonstrated that a joint interpretation of infrared thermography and ground penetrating radar data supplies detailed 3D information from near-surface to deep layers, which may assist in restoration planning

  2. Identifying cis-regulatory modules by combining comparative and compositional analysis of DNA.

    Science.gov (United States)

    Pierstorff, Nora; Bergman, Casey M; Wiehe, Thomas

    2006-12-01

    Predicting cis-regulatory modules (CRMs) in higher eukaryotes is a challenging computational task. Commonly used methods to predict CRMs based on the signal of transcription factor binding sites (TFBS) are limited by prior information about transcription factor specificity. More general methods that bypass the reliance on TFBS models are needed for comprehensive CRM prediction. We have developed a method to predict CRMs called CisPlusFinder that identifies high density regions of perfect local ungapped sequences (PLUSs) based on multiple species conservation. By assuming that PLUSs contain core TFBS motifs that are locally overrepresented, the method attempts to capture the expected features of CRM structure and evolution. Applied to a benchmark dataset of CRMs involved in early Drosophila development, CisPlusFinder predicts more annotated CRMs than all other methods tested. Using the REDfly database, we find that some 'false positive' predictions in the benchmark dataset correspond to recently annotated CRMs. Our work demonstrates that CRM prediction methods that combine comparative genomic data with statistical properties of DNA may achieve reasonable performance when applied genome-wide in the absence of an a priori set of known TFBS motifs. The program CisPlusFinder can be downloaded at http://jakob.genetik.uni-koeln.de/bioinformatik/people/nora/nora.html. All software is licensed under the Lesser GNU Public License (LGPL).

  3. Special Workshop of Marie Curie Fellows on Research and Training in Physics and Technology

    CERN Multimedia

    Patrice Loiez

    2002-01-01

    Photo 0210006_07a: Prof. L. Maiani, Director General of CERN. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Function of Large-scale Facilities and Centres of Excellence". Photo 0210006_14a: Prof. L. Maiani, Director General of CERN. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Function of Large-scale Facilities and Centres of Excellence". Photo 0210006_22: Dr. David Plane (CERN) introducing Dr. Theodore Papazoglou from the European Commission. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Marie Curie Fellowships in the 6th Framework Programme". Photo 0210006_28a: Dr. Nora Brambilla, Vice-President of Marie Curie Fellow Association, INFN and Dept. of Physics, University of Milan. Addressing the Marie-Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Marie Curie Fellows Association". Photo 0210006_29a: Dr. Nora Brambilla, Vice-President of Marie Curie Fellow Association, INFN a...

  4. Analysis of Moderator Temperature Reactivity Coefficient of the PWR Core Using WIMS-ANL

    International Nuclear Information System (INIS)

    Tukiran; Rokhmadi

    2007-01-01

    The Moderator Temperature Reactivity Coefficient (MTRC) is an important parameter in design, control and safety, particularly in PWR reactor. It is then very important to validate any new processed library for an accurate prediction of this parameter. The objective of this work is to validate the newly WIMS library based on ENDF/B-VI nuclear data files, especially for the prediction of the MTRC parameter. For this purpose, it is used a set of light water moderated lattice experiments as the NORA experiment and R1-100H critical reactors, both of reactors using UO 2 fuel pellet. Analysis is used with WIMSD/4 lattice code with original cross section libraries and WIMS-ANL with ENDF/B-VI cross section libraries. The results showed that the moderator temperatures reactivity coefficients for the NORA reactor using original libraries is - 5.039E-04 %Δk/k/℃ but for ENDF/B-VI libraries is - 2.925E-03 %Δk/k/℃. Compared to the designed value of the reactor core, the difference is in the range of 1.8 - 3.8 % for ENDF/B-IV libraries. It can be concluded that for reactor safety and control analysis, it has to be used ENDF/B- VI libraries because the original libraries is not accurate any more. (author)

  5. Workgroup Report: Implementing a National Occupational Reproductive Research Agenda—Decade One and Beyond

    Science.gov (United States)

    Lawson, Christina C.; Grajewski, Barbara; Daston, George P.; Frazier, Linda M.; Lynch, Dennis; McDiarmid, Melissa; Murono, Eisuke; Perreault, Sally D.; Robbins, Wendie A.; Ryan, Megan A.K.; Shelby, Michael; Whelan, Elizabeth A.

    2006-01-01

    The initial goal of occupational reproductive health research is to effectively study the many toxicants, physical agents, and biomechanical and psychosocial stressors that may constitute reproductive hazards in the workplace. Although the main objective of occupational reproductive researchers and clinicians is to prevent recognized adverse reproductive outcomes, research has expanded to include a broader spectrum of chronic health outcomes potentially affected by reproductive toxicants. To aid in achieving these goals, the National Institute for Occupational Safety and Health, along with its university, federal, industry, and labor colleagues, formed the National Occupational Research Agenda (NORA) in 1996. NORA resulted in 21 research teams, including the Reproductive Health Research Team (RHRT). In this report, we describe progress made in the last decade by the RHRT and by others in this field, including prioritizing reproductive toxicants for further study; facilitating collaboration among epidemiologists, biologists, and toxicologists; promoting quality exposure assessment in field studies and surveillance; and encouraging the design and conduct of priority occupational reproductive studies. We also describe new tools for screening reproductive toxicants and for analyzing mode of action. We recommend considering outcomes such as menopause and latent adverse effects for further study, as well as including exposures such as shift work and nanomaterials. We describe a broad domain of scholarship activities where a cohesive system of organized and aligned work activities integrates 10 years of team efforts and provides guidance for future research. PMID:16507468

  6. Post-test calculations of out-of-pile single rod burst experiments with Argentine ZRY-4 tubes using SSYST codes system

    International Nuclear Information System (INIS)

    Nassini, H.; Meyder, R.

    1988-11-01

    The calculations were performed with SSYST-3 code system. The experiments have been carried out with shortened REBEKA simulators. The main goal was to verify whether the model for describing the Zircaloy cladding deformation and rupture at high temperatures (NORA2 model) is able to predict the Argentine cladding material behaviour under such conditions. A good agreement between experimental results and model predictions was found in the range of temperatures from 700 to 850 0 C (in α phase and first half of α+β transition phase). There were some discrepances at higher temperatures, probably due to the strong influence of heating rate on material properties. According to the results of these post-test calculations, it can be concluded that NORA2 model is able to well describe the Argentine Zircaloy cladding deformation and rupture under LOCA conditions, because there was a good agreement in the range of burst (ballooning) temperatures which are expected in this type of accident. (orig./HP) [de

  7. THE INFLUENCE OF GRANDMOTHERS ON BREASTFEEDING OF HER GRANDCHILDREN: BELIEFS AND CULTURAL PRACTICES

    Directory of Open Access Journals (Sweden)

    Leila Rangel da Silva

    2013-09-01

    Full Text Available Objetivos: Conhecer as crenças e as práticas das avós com relação ao aleitamento materno; descrever a influência das avós no manejo do aleitamento das suas filhas e/ou noras. Métodos: Estudo descritivo com abordagem qualitativa. O cenário foi o Alojamento Conjunto da Maternidade do Hospital Universitário Gaffrée e Guinle no Rio de Janeiro. Os sujeitos foram 20 avós que visitaram seus netos ou netas no período de internação. Coleta de dados entre os meses de março e maio de 2011. O instrumento foi um questionário preenchido pelas pesquisadoras. Resultados: As avós reconhecem a importância do aleitamento e passa esses valores para suas filhas e noras. Conclusão: As avós são peças fundamentais no apoio a mulher, durante o período de amamentação. Descritores: Aleitamento materno, lactação, cultura, enfermagem.

  8. The NIOSH Construction Program: research to practice, impact, and developing a National Construction Agenda.

    Science.gov (United States)

    Gillen, Matt

    2010-06-01

    The U.S. National Institute for Occupational Safety and Health (NIOSH) conducts research to improve and protect the health and safety of workers. This paper describes the experience of the NIOSH Construction Program with two recent program planning initiatives intended to improve the program: (a) an independent external review of work over the past decade and (b) the development of strategic goals organized into a "National Construction Agenda" to guide a decade of future work. These goals, developed with input from construction industry stakeholders and researchers, are a part of the NIOSH National Occupational Research Agenda (NORA) initiative. The NORA goals are intended to provide an ambitious set of goals for all construction stakeholders to work together on. Both efforts relate to insuring the relevance and impact of research, reflecting an emerging policy perspective that research programs should be judged not just by the quality and quantity of science produced, but by the industry impact and tangible benefit resulting from the research. This paper describes how views on research planning have evolved to incorporate lessons learned about how research leads to improved safety and health for workers. It also describes the process used to develop the goals and the resulting strategic and intermediate goals that comprise the National Construction Agenda. (c) 2010 Elsevier Ltd. All rights reserved.

  9. On the Mechanism of Berberine-INF55 (5-Nitro-2-phenylindole) Hybrid Antibacterials.

    Science.gov (United States)

    Dolla, Naveen K; Chen, Chao; Larkins-Ford, Jonah; Rajamuthiah, Rajmohan; Jagadeesan, Sakthimala; Conery, Annie L; Ausubel, Frederick M; Mylonakis, Eleftherios; Bremner, John B; Lewis, Kim; Kelso, Michael J

    Berberine-INF55 hybrids are a promising class of antibacterials that combine berberine and the NorA multidrug resistance pump inhibitor INF55 (5-nitro-2-phenylindole) together in one molecule via a chemically stable linkage. Previous studies demonstrated the potential of these compounds for countering efflux-mediated antibacterial drug resistance but they didn't establish whether the compounds function as originally intended, i.e. with the berberine moiety providing antibacterial activity and the attached INF55 component independently blocking multidrug resistance pumps, thereby enhancing the activity of berberine by reducing its efflux. We hypothesised that if the proposed mechanism is correct, then hybrids carrying more potent INF55 pump inhibitor structures should show enhanced antibacterial effects relative to those bearing weaker inhibitors. Two INF55 analogues showing graded reductions in NorA inhibitory activity compared with INF55 were identified and their corresponding berberine-INF55 hybrids carrying equivalent INF55 inhibitor structures synthesised. Multiple assays comparing the antibacterial effects of the hybrids and their corresponding berberine-INF55 analogue combinations showed that the three hybrids all show very similar activities, leading us to conclude that the antibacterial mechanism(s) of berberine-INF55 hybrids is different from berberine-INF55 combinations.

  10. Recharge Area, Base-Flow and Quick-Flow Discharge Rates and Ages, and General Water Quality of Big Spring in Carter County, Missouri, 2000-04

    Science.gov (United States)

    Imes, Jeffrey L.; Plummer, Niel; Kleeschulte, Michael J.; Schumacher, John G.

    2007-01-01

    Exploration for lead deposits has occurred in a mature karst area of southeast Missouri that is highly valued for its scenic beauty and recreational opportunities. The area contains the two largest springs in Missouri (Big Spring and Greer Spring), both of which flow into federally designated scenic rivers. Concerns about potential mining effects on the area ground water and aquatic biota prompted an investigation of Big Spring. Water-level measurements made during 2000 helped define the recharge area of Big Spring, Greer Spring, Mammoth Spring, and Boze Mill Spring. The data infer two distinct potentiometric surfaces. The shallow potentiometric surface, where the depth-to-water is less than about 250 feet, tends to mimic topographic features and is strongly controlled by streams. The deep potentiometric surface, where the depth-to-water is greater than about 250 feet represents ground-water hydraulic heads within the more mature karst areas. A highly permeable zone extends about 20 mile west of Big Spring toward the upper Hurricane Creek Basin. Deeper flowing water in the Big Spring recharge area is directed toward this permeable zone. The estimated sizes of the spring recharge areas are 426 square miles for Big Spring, 352 square miles for Greer Spring, 290 square miles for Mammoth Spring, and 54 square miles for Boze Mill Spring. A discharge accumulation curve using Big Spring daily mean discharge data shows no substantial change in the discharge pattern of Big Spring during the period of record (water years 1922 through 2004). The extended periods when the spring flow deviated from the trend line can be attributed to prolonged departures from normal precipitation. The maximum possible instantaneous flow from Big Spring has not been adequately defined because of backwater effects from the Current River during high-flow conditions. Physical constraints within the spring conduit system may restrict its maximum flow. The largest discharge measured at Big Spring

  11. Acute Effects of Plyometric and Resistance Training on Running Economy in Trained Runners.

    Science.gov (United States)

    Marcello, Richard T; Greer, Beau K; Greer, Anna E

    2017-09-01

    Marcello, RT, Greer, BK, and Greer, AE. Acute effects of plyometric and resistance training on running economy in trained runners. J Strength Cond Res 31(9): 2432-2437, 2017-Results regarding the acute effects of plyometrics and resistance training (PRT) on running economy (RE) are conflicting. Eight male collegiate distance runners (21 ± 1 years, 62.5 ± 7.8 ml·kg·min V[Combining Dot Above]O2 peak) completed V[Combining Dot Above]O2 peak and 1 repetition maximum (1RM) testing. Seven days later, subjects completed a 12 minutes RE test at 60 and 80% V[Combining Dot Above]O2 peak, followed by a PRT protocol or a rested condition of equal duration (CON). The PRT protocol consisted of 3 sets of 5 repetitions at 85% 1RM for barbell squats, Romanian deadlifts, and barbell lunges; the same volume was used for resisted lateral lunges, box jumps, and depth jumps. Subjects completed another RE test immediately after the treatments and 24 hours later. Subjects followed an identical protocol 6 days later with condition assignment reversed. Running economy was determined by both relative V[Combining Dot Above]O2 (ml·kg·min) and energy expenditure (EE) (kcal·min). There was a significant (p ≤ 0.05) between-trial increase in V[Combining Dot Above]O2 (37.1 ± 4.2 ml·kg·min PRT vs. 35.5 ± 3.9 ml·kg·min CON) and EE (11.4 ± 1.3 kcal·min PRT vs. 11.0 ± 1.4 kcal·min CON) immediately after PRT at 60% V[Combining Dot Above]O2 peak, but no significant changes were observed at 80% V[Combining Dot Above]O2 peak. Respiratory exchange ratio was significantly (p ≤ 0.05) reduced 24 hours after PRT (0.93 ± 0.0) as compared to the CON trial (0.96 ± 0.0) at 80% V[Combining Dot Above]O2 peak. Results indicate that high-intensity PRT may acutely impair RE in aerobically trained individuals at a moderate running intensity, but that the attenuation lasts less than 24 hours in duration.

  12. Cultural noise and the night-day asymmetry of the seismic activity recorded at the Bunker-East (BKE) Vesuvian Station

    Science.gov (United States)

    Scafetta, Nicola; Mazzarella, Adriano

    2018-01-01

    Mazzarella and Scafetta (2016) showed that the seismic activity recorded at the Bunker-East (BKE) Vesuvian station from 1999 to 2014 suggests a higher nocturnal seismic activity. However, this station is located at about 50 m from the main road to the volcano's crater and since 2009 its seismograms also record a significant diurnal cultural noise due mostly to tourist tours to Mt. Vesuvius. Herein, we investigate whether the different seismic frequency between day and night times could be an artifact of the peculiar cultural noise that affects this station mostly from 9:00 am to 5:00 pm from spring to fall. This time-distributed cultural noise should evidently reduce the possibility to detect low magnitude earthquakes during those hours but not high magnitude events. Using hourly distributions referring to different magnitude thresholds from M = 0.2 to M = 2.0, the Gutenberg-Richter magnitude-frequency diagram applied to the day and night-time sub-catalogs and Montecarlo statistical modeling, we demonstrate that the day-night asymmetry persists despite an evident disruption induced by cultural noise during day-hours. In particular, for the period 1999-2017, and for earthquakes with M ≥ 2 we found a Gutenberg-Richter exponent b = 1.66 ± 0.07 for the night-time events and b = 2.06 ± 0.07 for day-time events. Moreover, we repeat the analysis also for an older BKE catalog covering the period from 1992 to 2000 when cultural noise was not present. The analysis confirms a higher seismic nocturnal activity that is also characterized by a smaller Gutenberg-Richter exponent b for M ≥ 2 earthquakes relative to the day-time activity. Thus, the found night-day seismic asymmetric behavior is likely due to a real physical feature affecting Mt. Vesuvius.

  13. An experimental study on counter current flow limitation in annular narrow gaps with large diameter

    Energy Technology Data Exchange (ETDEWEB)

    Park, Rae Joon; Jeong, Ji Whan; Lee, Sung Jin; Cho, Young Ro; Ha, Kwang Sun; Kim, Sang Baik; Kim, Hee Dong [Korea Atomic Energy Research Institute, Taejeon (Korea)

    2002-04-01

    The present study intends to carry out CCFL experiment with the same gap size as the CHFG facility and suggest an empirical correlation in order to provide basic information useful to development of an empirical critical-power correlation. The present facility consists of water accumulator tank, test section, DC pump, air regulator, valves and sensors. Air and water are used as working fluids. The experiments are carried out at the atmospheric pressure. Differential pressure between the gap ends, liquid and gas phase flow rates, temperature, lower plenum pressure are measured.Measured values are expressed in terms of Wallis' parameter using gap size as a characteristic length. There is a big difference between the present experimental results and the Koizumi et al.'s results, but the present experimental results are very similar to the Richter et al.'s results. The present results agree well with the Osakabe and Kawasaki's results. In comparison of present experiments with the Koizumi et al.'s experiments, gap thickness is similar, but the diameter of the present is bigger than that of Koizumi et al.'s experiments. In comparison of present experiments with the Richter et al.'s experiments, diameter is similar, but the gap thickness of the present is smaller than that of Richter et al.'s experiments. It is judged from these results that correlation development on CCFL to consider gap thickness is reasonable at similar condition of diameter.The developed correlation will be used to develop the CHFG model. 36 refs., 26 figs., 7 tabs. (Author)

  14. Valencia-Madrid / Jaan Elken

    Index Scriptorium Estoniae

    Elken, Jaan, 1954-

    2009-01-01

    Jaan Elken oli Erasmuse programmi raames külalisloengutel Valencia polütehnilises instituudis. Valencia arhitektuurist, muuseumidest, näitusest "Valencia 09. Confines/Passages of Contemporary Arts" Valencia Kaasaegse Kunsti Instituudis, festivalist "PhotoEspana (PHE 09)" Madridis, saksa maalikunstniku näitusest "Gerhard Richter. Fotografias pintadas" ("Maalitud fotod"). Lühidalt hispaania skulptori Juan Muñoze näitusest Hispaania rahvusmuuseumi Reina Sofia kaasaegse kunsti keskuses, prantsuse maalikunstniku Henri Matisse'i näitusest Thyssen-Bornemiszas, hispaania maalikunstniku Joaquín Sorolla näitusest Prado muuseumis

  15. The Pocatello Valley, Idaho, earthquake

    Science.gov (United States)

    Rogers, A. M.; Langer, C.J.; Bucknam, R.C.

    1975-01-01

    A Richter magnitude 6.3 earthquake occurred at 8:31 p.m mountain daylight time on March 27, 1975, near the Utah-Idaho border in Pocatello Valley. The epicenter of the main shock was located at 42.094° N, 112.478° W, and had a focal depth of 5.5 km. This earthquake was the largest in the continental United States since the destructive San Fernando earthquake of February 1971. The main shock was preceded by a magnitude 4.5 foreshock on March 26. 

  16. 'Universal' Distribution of Interearthquake Times Explained

    International Nuclear Information System (INIS)

    Saichev, A.; Sornette, D.

    2006-01-01

    We propose a simple theory for the 'universal' scaling law previously reported for the distributions of waiting times between earthquakes. It is based on a largely used benchmark model of seismicity, which just assumes no difference in the physics of foreshocks, mainshocks, and aftershocks. Our theoretical calculations provide good fits to the data and show that universality is only approximate. We conclude that the distributions of interevent times do not reveal more information than what is already known from the Gutenberg-Richter and the Omori power laws. Our results reinforce the view that triggering earthquakes by other earthquakes is a key physical mechanism to understand seismicity

  17. Structural performance of the DOE's Idaho National Engineering Laboratory during the 1983 Borah Peak Earthquake

    International Nuclear Information System (INIS)

    Guenzler, R.C.; Gorman, V.W.

    1985-01-01

    The 1983 Borah Peak Earthquake (7.3 Richter magnitude) was the largest earthquake ever experienced by the DOE's Idaho National Engineering Laboratory (INEL). Reactor and plant facilities are generally located about 90 to 110 km (60 miles) from the epicenter. Several reactors were operating normally at the time of the earthquake. Based on detailed inspections, comparisons of measured accelerations with design levels, and instrumental seismograph information, it was concluded that the 1983 Borah Peak Earthquake created no safety problems for INEL reactors or other facilities. 10 references, 16 figures, 2 tables

  18. A new dataset of Wood Anderson magnitude from the Trieste (Italy) seismic station

    Science.gov (United States)

    Sandron, Denis; Gentile, G. Francesco; Gentili, Stefania; Rebez, Alessandro; Santulin, Marco; Slejko, Dario

    2014-05-01

    The standard torsion Wood Anderson (WA) seismograph owes its fame to the fact that historically it has been used for the definition of the magnitude of an earthquake (Richter, 1935). With the progress of the technology, digital broadband (BB) seismographs replaced it. However, for historical consistency and homogeneity with the old seismic catalogues, it is still important continuing to compute the so called Wood Anderson magnitude. In order to evaluate WA magnitude, the synthetic seismograms WA equivalent are simulated convolving the waveforms recorded by a BB instrument with a suitable transfer function. The value of static magnification that should be applied in order to simulate correctly the WA instrument is debated. The original WA instrument in Trieste operated from 1971 to 1992 and the WA magnitude (MAW) estimates were regularly reported in the seismic station bulletins. The calculation of the local magnitude was performed following the Richter's formula (Richter, 1935), using the table of corrections factor unmodified from those calibrated for California and without station correction applied (Finetti, 1972). However, the WA amplitudes were computed as vector sum rather than arithmetic average of the horizontal components, resulting in a systematic overestimation of approximately 0.25, depending on the azimuth. In this work, we have retrieved the E-W and N-S components of the original recordings and re-computed MAW according to the original Richter (1935) formula. In 1992, the WA recording were stopped, due to the long time required for the daily development of the photographic paper, the costs of the photographic paper and the progress of the technology. After a decade of interruption, the WA was recovered and modernized by replacing the recording on photographic paper with an electronic device and it continues presently to record earthquakes. The E-W and N-S components records were memorized, but not published till now. Since 2004, next to the WA (few

  19. CORRELATION BETWEEN BAMBOO UTILIZATION AS EARTHQUAKE RESISTANT HOME CONSTRUCTION MATERIALS WITH COMMUNITY BEHAVIOR IN MAINTAINING ENVIRONMENTAL SUSTAINABILITY

    Directory of Open Access Journals (Sweden)

    Tineu Indrianeu

    2017-12-01

    Full Text Available In 2009 Jayapura Village was hit by an earthquake with a strength of 7.3 on the Richter Scale. Many homes were damaged by the quake. The purpose of this study is to analyze the relationship between the utilization of bamboo as a home building material with environmental preservation behavior of Jayapura Village residents. The study population was 1,367 heads of households with a sample of 137 families. The method used in this research is using sequential mixed methods. The result of the research shows that there is a correlation between the two things which is indicated by the correlation value of 0,501 (medium correlation.

  20. Focus on focusing

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The discovery and impact of the principle of strong focusing was celebrated at a history Symposium at Stanford on 25 July in the course of the 1985 US Summer School on Particle Accelerators. Burt Richter, Stanford Linac Director, who introduced all the speakers with well chosen reminders about their various contributions related to the theme of the symposium, remarked that it was an appropriate time to be lauding the great contributions of accelerator physicists following the Nobel Prize award to Simon van der Meer for outstanding achievements in accelerator physics

  1. From the Proton Synchroton to the Large Hadron Collider - 50 Years of Nobel Memories in High-Energy Physics

    CERN Multimedia

    CERN. Geneva

    2009-01-01

    Council Chamber, IT Auditorium, Prévessin BE Auditorium , Kjell Johnssen Auditorium in Building 30, Room 40-S2-A01, and via webcast. Confirmed Speakers include: Prof. Jack Steinberger, Dr. Guenther Plass, Prof. Emilio Picasso, Dr. Steve Myers, Prof. Carlo Rubbia, Prof. Burton Richter, Dr. Lyndon Evans, Prof. Rolf-Dieter Heuer, Prof. Leon Lederman, Prof. Jim Cronin, Prof. Sheldon Glashow, Prof. Jerome Friedman, Prof. Frank Wilczek, Prof. Martinus Veltman, Prof. Gerardus 't Hooft, Prof. David Gross, Prof. Samuel Ting, Prof. Steven Weinberg (via teleconference) --- Contact: Directorate.Office@cern.ch

  2. Iroquois Confederacy’s Experiences with Centerifugal and Centripetal Forces: A Historical Analysis

    Science.gov (United States)

    2007-06-15

    times of great sickness. As noted by a Jesuit missionary, Father Jean de Lamberville, the greatest converts “has been among the sick.”42 The...Charles T. Gehring, and William A. Starna (Syracuse, NY: Syracuse University Press, 1996), 46. 37Pierre Millet , “Letter from Father Millet to Reverend...272. 46Richter, “Cultural Brokers,” American History, 48. 47Jean De Lamberville, “Of the Mission of Saint Jean Baptiste at Onnontague – 1674,” in

  3. Development of methodology to assess application of practical elimination for nuclear power plants

    International Nuclear Information System (INIS)

    Jung, J.; Sivekumar, D.; Thambirasa, S.

    2015-01-01

    The Fukushima Daiichi nuclear accident is presented as the primary case study for the topic of practical elimination. A decision matrix was created to assess whether practical elimination has been achieved or not. Public acceptance is included as a factor in practical elimination. An evaluation of an underground High-Temperature Gas Cooled Reactor was performed, where it was determined that a greater than 10 earthquake on the Richter scale is practically eliminated, but can easily be overturned based on public acceptance. A plane crash scenario was also practically eliminated. The gap analysis performed concluded that the developed decision matrix requires reworking. (author)

  4. GIS Based Study on Seismicity of Makran over 100 Years

    Directory of Open Access Journals (Sweden)

    Mubarik Ali

    2015-12-01

    Full Text Available The earthquakes in Makran have a history of 600 years (1483-2015. The new ventures of development, urbanization, mining, and exploration for hydrocarbons in Makran region demand recent studies on seismicity. The major tectonic earthquakes are although infrequent in Makran, but are responsible for generating tsunami in coastal areas of Pakistan and Iran and have a long tail of aftershocks of shallow to deep focal depths. The oceanic part of Arabian plate which is underthrusting Eurasian plate (northwards, contributes a major share in producing seismicity of low magnitude (ML 6 on Richter scale has a relation with the rotation of moon (lunar dates in Makran.

  5. Produção e certificação de mudas de videira na França 1: situação Atual da Produção

    OpenAIRE

    REGINA, MURILLO DE ALBUQUERQUE

    2002-01-01

    A França é o principal país produtor de mudas de videira, enxertando anualmente 270 milhões de mudas. Neste país, o programa de certificação de mudas alcança mais de 90% do material produzido, e, para tanto, a área utilizada de matrizes de porta-enxertos e produtoras atinge 3.454 ha. As principais cultivares multiplicadas, em ordem decrescente, são Merlot Noir, Cabernet Sauvignon, Syrah, Chardonnay, e os principais porta-enxertos o SO4, 110 Richter, 3309 Couderc, 41 B e 140 Ruggieri. Os perce...

  6. Local seismic activity monitored at King Sejong Station, Antarctica

    OpenAIRE

    Lee,Duk Kee; Kim,Yea Dong; Nam,Sang Heon; Jin,Young Keun

    1998-01-01

    Source location estimation from single station earthquake data collected at King Sejong Station (62°13'3l"N, 58°47'07"W) from 1995 to 1996 provides seismic activity around King Sejong Station. Analysis of local events, less than 1.5°in angular epicentral distance, finds epicenters located near the Shackleton Fracture Zone, the South Shetland Platform, Deception Island, and North Bransfield Basin. Estimated magnitudes range from 2.2 to 4.5 on the Richter scale, averaging 4.0 in North Bransfiel...

  7. Unified scaling law for earthquakes in Crimea and Northern Caucasus

    Science.gov (United States)

    Nekrasova, A. K.; Kossobokov, V. G.

    2016-10-01

    This study continues detailed investigations on the construction of regional charts of the parameters of the generalized Guttenberg-Richter Law, which takes into account the properties of the spatiotemporal seismic energy scaling. We analyzed the parameters of the law in the vicinity of the intersections of morphostructural lineaments in Crimea and Greater Caucasus. It was shown that ignoring the fractal character of the spatial distribution of earthquakes in the southern part of the Russian Federation can lead to significant underestimation of the seismic hazard in the largest cities of the region.

  8. Reply [to Comment on Earthquake precursors: Banished forever?] Comment: Unpredictability of earthquakes-Truth or fiction?

    Science.gov (United States)

    Gusev, Alexander

    I agree with many of C. Lomnitz's points. I only wish to add that by the word “paradigm” I mean the entity as T. Kuhn defines it in The Nature of Scientific Revolutions, that is, a belief system considered as the truth by a scientific community for a certain amount of time. Kuhn's idea of scientific progress is by radical paradigm shifts. Earthquake prediction (EP) is a good example. It was a nonscience in 1960, and C. Richter warned every student in his Elementary Seismology that it is “a marsh light,” appealing to one from the darkness but leading those who respond to the swamp.

  9. O mito do duplo em retratos

    OpenAIRE

    Cesaro, Patrícia Souza Silva

    2012-01-01

    O mito do duplo faz parte de um conjunto de mitos dos mais antigos, que permeiam o imaginário do homem desde a sua própria existência. Tem por principais manifestações os casos de sósias, gêmeos idênticos, o ver a si mesmo em outro, a dualidade. O termo consagrado para designar o duplo, cunhado pelo escritor alemão Jean-Paul Richter, é doppelgänger, e significa aquele que caminha ao lado, o companheiro de estrada. Tem a ver com uma experiência de si na alteridade. Alguns exempl...

  10. Evaluation of Androgen Receptor Function in Prostate Cancer Prognosis and Therapeutic Stratification

    Science.gov (United States)

    2015-12-01

    evaluated for DNA meth - ylation. Patient matched non-adjacent normal epithelial cells Figure 1. (A) schematic representation of the PMEPA1 gene structure...reduced or lost expression of PMEPA1 in CaP. The results presented here demonstrate that promoter meth - ylation is a major mechanism involved in...c-Myc-p21 Cip1 signaling pathway. J Pathol 2011; 223:683- 94; PMID:21341270; http://dx.doi.org/10.1002/ path.2834 21. Richter E, Masuda K, Cook C

  11. Elastic enhancement factor in the 11B(p,n0)11C reaction at Ep=14.3 MeV

    International Nuclear Information System (INIS)

    Hussein, M.S.; Pessoa, E.F.; Schelin, H.R.; Carlson, B.V.; Douglas, R.A.

    1985-01-01

    The elastic enhancement factor in charge exchange reactions proceeding via the compound nucleus, predicted to attain the value of 2 in the weak isospin mixing regime by Harney, Weidenmuller and Richter five years ago, is tested here in the system 11 B(p,n) 11 C at = 14.3 MeV. Both the DWBA and Hauser-Feshbach calculations employed in the analysis are used in a way which physically simulates a two coupled-channels model. Our results show an enhancement factor larger than 1 indicating that isospin is mainly conserved in this reaction. (Author) [pt

  12. Stanford survives 7.1 shock

    Energy Technology Data Exchange (ETDEWEB)

    Riordan, Michael

    1989-12-15

    The Monday morning of 16 October looked like the start of a quiet week at the Stanford Linear Accelerator Center (SLAC). After a successful six-month physics run, the SLC Stanford Linear Collider was shut down to begin scheduled upgrades and the installation of two vertex detectors for the Mark II detector. Then at 5.04 p.m. the next day, the Earth's crust had had enough. A major earthquake measuring 7.1 on the Richter scale rocked the San Francisco Bay Area from an epicentre along the wicked San Andreas Fault in the Southern Santa Cruz mountains.

  13. Environmental controls for the precipitation of different fibrous calcite cement fabrics

    Science.gov (United States)

    Ritter, Ann-Christine; Wiethoff, Felix; Neuser, Rolf D.; Richter, Detlev K.; Immenhauser, Adrian

    2016-04-01

    Abiogenic calcite cements are widely used as climate archives. They can yield information on environmental change and climate dynamics at the time when the sediment was lithified in a (marine) diagenetic environment. Radiaxial-fibrous (RFC) and fascicular-optic fibrous (FOFC) calcite cements are two very common and similar pore-filling cement fabrics in Palaeozoic and Mesozoic carbonate rocks (Richter et al., 2011) and in Holocene Mg-calcitic speleothems (Richter et al., 2015). Both fabrics are characterised by distinct crystallographic properties. Current research has shown that these fabrics are often underexplored and that a careful combination of conservative and innovative proxies allows for a better applicability of these carbonate archives to paleoenvironmental reconstructions (Ritter et al., 2015). A main uncertainty in this context is that it is still poorly understood which parameters lead to the formation of either RFC or FOFC and if differential crystallographic parameters affect proxy data from these fabrics. This study aims at a better understanding of the environmental factors that may control either RFC or FOFC precipitation. Therefore, suitable samples (a stalagmite and a Triassic marine cement succession), each with clearly differentiable layers of RFC and FOFC, were identified and analysed in high detail using a multi-proxy approach. Detailed thin section and cathodoluminescence analysis of the samples allowed for a precise identification of layers consisting solely of either RFC or FOFC. Isotopic (δ13C, δ18O) as well as trace elemental compositions have been determined and the comparison of data obtained from these different carbonate archives sheds light on changes in environmental parameters during RFC or FOFC precipitation. References: Richter, D.K., et al., 2011. Radiaxial-fibrous calcites: A new look at an old problem. Sedimentary Geology, 239, 26-36 Richter, D.K., et al., 2015. Radiaxial-fibrous and fascicular-optic Mg-calcitic cave

  14. Focus on focusing

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1985-10-15

    The discovery and impact of the principle of strong focusing was celebrated at a history Symposium at Stanford on 25 July in the course of the 1985 US Summer School on Particle Accelerators. Burt Richter, Stanford Linac Director, who introduced all the speakers with well chosen reminders about their various contributions related to the theme of the symposium, remarked that it was an appropriate time to be lauding the great contributions of accelerator physicists following the Nobel Prize award to Simon van der Meer for outstanding achievements in accelerator physics.

  15. Pembrolizumab Alone or With Idelalisib or Ibrutinib in Treating Patients With Relapsed or Refractory Chronic Lymphocytic Leukemia or Other Low-Grade B-Cell Non-Hodgkin Lymphomas

    Science.gov (United States)

    2017-06-30

    Recurrent Chronic Lymphocytic Leukemia; Recurrent Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue; Recurrent Grade 1 Follicular Lymphoma; Recurrent Grade 2 Follicular Lymphoma; Recurrent Grade 3 Follicular Lymphoma; Recurrent Lymphoplasmacytic Lymphoma; Recurrent Marginal Zone Lymphoma; Recurrent Nodal Marginal Zone Lymphoma; Recurrent Small Lymphocytic Lymphoma; Recurrent Splenic Marginal Zone Lymphoma; Refractory Chronic Lymphocytic Leukemia; Refractory Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue; Refractory Follicular Lymphoma; Refractory Lymphoplasmacytic Lymphoma; Refractory Nodal Marginal Zone Lymphoma; Refractory Small Lymphocytic Lymphoma; Refractory Splenic Marginal Zone Lymphoma; Richter Syndrome; Waldenstrom Macroglobulinemia

  16. Stanford survives 7.1 shock

    International Nuclear Information System (INIS)

    Riordan, Michael

    1989-01-01

    The Monday morning of 16 October looked like the start of a quiet week at the Stanford Linear Accelerator Center (SLAC). After a successful six-month physics run, the SLC Stanford Linear Collider was shut down to begin scheduled upgrades and the installation of two vertex detectors for the Mark II detector. Then at 5.04 p.m. the next day, the Earth's crust had had enough. A major earthquake measuring 7.1 on the Richter scale rocked the San Francisco Bay Area from an epicentre along the wicked San Andreas Fault in the Southern Santa Cruz mountains

  17. Discovery of massive neutral vector mesons

    International Nuclear Information System (INIS)

    Anon.

    1976-01-01

    Personal accounts of the discovery of massive neutral vector mesons (psi particles) are given by researchers S. Ting, G. Goldhaber, and B. Richter. The double-arm spectrometer and the Cherenkov effect are explained in a technical note, and the solenoidal magnetic detector is discussed in an explanatory note for nonspecialists. Reprints of three papers in Physical Review Letters which announced the discovery of the particles are given: Experimental observation of a heavy particle J, Discovery of a narrow resonance in e + e - annihilation, and Discovery of a second narrow resonance in e + e - annihilation. A discussion of subsequent developments and scientific biographies of the three authors are also presented. 25 figures

  18. Tardigrada of Ireland: a review of records and an updated checklist of species including a new addition to the Irish fauna

    Directory of Open Access Journals (Sweden)

    Erica DeMilio

    2016-09-01

    Full Text Available The phylum Tardigrada was not recorded in Ireland until the Clare Island Survey of 1909–1911, with only rare subsequent reports on Irish tardigrade species. In recent decades, significant taxonomic revision has occurred within Tardigrada. This has resulted in the need for a review of all known historical records from Ireland and Northern Ireland in order to produce an updated checklist of valid taxa. The new checklist includes fifty-one tardigrade species and subspecies including a new addition to the Irish fauna reported herein, Echiniscus quadrispinosus quadrispinosus Richters, 1902 from Newtown, Ballyvaughan, Co. Clare.

  19. On the structure of self-affine convex bodies

    Energy Technology Data Exchange (ETDEWEB)

    Voynov, A S [M. V. Lomonosov Moscow State University, Faculty of Mechanics and Mathematics, Moscow (Russian Federation)

    2013-08-31

    We study the structure of convex bodies in R{sup d} that can be represented as a union of their affine images with no common interior points. Such bodies are called self-affine. Vallet's conjecture on the structure of self-affine bodies was proved for d = 2 by Richter in 2011. In the present paper we disprove the conjecture for all d≥3 and derive a detailed description of self-affine bodies in R{sup 3}. Also we consider the relation between properties of self-affine bodies and functional equations with a contraction of an argument. Bibliography: 10 titles.

  20. Diversity in Action workshop | 5 May | Technoparc Business Centre

    CERN Multimedia

    CERN Diversity Office

    2015-01-01

    Get an insight into diversity, develop greater sensitivity to differences, acquire new tools to recognise and overcome unconscious biases.   Diversity in Action workshop 5th edition in English Tuesday, 5 May 2015 8:30 a.m. - 12 p.m. Technoparc Business Centre – Saint-Genis-Pouilly Registration and more information on the workshop: http://cern.ch/diversity/in-action On 5 May at 2 p.m., Alan Richter will also lead a forum for discussion  on the topic of “Respect in the workplace”. More information here.  

  1. Entre a abstração e a imagem realista: pintura no limite

    Directory of Open Access Journals (Sweden)

    Fátima Junqueira

    Full Text Available RESUMO Este texto pretende fazer uma reflexão sobre a pintura contemporânea, que se destaca por ficar no limite entre dois conceitos clássicos da arte moderna: "figurativo" e "abstrato". O artigo baseia-se em autores da teoria da arte moderna (como Clement Greenberg e Leo Steinberg da filosofia (como Jacques Rancière, da teoria da arte contemporânea (como Anne Cauquelin e nos escritos do pintor alemão Gerhard Richter.

  2. Coexistence of chronic myeloid leukemia and diffuse large B-cell lymphoma with antecedent chronic lymphocytic leukemia: a case report and review of the literature.

    Science.gov (United States)

    Abuelgasim, Khadega A; Rehan, Hinna; Alsubaie, Maha; Al Atwi, Nasser; Al Balwi, Mohammed; Alshieban, Saeed; Almughairi, Areej

    2018-03-11

    Chronic lymphocytic leukemia and chronic myeloid leukemia are the most common types of adult leukemia. However, it is rare for the same patient to suffer from both. Richter's transformation to diffuse large B-cell lymphoma is frequently observed in chronic lymphocytic leukemia. Purine analog therapy and the presence of trisomy 12, and CCND1 gene rearrangement have been linked to increased risk of Richter's transformation. The coexistence of chronic myeloid leukemia and diffuse large B-cell lymphoma in the same patient is extremely rare, with only nine reported cases. Here, we describe the first reported case of concurrent chronic myeloid leukemia and diffuse large B-cell lymphoma in a background of chronic lymphocytic leukemia. A 60-year-old Saudi man known to have diabetes, hypertension, and chronic active hepatitis B was diagnosed as having Rai stage II chronic lymphocytic leukemia, with trisomy 12 and rearrangement of the CCND1 gene in December 2012. He required no therapy until January 2016 when he developed significant anemia, thrombocytopenia, and constitutional symptoms. He received six cycles of fludarabine, cyclophosphamide, and rituximab, after which he achieved complete remission. One month later, he presented with progressive leukocytosis (mostly neutrophilia) and splenomegaly. Fluorescence in situ hybridization from bone marrow aspirate was positive for translocation (9;22) and reverse transcription polymerase chain reaction detected BCR-ABL fusion gene consistent with chronic myeloid leukemia. He had no morphologic or immunophenotypic evidence of chronic lymphocytic leukemia at the time. Imatinib, a first-line tyrosine kinase inhibitor, was started. Eight months later, a screening imaging revealed new liver lesions, which were confirmed to be diffuse large B-cell lymphoma. In chronic lymphocytic leukemia, progressive leukocytosis and splenomegaly caused by emerging chronic myeloid leukemia can be easily overlooked. It is unlikely that chronic myeloid

  3. Measuring Socioeconomic Inequality in Obesity: Looking Beyond the Obesity Threshold.

    Science.gov (United States)

    Bilger, Marcel; Kruger, Eliza J; Finkelstein, Eric A

    2017-08-01

    We combine two of the most widely used measures in the inequality and poverty literature, the concentration index and Foster-Greer-Thorbecke metric to the analysis of socioeconomic inequality in obesity. This enables us to describe socioeconomic inequality not only in obesity status but also in its depth and severity. We apply our method to 1971-2012 US data and show that while the socioeconomic inequality in obesity status has now almost disappeared, this is not the case when depth and severity of obesity are considered. Such socioeconomic gradient is found to be greatest among non-Hispanic whites, but decomposition analysis also reveals an inverse relationship between income and obesity outcomes among Mexican Americans once the effect of immigrant status has been accounted for. The socioeconomic gradient is also greater among women with marital status further increasing it for severity of obesity while the opposite is true among men. Overall, the socioeconomic gradient exists as poorer individuals lie further away from the obesity threshold. Our study stresses the need for policies that jointly consider obesity and income to support those who suffer from the double burden of poverty and obesity-related health conditions. © 2016 The Authors. Health Economics Published by John Wiley & Sons Ltd. © 2016 The Authors. Health Economics Published by John Wiley & Sons Ltd.

  4. La pobreza urbana y rural en México y Sonora: impacto de Oportunidades en los primeros años de aplicación, 2002-2006

    Directory of Open Access Journals (Sweden)

    Joaquín Bracamontes Nevárez

    2012-01-01

    Full Text Available La pobreza se define con base en el enfoque monetario y se estima con el método de líneas de pobreza (Foster, Greer y Thoerbecke, 1984; Sen, 1976; luego, se recurre a la técnica de microsimulación estática (Bourguignon y Spadaro, 2006 para captar el impacto del programa Oportunidades en la disminución de la pobreza en el sector urbano y rural de México y Sonora. Se encontró un impacto muy limitado en la reducción de la pobreza, lo que se debe a la insuficiencia de recursos asignados al programa y a la exclusión de hogares en pobreza; sin embargo, mientras el impacto nacional fue ligeramente mayor en el sector rural, Sonora observó uno heterogéneo, ya que el sector urbano redujo más la pobreza alimentaria y el rural la pobreza patrimonial. La información proviene de la Encuesta Nacional de Ingresos y Gastos de los Hogares 2002 y 2006.

  5. An explanatory analysis of economic and health inequality changes among Mexican indigenous people, 2000-2010

    Science.gov (United States)

    2014-01-01

    Introduction Mexico faces important problems concerning income and health inequity. Mexico’s national public agenda prioritizes remedying current inequities between its indigenous and non-indigenous population groups. This study explores the changes in social inequalities among Mexico’s indigenous and non-indigenous populations for the time period 2000 to 2010 using routinely collected poverty, welfare and health indicator data. Methods We described changes in socioeconomic indicators (housing condition), poverty (Foster-Greer-Thorbecke and Sen-Shorrocks-Sen indexes), health indicators (childhood stunting and infant mortality) using diverse sources of nationally representative data. Results This analysis provides consistent evidence of disparities in the Mexican indigenous population regarding both basic and crucial developmental indicators. Although developmental indicators have improved among the indigenous population, when we compare indigenous and non-indigenous people, the gap in socio-economic and developmental indicators persists. Conclusions Despite a decade of efforts to promote public programs, poverty persists and is a particular burden for indigenous populations within Mexican society. In light of the results, it would be advisable to review public policy and to specifically target future policy to the needs of the indigenous population. PMID:24576113

  6. Rapid City Collective Impact: A City-Wide Effort to Create Quality of Life for All Its Citizens

    Directory of Open Access Journals (Sweden)

    Albert Linderman

    2016-06-01

    Full Text Available In Rapid City, South Dakota, community, business, nonprofit, and faith communities leaders, along with a number of citizens across all demographics, are collaborating in a unique plan to create quality of life for all its citizens. Named Rapid City Collective Impact (RCCI, this initiative began with the vision of several local philanthropists and has expanded quickly throughout the community. Cultural anthropologist Albert Linderman along with expertise from community based systems dynamics experts Don Greer, Megan Odenthal, and Christine Capra have formed a facilitative “backbone” organization for RCCI. Based on the model for “Collective Impact” made popular by an article by a Stanford Innovation Review article by authors John Kania and Mark Kramer, organizations and programs serving Rapid City citizens are committed to significantly increasing the amount of collaboration occurring within the social service sector, while business and other community leaders work to leverage newly understood leverage points within the intersecting systems of the city which often limits ability to address entrenched social issues.

  7. Time poverty in Brazil: measurement and analysis of its determinants

    Directory of Open Access Journals (Sweden)

    Lilian Lopes Ribeiro

    2012-06-01

    Full Text Available This article analyzes well-being on an individual level, through the allocation of work hours done by adults and children and thus it measures time poverty in Brazil. In order to achieve such measurement, poverty indicators such as Foster, Greer and Thorbecke (FGT were adapted into a time poverty mode. Additionally, an analysis of its determinants was also conducted. Among other findings, the fact that women (either children and adult ones are the time-poorest individuals in urban or rural areas. Another unfortunate finding is that the high rate of time poverty among children, numerically 16,1% is not far from the adult rate which is of 19,7%. The overall composite time poor individual profile is of an African-Brazilian adult woman of little education, not necessarily income poor and residing in an urban area of the northeast region, living in a household of few people, she is the mother of children who are younger than 14 years old.

  8. A DISAGGREGATED MEASURES APPROACH OF POVERTY STATUS OF FARMING HOUSEHOLDS IN KWARA STATE, NIGERIA

    Directory of Open Access Journals (Sweden)

    Grace Oluwabukunmi Akinsola

    2016-12-01

    Full Text Available In a bid to strengthen the agricultural sector in Nigeria, the Kwara State Government invited thirteen Zimbabwean farmers to participate in agricultural production in Kwara State in 2004. The main objective of this study therefore was to examine the effect of the activities of these foreign farmers on local farmers’ poverty status. A questionnaire was administered on the heads of farming households. A total of 240 respondents were used for the study, which was comprised of 120 contact and 120 non-contact heads of farming households. The analytical tools employed included descriptive statistics and the Foster, Greer and Thorbecke method. The result indicated that the non-contact farming households are poorer than the contact farming households. Using the disaggregated poverty profile, poverty is most severe among the age group of above 60 years. The intensity of poverty is also higher among the married group than the singles. Based on the education level, poverty seems to be most severe among those without any formal education. It is therefore recommended that a minimum of secondary school education should be encouraged among the farming households to prevent higher incidence of poverty in the study area.

  9. Increasing urban community empowerment through changing of poverty rate index on the productive zakat impact

    Science.gov (United States)

    Zaenal, M. H.; Astuti, A. D.; Sadariyah, A. S.

    2018-01-01

    We show how changes in poverty measures can be applied into growth of islamic philanthropy distribution via zakat, and we use the methodology to zakat community development (ZCD) program in Bantul during the 2016. The purpose of the present paper is to prove zakat is able to be a solution part for the community empowerment. The result is the number of productive zakat program beneficiaries whose income is below the poverty line (poor category) before the program are 244 people (H = 0.171) and after the program change to 168 (H = 0.118), which means the program has succeeded in reducing the number of poor people by 76 people (5.34 percent). The poverty gap (P1) of beneficiaries of productive zakat program in Bantul also decrease. The gap between poverty line and average income of beneficiaries is Rp 63,763 before the program, while the gap after the program is Rp 56,992. The income gap (I) is also decline from 0.197 to 0.169. Poverty severity of beneficiaries of productive zakat program in Bantul seen by Sen Index (P2) decrease from 0.093 to 0.062, while using Foster-Greer-Thorbecke Index (P3), the poverty severity decrease from 0.010 to 0.004. The analysis revealed the zakat community empowerment was significant economically in suppressing the poverty rate, and possible for reducing inequality and ending poverty in Indonesia.

  10. Rush allergen specific immunotherapy protocol in feline atopic dermatitis: a pilot study of four cats.

    Science.gov (United States)

    Trimmer, Ann M; Griffin, Craig E; Boord, Mona J; Rosenkrantz, Wayne S

    2005-10-01

    Rush immunotherapy has been shown to be as safe as conventional immunotherapy in canine atopic patients. Rush immunotherapy has not been reported in the feline atopic patient. The purpose of this pilot study was to determine a safe protocol for rush immunotherapy in feline atopic patients. Four atopic cats diagnosed by history, physical examination and exclusion of appropriate differential diagnoses were included in the study. Allergens were identified via liquid phase immunoenzymatic testing (VARL: Veterinary Allergy Reference Labs, Pasadena, CA). Cats were premedicated with 1.5 mg triamcinolone orally 24 and 2 h prior to first injection and 10 mg hydroxyzine PO 24, 12 and 2 h prior to first injection. An intravenous catheter was placed prior to first injection. Allergen extracts (Greer Laboratories, Lenoir, North Carolina) were all administered subcutaneously at increasing protein nitrogen units (pnu) every 30 minutes for 5 h to maintenance dose of 15,000 pnus ml-1. Vital signs were assessed every 15 minutes. Two cats developed mild pruritus and the subsequent injection was delayed 30 minutes. No changes in either cat's vital signs were noted, nor was there any further pruritus. All four cats successfully completed rush immunotherapy. Two cats developed a dermal swelling on the dorsal neck one week later. In these four cats, this protocol appeared to be a safe regimen to reach maintenance therapy. A larger sample of feline patients is needed to determine the incidence of adverse reactions and to follow the success of ASIT based upon this method of induction.

  11. Emotional functions in transsexuals after the first step in physical transformation.

    Science.gov (United States)

    Warmuz-Stangierska, Izabela; Stangierski, Adam; Ziemnicka, Katarzyna; Gołąb, Monika; Zdanowska, Joanna; Lodyga, Martha; Komarowska, Hanna; Głowacka, Maria Danuta; Ruchała, Marek

    2015-01-01

    Transsexuals have to face multiple medical, social and bureaucratic problems. These problems are not only encountered before the transformation, but also during and after medical procedures. In the search for improvement of transsexual individuals' quality of life during therapy, it seems desirable to supplement hormonal treatments with psychological explorations. This study was conducted with the aim of defining emotional conditions and included 28 transsexual female-to-male (F/M) patients and two gender-divided control groups (males and females) of similar age. The following psychometric scales were used: CECS (Courtauld Emotional Control Scale constructed by M. Watson and S. Greer in the Polish Adaptation by Z. Juczyński), ISCL (the Polish Adaptation of the State-Trait Anxiety Inventory for Adults by T. Sosnowski), and GSES (the Polish Adaptation of the R. Schwarzer, M. Jerusalem Generalized Self-Efficacy Scaleby Z. Juczyński and K. Wrześniewski). Transsexual F/M patients appeared very similar to males in the male control group in terms of their subjective selfefficacy and state-trait anxiety, while their subjective belief of anxiety and fear control was more comparable to that of the female controls. It was also found to be statistically significantly lower than in the male controls.

  12. Crossing borders: a critical review of the role of the European Court of Justice in EU health policy.

    Science.gov (United States)

    Brooks, Eleanor

    2012-04-01

    Over the last two decades, the European Union (EU) has steadily increased its involvement in the health policies of its member states, with considerable support from the European Court of Justice (ECJ). However, much of the literature examining the Court's role has focused upon the intersection between internal market law and the health services sector; the majority of studies have failed to examine the potential role for the Court in public health policy. Observers such as Greer have seen the development of healthcare as a clear case of neofunctional spillover, a view supported but qualified by Wasserfallen and others, who present a more detailed account of the mechanics of the process. Alternative analyses have focused upon the new modes of governance, soft law and other factors - this article reviews the current state of research in the field and the extent to which it should concern health policy actors and non-specialists in EU policy alike. It concludes that the Court has played and continues to play a crucial role in the development of EU public health policy, as well as in health services and broader social policy, where its influence has already been well documented. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  13. BRAIN vol. 4 (2013, issues 1-4, first 4 pages

    Directory of Open Access Journals (Sweden)

    Bogdan Patrut

    2013-10-01

    Full Text Available TABLE OF CONTENTS Sections BRAINStorming and BRAINovations 1. Evolving Spiking Neural Networks for Control of Artificial Creatures 5Arash Ahmadi 2. Artificial Neuron Modelling Based on Wave Shape 20Kieran Greer 3. Brain-Like Artificial Intelligence for Automation – Foundations, Concepts andImplementation Examples 26Rosemarie Velik 4. Performance Analysis of Unsupervised Clustering Methods for Brain Tumor Segmentation 55Tushar H Jaware and Dr. K B Khanchandani 5. High Performance Data mining by Genetic Neural Network 60Dadmehr Rahbari 6. Isomorphism Between Estes’ Stimulus Fluctuation Model and a Physical-Chemical System 71Makoto Yamaguchi 7. Intelligent Continuous Double Auction method For Service Allocation in Cloud Computing 74Nima Farajian, Kamran Zamanifar 8. An Enhancement Over Texture Feature Based Multiclass Image Classification UnderUnknown Noise 84Ajay Kumar Singh, V P Shukla, Shamik Tiwari and S R Biradar 9. Suicide: Neurochemical Approaches 97Ritabrata Banerjee, Anup K. Ghosh, Balaram Ghosh, Somnath Bhattacharya and Amal C. Mondal 10. L1 Transfer in Post-Verbal Preposition: An Inter-level Comparison 125Samira Mollaei, Ali Jahangard and Hemaseh Bagheri Section BRAINotes 11. Looking for Oriental fundamentals Fuzzy Logic 141Ángel Garrido and Piedad Yuste Instructions for authors 146

  14. Climate change, poverty and agricultural resource degradation: a case study of district d.g. khan

    International Nuclear Information System (INIS)

    Imran, M.; Bano, S.; Dawood, M.; Tarar, M.A.; Ali, A.

    2012-01-01

    Global development agendas are now being bonded with adaptation to climate change. Sustainable biodiversity and community adaptation to climate change are closely associated as depletion of natural resources adversely affects the living standard of people. Rapid climatic changes and intervention to regulate water resources in Indus delta of Pakistan have put the lives of millions of people residing near the Indus river belt at the stake of climate change. Therefore, this study was designed to inquire the socio-economic conditions of the people residing near the Indus river bank and the perceived impact of climate change on river belt agricultural resources specifically in district D. G. Khan. Based on primary data study employed univariate and bivariate analysis which suggested flood, wind storm and temperature as the significant climate change parameters affecting the land fertility, forest and fisheries. The Foster Greer and Thorbeck technique for calculating the poverty indicated that majority (82%) of population was below poverty line and most of them entirely depend on river belt agricultural resources which were found to be depleting due to rapid climate change. (author)

  15. The effects of stating problems in bilingual students' first and second languages on solving mathematical word problems.

    Science.gov (United States)

    Bernardo, Allan B I; Calleja, Marissa O

    2005-03-01

    Researchers have suggested that among bilinguals, solving word problems in mathematics is influenced by linguistic factors (K. Durkin & B. Shire, 1991; L. Verschaffel, B. Greer, & E. De Corte, 2000). Others have suggested that students exhibit a strong tendency to exclude real-world constraints in solving mathematics word problems (L. Verschaffel, E. De Corte, & S. Lasure, 1994). In the present study, the authors explored the effects of stating word problems in either Filipino or English on how Filipino-English bilingual students solved word problems in which the solution required the application of real-world knowledge. The authors asked bilingual students to solve word problems in either their first or second language. For some of the word problems, real-life constraints prevented straightforward application of mathematical procedures. The authors analyzed the students' solutions to determine whether the language of the word problems affected the tendency to apply real-life constraints in the solution. Results showed that the bilingual students (a) rarely considered real-life constraints in their solutions, (b) were more successful in understanding and solving word problems that were stated in their first language, and (c) were more likely to experience failure in finding a solution to problems stated in their second language. The results are discussed in terms of the relationship between linguistic and mathematical problem-solving processes among bilinguals.

  16. [Psychological and behavioral predictors of the quality of life of people with multiple sclerosis].

    Science.gov (United States)

    Juczyński, Z; Adamiak, G

    2000-06-01

    The aim of the study was to determine the relationship between some psychological and behavioural variables associated with disease, and health related quality of life. A survey was conducted on a sample of 44 people with multiple sclerosis. Quality of life was defined as life satisfaction and subjective assessment of current health status. The following methods were used: The Satisfaction With Life Scale (Diener et al.) and Visual Analogue Scale (single-item self-ratings of health) to measure the quality of life; Multidimensional Health Locus of Control Scale--MHLC (Wallston et al.); Acceptance of Illness Scale (Felton et al.); Self-Esteem Scale (Rosenberg); Courtauld Emotional Control Scale (Watson and Greer) and Health Behaviour Inventory (Juczyński). A series of step-wise regression models and discriminant function analysis on future quality of life variables were calculated, taking as predictors psychological and behavioural variables. High self-esteem, engagement in a large number of health behaviour and acceptance of illness were most predictive of good health related quality of life of people with multiple sclerosis.

  17. An overview of the evaluations of nuclear power by Canadians

    International Nuclear Information System (INIS)

    Barrados, Maria

    1980-01-01

    Limited data are available on Canadian evaluations of nuclear power. General observations are made, based on a 1976 national study by B. Greer-Wootten and a 1978 Canadian Gallup Poll survey. Little change in the knowledge Canadians have of nuclear power appears to have taken place. A sizeable proportion of the population is willing to offer an opinion about the use of nuclear power while knowing nothing about it. Increased knowledge is not associated with more positive or negative evaluations of nuclear power. In more specific evaluations of nuclear safety, increased knowledge is found to be associated with a lowered confidence in the safety of Canadian reactors. There appears to have been a drop in the proportions of Canadians somewhat in favour of nuclear power between 1976 and 1978. Since many Canadians do not know much about the use of nuclear power and the majority of opinions are not strongly committed, there is considerable potential for fluctuation in these figures. Increased emphasis appears to be put on waste management issues in 1978, while nuclear power plants are less likely to be perceived as unsafe. This may be the result of increased discussion of Canadian power reactors. (LL)

  18. The Economic Impact of Productive Safety Net Program on Poverty: Microeconometrics Analysis, Tigrai National Regional State, Ethiopia

    Directory of Open Access Journals (Sweden)

    Yibrah Hagos Gebresilassie

    2014-08-01

    Full Text Available This paper aims at evaluating the impact of productive safety net program on poverty using primary data from randomly selected 600 households in central zone of Tigrai National Regional State, Ethiopia. Propensity Score Matching and Foster-Greer-Thorbecke were used to evaluate impact of the program and poverty, respectively. The paper revealed that the program has positive and significant effect on consumption, livestock holdings, and productive assets. Moreover, impact of the program on total consumption expenditure per adult equivalent was found to be positive and significant. Using total poverty line, poverty rate was lowest among program participants (30.33% than non-participants (31.1%. Highest poverty rate was found among households headed by women (38.42% while households headed by men (23.1%. The study also revealed that the program has positive and significant effect on poverty reduction and protecting productive assets. Finally, it was recommended that female headed program participants based programs should be provided to help boost their agricultural output and reduce endemic poverty.

  19. (58 Indices, Metaphors and Montages. The Heterogeneous Work in Current Latin American Literary Studies

    Directory of Open Access Journals (Sweden)

    Francisco Gelman Constantin

    2017-09-01

    Full Text Available As contemporary literary scholars challenge the ruling exclusionary criteria for the homogenization of their objects, while at the same time the biopolitical turn on literary theory criticizes representational understandings of the bond between language and the body, this paper suggests to address said relationship with recourse to the Lacanian notion of the ‘montage of heterogeneous’, which was brought forth toward a redefinition of the psychoanalytical concept of drive. Drawing from the notion of ‘heterogeneous literatures’, I advocate a theoretical genealogy from Bataille to Lacan (while Nancy, Foucault and Butler are also summoned to the discussion in order to come to terms with the rethinking of the objects for literary scholarship demanded by works such as Emilio García Wehbi’s performance piece 58 indicios sobre el cuerpo, along with his and Nora Lezano’s poetical- photographical essay Communitas.

  20. A 41 ps ASIC time-to-digital converter for physics experiments

    International Nuclear Information System (INIS)

    Russo, Stefano; Petra, Nicola; De Caro, Davide; Barbarino, Giancarlo; Strollo, Antonio G.M.

    2011-01-01

    We present a novel Time-to-Digital (TDC) converter for physics experiments. Proposed TDC is based on a synchronous counter and an asynchronous fine interpolator. The fine part of the measurement is obtained using NORA inverters that provide improved resolution. A prototype IC was fabricated in 180 nm CMOS technology. Experimental measurements show that proposed TDC features 41 ps resolution associated with 0.35LSB differential non-linearity, 0.77LSB integral non-linearity and a negligible single shot precision. The whole dynamic range is equal to 18μs. The proposed TDC is designed using a flash architecture that reduces dead time. Data reported in the paper show that our design is well suited for present and future particle physics experiments.

  1. Perturbation method for experimental determination of neutron spatial distribution in the reactor cell

    International Nuclear Information System (INIS)

    Takac, S.M.

    1972-01-01

    The method is based on perturbation of the reactor cell from a few up to few tens of percent. Measurements were performed for square lattice calls of zero power reactors Anna, NORA and RB, with metal uranium and uranium oxide fuel elements, water, heavy water and graphite moderators. Character and functional dependence of perturbations were obtained from the experimental results. Zero perturbation was determined by extrapolation thus obtaining the real physical neutron flux distribution in the reactor cell. Simple diffusion theory for partial plate cell perturbation was developed for verification of the perturbation method. The results of these calculation proved that introducing the perturbation sample in the fuel results in flattening the thermal neutron density dependent on the amplitude of the applied perturbation. Extrapolation applied for perturbed distributions was found to be justified

  2. Reflektuojančio būsimo specialiojo pedagogo profesinio apsisprendimo patirtys

    OpenAIRE

    Bubnys, Remigijus; Žydžiūnaitė, Vilma

    2008-01-01

    Fenomenologinės hermeneutikos rezultatai atskleidė būsimų specialiųjų pedagogų profesinį apsisprendimą lemiančius veiksnius. Studentų pasirinkimą studijuoti lemia į žmogų orientuoti ir savirealizacijos veiksniai: poreikis rūpintis kitais, meilė vaikams, noras padėti žmonėms, įgyti žinių bei poreikis perimti profesinį vaidmenį. Apsisprendimą nebūti specialiuoju pedagogu stiprina komplikuotas darbo pobūdis, asmeninių įgūdžių stoka bei specialiųjų ugdymosi poreikių turinčių vaikų individualūs el...

  3. The Frontier Speaks Back: Two Australian Artists Working in Paris and London

    Directory of Open Access Journals (Sweden)

    Catherine Margaret Speck

    2013-07-01

    Full Text Available Australian artists living and working in Paris and London in the Belle Époque and modern eras had a deep engagement with cosmopolitanism in cities that were at the frontiers of international modernism. They experienced the liberation of putting aside issues of nation, and of working in large, alienating but culturally challenging multi-nation environs in the pre and post war years. This paper will explore how two women artists, Hilda Rix in Paris, a hub of internationalism; and Nora Heysen in London, a city ill-described in the Empire language of ‘home’ for Australians, connected with and articulated cosmopolitan culture. Expatriatism facilitated an offshore variant of Australian modernism.

  4. Music, empathy and cultural understanding: The need for developmental research. Comment on "Music, empathy and cultural understanding" by E. Clarke et al.

    Science.gov (United States)

    Rabinowitch, Tal-Chen

    2015-12-01

    Clarke, DeNora and Vuoskoski have carried out a formidable task of preparing a profound and encompassing review [3] that brings together two highly complex and multifaceted concepts, empathy and music, as well as a specific aspect of empathy that is highly relevant to society, cultural understanding. They have done an extraordinary service in synthesizing the growing, but still highly fragmented body of work in this area. At the heart of this review lies an intricate model that the authors develop, which accounts for a variety of mechanisms and cognitive processes underlying musical empathic engagement. In what follows I would like to first point out what I think is unique about this model. Then, I will briefly describe the need for including in any such model a developmental angle.

  5. Energy-saving chlorine production. Chlor-alkali electrolysis using innovative cathode technology; Energiesparende Chlorpoduktion. Chlor-Alkali-Elektrolyse mit innovativer Kathoden-Technologie

    Energy Technology Data Exchange (ETDEWEB)

    Woltering, Peter; Hofmann, Philipp; Funck, Frank; Kiefer, Randolf; Baeumer, Ulf-Steffen; Donst, Dmitri; Schmitt, Carsten [Thyssen Krupp Uhde GmbH, Dortmund (Germany)

    2013-11-01

    Chlorine is used in the synthesis of almost two thirds of all chemical products. Producing chlorine from salt by electrolysis is a very energy-intensive process. Through their joint venture UHDENORA S.p.A., ThyssenKrupp Uhde and Industrie De Nora S.p.A. have played a major part in the development of a globally available technology that can produce chlorine using up to 30 percent less energy than conventional processes. It uses oxygen depolarized cathode technology with an innovative new cathode chamber design in an Uhde single-cell element. In Germany alone, converting all existing plants to the new technology would save enough electricity to power a city the size of Cologne. (orig.)

  6. Development of a Zircaloy creep and failure model for LOCA conditions

    International Nuclear Information System (INIS)

    Raff, S.; Meyder, R.

    1981-01-01

    The present status of NORA model for zircaloy-4 creep and failure in the high temperature region (from 600 deg C up to 1200 deg C) is described. Temperature dependence, strain hardening and oxygen content are found to be the most important features of the strain rate creep equation. The failure criterion is based on a modified strain fraction rule. Variables of this criterion are temperature, strain rate or applied stress respectively and oxygen content. Concerning the application of the deformation model, deduced from uniaxial tests, to tube deformation calculation the axial ballooning shape has to be taken into account. Its influence on the tube stress components and therefore on strain rate is discussed. A further improvement of the deformation model concerning yield drop and irregular creep behaviour aims at the enlargement of the range of applicability and reduction of the error band of the model

  7. Use of fluorescent-metal intensifying screens with RT-type films for X-ray radiography using pulse devices

    International Nuclear Information System (INIS)

    Morgovskij, L.Ya.; Khakim'yanov, R.R.

    1985-01-01

    A study was made on characteristics of combination of fluorescent-metal Kyokko SMP-308 (Japan) and RCF (Agfa-Gevert) screens with domestic X-ray RT-1, RT-2, RT-5 films. Pulse X-ray MIRA-3D and NORA devices at 200 kV voltage amplitude in X-ray tube were used as radiation source. Testing was conducted for steel samples of 5-40 mm thickness. Comparative exposures for various film combinations with fluorescent-metal screens, fluorescent VP-2 screens and lead foils of 27 μm thickness were determined at that. It is shown that fluorescent-metal screens can be successfully applied with domestic X-ray technical films. They enable to decrease exposure by one order with insignificant deterioration of sensitivity. It is important for testing of pipeline welds

  8. Case a mare: proposte di ricostruzione

    Directory of Open Access Journals (Sweden)

    Silvia Mevio

    2013-11-01

    Full Text Available This contribution tries to throw new light on the area of the “case a mare”, dug in the 50s, and more specifically the northern sector of the district, called sector A. The studied area includes 5 different rooms attributable on two different housing units: the rooms Aa, Ab and Ac belong to the first while rooms Ad and Ae belong to the second. The rooms are described first in their present state, and then the intervention of virtual reconstruction that was carried out is presented. The reconstructions provided here are based on the comparison between other units outside the site of Nora (Ostia and Pompei above all and on direct archaeological evidence found in situ. Finally, a description of the software, called Rhynoceros, used for the reconstruction is provided, with particular attention to the materials which were used.

  9. Læring og objektivitet i postmoderne uddannelsesteori

    Directory of Open Access Journals (Sweden)

    Thomas Aastrup Rømer

    2005-01-01

    Full Text Available In this article, two major postmodern contributions are discussed:the book The Postmodern Condition by Jean-Francois Lyotardand a few influential publications by psychologist Kenneth Ger-gen. The overall aim is to identify an object of postmodern educa-tion, which is neither a totally relativist play of the imagination nora radical instance of critical theory. Instead, it is argued that post-modern education is situated as a relation between learning andlocal objectivity, which is interpreted as the relation between a newmove in a language game and the local regime of competence. Post-modern education is a “back to basic”, a “how do people speak inmy local surroundings”, a “how can I reorganise these vocabular-ies in new and interesting constellations, and a “how are thesereorganisations evaluated by the local paradigm of power.

  10. La construcción de un lugar de memoria en la Provincia de Buenos Aires. Mansión Seré, Morón, 1983-2007

    Directory of Open Access Journals (Sweden)

    Dolores San Julián

    2014-04-01

    Full Text Available En este trabajo reconstruimos sintéticamente el proceso de constitución de Mansión Seré como un lugar de memoria (Nora, 1984. Durante los primeros años de la última dictadura militar en Argentina (1976-1983, esta casona funcionó como centro de tortura y desaparición de personas. En el año 2000, el Estado local junto a organismos de Derechos Humanos decidieron convertirla en un espacio de rememoración y transmisión de lo ocurrido bajo el terrorismo de Estado. A partir de documentos y entrevistas, reconstruimos y analizamos los antecedentes político-institucionales del desarrollo de una política de la memoria y el proceso inicial de elaboración de un programa de memoria en este sitio

  11. Vaba Läti ehitab / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2007-01-01

    13.-17.04. 2007 hindas rahvusvaheline žürii Läti parimaid arhitektuuriteoseid. Parim rekonstrueeritud ehitis oli büroohoone Riias Dzirnavu tn. 68 (arhitektid Aleksejs Birjukovs, Andis Silis). Parim tööstushoone oli Ventspilsis asuv mahlakontsentraatide käitlus- ja laohoone (arhitektid Aija Kokina, Andris Kokins, Krista Strelita-Strele). Bürookategooria võiduprojektiks valiti Liepajas Zivju tn. 11/13 paiknev kontorihoone (arhitektid Diana Zalane, Artis Rokis). Parima elamu tiitli pälvis Jurmalas Jura tn. 32 asuv maja (arhitektid Janis Alksnis, Nora Saulespurena, Andris Rubenis). Eramajadest oli parim suvemaja Pavilostas (arhitekt Janis Sauka). Parima maastikuarhitektuur-väikevormi preemia said Gvido Rekis, Anita Neilande, Andris Kausenieks, Didzis Oshenieks Ventspilsi dzhungliraja eest. Sisekujunduspreemia sai originaaldisainiga ekspositsioonikapslitega Grindeksi farmaatsiatoodete näidisteruum Riias

  12. Music as a way of knowing. Comment on "Music, empathy, and cultural understanding" by E. Clarke et al.

    Science.gov (United States)

    Dibben, Nicola

    2015-12-01

    In their critical review, Clarke, DeNora and Vuoskoski [3, this issue] integrate and make sense of a diverse range of theory and evidence to argue that music has the capacity to facilitate empathy and aid cultural understanding. The invitation to comment on this paper arrived in my email in-box at a time when Europe was witnessing one of the largest movements of people in modern times and when thousands of refugees were dying in the attempt to cross the Mediterranean. For a short while at least, empathy, or the lack thereof, became a socio-political lever, galvanizing European citizens to demonstrate their willingness to give asylum to refugees (#refugeeswelcome), and shaping domestic and European immigration policies. In this context, it would be hard to refute the importance of understanding empathy, albeit through its musical incarnation.

  13. Cinema as a site of memory: thoughts from amateur Super-8 films re-edited in the short film 'Supermemórias'

    Directory of Open Access Journals (Sweden)

    Maíra Magalhães Bosi

    2016-07-01

    Full Text Available This paper aims to study amateur films, made in a private context, as a powerful way of creating memory. To do so, we first present a theoretical analisys on the idea of “sites os memory” (Nora 1984 and also on the desire to protect memory, that calls to action the amateur filmmaker. At least, we analyze two Super-8 amateur films produced in Fortaleza (Brazil, in 1978, which were re-edited in the short movie Supermemorias (Danilo Carvalho, 2010. This analysis evidences to us the editing process as a way of constructing new sites of memory and also allow us to reafirm that the amateur film production can instigate interesting and relevant contemporary investigations.

  14. Virginia oil and gas production, exploration and development

    International Nuclear Information System (INIS)

    Stern, M.

    1990-01-01

    This paper reports that although production and drilling declined in Virginia in 1989, there were interesting projects that should impact Virginal's future oil and gas potential. In Dickenson County, Equitable Resources (EREX) began development on two areas of coalbed methane and extended the limits of the Nora Coalbed Methane Field with an exploratory well. In Westmoreland County, Texaco drilled a deep test well in the Taylorsville Basin. While a depressed market caused a decline in natural gas production of four percent, there was significant new production from ten coalbed methane wells in Dickenson County. The coalbed methane wells produced 181,526 Mcf or over one percent of the total production in the state. The 1989 total of 17,935,376 Mcf produced from 752 wells was a four percent decline from the 1988 figure of 18,682,350 Mcf from 728 wells

  15. Performative Urban Architecture

    DEFF Research Database (Denmark)

    Thomsen, Bo Stjerne; Jensen, Ole B.

    The paper explores how performative urban architecture can enhance community-making and public domain using socio-technical systems and digital technologies to constitute an urban reality. Digital medias developed for the web are now increasingly occupying the urban realm as a tool for navigating...... the physical world e.g. as exemplified by the Google Walk Score and the mobile extension of the Google Maps to the iPhone. At the same time the development in pervasive technologies and situated computing extends the build environment with digital feedback systems that are increasingly embedded and deployed...... using sensor technologies opening up for new access considerations in architecture as well as the ability for a local environment to act as real-time sources of information and facilities. Starting from the NoRA pavilion for the 10th International Architecture Biennale in Venice the paper discusses...

  16. Deformation behavior of Zircaloy-4 cladding tubes under inert gas conditions in the temperature range from 600 to 12000C

    International Nuclear Information System (INIS)

    Hofmann, P.; Raff, S.; Gausmann, G.

    1981-07-01

    Within the temperature range from 600 0 to 1200 0 isothermal, isobaric creep rupture experiments were performed under inert gas with short Zircaloy-4 tube specimens in order to obtain experimental data supporting the development of the NORA cladding tube deformation model. The values of the tube inner pressure were so selected that the time-to-failure values varied between 2 and 2000 s. The corresponding creep rupture curves are indicated. Besides the temperature and the burst pressure the development of deformation over time of the tube specimens was measured. This allowed to draw diagrams of stress, strain rate and strain. On account of the type of specimen heating applied (radiation heating) the temperature difference at the cladding tube circumference is very small ( [de

  17. Changes in social relations in old age. Are they influenced by functional ability?

    DEFF Research Database (Denmark)

    Avlund, Kirsten; Due, Pernille; Holstein, Bjørn Evald

    2002-01-01

    The aims of this article were to describe changes in social relations from ages 75 to 80, and analyze whether changes in social relations are influenced by functional ability at age 75. The study includes data from the NORA follow-up study of 75-80 year-old men and women in Jyväskylä (Finland......, close friends, acquaintances, and neighbors; 2) diversity of social relations (number of types of social contacts); 3) telephone contacts; and 4) social participation. The function of social relations was measured by instrumental social support. Functional ability was measured by tiredness and need......), Göteborg (Sweden) and Glostrup (Denmark). The present analyses include the 743 persons who participated in both studies and who answered the questions about social relations. The structure of social relations was measured by: 1) frequency of contacts with children, grand/greatgrandchildren, relatives...

  18. Performative Urban Environments

    DEFF Research Database (Denmark)

    Jensen, Ole B.; Thomsen, Bo Stjerne

    2008-01-01

    The chapter explores how temporary architectural structures can become media for bottom-up approaches to urban development. Urban interactions in the city developed from the sidewalks were seen as locally bounded neighbourhoods. However, with the advent of contemporary network technologies....... In investigating architectural media-constructions the paper draws on the notion of ‘Capsular Civilization'. Arguing that architectural capsules in the cities' in-between spaces may become the media and places of meaningful interaction by establishing a feedback loop guided by social interaction. Architecture thus......-organizing, communicative environments for an organized complexity between flows of local interactions and network behaviour. The chapter applies the concepts on the case of the Pavilion Project, NoRA, built for the 10th International Architecture Biennale in Venice for the network of Food College Denmark....

  19. Literatura en el espacio público. Rivas y su obra: un punto de inflexión en la recuperación de la memoria histórica

    Directory of Open Access Journals (Sweden)

    Dolores Vilavedra

    2015-07-01

    Full Text Available Tras una revisión diacrónica del tratamiento del tema de la guerra civil en la narrativa gallega, el artículo analiza la función performativa que en ese contexto han desempeñado una serie de obras narrativas de Manuel Rivas y su eficacia como factores de legitimación y dinamización del proceso de recuperación de la memoria histórica. Como conclusión se propone considerar a Rivas como un emprendedor de la memoria (Jelin y sus obras como ‘lieux de memoire’ (Nora por su condición de artefactos culturales de integración social

  20. Perturbation method for experimental determination of neutron spatial distribution in the reactor cell; Metoda perturbacije za eksperimentalno odredjivanje prostorne raspodele neutrona u celiji reaktora

    Energy Technology Data Exchange (ETDEWEB)

    Takac, S M [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Yugoslavia)

    1972-07-01

    The method is based on perturbation of the reactor cell from a few up to few tens of percent. Measurements were performed for square lattice calls of zero power reactors ANNA, NORA and RB, with metal uranium and uranium oxide fuel elements, water, heavy water and graphite moderators. Character and functional dependence of perturbations were obtained from the experimental results. Zero perturbation was determined by extrapolation thus obtaining the real physical neutron flux distribution in the reactor cell. Simple diffusion theory for partial plate cell perturbation was developed for verification of the perturbation method. The results of these calculation proved that introducing the perturbation sample in the fuel results in flattening the thermal neutron density dependent on the amplitude of the applied perturbation. Extrapolation applied for perturbed distributions was found to be justified.