WorldWideScience

Sample records for nora dauenhauer robert

  1. Raising Nora.

    Science.gov (United States)

    Mack, Margo

    1996-01-01

    Describes a creative approach to including Nora, a student with cerebral palsy, in an outdoor adventure--a hilly, seven-mile trek through Eastern Oregon's Ponderosa pine forests. With teachers' and classmates' help, Nora practiced on a simulated horse and saddle, overcame her fear of heights, and eagerly joined classmates on horseback. (MLH)

  2. From Phoenician Nora to Punic Nora and Beyond

    Directory of Open Access Journals (Sweden)

    Stefano Finocchi

    2013-11-01

    Full Text Available Sulla base dei risultati conseguiti dalla missione dell’Università della Tuscia a Nora si esaminano i dati circa le più antiche fasi dell’insediamento fenicio di Nora in Sardegna e le prime forme di organizzazione urbana (fine dell’VIII - seconda metà del VI secolo a.C.. Si illustrano quindi gli aspetti urbanistici legati all’affermazione dell’egemonia cartaginese a Nora (dall’ultimo quarto del VI secolo a.C. e le trasformazioni urbanistiche e topografiche che interessano un settore della città, il “Colle di Tanit”, tra l’età ellenistica e le ultime fasi di vita dell’età repubblicana. Grazie ai dati delle ricognizioni territoriali, si esaminano le modalità della diffusione e dello sfruttamento delle relative risorse tra l’età fenicia e punica prima, quella romana repubblicana e imperiale poi e quella di età bizantina e basso medievale in seguito.

  3. Welcoming nora: a family event.

    Science.gov (United States)

    Walsh, Allison J; Walsh, Paul R; Walsh, Jane M; Walsh, Gavin T

    2011-01-01

    In this column, Allison and Paul Walsh share the story of the birth of Nora, their third baby and their second child to be born at home. Allison and Paul share their individual memories of labor and birth. But their story is only part of the story of Nora's birth. Nora's birth was a family event, with Allison and Paul's other children very much part of the experience. Jane and Gavin share their own memories of their baby sister's birth.

  4. Development of Nora Performance and Management System for Creative Economy

    OpenAIRE

    Sriaroon Ruangrit; Prajak Maicharoen; Kla Somtrakool

    2015-01-01

    This research study on “Development of Nora Performance and Management System for Creative Economy” is a qualitative research that aims to study 1) historical background, popular traditions, beliefs and management system of Nora performance; 2) problems encountered pertaining Nora performance and its management system; and 3) an appropriate model for development of Nora performance and management system for the creative economy. The target area of the research is a selection of 6 Nora perform...

  5. Nora's lesion, a distinct radiological entity?

    International Nuclear Information System (INIS)

    Dhondt, E.; Oudenhoven, L.; Khan, S.; Kroon, H.M.; Hogendoorn, P.C.; Nieborg, A.; Bloem, J.L.; Schepper, A. de

    2006-01-01

    To describe the radiological findings of ''Bizarre parosteal osteochondromatous proliferation''(BPOP) - otherwise known as Nora's lesion, to describe the natural evolution of BPOP and to assess radiologically if BPOP is indeed part of a spectrum of reactive lesions including florid reactive periostitis and turret exostosis. Four experienced musculoskeletal radiologists studied plain radiographs and other imaging documents of histologically-proven Nora's lesions, looking for soft-tissue changes, periosteal reaction/calcification and calcified/ossified pseudotumours, and compared those findings with findings on pathology reviewed by a peer group of pathologists. Twenty-four Nora's lesions originating from a series of 200 consecutive, histologically-verified bone (pseudo)tumours of the hand, seen by the ''Netherlands Committee on Bone Tumours'' for review and second opinion. Nora's lesions have a recognised presentation on radiographs without specific MR characteristics. Natural evolution could be assessed retrospectively in four cases. Recurrent lesions were seen in seven cases and are difficult to differentiate from primary Lesions. (orig.)

  6. Development of Nora Performance and Management System for Creative Economy

    Directory of Open Access Journals (Sweden)

    Sriaroon Ruangrit

    2015-11-01

    Full Text Available This research study on “Development of Nora Performance and Management System for Creative Economy” is a qualitative research that aims to study 1 historical background, popular traditions, beliefs and management system of Nora performance; 2 problems encountered pertaining Nora performance and its management system; and 3 an appropriate model for development of Nora performance and management system for the creative economy. The target area of the research is a selection of 6 Nora performance teams in 3 provinces – Pathalung, Nakhon Sri Thammarat and Trang. The research methods are comprised of documentation studies, observations, interviews, group discussion and workshop. Data analysis was performed through a descriptive analysis. The research findings show that historical background of Nora ensembles are mostly derived and promoted from the families, relatives and other interested group of people. The research also finds that there are 9 elements of Nora performance, which comprise 1 the theater and scenes to be used for Nora performance; 2 the outstanding costumes to be used; 3 the musical instruments; 4 light and sound decoration; 5 the number of performers (20-70; 6 the stories to be performed; 7 the manager; 8 the popular traditions of performance; 9 Nora traditional beliefs. In terms of problems encountered, it was found that the popularity of Nora performance has decreased, since nowadays there is more technological media, thereby decreasing the amount of revenue and the degree of Nora inheritance. The research found that in developing Nora performance and management system for creative economy, the local curriculum should be developed for school use or educational academies. Besides, it may be developed in the form of a website database, books and videos, all of which should be aimed to meet public relations targets and distribution as well as to increase revenue. The local institutions should render cooperation and frequently

  7. Nora's Voice.

    Science.gov (United States)

    Rameka, Nora; Stalker, Joyce

    1996-01-01

    The cultural and gender issues raised by a Maori adult educator (Nora Rameka) are framed by the interviewer (Joyce Stalker) who comments on methodological difficulties and compromises that were necessary in order to have Maori perspectives represented in this issue. (SK)

  8. 75 FR 30044 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2010-05-28

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... (NORA) has been structured to engage partners with each other and/or with NIOSH to advance NORA...

  9. 76 FR 44337 - Comments and Information Relevant to Mid Decade Review of NORA

    Science.gov (United States)

    2011-07-25

    ... NIOSH-244] Comments and Information Relevant to Mid Decade Review of NORA AGENCY: Department of Health...) is conducting a review of the processes of the National Occupational Research Agenda (NORA). In 2006, NORA entered its second decade with an industry sector-based structure. In 2011, as NORA reaches the...

  10. 77 FR 16840 - Partnerships to Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2012-03-22

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to advance...

  11. 76 FR 25694 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2011-05-05

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to advance...

  12. 76 FR 66071 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2011-10-25

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Occupational Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to...

  13. 77 FR 66619 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2012-11-06

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to advance...

  14. 75 FR 63495 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2010-10-15

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Occupational Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to...

  15. 78 FR 30306 - Partnerships To Advance the National Occupational Research Agenda (NORA)

    Science.gov (United States)

    2013-05-22

    ... Advance the National Occupational Research Agenda (NORA) AGENCY: The National Institute for Occupational... following public meeting: ``Partnerships to Advance the National Occupational Research Agenda (NORA... Occupational Research Agenda (NORA) has been structured to engage partners with each other and/or with NIOSH to...

  16. Nora: A Vocabulary Discovery Tool for Concept Extraction.

    Science.gov (United States)

    Divita, Guy; Carter, Marjorie E; Durgahee, B S Begum; Pettey, Warren E; Redd, Andrew; Samore, Matthew H; Gundlapalli, Adi V

    2015-01-01

    Coverage of terms in domain-specific terminologies and ontologies is often limited in controlled medical vocabularies. Creating and augmenting such terminologies is resource intensive. We developed Nora as an interactive tool to discover terminology from text corpora; the output can then be employed to refine and enhance natural language processing-based concept extraction tasks. Nora provides a visualization of chains of words foraged from word frequency indexes from a text corpus. Domain experts direct and curate chains that contain relevant terms, which are further curated to identify lexical variants. A test of Nora demonstrated an increase of a domain lexicon in homelessness and related psychosocial factors by 38%, yielding an additional 10% extracted concepts.

  17. Nora

    Directory of Open Access Journals (Sweden)

    Ilaria Frontori

    2014-08-01

    Full Text Available L’Università degli Studi di Milano, sotto la direzione scientifica del Prof. G. Bejor, opera a Nora (Pula, Cagliari dal 2002, in un progetto sostenuto da quattro atenei italiani. Oggetto della ricerca sono il settore centrale della penisola e le due fasce abitative collocate sulla costa occidentale e meridionale. Nel quartiere centrale le recenti campagne di scavo stanno portando alla luce l’isolato sottostante le Terme Centrali e le domus mosaicate, dimostrando una continuità di vita dall’età repubblicana fino al periodo tardoantico.

  18. Redox-controlled dinitrosyl formation at the diiron-oxo center of NorA.

    Science.gov (United States)

    Cramm, Rainer; Strube, Katja

    2008-01-01

    In the denitrifying bacterium Ralstonia eutropha H16, the NorA protein is coproduced with the respiratory nitric oxide (NO) reductase. NorA contains a diiron-oxo center, which can form stable adducts with dioxygen and NO. In contrast to other diiron proteins, the formation of NorA-NO requires both fully reduced protein and additional electrons. A minor fraction of in vitro NorA-NO represents a paramagnetic dinitrosyl iron complex (DNIC), while the major fraction is attributed to a DNIC of the structure {Fe(NO)(2)}, which shows no electron paramagnetic resonance. The NorA-DNIC may be formed either upon direct reaction of the protein with NO or upon incubation with nitrite due to an intrinsic nitrite reduction activity of NorA that liberates NO. NorA can be purified rapidly as a six histidine-tagged derivative from overproducing cells of Escherichia coli. This chapter describes procedures for the preparation of different redox forms of NorA for the formation of NorA adducts with NO, dioxygen, and azide, as well as for the quantification of NorA-bound NO.

  19. Fluoroquinolone resistance protein NorA of Staphylococcus aureus is a multidrug efflux transporter.

    OpenAIRE

    Neyfakh, A A; Borsch, C M; Kaatz, G W

    1993-01-01

    The gene of the Staphylococcus aureus fluoroquinolone efflux transporter protein NorA confers resistance to a number of structurally dissimilar drugs, not just to fluoroquinolones, when it is expressed in Bacillus subtilis. NorA provides B. subtilis with resistance to the same drugs and to a similar extent as the B. subtilis multidrug transporter protein Bmr does. NorA and Bmr share 44% sequence similarity. Both the NorA- and Bmr-conferred resistances can be completely reversed by reserpine.

  20. Characterization of Nora Virus Structural Proteins via Western Blot Analysis.

    Science.gov (United States)

    Ericson, Brad L; Carlson, Darby J; Carlson, Kimberly A

    2016-01-01

    Nora virus is a single stranded RNA picorna-like virus with four open reading frames (ORFs). The coding potentials of the ORFs are not fully characterized, but ORF3 and ORF4 are believed to encode the capsid proteins (VP3, VP4a, VP4b, and VP4c) comprising the virion. To determine the polypeptide composition of Nora virus virions, polypeptides from purified virus were compared to polypeptides detected in Nora virus infected Drosophila melanogaster. Nora virus was purified from infected flies and used to challenge mice for the production of antisera. ORF3, ORF4a, ORF4b, and ORF4c were individually cloned and expressed in E. coli; resultant recombinant proteins purified and were used to make monospecific antisera. Antisera were evaluated via Western blot against whole virus particles and Nora virus infected fly lysates. Viral purification yielded two particle types with densities of ~1.31 g/mL (empty particles) and ~1.33 g/mL (complete virions). Comparison of purified virus polypeptide composition to Nora virus infected D. melanogaster lysate showed the number of proteins in infected cell lysates is less than purified virus. Our results suggest the virion is composed of 6 polypeptides, VP3, VP4a, two forms of VP4b, and two forms of VP4c. This polypeptide composition is similar to other small RNA insect viruses.

  1. A Summary of NORA Project Results Related to Reactivity Measurements

    International Nuclear Information System (INIS)

    Berg, J.O.; Døderlein, J-M-; Haugset, K

    1969-01-01

    The NORA Project has been an international undertaking within the field of reactor physics, resulting from an agreement signed by the International Atomic Energy Agency and the Norwegian Government in April 1961, and subsequently renewed for three years in 1964 and one year in 1967. A summary of the research performed in the period 1961-1964 has been published in IAEA Technical Report Series no. 67. The Project work carried out through the years 1964-1968 will be covered in a forthcoming IAEA Technical Report. The main experimental facility used in the Project has been the zero-power reactor NORA Reactor kinetics, both experimental end theoretical, has been a major item of research in the NORA Project. The present report will briefly summarize results and conclusions considered relevant to the topic discussed by this Panel. Extensive referencing will be made to the final NORA Project Report

  2. Expression of multidrug resistance efflux pump gene norA is iron responsive in Staphylococcus aureus.

    Science.gov (United States)

    Deng, Xin; Sun, Fei; Ji, Quanjiang; Liang, Haihua; Missiakas, Dominique; Lan, Lefu; He, Chuan

    2012-04-01

    Staphylococcus aureus utilizes efflux transporter NorA to pump out a wide range of structurally dissimilar drugs, conferring low-level multidrug resistance. The regulation of norA expression has yet to be fully understood although past studies have revealed that this gene is under the control of the global transcriptional regulator MgrA and the two-component system ArlRS. To identify additional regulators of norA, we screened a transposon library in strain Newman expressing the transcriptional fusion norA-lacZ for altered β-galactosidase activity. We identify a transposon insertion in fhuB, a gene that encodes a ferric hydroxamate uptake system permease, and propose that the norA transcription is iron responsive. In agreement with this observation, addition of FeCl(3) repressed the induction of norA-lacZ, suggesting that bacterial iron uptake plays an important role in regulating norA transcription. In addition, a fur (ferric uptake regulator) deletion exhibited compromised norA transcription and reduced resistance to quinolone compared to the wild-type strain, indicating that fur functions as a positive regulator of norA. A putative Fur box identified in the promoter region of norA was confirmed by electrophoretic mobility shift and DNase I footprint assays. Finally, by employing a siderophore secretion assay, we reveal that NorA may contribute to the export of siderophores. Collectively, our experiments uncover some novel interactions between cellular iron level and norA regulation in S. aureus.

  3. Nora virus persistent infections are not affected by the RNAi machinery.

    Science.gov (United States)

    Habayeb, Mazen S; Ekström, Jens-Ola; Hultmark, Dan

    2009-05-29

    Drosophila melanogaster is widely used to decipher the innate immune system in response to various pathogens. The innate immune response towards persistent virus infections is among the least studied in this model system. We recently discovered a picorna-like virus, the Nora virus which gives rise to persistent and essentially symptom-free infections in Drosophila melanogaster. Here, we have used this virus to study the interaction with its host and with some of the known Drosophila antiviral immune pathways. First, we find a striking variability in the course of the infection, even between flies of the same inbred stock. Some flies are able to clear the Nora virus but not others. This phenomenon seems to be threshold-dependent; flies with a high-titer infection establish stable persistent infections, whereas flies with a lower level of infection are able to clear the virus. Surprisingly, we find that both the clearance of low-level Nora virus infections and the stability of persistent infections are unaffected by mutations in the RNAi pathways. Nora virus infections are also unaffected by mutations in the Toll and Jak-Stat pathways. In these respects, the Nora virus differs from other studied Drosophila RNA viruses.

  4. The Drosophila Nora virus is an enteric virus, transmitted via feces.

    Science.gov (United States)

    Habayeb, Mazen S; Cantera, Rafael; Casanova, Gabriela; Ekström, Jens-Ola; Albright, Shannon; Hultmark, Dan

    2009-04-01

    The biology of the Drosophila viruses has not been intensely investigated. Here we have investigated the biology of the Nora virus, a persistent Drosophila virus. We find that injected Nora virus is able to replicate in the files, reaching a high titer that is maintained in the next generation. There is a remarkable variation in the viral loads of individual flies in persistently infected stocks; the titers can differ by three orders of magnitude. The Nora virus is mainly found in the intestine of infected flies, and the histology of these infected intestines show increased vacuolization. The virus is excreted in the feces and is horizontally transmitted. The Nora virus infection has a very mild effect on the longevity of the flies, and no significant effect on the number of eggs laid and the percent of eggs that develop to adults.

  5. Discovery of novel inhibitors of the NorA multidrug transporter of Staphylococcus aureus.

    Science.gov (United States)

    Brincat, Jean Pierre; Carosati, Emanuele; Sabatini, Stefano; Manfroni, Giuseppe; Fravolini, Arnaldo; Raygada, Jose L; Patel, Diixa; Kaatz, Glenn W; Cruciani, Gabriele

    2011-01-13

    Four novel inhibitors of the NorA efflux pump of Staphylococcus aureus, discovered through a virtual screening process, are reported. The four compounds belong to different chemical classes and were tested for their in vitro ability to block the efflux of a well-known NorA substrate, as well as for their ability to potentiate the effect of ciprofloxacin (CPX) on several strains of S. aureus, including a NorA overexpressing strain. Additionally, the MIC values of each of the compounds individually are reported. A structure-activity relationship study was also performed on these novel chemotypes, revealing three new compounds that are also potent NorA inhibitors. The virtual screening procedure employed FLAP, a new methodology based on GRID force field descriptors.

  6. Osteoporosis practice patterns in 2006 among primary care physicians participating in the NORA study.

    Science.gov (United States)

    Weiss, T W; Siris, E S; Barrett-Connor, E; Miller, P D; McHorney, C A

    2007-11-01

    This study investigated osteoporosis management trends from 1998 to 2006 among 808 primary care physicians involved in the US-based NORA (National Osteoporosis Risk Assessment) study. These results suggest some significant improvements in osteoporosis management over the past eight years. The purpose of this study was to investigate osteoporosis management trends among a large cohort of primary care physicians (PCPs) involved in the US-based NORA (National Osteoporosis Risk Assessment) study. In 2006, we undertook a resurvey of the 2,836 NORA PCPs who completed a baseline survey in 1998. Of the 2,199 PCPs for whom we had current contact information and who were still practicing, we collected usable surveys from 808 (37% response rate). From 1998 to 2006, more than double the percentage of NORA PCPs reported using BMDs "often" (35% vs. 87%). There was a doubling of the percentage of NORA PCPs who reported that a T-score of NORA PCPs who reported using bone turnover markers to screen, diagnosis, or monitor osteoporosis almost tripled (19% vs. 55%). The percentage of patients prescribed or recommended hormone therapy dropped sixfold (67% to 11%), and the percentage of patients prescribed bisphosphonates increased fourfold from 15% to 59%. These results suggest some significant improvements in osteoporosis management over the past eight years.

  7. Nora ehk elu võimalikkusest naisena perekonnas, teatris ja kapitalismis / Anneli Saro

    Index Scriptorium Estoniae

    Saro, Anneli, 1968-

    2008-01-01

    Naistegelasest teatrist järgnevate lavastuste põhjal: Helen Rekkori lavastusest "Nora/Maja" Henrik Ibseni "Nukumaja" järgi Ugala teatris ja Elfriede Jelineki "Mis juhtus pärast seda, kui Nora oma mehe maha oli jätnud ehk Ühiskondade toed" Von Krahli Teatris, lavastaja Rainer Sarnet

  8. Posttranslational modification influences the effects of MgrA on norA expression in Staphylococcus aureus.

    Science.gov (United States)

    Truong-Bolduc, Que Chi; Ding, Yanpeng; Hooper, David C

    2008-11-01

    MgrA is a global regulator in Staphylococcus aureus. Differences in the effects of MgrA on norA expression have been reported for different strains, which varied in rsbU, a gene that affects the expression of sigB, which encodes an alternative sigma factor involved in stress responses. We hypothesized that MgrA was modified by sigB-dependent factors that affected its ability to control the expression of the norA efflux pump. Heterologously expressed MgrA purified from Escherichia coli was incubated with crude extracts (CE) from strains RN6390 (rsbU) and SH1000 (rsbU(+)) and tested for binding to the norA promoter. Purified MgrA exhibited greater binding to norA promoter DNA after being incubated with SH1000 CE than MgrA incubated with the RN6390 CE. Phosphorylation of MgrA occurring in cell extracts caused it to lose the ability to bind norA promoter DNA. Overexpression of pknB, encoding a candidate serine/threonine kinase, produced increased phospho-MgrA and led to a fivefold increase in the transcript level of norA for both RN6390 and SH1000, as well as a fourfold increase in the MICs of norfloxacin and ciprofloxacin for these two strains. The levels of expression of pknB in RN6390 and SH1000, however, indicated that additional factors related to rsbU or sigB contribute to the differential regulatory effects of MgrA on norA expression.

  9. VP3 is crucial for the stability of Nora virus virions.

    Science.gov (United States)

    Sadanandan, Sajna Anand; Ekström, Jens-Ola; Jonna, Venkateswara Rao; Hofer, Anders; Hultmark, Dan

    2016-09-02

    Nora virus is an enteric virus that causes persistent, non-pathological infection in Drosophila melanogaster. It replicates in the fly gut and is transmitted via the fecal-oral route. Nora virus has a single-stranded positive-sense RNA genome, which is translated in four open reading frames. Reading frame three encodes the VP3 protein, the structure and function of which we have investigated in this work. We have shown that VP3 is a trimer that has an α-helical secondary structure, with a functionally important coiled-coil domain. In order to identify the role of VP3 in the Nora virus life cycle, we constructed VP3-mutants using the cDNA clone of the virus. Our results show that VP3 does not have a role in the actual assembly of the virus particles, but virions that lack VP3 or harbor VP3 with a disrupted coiled coil domain are incapable of transmission via the fecal-oral route. Removing the region downstream of the putative coiled coil appears to have an effect on the fitness of the virus but does not hamper its replication or transmission. We also found that the VP3 protein and particularly the coiled coil domain are crucial for the stability of Nora virus virions when exposed to heat or proteases. Hence, we propose that VP3 is imperative to Nora virus virions as it confers stability to the viral capsid. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.

  10. Nora Särak: kõige suurem katsumus on iseenda usaldamine / intervjueerinud Katariina Rebane

    Index Scriptorium Estoniae

    Särak, Nora

    2016-01-01

    Kevadel Balti filmi- ja meediakooli magistriõppe lõpetanud Nora Säraku lõputööna valminud lühidokumentaalfilm "Valguseks/Valguseni/Valgusena" Petseris elavatest eestlastest pälvis Eesti Kultuurkapitali Audiovisuaalse kunsti sihtkapitali aastapreemia ning film valiti aasta dokumentaalfilmiks. Intervjuu Nora Särakuga

  11. Second toe swelling: Nora's lesion or glomus tumour, case report and literature review.

    LENUS (Irish Health Repository)

    Mohammad, A

    2012-09-01

    We report a rare case of bizarre parosteal osteochondromatous proliferation (BPOP, Nora\\'s lesion) of the right second toe in a 60-year-old man who presented with painful, bluish and bulbous swelling of the right second toe without any break in the skin.

  12. Ligand Promiscuity between the Efflux Pumps Human P-Glycoprotein and S. aureus NorA.

    Science.gov (United States)

    Brincat, Jean Pierre; Broccatelli, Fabio; Sabatini, Stefano; Frosini, Maria; Neri, Annalisa; Kaatz, Glenn W; Cruciani, Gabriele; Carosati, Emanuele

    2012-03-08

    Thirty-two diverse compounds were evaluated for their ability to inhibit both Pgp-mediated efflux in mouse T-lymphoma L5178 MDR1 and NorA-mediated efflux in S. aureus SA-1199B. Only four compounds were strong inhibitors of both efflux pumps. Three compounds were found to inhibit Pgp exclusively and strongly, while seven compounds inhibited only NorA. These results demonstrate that Pgp and NorA inhibitors do not necessarily overlap, opening the way to safer therapeutic use of effective NorA inhibitors.

  13. Capsaicin, a novel inhibitor of the NorA efflux pump, reduces the intracellular invasion of Staphylococcus aureus.

    Science.gov (United States)

    Kalia, Nitin Pal; Mahajan, Priya; Mehra, Rukmankesh; Nargotra, Amit; Sharma, Jai Parkash; Koul, Surrinder; Khan, Inshad Ali

    2012-10-01

    To delineate the role of capsaicin (8-methyl-N-vanillyl-6-nonenamide) as an inhibitor of the NorA efflux pump and its impact on invasion of macrophages by Staphylococcus aureus. Capsaicin in combination with ciprofloxacin was tested for activity against S. aureus SA-1199B (NorA overproducing), SA-1199 (wild-type) and SA-K1758 (norA knockout). The role of NorA in the intracellular invasion of S. aureus and the ability of capsaicin to inhibit this invasion was established in J774 macrophage cell lines. The three-dimensional structure of NorA was predicted using an in silico approach and docking studies of capsaicin were performed. Capsaicin significantly reduced the MIC of ciprofloxacin for S. aureus SA-1199 and SA-1199B. Furthermore, capsaicin also extended the post-antibiotic effect of ciprofloxacin by 1.1 h at MIC concentration. There was a decrease in mutation prevention concentration of ciprofloxacin when combined with capsaicin. Inhibition of ethidium bromide efflux by NorA-overproducing S. aureus SA-1199B confirmed the role of capsaicin as a NorA efflux pump inhibitor (EPI). The most significant finding of this study was the ability of capsaicin to reduce the intracellular invasion of S. aureus SA-1199B (NorA overproducing) in J774 macrophage cell lines by 2 log(10). This study, for the first time, has shown that capsaicin, a novel EPI, not only inhibits the NorA efflux pump of S. aureus but also reduces the invasiveness of S. aureus, thereby reducing its virulence.

  14. Homology modeling, molecular dynamics, and virtual screening of NorA efflux pump inhibitors of Staphylococcus aureus.

    Science.gov (United States)

    Bhaskar, Baki Vijaya; Babu, Tirumalasetty Muni Chandra; Reddy, Netala Vasudeva; Rajendra, Wudayagiri

    2016-01-01

    Emerging drug resistance in clinical isolates of Staphylococcus aureus might be implicated to the overexpression of NorA efflux pump which is capable of extruding numerous structurally diverse compounds. However, NorA efflux pump is considered as a potential drug target for the development of efflux pump inhibitors. In the present study, NorA model was constructed based on the crystal structure of glycerol-3-phosphate transporter (PDBID: 1PW4). Molecular dynamics (MD) simulation was performed using NAMD2.7 for NorA which is embedded in the hydrated lipid bilayer. Structural design of NorA unveils amino (N)- and carboxyl (C)-terminal domains which are connected by long cytoplasmic loop. N and C domains are composed of six transmembrane α-helices (TM) which exhibits pseudo-twofold symmetry and possess voluminous substrate binding cavity between TM helices. Molecular docking of reserpine, totarol, ferruginol, salvin, thioxanthene, phenothiazine, omeprazole, verapamil, nalidixic acid, ciprofloxacin, levofloxacin, and acridine to NorA found that all the molecules were bound at the large hydrophobic cleft and indicated significant interactions with the key residues. In addition, structure-based virtual screening was employed which indicates that 14 potent novel lead molecules such as CID58685302, CID58685367, CID5799283, CID5578487, CID60028372, ZINC12196383, ZINC72140751, ZINC72137843, ZINC39227983, ZINC43742707, ZINC12196375, ZINC66166948, ZINC39228014, and ZINC14616160 have highest binding affinity for NorA. These lead molecules displayed considerable pharmacological properties as evidenced by Lipinski rule of five and prophecy of toxicity risk assessment. Thus, the present study will be helpful in designing and synthesis of a novel class of NorA efflux pump inhibitors that restore the susceptibilities of drug compounds.

  15. The Extended Northern ROSAT Galaxy Cluster Survey (NORAS II). I. Survey Construction and First Results

    International Nuclear Information System (INIS)

    Böhringer, Hans; Chon, Gayoung; Trümper, Joachim; Retzlaff, Jörg; Meisenheimer, Klaus; Schartel, Norbert

    2017-01-01

    As the largest, clearly defined building blocks of our universe, galaxy clusters are interesting astrophysical laboratories and important probes for cosmology. X-ray surveys for galaxy clusters provide one of the best ways to characterize the population of galaxy clusters. We provide a description of the construction of the NORAS II galaxy cluster survey based on X-ray data from the northern part of the ROSAT All-Sky Survey. NORAS II extends the NORAS survey down to a flux limit of 1.8 × 10 −12 erg s −1 cm −2 (0.1–2.4 keV), increasing the sample size by about a factor of two. The NORAS II cluster survey now reaches the same quality and depth as its counterpart, the southern REFLEX II survey, allowing us to combine the two complementary surveys. The paper provides information on the determination of the cluster X-ray parameters, the identification process of the X-ray sources, the statistics of the survey, and the construction of the survey selection function, which we provide in numerical format. Currently NORAS II contains 860 clusters with a median redshift of z  = 0.102. We provide a number of statistical functions, including the log N –log S and the X-ray luminosity function and compare these to the results from the complementary REFLEX II survey. Using the NORAS II sample to constrain the cosmological parameters, σ 8 and Ω m , yields results perfectly consistent with those of REFLEX II. Overall, the results show that the two hemisphere samples, NORAS II and REFLEX II, can be combined without problems into an all-sky sample, just excluding the zone of avoidance.

  16. The Extended Northern ROSAT Galaxy Cluster Survey (NORAS II). I. Survey Construction and First Results

    Energy Technology Data Exchange (ETDEWEB)

    Böhringer, Hans; Chon, Gayoung; Trümper, Joachim [Max-Planck-Institut für Extraterrestrische Physik, D-85748 Garching (Germany); Retzlaff, Jörg [ESO, D-85748 Garching (Germany); Meisenheimer, Klaus [Max-Planck-Institut für Astronomy, Königstuhl 17, D-69117 Heidelberg (Germany); Schartel, Norbert [ESAC, Camino Bajo del Castillo, Villanueva de la Cañada, E-28692 Madrid (Spain)

    2017-05-01

    As the largest, clearly defined building blocks of our universe, galaxy clusters are interesting astrophysical laboratories and important probes for cosmology. X-ray surveys for galaxy clusters provide one of the best ways to characterize the population of galaxy clusters. We provide a description of the construction of the NORAS II galaxy cluster survey based on X-ray data from the northern part of the ROSAT All-Sky Survey. NORAS II extends the NORAS survey down to a flux limit of 1.8 × 10{sup −12} erg s{sup −1} cm{sup −2} (0.1–2.4 keV), increasing the sample size by about a factor of two. The NORAS II cluster survey now reaches the same quality and depth as its counterpart, the southern REFLEX II survey, allowing us to combine the two complementary surveys. The paper provides information on the determination of the cluster X-ray parameters, the identification process of the X-ray sources, the statistics of the survey, and the construction of the survey selection function, which we provide in numerical format. Currently NORAS II contains 860 clusters with a median redshift of z  = 0.102. We provide a number of statistical functions, including the log N –log S and the X-ray luminosity function and compare these to the results from the complementary REFLEX II survey. Using the NORAS II sample to constrain the cosmological parameters, σ {sub 8} and Ω{sub m}, yields results perfectly consistent with those of REFLEX II. Overall, the results show that the two hemisphere samples, NORAS II and REFLEX II, can be combined without problems into an all-sky sample, just excluding the zone of avoidance.

  17. Piperine analogs as potent Staphylococcus aureus NorA efflux pump inhibitors

    DEFF Research Database (Denmark)

    Sangwan, Payare L; Koul, Jawahir L; Koul, Surrinder

    2008-01-01

    Based on our recent findings that piperine is a potent Staphylococcus aureus NorA efflux pump inhibitor (EPI), 38 piperine analogs were synthesized and bioevaluated for their EPI activity. Twenty-five of them were found active with potentiating activity equivalent or more than known EPIs like...... reserpine, carsonic acid and verapamil. The inhibitory mechanism of the compounds was confirmed by efflux inhibition assay using ethidium bromide as NorA substrate. The present communication describes the synthesis, bioevaluation and structure related activity of these efflux pump inhibitors....

  18. Formation of a dinitrosyl iron complex by NorA, a nitric oxide-binding di-iron protein from Ralstonia eutropha H16.

    Science.gov (United States)

    Strube, Katja; de Vries, Simon; Cramm, Rainer

    2007-07-13

    In Ralstonia eutropha H16, two genes, norA and norB, form a dicistronic operon that is controlled by the NO-responsive transcriptional regulator NorR. NorB has been identified as a membrane-bound NO reductase, but the physiological function of NorA is unknown. We found that, in a NorA deletion mutant, the promoter activity of the norAB operon was increased 3-fold, indicating that NorA attenuates activation of NorR. NorA shows limited sequence similarity to the oxygen carrier hemerythrin, which contains a di-iron center. Indeed, optical and EPR spectroscopy of purified NorA revealed the presence of a di-iron center, which binds oxygen in a similar way as hemerythrin. Diferrous NorA binds two molecules of NO maximally. Unexpectedly, binding of NO to the diferrous NorA required an external reductant. Two different NorA-NO species could be resolved. A minor species (up to 20%) showed an S = (1/2) EPR signal with g( perpendicular) = 2.041, and g( parallel) = 2.018, typical of a paramagnetic dinitrosyl iron complex. The major species was EPR-silent, showing characteristic signals at 420 nm and 750 nm in the optical spectrum. This species is proposed to represent a novel dinitrosyl iron complex of the form Fe(2+)-[NO](2)(2-), i.e. NO is bound as NO(-). The NO binding capacity of NorA in conjunction with its high cytoplasmic concentration (20 mum) suggests that NorA regulates transcription by lowering the free cytoplasmic concentration of NO.

  19. Analysis of immune-related genes during Nora virus infection of Drosophila melanogaster using next generation sequencing.

    Science.gov (United States)

    Lopez, Wilfredo; Page, Alexis M; Carlson, Darby J; Ericson, Brad L; Cserhati, Matyas F; Guda, Chittibabu; Carlson, Kimberly A

    2018-01-01

    Drosophila melanogaster depends upon the innate immune system to regulate and combat viral infection. This is a complex, yet widely conserved process that involves a number of immune pathways and gene interactions. In addition, expression of genes involved in immunity are differentially regulated as the organism ages. This is particularly true for viruses that demonstrate chronic infection, as is seen with Nora virus. Nora virus is a persistent non-pathogenic virus that replicates in a horizontal manner in D. melanogaster . The genes involved in the regulation of the immune response to Nora virus infection are largely unknown. In addition, the temporal response of immune response genes as a result of infection has not been examined. In this study, D. melanogaster either infected with Nora virus or left uninfected were aged for 2, 10, 20 and 30 days. The RNA from these samples was analyzed by next generation sequencing (NGS) and the resulting immune-related genes evaluated by utilizing both the PANTHER and DAVID databases, as well as comparison to lists of immune related genes and FlyBase. The data demonstrate that Nora virus infected D. melanogaster exhibit an increase in immune related gene expression over time. In addition, at day 30, the data demonstrate that a persistent immune response may occur leading to an upregulation of specific immune response genes. These results demonstrate the utility of NGS in determining the potential immune system genes involved in Nora virus replication, chronic infection and involvement of antiviral pathways.

  20. Significance of normalized residual activity value (Nora) - the new parameter of isotopic renography - for the diagnosis of patients with obstructive uropathy

    International Nuclear Information System (INIS)

    Juszczyk-Gontaszewska, M.; Gontaszewski, W.; Rogowski, F.

    2005-01-01

    The aim of this research was to establish NORA values typical of patients with compensated and uncompensated obstructive uropathy. 147 results of renoscintigraphies carried out after the application of Tc-99m DTPA with furosemide diuretic test were analyzed. The patients were divided into three groups: the group with compensated obstructive uropathy, the group with uncompensated obstructive uropathy, and the controlled group. NORA-1 and NORA-2 values were calculated in each patient, for each kidney separately. It was established that the mean NORA-1 values in the three groups (the controlled group, the compensated uropathy group, and the uncompensated uropathy group) were significantly different, thus enabling differentiation between them. Based on the examination described above, the following conclusions wee drawn: 1. NORA is an effective differentiation index for compensated and uncompensated uropathy. 2. NORA values should be routinely calculated in every case of isotopic diuretic renography. (author)

  1. Nora Tully MacAlvay--Her Life in the Theatre.

    Science.gov (United States)

    Webb, Dorothy

    1996-01-01

    Recounts the life and times of a pioneer children's theater playwright and fiction author, Nora Tully MacAlvay (1900-86). Points out that her interest in children's theater and children's literature was lifelong and intense. (PA)

  2. Differential gene expression related to Nora virus infection of Drosophila melanogaster.

    Science.gov (United States)

    Cordes, Ethan J; Licking-Murray, Kellie D; Carlson, Kimberly A

    2013-08-01

    Nora virus is a recently discovered RNA picorna-like virus that produces a persistent infection in Drosophila melanogaster, but the antiviral pathway or change in gene expression is unknown. We performed cDNA microarray analysis comparing the gene expression profiles of Nora virus infected and uninfected wild-type D. melanogaster. This analysis yielded 58 genes exhibiting a 1.5-fold change or greater and p-value less than 0.01. Of these genes, 46 were up-regulated and 12 down-regulated in response to infection. To validate the microarray results, qRT-PCR was performed with probes for Chorion protein 16 and Troponin C isoform 4, which show good correspondence with cDNA microarray results. Differential regulation of genes associated with Toll and immune-deficient pathways, cytoskeletal development, Janus Kinase-Signal Transducer and Activator of Transcription interactions, and a potential gut-specific innate immune response were found. This genome-wide expression profile of Nora virus infection of D. melanogaster can pinpoint genes of interest for further investigation of antiviral pathways employed, genetic mechanisms, sites of replication, viral persistence, and developmental effects. Copyright © 2013. Published by Elsevier B.V.

  3. Welcoming Nora: A Family Event

    OpenAIRE

    Walsh, Allison J.; Walsh, Paul R.; Walsh, Jane M.; Walsh, Gavin T.

    2011-01-01

    In this column, Allison and Paul Walsh share the story of the birth of Nora, their third baby and their second child to be born at home. Allison and Paul share their individual memories of labor and birth. But their story is only part of the story of Nora’s birth. Nora’s birth was a family event, with Allison and Paul’s other children very much part of the experience. Jane and Gavin share their own memories of their baby sister’s birth.

  4. Virtual screening for novel Staphylococcus Aureus NorA efflux pump inhibitors from natural products.

    Science.gov (United States)

    Thai, Khac-Minh; Ngo, Trieu-Du; Phan, Thien-Vy; Tran, Thanh-Dao; Nguyen, Ngoc-Vinh; Nguyen, Thien-Hai; Le, Minh-Tri

    2015-01-01

    NorA is a member of the Major Facilitator Superfamily (MFS) drug efflux pumps that have been shown to mediate antibiotic resistance in Staphylococcus aureus (SA). In this study, QSAR analysis, virtual screening and molecular docking were implemented in an effort to discover novel SA NorA efflux pump inhibitors. Originally, a set of 47 structurally diverse compounds compiled from the literature was used to develop linear QSAR models and another set of 15 different compounds were chosen for extra validation. The final model which was estimated by statistical values for the full data set (n = 45, Q(2) = 0.80, RMSE = 0.20) and for the external test set (n = 15, R(2) = 0.60, |res|max = 0.75, |res|min = 0.02) was applied on the collection of 182 flavonoides and the traditional Chinese medicine (TCM) database to screen for novel NorA inhibitors. Finally, 33 lead compounds that met the Lipinski's rules of five/three and had good predicted pIC50 values from in silico screening process were employed to analyze the binding ability by docking studies on NorA homology model in place of its unavailable crystal structures at two active sites, the central channel and the Walker B.

  5. Novel inhibitory activity of the Staphylococcus aureus NorA efflux pump by a kaempferol rhamnoside isolated from Persea lingue Nees.

    Science.gov (United States)

    Holler, Jes Gitz; Christensen, S Brøgger; Slotved, Hans-Christian; Rasmussen, Hasse B; Gúzman, Alfonso; Olsen, Carl-Erik; Petersen, Bent; Mølgaard, Per

    2012-05-01

    To isolate a plant-derived compound with efflux inhibitory activity towards the NorA transporter of Staphylococcus aureus. Bioassay-guided isolation was used, with inhibition of ethidium bromide efflux via NorA as a guide. Characterization of activity was carried out using MIC determination and potentiation studies of a fluoroquinolone antibiotic in combination with the isolated compound. Everted membrane vesicles of Escherichia coli cells enriched with NorA were prepared to study efflux inhibitory activity in an isolated manner. The ethanolic extract of Persea lingue was subjected to bioassay-guided fractionation and led to the isolation of the known compound kaempferol-3-O-α-L-(2,4-bis-E-p-coumaroyl)rhamnoside (compound 1). Evaluation of the dose-response relationship of compound 1 showed that ethidium bromide efflux was inhibited, with an IC(50) value of 2 μM. The positive control, reserpine, was found to have an IC(50) value of 9 μM. Compound 1 also inhibited NorA in enriched everted membrane vesicles of E. coli. Potentiation studies revealed that compound 1 at 1.56 mg/L synergistically increased the antimicrobial activity of ciprofloxacin 8-fold against a NorA overexpresser, and the synergistic activity was exerted at a fourth of the concentration necessary for reserpine. Compound 1 was not found to exert a synergistic effect on ciprofloxacin against a norA deletion mutant. The 2,3-coumaroyl isomer of compound 1 has been shown previously not to cause acute toxicity in mice at 20 mg/kg/day. Our results show that compound 1 acts through inhibition of the NorA efflux pump. Combination of compound 1 with subinhibitory concentrations of ciprofloxacin renders a wild-type more susceptible and a NorA overexpresser S. aureus susceptible.

  6. Pharmacophore-Based Repositioning of Approved Drugs as Novel Staphylococcus aureus NorA Efflux Pump Inhibitors.

    Science.gov (United States)

    Astolfi, Andrea; Felicetti, Tommaso; Iraci, Nunzio; Manfroni, Giuseppe; Massari, Serena; Pietrella, Donatella; Tabarrini, Oriana; Kaatz, Glenn W; Barreca, Maria L; Sabatini, Stefano; Cecchetti, Violetta

    2017-02-23

    An intriguing opportunity to address antimicrobial resistance is represented by the inhibition of efflux pumps. Focusing on NorA, the most important efflux pump of Staphylococcus aureus, an efflux pump inhibitors (EPIs) library was used for ligand-based pharmacophore modeling studies. By exploitation of the obtained models, an in silico drug repositioning approach allowed for the identification of novel and potent NorA EPIs.

  7. Inhibition of the NorA multi-drug transporter by oxygenated monoterpenes.

    Science.gov (United States)

    Coêlho, Mayara Ladeira; Ferreira, Josie Haydée Lima; de Siqueira Júnior, José Pinto; Kaatz, Glenn W; Barreto, Humberto Medeiros; de Carvalho Melo Cavalcante, Ana Amélia

    2016-10-01

    The aim of this study was to investigate intrinsic antimicrobial activity of three monoterpenes nerol, dimethyl octanol and estragole, against bacteria and yeast strains, as well as, investigate if these compounds are able to inhibit the NorA efflux pump related to fluoroquinolone resistance in Staphylococcus aureus. Minimal inhibitory concentrations (MICs) of the monoterpenes against Staphylococcus aureus, Escherichia coli and Candida albicans strains were determined by micro-dilution assay. MICs of the norfloxacin against a S. aureus strain overexpressing the NorA protein were determined in the absence or in the presence of the monoterpenes at subinhibitory concentrations, aiming to verify the ability of this compounds act as efflux pump inhibitors. The monoterpenes were inactive against S. aureus however the nerol was active against E. coli and C. albicans. The addition of the compounds to growth media at sub-inhibitory concentrations enhanced the activity of norfloxacin against S. aureus SA1199-B. This result shows that bioactives tested, especially the nerol, are able to inhibit NorA efflux pump indicating a potential use as adjuvants of norfloxacin for therapy of infections caused by multi-drug resistant S. aureus strains. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Novel structural analogues of piperine as inhibitors of the NorA efflux pump of Staphylococcus aureus

    DEFF Research Database (Denmark)

    Kumar, Ashwani; Khan, Inshad Ali; Koul, Surrinder

    2008-01-01

    OBJECTIVES: Evaluation of novel synthetic analogues of piperine as inhibitors of multidrug efflux pump NorA of Staphylococcus aureus. METHODS: A library of piperine-derived compounds was evaluated for their potential to inhibit ethidium bromide efflux in NorA-overexpressing S. aureus SA 1199B...... inhibitors of the NorA efflux pump. These inhibitors acted in a synergistic manner with ciprofloxacin, by substantially increasing its activity against both NorA-overexpressing and wild-type S. aureus isolates. These analogues were 2- to 4-fold more potent than piperine at a significantly lower minimal...... of ciprofloxacin through the inhibition of the NorA efflux pump. These molecules may prove useful in augmenting the antibacterial activities of fluoroquinolones in a clinical setting....

  9. The 95ΔG mutation in the 5'untranslated region of the norA gene increases efflux activity in Staphylococcus epidermidis isolates.

    Science.gov (United States)

    García-Gómez, Elizabeth; Jaso-Vera, Marcos E; Juárez-Verdayes, Marco A; Alcántar-Curiel, María D; Zenteno, Juan C; Betanzos-Cabrera, Gabriel; Peralta, Humberto; Rodríguez-Martínez, Sandra; Cancino-Díaz, Mario E; Jan-Roblero, Janet; Cancino-Diaz, Juan C

    2017-02-01

    In the Staphylococcus aureus ATCC25923 strain, the flqB mutation in the 5'untranslated region (5'UTR) of the norA gene causes increased norA mRNA expression and high efflux activity (HEA). The involvement of the norA gene 5'UTR in HEA has not been explored in S. epidermidis; therefore, we examined the function of this region in S. epidermidis clinical isolates. The selection of isolates with HEA was performed based on ethidium bromide (EtBr) MIC values and efflux efficiency (EF) using the semi-automated fluorometric method. The function of the 5'UTR was studied by quantifying the levels of norA expression (RT-qPCR) and by identifying 5'UTR mutations by sequence analysis. Only 10 isolates from a total of 165 (6.1%) had HEA (EtBr MIC = 300 μg/ml and EF ranged from 48.4 to 97.2%). Eight of 10 isolates with HEA had the 5'UTR 95 Δ G mutation. Isolates carrying the 95 Δ G mutation had higher levels of norA expression compared with those that did not. To corroborate that the 95 Δ G mutation is involved in HEA, a strain adapted to EtBr was obtained in vitro. This strain also presented the 95 Δ G mutation and had a high level of norA expression and EF, indicating that the 95 Δ G mutation is important for the HEA phenotype. The 95 Δ G mutation produces a different structure in the Shine-Dalgarno region, which may promote better translation of norA mRNA. To our knowledge, this is the first report to demonstrate the participation of the 5'UTR 95 Δ G mutation of the norA gene in the HEA phenotype of S. epidermidis isolates. Here, we propose that the efflux of EtBr is caused by an increment in the transcription and/or translation of the norA gene. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Phosphorylation of MgrA and its effect on expression of the NorA and NorB efflux pumps of Staphylococcus aureus.

    Science.gov (United States)

    Truong-Bolduc, Que Chi; Hooper, David C

    2010-05-01

    MgrA is a global regulator in Staphylococcus aureus that controls the expression of diverse genes encoding virulence factors and multidrug resistance (MDR) efflux transporters. We identified pknB, which encodes the (Ser/Thr) kinase PknB, in the S. aureus genome. PknB was able to autophosphorylate as well as phosphorylate purified MgrA. We demonstrated that rsbU, which encodes a Ser/Thr phosphatase and is involved in the activation of the SigB regulon, was able to dephosphorylate MgrA-P but not PknB-P. Serines 110 and 113 of MgrA were found to be phosphorylated, and Ala substitutions at these positions resulted in reductions in the level of phosphorylation of MgrA. DNA gel shift binding assays using norA and norB promoters showed that MgrA-P was able to bind the norB promoter but not the norA promoter, a pattern which was the reverse of that for unphosphorylated MgrA. The double mutant MgrA(S110A-S113A) bound to the norA promoter but not the norB promoter. The double mutant led to a 2-fold decrease in norA transcripts and a 2-fold decrease in the MICs of norfloxacin and ciprofloxacin in strain RN6390. Thus, phosphorylation of MgrA results in loss of binding to the norA promoter, but with a gain of the ability to bind the norB promoter. Loss of the ability to phosphorylate MgrA by Ala substitution resulted in increased repression of norA expression and in reductions in susceptibilities to NorA substrates.

  11. Using Network Oriented Research Assistant (NORA) Technology to Compare Digital Photographic With In-Person Assessment of Acne Vulgaris.

    Science.gov (United States)

    Singer, Hannah M; Almazan, Timothy; Craft, Noah; David, Consuelo V; Eells, Samantha; Erfe, Crisel; Lazzaro, Cynthia; Nguyen, Kathy; Preciado, Katy; Tan, Belinda; Patel, Vishal A

    2018-02-01

    Teledermatology has undergone exponential growth in the past 2 decades. Many technological innovations are becoming available without necessarily undergoing validation studies for specific dermatologic applications. To determine whether patient-taken photographs of acne using Network Oriented Research Assistant (NORA) result in similar lesion counts and Investigator's Global Assessment (IGA) findings compared with in-person examination findings. This pilot reliability study enrolled consecutive patients with acne vulgaris from a single general dermatology practice in Los Angeles, California, who were able to use NORA on an iPhone 6 to take self-photographs. Patients were enrolled from January 1 through March 31, 2016. Each individual underwent in-person and digital evaluation of his or her acne by the same dermatologist. A period of at least 1 week separated the in-person and digital assessments of acne. All participants were trained on how to use NORA on the iPhone 6 and take photographs of their face with the rear-facing camera. Reliability of patient-taken photographs with NORA for acne evaluation compared with in-person examination findings. Acne assessment measures included lesion count (total, inflammatory, noninflammatory, and cystic) and IGA for acne severity. A total of 69 patients (37 male [54%] and 32 female [46%]; mean [SD] age, 22.7 [7.7] years) enrolled in the study. The intraclass correlation coefficients of in-person and photograph-based acne evaluations indicated strong agreement. The intraclass correlation coefficient for total lesion count was 0.81; for the IGA, 0.75. Inflammatory lesion count, noninflammatory lesion count, and cyst count had intraclass correlation coefficients of 0.72, 0.72, and 0.82, respectively. This study found agreement between acne evaluations performed in person and from self-photographs with NORA. As a reliable telehealth technology for acne, NORA can be used as a teledermatology platform for dermatology research and can

  12. Effect of Promoter Region Mutations and mgrA Overexpression on Transcription of norA, Which Encodes a Staphylococcus aureus Multidrug Efflux Transporter

    OpenAIRE

    Kaatz, Glenn W.; Thyagarajan, Rama V.; Seo, Susan M.

    2005-01-01

    NorA is a Staphylococcus aureus multidrug transporter that confers resistance to structurally distinct compounds. The MgrA global regulatory protein is reported to augment norA expression when mgrA is overexpressed from an undefined plasmid-based promoter. Further details about norA regulatory mechanisms are scant. A chromosomal norA::lacZ transcriptional fusion was constructed in different S. aureus strains, and allele replacement was used to define the relevance of promoter region sequences...

  13. Evaluation of expression of NorA efflux pump in ciprofloxacin resistant Staphylococcus aureus against hexahydroquinoline derivative by real-time PCR.

    Science.gov (United States)

    Pourmand, Mohammad Reza; Yousefi, Masoud; Salami, Seyed Alireza; Amini, Mohsen

    2014-01-01

    Staphylococcus aureus causes a wide variety of infections worldwide. Methicillin-resistant S. aureus is one of most common causes of nosocomial and community acquired infections. The fluoroquinolones are an important class of antibiotics that used to treat infections caused by S. aureus. Today, a significant increase in the rate of ciprofloxacin resistance in methicillin-resistant S. aureus strains is concerning. The norA efflux pump is considered as contributors to antibiotic resistance. Here, we aimed to evaluate the expression of norA efflux pump in the presence of hexahydroquinoline derivative in methicillin and ciprofloxacin resistant S. aureus. We were determined minimum inhibitory concentration of ciprofloxacin and hexahydroquinoline derivative and their combination by broth microdilution method against ciprofloxacin resistant S. aureus. The expression of the norA efflux pump gene was evaluated by quantitative Real-time PCR. This study showed that minimum inhibitory concentrations of ciprofloxacin in the presence of hexahydroquinoline derivative in comparison to ciprofloxacin were decreased. Quantitative Real-time PCR identified the increased expression of norA efflux pump gene in methicillin and ciprofloxacin resistant S. aureus strain. The increased expression of norA efflux pump gene may have resulted in the effort of S. aureus to survive. The results showed that the hexahydroquinoline derivative enhanced the antibacterial effect of ciprofloxacin against methicillin and ciprofloxacin resistant S. aureus. Therefore, the derivatives may be used as inhibitors of antibiotic resistance for combination therapy.

  14. Citral derived amides as potent bacterial NorA efflux pump inhibitors

    DEFF Research Database (Denmark)

    Thota, Niranjan; Koul, Surrinder; Reddy, Mallepally V

    2008-01-01

    Monoterpene citral and citronellal have been used as starting material for the preparation of 5,9-dimethyl-deca-2,4,8-trienoic acid amides and 9-formyl-5-methyl-deca-2,4,8-trienoic acid amides. The amides on bioevaluation as efflux pump inhibitors (EPIs) against Staphylococcus aureus 1199 and NorA...

  15. Amino acid amides of piperic acid (PA) and 4-ethylpiperic acid (EPA) as NorA efflux pump inhibitors of Staphylococcus aureus.

    Science.gov (United States)

    Wani, Naiem Ahmad; Singh, Samsher; Farooq, Saleem; Shankar, Sudha; Koul, Surrinder; Khan, Inshad Ali; Rai, Rajkishor

    2016-09-01

    A total of eighteen piperic acid (PA) and 4-ethylpiperic acid (EPA) amides (C1-C18) with α-, β- and γ-amino acids were synthesized, characterized and evaluated for their efflux pump inhibitory activity against ciprofloxacin resistant Staphylococcus aureus. The amides were screened against NorA overexpressing S. aureus SA-1199B and wild type S. aureus SA-1199 using ethidium bromide as NorA efflux pump substrate. EPI C6 was found to be most potent and reduced the MIC of ciprofloxacin by 16 fold followed by C18 which showed 4 fold reduction of MIC. Ethidium bromide efflux inhibition and accumulation assay proved these compounds as NorA inhibitors. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Aminoguanidine hydrazones (AGH's) as modulators of norfloxacin resistance in Staphylococcus aureus that overexpress NorA efflux pump.

    Science.gov (United States)

    Dantas, Natalina; de Aquino, Thiago Mendonça; de Araújo-Júnior, João Xavier; da Silva-Júnior, Edeildo; Gomes, Ednaldo Almeida; Gomes, Antoniel Augusto Severo; Siqueira-Júnior, José Pinto; Mendonça Junior, Francisco Jaime Bezerra

    2018-01-25

    One of the promising fields for improving the effectiveness of antimicrobial agents is their combination with efflux pump inhibitors (EPIs), which besides expanding the use of existing antibiotics. The goal of this research was to evaluate a series of aminoguanidine hydrazones (AGH's, 1-19) as antibacterial agents and NorA efflux pump inhibitors in Staphylococcus aureus strain SA-1199B. Molecular modeling and docking studies were also performed in order to explain at the molecular level the interactions of the compounds with the generated NorA efflux pump model. The MICs of the antibiotic and ethidium bromide were determined by microdilution assay in absence or presence of a subinhibitory concentration of aminoguanidine hydrazones and macrophages viability was determined through MTT assay. Bioinformatic software Swiss-Model and AutoDock 4.2 were used to perform modeling and docking studies, respectively. As results, all AGH's were able to potentiate the action for the antibiotic norfloxacin, causing MIC's reduction of 16-fold and 32-fold to ethidium bromide. In the cell viability test, the concentration of 10 μg/mL showed better results than 90% and the concentration of 1000 μg/mL showed the lowest viability, reaching a maximum of 50% for the analyzed aminoguanidine hydrazones. Molecular docking studies showed that both norfloxacin and derivative 13 were recognized by the same binding site of NorA pump, suggesting a competitive mechanism. The present work demonstrated for the first time that AGH derivatives have potential to be putative inhibitors of NorA efflux pump, showing a promising activity as an antibacterial drug development. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Novel structural analogues of piperine as inhibitors of the NorA efflux pump of Staphylococcus aureus.

    Science.gov (United States)

    Kumar, Ashwani; Khan, Inshad Ali; Koul, Surrinder; Koul, Jawahir Lal; Taneja, Subhash Chandra; Ali, Intzar; Ali, Furqan; Sharma, Sandeep; Mirza, Zahid Mehmood; Kumar, Manoj; Sangwan, Pyare Lal; Gupta, Pankaj; Thota, Niranjan; Qazi, Ghulam Nabi

    2008-06-01

    Evaluation of novel synthetic analogues of piperine as inhibitors of multidrug efflux pump NorA of Staphylococcus aureus. A library of piperine-derived compounds was evaluated for their potential to inhibit ethidium bromide efflux in NorA-overexpressing S. aureus SA 1199B. The active compounds were then individually combined with ciprofloxacin to study the potentiation of ciprofloxacin's activity. Based on the efflux inhibition assay, a library of 200 compounds was screened. Three piperine analogues, namely SK-20, SK-56 and SK-29, were found to be the most potent inhibitors of the NorA efflux pump. These inhibitors acted in a synergistic manner with ciprofloxacin, by substantially increasing its activity against both NorA-overexpressing and wild-type S. aureus isolates. These analogues were 2- to 4-fold more potent than piperine at a significantly lower minimal effective concentration. Furthermore, these inhibitors also significantly suppressed the in vitro emergence of ciprofloxacin-resistant S. aureus. A newly identified class of compounds derived from a natural amide, piperine, is more potent than the parent molecule in potentiating the activity of ciprofloxacin through the inhibition of the NorA efflux pump. These molecules may prove useful in augmenting the antibacterial activities of fluoroquinolones in a clinical setting.

  18. From phenothiazine to 3-phenyl-1,4-benzothiazine derivatives as inhibitors of the Staphylococcus aureus NorA multidrug efflux pump.

    Science.gov (United States)

    Sabatini, Stefano; Kaatz, Glenn W; Rossolini, Gian Maria; Brandini, David; Fravolini, Arnaldo

    2008-07-24

    Overexpression of efflux pumps is an important mechanism by which bacteria evade effects of substrate antimicrobial agents and inhibition of such pumps is a promising strategy to circumvent this resistance mechanism. NorA is a Staphylococcus aureus multidrug efflux pump, the activity of which confers decreased susceptibility to many structurally unrelated agents, including fluoroquinolones, resulting in a multidrug resistant (MDR) phenotype. In this work, a series of 1,4-benzothiazine derivatives were designed and synthesized as a minimized structural template of phenothiazine MDR efflux pump inhibitors (EPIs) in an effort to identify more potent S. aureus NorA EPIs. Almost all derivatives evaluated showed good activity in combination with ciprofloxacin against S. aureus ATCC 25923; some were capable of completely restoring ciprofloxacin activity in a norA-overexpressing strain (SA-K2378). Compounds 6k and 7j displayed good activity against SA-1199B, a strain that also overexpresses norA, in an ethidium bromide (EtBr) efflux inhibition assay.

  19. Drosophila Nora virus capsid proteins differ from those of other picorna-like viruses.

    Science.gov (United States)

    Ekström, Jens-Ola; Habayeb, Mazen S; Srivastava, Vaibhav; Kieselbach, Thomas; Wingsle, Gunnar; Hultmark, Dan

    2011-09-01

    The recently discovered Nora virus from Drosophila melanogaster is a single-stranded RNA virus. Its published genomic sequence encodes a typical picorna-like cassette of replicative enzymes, but no capsid proteins similar to those in other picorna-like viruses. We have now done additional sequencing at the termini of the viral genome, extending it by 455 nucleotides at the 5' end, but no more coding sequence was found. The completeness of the final 12,333-nucleotide sequence was verified by the production of infectious virus from the cloned genome. To identify the capsid proteins, we purified Nora virus particles and analyzed their proteins by mass spectrometry. Our results show that the capsid is built from three major proteins, VP4A, B and C, encoded in the fourth open reading frame of the viral genome. The viral particles also contain traces of a protein from the third open reading frame, VP3. VP4A and B are not closely related to other picorna-like virus capsid proteins in sequence, but may form similar jelly roll folds. VP4C differs from the others and is predicted to have an essentially α-helical conformation. In a related virus, identified from EST database sequences from Nasonia parasitoid wasps, VP4C is encoded in a separate open reading frame, separated from VP4A and B by a frame-shift. This opens a possibility that VP4C is produced in non-equimolar quantities. Altogether, our results suggest that the Nora virus capsid has a different protein organization compared to the order Picornavirales. Copyright © 2011 Elsevier B.V. All rights reserved.

  20. NORA project offers unique reactor research and advanced training opportunities

    International Nuclear Information System (INIS)

    1961-01-01

    An international program for reactor research and advanced training for a period of three years has been established in connection with the Norwegian critical assembly NORA. The aim of the project is to determine, through integral experiments, the basic reactor physics data for lattices moderated with light-water, heavy-water or mixtures of heavy and light water, with fuels of different sizes and spacing, three different enrichments and compositions. The objectives, programme, and facilities are described in details

  1. Quantitative structure activity relationship (QSAR) of piperine analogs for bacterial NorA efflux pump inhibitors.

    Science.gov (United States)

    Nargotra, Amit; Sharma, Sujata; Koul, Jawahir Lal; Sangwan, Pyare Lal; Khan, Inshad Ali; Kumar, Ashwani; Taneja, Subhash Chander; Koul, Surrinder

    2009-10-01

    Quantitative structure activity relationship (QSAR) analysis of piperine analogs as inhibitors of efflux pump NorA from Staphylococcus aureus has been performed in order to obtain a highly accurate model enabling prediction of inhibition of S. aureus NorA of new chemical entities from natural sources as well as synthetic ones. Algorithm based on genetic function approximation method of variable selection in Cerius2 was used to generate the model. Among several types of descriptors viz., topological, spatial, thermodynamic, information content and E-state indices that were considered in generating the QSAR model, three descriptors such as partial negative surface area of the compounds, area of the molecular shadow in the XZ plane and heat of formation of the molecules resulted in a statistically significant model with r(2)=0.962 and cross-validation parameter q(2)=0.917. The validation of the QSAR models was done by cross-validation, leave-25%-out and external test set prediction. The theoretical approach indicates that the increase in the exposed partial negative surface area increases the inhibitory activity of the compound against NorA whereas the area of the molecular shadow in the XZ plane is inversely proportional to the inhibitory activity. This model also explains the relationship of the heat of formation of the compound with the inhibitory activity. The model is not only able to predict the activity of new compounds but also explains the important regions in the molecules in quantitative manner.

  2. 1-(1H-indol-3-yl)ethanamine derivatives as potent Staphylococcus aureus NorA efflux pump inhibitors.

    Science.gov (United States)

    Hequet, Arnaud; Burchak, Olga N; Jeanty, Matthieu; Guinchard, Xavier; Le Pihive, Emmanuelle; Maigre, Laure; Bouhours, Pascale; Schneider, Dominique; Maurin, Max; Paris, Jean-Marc; Denis, Jean-Noël; Jolivalt, Claude

    2014-07-01

    The synthesis of 37 1-(1H-indol-3-yl)ethanamine derivatives, including 12 new compounds, was achieved through a series of simple and efficient chemical modifications. These indole derivatives displayed modest or no intrinsic anti-staphylococcal activity. By contrast, several of the compounds restored, in a concentration-dependent manner, the antibacterial activity of ciprofloxacin against Staphylococcus aureus strains that were resistant to fluoroquinolones due to overexpression of the NorA efflux pump. Structure-activity relationships studies revealed that the indolic aldonitrones halogenated at position 5 of the indole core were the most efficient inhibitors of the S. aureus NorA efflux pump. Among the compounds, (Z)-N-benzylidene-2-(tert-butoxycarbonylamino)-1-(5-iodo-1H-indol-3-yl)ethanamine oxide led to a fourfold decrease of the ciprofloxacin minimum inhibitory concentration against the SA-1199B strain when used at a concentration of 0.5 mg L(-1) . To the best of our knowledge, this activity is the highest reported to date for an indolic NorA inhibitor. In addition, a new antibacterial compound, tert-butyl (2-(3-hydroxyureido)-2-(1H-indol-3-yl)ethyl)carbamate, which is not toxic for human cells, was also found. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Detecting the Presence of Nora Virus in "Drosophila" Utilizing Single Fly RT-PCR

    Science.gov (United States)

    Munn, Bethany; Ericson, Brad; Carlson, Darby J.; Carlson, Kimberly A.

    2015-01-01

    A single fly RT-PCR protocol has recently been developed to detect the presence of the persistent, horizontally transmitted Nora virus in "Drosophila." Wild-caught flies from Ohio were tested for the presence of the virus, with nearly one-fifth testing positive. The investigation presented can serve as an ideal project for biology…

  4. Is the societal burden of fatal occupational injury different among NORA industry sectors?

    Science.gov (United States)

    Biddle, Elyce Anne

    2013-02-01

    Since the implementation of the Occupational Safety and Health Act, safety and health in the work environment has seen marked improvement. Although these improvements are laudable, workplace hazards continue to plague the American worker. Understanding the economic burden of fatalities by industry sector is important to setting broad occupational safety and health research priorities. Cost estimates provide additional information about how fatal injuries affect society and hence can improve injury prevention program planning, policy analysis, evaluation, and advocacy. This study estimated the total, mean, and median societal costs by worker and case characteristic in 2003-2006 for the industry sectors identified in the National Institute for Occupational Safety and Health National Occupational Research Agenda (NORA). Analyses were conducted with restricted access to the Bureau of Labor Statistics Census of Fatal Occupational Injuries data. These data exclude military personnel, decedents with unknown age or sex, and fatalities occurring in New York City. Societal costs were estimated using the cost-of-illness approach, which combines direct and indirect costs to yield an overall cost of an fatal occupational injury. During this period, the cost of the 22,197 fatal occupational injuries exceeded $21 billion. The mean and median costs of these fatalities were $960,000 and $944,000 respectively. Total societal costs by NORA sector ranged from a high of $5.8 billion in Services to a low of $530 million in Healthcare and Social Assistance with mean costs ranging from the nearly $800,000 in Agriculture, Forestry, and Fishing to almost $1.1 million in Mining. The societal costs-total, mean, and median costs-of case and worker characteristics for occupational fatal injuries varied within each NORA sector. To have the greatest societal impact, these costs can be used to target resources for public and private sector research by industry. Published by Elsevier Ltd.

  5. Is the Societal burden of fatal occupational injury different among NORA industry sectors?

    Science.gov (United States)

    Biddle, Elyce Anne

    2015-01-01

    Problem Since the implementation of the Occupational Safety and Health Act, safety and health in the work environment has seen marked improvement. Although these improvements are laudable, workplace hazards continue to plague the American worker. Understanding the economic burden of fatalities by industry sector is important to setting broad occupational safety and health research priorities. Cost estimates provide additional information about how fatal injuries affect society and hence can improve injury prevention program planning, policy analysis, evaluation, and advocacy. Method This study estimated the total, mean, and median societal costs by worker and case characteristic in 2003–2006 for the industry sectors identified in the National Institute for Occupational Safety and Health National Occupational Research Agenda (NORA). Analyses were conducted with restricted access to the Bureau of Labor Statistics Census of Fatal Occupational Injuries data. These data exclude military personnel, decedents with unknown age or sex, and fatalities occurring in New York City. Societal costs were estimated using the cost-of-illness approach, which combines direct and indirect costs to yield an overall cost of an fatal occupational injury. Results During this period, the cost of the 22,197 fatal occupational injuries exceeded $21 billion. The mean and median costs of these fatalities were $960,000 and $944,000 respectively. Total societal costs by NORA sector ranged from a high of $5.8 billion in Services to a low of $530 million in Healthcare and Social Assistance with mean costs ranging from the nearly $800,000 in Agriculture, Forestry, and Fishing to almost $1.1 million in Mining. Discussion The societal costs—total, mean, and median costs—of case and worker characteristics for occupational fatal injuries varied within each NORA sector. Impact on Industry To have the greatest societal impact, these costs can be used to target resources for public and private sector

  6. Inhibition of the NorA efflux pump of Staphylococcus aureus by synthetic riparins.

    Science.gov (United States)

    Costa, L M; de Macedo, E V; Oliveira, F A A; Ferreira, J H L; Gutierrez, S J C; Peláez, W J; Lima, F C A; de Siqueira Júnior, J P; Coutinho, H D M; Kaatz, G W; de Freitas, R M; Barreto, H M

    2016-11-01

    The goal of this study was to increase knowledge about the antimicrobial activity of some synthetic Riparin-derived compounds, alone or in combination with fluoroquinolone antibiotics, against a strain of Staphylococcus aureus resistant to fluoroquinolone by way of overexpression of the NorA efflux pump. Microdilution tests showed that Riparins A and B did not show any significant antibacterial activity against Staph. aureus strains. On the other hand, the intrinsic antibacterial activity increased with increasing lipophilicity of the compounds, in the following order: Riparin-D (MIC 256 μg ml -1 ; Log P 2·95) NorA-overexpressing test strain. Riparin-B, which has two methoxyl groups at the phenethyl moiety, showed the best modulatory effect. Riparin-E is a good anti-staphylococci agent, while Riparin-B functions as a NorA efflux pump inhibitor. Our data suggest the possibility of using Riparin-B in combination with norfloxacin or ciprofloxacin for therapy of infections caused by multi-drug resistant Staph. aureus. © 2016 The Society for Applied Microbiology.

  7. Robert Wood Johnson Foundation

    Science.gov (United States)

    Robert Wood Johnson Foundation Search How We Work Our Focus Areas About RWJF Search Menu How We Work Grants ... Learn more For Grantees and Grantseekers The Robert Wood Johnson Foundation funds a wide array of programs ...

  8. Chalcone inhibitors of the NorA efflux pump in Staphylococcus aureus whole cells and enriched everted membrane vesicles.

    Science.gov (United States)

    Holler, Jes Gitz; Slotved, Hans-Christian; Mølgaard, Per; Olsen, Carl Erik; Christensen, Søren Brøgger

    2012-07-15

    A library of 117 chalcones was screened for efflux pump inhibitory (EPI) activity against NorA mediated ethidium bromide efflux. Five of the chalcones (5-7, 9, and 10) were active and two chalcones (9 and 10) were equipotent to reserpine with IC(50)-values of 9.0 and 7.7 μM, respectively. Twenty chalcones were subsequently proved to be inhibitors of the NorA efflux pump in everted membrane vesicles. Compounds 5, 7, and 9 synergistically increased the effect of ciprofloxacin on Staphylococcus aureus. Our results suggest that chalcones might be developed into drugs for overcoming multidrug resistance based on efflux transporters of microorganisms. Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. A New Natural Product Analog of Blasticidin S Reveals Cellular Uptake Facilitated by the NorA Multidrug Transporter.

    Science.gov (United States)

    Davison, Jack R; Lohith, Katheryn M; Wang, Xiaoning; Bobyk, Kostyantyn; Mandadapu, Sivakoteswara R; Lee, Su-Lin; Cencic, Regina; Nelson, Justin; Simpkins, Scott; Frank, Karen M; Pelletier, Jerry; Myers, Chad L; Piotrowski, Jeff; Smith, Harold E; Bewley, Carole A

    2017-06-01

    The permeation of antibiotics through bacterial membranes to their target site is a crucial determinant of drug activity but in many cases remains poorly understood. During screening efforts to discover new broad-spectrum antibiotic compounds from marine sponge samples, we identified a new analog of the peptidyl nucleoside antibiotic blasticidin S that exhibited up to 16-fold-improved potency against a range of laboratory and clinical bacterial strains which we named P10. Whole-genome sequencing of laboratory-evolved strains of Staphylococcus aureus resistant to blasticidin S and P10, combined with genome-wide assessment of the fitness of barcoded Escherichia coli knockout strains in the presence of the antibiotics, revealed that restriction of cellular access was a key feature in the development of resistance to this class of drug. In particular, the gene encoding the well-characterized multidrug efflux pump NorA was found to be mutated in 69% of all S. aureus isolates resistant to blasticidin S or P10. Unexpectedly, resistance was associated with inactivation of norA , suggesting that the NorA transporter facilitates cellular entry of peptidyl nucleosides in addition to its known role in the efflux of diverse compounds, including fluoroquinolone antibiotics. Copyright © 2017 American Society for Microbiology.

  10. Measurements of Void Effects in the Zero-Power Critical Facility NORA; Mesures de l'Effet Cavitaire dans l'Ensemble Critique NORA de Puissance Zero; Izmerenie vliyaniya pustot v kriticheskoj ustanovke nulevoj moshchnosti NORA; DeterminaciOn de los Efectos de CavitaciOn en el Conjunto Critico NORA de Potencia Nula

    Energy Technology Data Exchange (ETDEWEB)

    Bryhn-Ingebrigtsen, K.; Eriksen, V. O.; Schatvet, J.; Ukkestad, A.; Wood, J. I.; Ofjord, K. [Kjeller Research Establishment (Norway)

    1964-02-15

    Reactivity effects of voids in a reactor core is of particular importance in boiling-water reactors. Non-uniform distributions of voids make it desirable to know and understand the spatial dependence of the void reactivity effect. An experimental study of void effects under physically clean conditions has been undertaken in NORA. Shrouds surrounding each individual fuel stringer define annular regions which are voided by introduction of air under pressure. For single-rod experiments reactivity effects are so small that it is preferable to oscillate the void volume periodically and analyse the corresponding modulation of power to obtain reactivity equivalents. Multiple-rod experiments are done statically. The experimental technique is described together with examples of its use to measure single-rod void effects, voided rod interactions, and full-voided core effects. (author) [French] L'effet cavitaire revet une importance particuliere dans les reacteurs a eau bouillante. Etant donne que les cavites ne sont pas uniformement reparties, il est souhaitable de connaitre et de comprendre les variations de l'effet cavitaire dans l'espace. L'etude experimentale de l'effet cavitaire dans un ensemble non empoisonne a ete entreprise dans l'ensemble critique NORA. Dans les regions tubulaires comprises entre les barres de combustible et leurs enveloppes, on cree des cavites par injection d'air comprime. Dans les experiences portant sur une seule barre, l'effet est si faible qu'il vaut mieux faire varier periodiquement le volume cavitaire et analyser la modulation de puissance correspondante pour mesurer la reactivite equivalente. Les experiences sur plusieurs barres sont faites dans des conditions statiques. Les auteurs decrivent la methode experimentale et donnent des exemples de son emploi pour mesurer l'effet cavitaire pour une seule barre, l'interaction de battes autour desquelles on a cree des cavites et l'effet des cavites creees dans tout le coeur. (author) [Spanish] La

  11. Optimized efflux assay for the NorA multidrug efflux pump in Staphylococcus aureus.

    Science.gov (United States)

    Zimmermann, Saskia; Tuchscherr, Lorena; Rödel, Jürgen; Löffler, Bettina; Bohnert, Jürgen A

    2017-11-01

    Real-time fluorescent efflux assays are commonly used for measuring the efflux of bacterial pumps. Here we describe an optimized protocol for the NorA efflux pump in S. aureus using DiOC 3 instead of ethidium bromide. Glucose and sodium formate were tested as energy carriers. This novel method is fast and reproducible. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. C2 Arylated Benzo[b]thiophene Derivatives as Staphylococcus aureus NorA Efflux Pump Inhibitors.

    Science.gov (United States)

    Liger, François; Bouhours, Pascale; Ganem-Elbaz, Carine; Jolivalt, Claude; Pellet-Rostaing, Stéphane; Popowycz, Florence; Paris, Jean-Marc; Lemaire, Marc

    2016-02-04

    An innovative and straightforward synthesis of second-generation 2-arylbenzo[b]thiophenes as structural analogues of INF55 and the first generation of our laboratory-made molecules was developed. The synthesis of C2-arylated benzo[b]thiophene derivatives was achieved through a method involving direct arylation, followed by simple structural modifications. Among the 34 compounds tested, two of them were potent NorA pump inhibitors, which led to a 16-fold decrease in the ciprofloxacin minimum inhibitory concentration (MIC) against the SA-1199B strain at concentrations of 0.25 and 0.5 μg mL(-1) (1 and 1.5 μm, respectively). This is a promising result relative to that obtained for reserpine (MIC=20 μg mL(-1)), a reference compound amongst NorA pump inhibitors. These molecules thus represent promising candidates to be used in combination with ciprofloxacin against fluoroquinolone-resistant strains. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Re-evolution of the 2-phenylquinolines: ligand-based design, synthesis, and biological evaluation of a potent new class of Staphylococcus aureus NorA efflux pump inhibitors to combat antimicrobial resistance.

    Science.gov (United States)

    Sabatini, Stefano; Gosetto, Francesca; Iraci, Nunzio; Barreca, Maria Letizia; Massari, Serena; Sancineto, Luca; Manfroni, Giuseppe; Tabarrini, Oriana; Dimovska, Mirjana; Kaatz, Glenn W; Cecchetti, Violetta

    2013-06-27

    Overexpression of efflux pumps is an important mechanism by which bacteria evade the effects of antimicrobial agents that are substrates. NorA is a Staphylococcus aureus efflux pump that confers reduced susceptibility to many structurally unrelated agents, including fluoroquinolones, biocides, and dyes, resulting in a multidrug resistant (MDR) phenotype. In this work, a series of 2-phenylquinoline derivatives was designed by means of ligand-based pharmacophore modeling in an attempt to identify improved S. aureus NorA efflux pump inhibitors (EPIs). Most of the 2-phenylquinoline derivatives displayed potent EPI activity against the norA overexpressing strain SA-1199B. The antibacterial activity of ciprofloxacin, when used in combination with some of the synthesized compounds, was completely restored in SA-1199B and SA-K2378, a strain overexpressing norA from a multicopy plasmid. Compounds 3m and 3q also showed potent synergistic activity with the ethidium bromide dye in a strain overexpressing the MepA MDR efflux pump.

  14. Studies on 2-phenylquinoline Staphylococcus aureus NorA efflux pump inhibitors: New insights on the C-6 position.

    Science.gov (United States)

    Felicetti, Tommaso; Cannalire, Rolando; Nizi, Maria Giulia; Tabarrini, Oriana; Massari, Serena; Barreca, Maria Letizia; Manfroni, Giuseppe; Schindler, Bryan D; Cecchetti, Violetta; Kaatz, Glenn W; Sabatini, Stefano

    2018-06-06

    The alarming and rapid spread of antimicrobial resistance among bacteria represents a high risk for global health. Targeting factors involved in resistance to restore the activity of failing antibiotics is a promising strategy to overcome this urgent medical need. Efflux pump inhibitors are able to increase antibiotic concentrations in bacteria, thus they can be considered true antimicrobial resistance breakers. In this work, continuing our studies on inhibitors of the Staphylococcus aureus NorA pump, we designed, synthesized and biologically evaluated novel 2-phenylquinoline derivatives starting from our hits 1 and 2. Two of the synthesized compounds (6 and 7) bearing a C-6 benzyloxy group showed the best NorA inhibition activity, thereby providing an excellent starting point to direct future chemical optimizations. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  15. Evolution from a natural flavones nucleus to obtain 2-(4-Propoxyphenyl)quinoline derivatives as potent inhibitors of the S. aureus NorA efflux pump.

    Science.gov (United States)

    Sabatini, Stefano; Gosetto, Francesca; Manfroni, Giuseppe; Tabarrini, Oriana; Kaatz, Glenn W; Patel, Diixa; Cecchetti, Violetta

    2011-08-25

    Overexpression of efflux pumps is an important mechanism by which bacteria evade the effects of substrate antimicrobial agents. Inhibition of such pumps is a promising strategy to circumvent this resistance mechanism. NorA is a Staphylococcus aureus efflux pump that confers reduced susceptibility to many structurally unrelated agents, including fluoroquinolones, resulting in a multidrug resistant phenotype. In this work, a series of 2-phenyl-4(1H)-quinolone and 2-phenyl-4-hydroxyquinoline derivatives, obtained by modifying the flavone nucleus of known efflux pump inhibitors (EPIs), were synthesized in an effort to identify more potent S. aureus NorA EPIs. The 2-phenyl-4-hydroxyquinoline derivatives 28f and 29f display potent EPI activity against SA-1199B, a strain that overexpresses norA, in an ethidium bromide efflux inhibition assay. The same compounds, in combination with ciprofloxacin, were able to completely restore its antibacterial activity against both S. aureus SA-K2378 and SA-1199B, norA-overexpressing strains. © 2011 American Chemical Society

  16. Nora Virus Transmission in "Drosophila Melanogaster": An Investigation to Teach Viral Infection and Prophylaxis to Biology Students

    Science.gov (United States)

    Weatherred, Wayland; Carlson, Darby J.; Carlson, Kimberly A.

    2014-01-01

    Proper hand hygiene accompanied with environmental surface disinfection provides a comprehensive approach to control and prevent respiratory and gastrointestinal illness in schools, hospitals, work environments, and the home. The persistent non-pathogenic Nora virus common in "Drosophila melanogaster" provides a horizontally transmitted…

  17. Searching for Novel Inhibitors of the S. aureus NorA Efflux Pump: Synthesis and Biological Evaluation of the 3-Phenyl-1,4-benzothiazine Analogues.

    Science.gov (United States)

    Felicetti, Tommaso; Cannalire, Rolando; Burali, Maria Sole; Massari, Serena; Manfroni, Giuseppe; Barreca, Maria Letizia; Tabarrini, Oriana; Schindler, Bryan D; Sabatini, Stefano; Kaatz, Glenn W; Cecchetti, Violetta

    2017-08-22

    Bacterial resistance to antimicrobial agents has become an increasingly serious health problem in recent years. Among the strategies by which resistance can be achieved, overexpression of efflux pumps such as NorA of Staphylococcus aureus leads to a sub-lethal concentration of the antibacterial agent at the active site that in turn may predispose the organism to the development of high-level target-based resistance. With an aim to improve both the chemical stability and potency of our previously reported 3-phenyl-1,4-benzothiazine NorA inhibitors, we replaced the benzothiazine core with different nuclei. None of the new synthesized compounds showed any appreciable intrinsic antibacterial activity, and, in particular, 2-(3,4-dimethoxyphenyl)quinoline (6 c) was able to decrease, in a concentration-dependent manner, the ciprofloxacin MIC against the norA-overexpressing strains S. aureus SA-K2378 (norA++) and SA-1199B (norA+/A116E GrlA). © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Robert's rules of order

    CERN Document Server

    Robert, Henry M; Balch, Thomas J; Seabold, Daniel E; Gerber, Shmuel

    2011-01-01

    The only authorized edition of the classic work on parliamentary procedure, with new and enhanced features, including how to conduct electronic meetings. Robert's Rules of Order is the book on parliamentary procedure for parliamentarians and anyone involved in an organization, association, club, or group and the authoritative guide to smooth, orderly, and fairly conducted meetings and assemblies. This newly revised edition is the only book on parliamentary procedure to have been updated since 1876 under the continuing program of review established by General Henry M. Robert himself, in cooperation with the official publisher of Robert's Rules. The eleventh edition has been thoroughly revised to address common inquiries and incorporate new rules, interpretations, and procedures made necessary by the evolution of parliamentary procedure, including new material relating to electronic communication and "electronic meetings."

  19. Robert Cailliau honoured by Belgium

    CERN Multimedia

    2004-01-01

    On 15 November, Robert Cailliau received the distinction of Commandeur de l'Ordre de Léopold from Belgium, his home country, for his pioneering work in developing the World Wide Web. Robert Cailliau worked closely with Tim Berners-Lee, the inventor of the Web.

  20. First identification of boronic species as novel potential inhibitors of the Staphylococcus aureus NorA efflux pump.

    Science.gov (United States)

    Fontaine, Fanny; Hequet, Arnaud; Voisin-Chiret, Anne-Sophie; Bouillon, Alexandre; Lesnard, Aurélien; Cresteil, Thierry; Jolivalt, Claude; Rault, Sylvain

    2014-03-27

    Overexpression of efflux pumps is an important mechanism of bacterial resistance that results in the extrusion of antimicrobial agents outside the bacterial cell. Inhibition of such pumps appears to be a promising strategy that could restore the potency of existing antibiotics. The NorA efflux pump of Staphylococcus aureus confers resistance to a wide range of unrelated substrates, such as hydrophilic fluoroquinolones, leading to a multidrug-resistance phenotype. In this work, approximately 150 heterocyclic boronic species were evaluated for their activity against susceptible and resistant strains of S. aureus. Twenty-four hit compounds, although inactive when tested alone, were found to potentiate ciprofloxacin activity by a 4-fold increase at concentrations ranging from 0.5 to 8 μg/mL against S. aureus 1199B, which overexpresses NorA. Boron-free analogues showed no biological activity, thus revealing that the boron atom is crucial for biological activity. This work describes the first reported efflux pump inhibitory activity of boronic acid derivatives.

  1. The Elusive Search for Nora Luca: Tony Gatlif's Adventures in Gypsy Land

    OpenAIRE

    Sylvie Eve Blum-Reid

    2005-01-01

    This essay examines Gypsy filmmaker Tony Gatlif and his 1997 film Gadjo Dilo (The Crazy Foreigner). The film ventures on the icy roads of Romania and casts a young French man in search for Nora Luca’s voice, a woman taped by his musicologist father. The young man is adopted by a Romanian Gypsy community and initiated to Gypsy culture. The film reverts stereotypes associated to Gypsies and questions the place of the white traveler in late 20th century Europe. Questions of otherness and exotici...

  2. Machine learning-, rule- and pharmacophore-based classification on the inhibition of P-glycoprotein and NorA.

    Science.gov (United States)

    Ngo, T-D; Tran, T-D; Le, M-T; Thai, K-M

    2016-09-01

    The efflux pumps P-glycoprotein (P-gp) in humans and NorA in Staphylococcus aureus are of great interest for medicinal chemists because of their important roles in multidrug resistance (MDR). The high polyspecificity as well as the unavailability of high-resolution X-ray crystal structures of these transmembrane proteins lead us to combining ligand-based approaches, which in the case of this study were machine learning, perceptual mapping and pharmacophore modelling. For P-gp inhibitory activity, individual models were developed using different machine learning algorithms and subsequently combined into an ensemble model which showed a good discrimination between inhibitors and noninhibitors (acctrain-diverse = 84%; accinternal-test = 92% and accexternal-test = 100%). For ligand promiscuity between P-gp and NorA, perceptual maps and pharmacophore models were generated for the detection of rules and features. Based on these in silico tools, hit compounds for reversing MDR were discovered from the in-house and DrugBank databases through virtual screening in an attempt to restore drug sensitivity in cancer cells and bacteria.

  3. The "racemic approach" in the evaluation of the enantiomeric NorA efflux pump inhibition activity of 2-phenylquinoline derivatives.

    Science.gov (United States)

    Carotti, Andrea; Ianni, Federica; Sabatini, Stefano; Di Michele, Alessandro; Sardella, Roccaldo; Kaatz, Glenn W; Lindner, Wolfgang; Cecchetti, Violetta; Natalini, Benedetto

    2016-09-10

    Among the mechanisms adopted by bacteria, efflux pumps (EPs) have been recognized as being significantly involved in contributing to resistance to commonly used antibacterial agents. However, little is known about their three-dimensional structures or the steric requirements for their inhibition. Lack of such knowledge includes NorA, one of the most studied Staphylococcus aureus EPs. In the present study, the use of two commercialized Cinchona alkaloid-based zwitterionic chiral stationary phases allowed the enantioseparation of four 2-((2-(4-propoxyphenyl)quinolin-4-yl)oxy)alkylamines 1-4 previously found to be potent S. aureus NorA efflux pump inhibitors when tested as racemates. In the identified optimal polar-ionic conditions (MeOH/THF/H2O-49/49/2 (v/v/v)+25mM formic acid, 12.5mM diethylamine), repeated consecutive injections of 1 allowed the isolation of sufficient amount of its enantiomers (2.6mg and 2.8mg, for (R)-1 and (S)-1, respectively) and then to evaluate their ability to inhibit the S. aureus NorA efflux pump. The biological evaluation highlighted the main contribution of the (R)-1 enantiomer to both the EtBr efflux inhibition and synergistic effect with against SA-1199B (norA+/A116E GrlA) respect to the racemate activity. The comparison between the experimental electronic circular dichroism and the time-dependent density functional theory calculations spectra of the two isolated enantiomeric fractions allowed for all compounds a clear and easy assignment of the enantiomeric elution order. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. The Transformations of the Central Area of Nora: the Reconstruction of the Houses

    Directory of Open Access Journals (Sweden)

    Elena Belgiovine

    2013-11-01

    Full Text Available La ricostruzione tridimensionale delle abitazioni presenti nel Quartiere Centrale della città di Nora è stata elaborata mediante l’uso del software Revit Architecture ed è stata concepita per mostrare le trasformazioni avvenute nell’area durante le fasi di II-III secolo d.C. e in età tardo antica. I modelli tridimensionali delle singole abitazioni, che si basano sulla documentazione di scavo, sono confluiti in un progetto di ricostruzione dell’intero isolato, in modo da ricrearne l’aspetto volumetrico e rendere immediatamente percepibili i vari aspetti di questo articolato contesto urbano.

  5. Robert Aumann

    DEFF Research Database (Denmark)

    Hansen, Pelle Guldborg

    2007-01-01

    In this interview Nobel Prize Winner Robert Aumann talks about how he was initially drawn into game theory, when he came to think of formalizing the folk-theorem, the proper role of game theory in relation to other disciplines and why behavioral game theory probably won't last long.......In this interview Nobel Prize Winner Robert Aumann talks about how he was initially drawn into game theory, when he came to think of formalizing the folk-theorem, the proper role of game theory in relation to other disciplines and why behavioral game theory probably won't last long....

  6. Éloge to Robert Fox

    Directory of Open Access Journals (Sweden)

    Efthymios Nicolaidis

    2017-12-01

    Full Text Available The 20th Alexandre Koyré Medal awarded since 1968 to prominent historians of science was awarded to Robert Fox, leading historian of European science of the period from the 18th to the beginnings of the 20th century. The Medal was presented to Robert Fox during the 7th International Conference of the European Society for the History of Science, Prague, 23 September 2016, and the Éloge describes his career and work.

  7. Robert W Floyd

    Indian Academy of Sciences (India)

    scientists - Zohar Manna, an authority on the verification of software systems, Robert. Tarjan ... He began as a self taught computer operator, and then went ... important subfields of computer science: the theory of parsing, the semantics of.

  8. Robert Oppenheimer

    International Nuclear Information System (INIS)

    Rival, M.

    1995-01-01

    Graduate from Harvard, reputed professor, founder of the first theoretical physics high school of the Usa, Robert Oppenheimer is nominated in 1942 scientific director of the ''Y project'', the research program for the nuclear weapon fabrication. This book describes its life and the evolution of the Los Alamos researches up to the first test, its opposition to the thermo-nuclear weapon, and the maccarthysm period. (A.B.)

  9. Dithiazole thione derivative as competitive NorA efflux pump inhibitor to curtail multi drug resistant clinical isolate of MRSA in a zebrafish infection model.

    Science.gov (United States)

    Lowrence, Rene Christena; Raman, Thiagarajan; Makala, Himesh V; Ulaganathan, Venkatasubramanian; Subramaniapillai, Selva Ganesan; Kuppuswamy, Ashok Ayyappa; Mani, Anisha; Chittoor Neelakantan, Sundaresan; Nagarajan, Saisubramanian

    2016-11-01

    Multi drug resistant (MDR) pathogens pose a serious threat to public health since they can easily render most potent drugs ineffective. Efflux pump inhibitors (EPI) can be used to counter the MDR phenotypes arising due to increased efflux. In the present study, a series of dithiazole thione derivatives were synthesized and checked for its antibacterial and efflux pump inhibitory (EPI) activity. Among 10 dithiazole thione derivatives, real-time efflux studies revealed that seven compounds were potent EPIs relative to CCCP. Zebrafish toxicity studies identified four non-toxic putative EPIs. Both DTT3 and DTT9 perturbed membrane potential and DTT6 was haemolytic. Among DTT6 and DTT10, the latter was less toxic as evidenced by histopathology studies. Since DTT10 was non-haemolytic, did not affect the membrane potential, and was least toxic, it was chosen further for in vivo study, wherein DTT10 potentiated effect of ciprofloxacin against clinical strain of MRSA and reduced bacterial burden in muscle and skin tissue of infected zebrafish by ~ 1.7 and 2.5 log fold respectively. Gene expression profiling of major efflux transport proteins by qPCR revealed that clinical isolate of MRSA, in the absence of antibiotic, upregulated NorA, NorB and MepA pump, whereas it downregulates NorC and MgrA relative to wild-type strain of Staphylococcus aureus. In vitro studies with NorA mutant strains and substrate profiling revealed that at higher concentrations DTT10 is likely to function as a competitive inhibitor of NorA efflux protein in S. aureus, whereas at lower concentrations it might inhibit ciprofloxacin efflux through NorB and MepA as implied by docking studies. A novel non-toxic, non-haemolytic dithiazole thione derivative (DTT10) was identified as a potent competitive inhibitor of NorA efflux pump in S. aureus using in silico, in vitro and in vivo studies. This study also underscores the importance of using zebrafish infection model to screen and evaluate putative EPI for

  10. Measurement of reactor parameters of the 'Nora' reactor by noise analysis method - power spectral density

    International Nuclear Information System (INIS)

    Jovanovic, S.; Stormark, E.

    1966-01-01

    Measurements of reactor parameters the Nora reactor by Power Spectral Density (PSD) method are described. In case of critical reactor this method was applied for direct measurement of β/l ratio, β is the effective yield of delayed neutrons and l is the neutron lifetime. In case of subcritical reactor values of α+β-ρ/l were measured, ρ is the negative reactivity. Out coming PSD was measured by a filter or by ISAC. PSD was registered by ISAC as well as the auto-correlation function [sr

  11. Boronic species as promising inhibitors of the Staphylococcus aureus NorA efflux pump: study of 6-substituted pyridine-3-boronic acid derivatives.

    Science.gov (United States)

    Fontaine, Fanny; Héquet, Arnaud; Voisin-Chiret, Anne-Sophie; Bouillon, Alexandre; Lesnard, Aurélien; Cresteil, Thierry; Jolivalt, Claude; Rault, Sylvain

    2015-05-05

    In response to the extensive use of antibiotics, bacteria have evolved numerous mechanisms of defense against antimicrobial agents. Among them, extrusion of the antimicrobial agents outside the bacterial cell through efflux pumps is a major cause of concern. At first limited to one or few structurally-related antibiotics, bacterial resistance have then progressed towards cross-resistance between different classes of antibiotics, leading to multidrug-resistant microorganisms. Emergence of these pathogens requires development of novel therapeutic strategies and inhibition of efflux pumps appears to be a promising strategy that could restore the potency of existing antibiotics. NorA is the most studied chromosomal efflux pump of Staphylococcus aureus; it is known to be implied in resistance of Methicillin-resistant S. aureus (MRSA) strains against a wide range of unrelated substrates, including hydrophilic fluoroquinolones. Starting from 6-benzyloxypyridine-3-boronic acid I that we previously identified as a potential inhibitor of the NorA efflux pump against the NorA-overexpressing S. aureus 1199B strain (SA1199B), we describe here the synthesis and biological evaluation of a series of 6-(aryl)alkoxypyridine-3-boronic acids. 6-(3-Phenylpropoxy)pyridine-3-boronic acid 3i and 6-(4-phenylbutoxy)pyridine-3-boronic acid 3j were found to potentiate ciprofloxacin activity by a 4-fold increase compared to the parent compound I. In addition, it has been shown that both compounds promote Ethidium Bromide (EtBr) accumulation in SA1199B, thus corroborating their potential mode of action as NorA inhibitors. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  12. THE DEMOKTESIS OF ROBERT NOZICK A DEMOKTESIS DE ROBERT NOZICK

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Netto de Andrade e Silva Sahd

    2008-04-01

    Full Text Available the present article aims at reconstructing Robert Nozick’s cen-tral arguments about the extreme positions held by North American li-bertarians who do not distinguish between Welfare state and totalitarian state. Despite divergences on a pivotal question, that of the state, there are some affinities between Nozick and this current of thought. Contrary to the anarchist theory, the Minimal state is preferable to the state of nature as described by John locke.O presente artigo tem como objetivo reconstruir argumentos cen-trais, desenvolvidos por Robert Nozick, acerca das posições extremas que não diferenciam Estado-providência e Estado totalitário na política dos libertarianos norte-americanos, isto é, sobre as afinidades percebidas por Nozick com as teses desta corrente de pensamento, embora se afastando num ponto essencial: a questão do Estado. Ao contrário da teoria anar-quista, o Estado mínimo é preferível ao estado de natureza, tal como John locke o descreve.

  13. Non-antibiotic agent ginsenoside 20(S)-Rh2 enhanced the antibacterial effects of ciprofloxacin in vitro and in vivo as a potential NorA inhibitor.

    Science.gov (United States)

    Zhang, Jingwei; Sun, Yuan; Wang, Yaoyao; Lu, Meng; He, Jichao; Liu, Jiali; Chen, Qianying; Zhang, Xiaoxuan; Zhou, Fang; Wang, Guangji; Sun, Xianqiang

    2014-10-05

    The aim of this study is to explore the potential enhancing effect of ginsenoside 20(S)-Rh2 (Rh2) towards ciprofloxacin (CIP) against Staphylococcus aureus (S. aureus) infection in vitro and in vivo, and analyze the possible mechanisms through NorA inhibition from a target cellular pharmacokinetic view. In combination with non-toxic dosage of Rh2, the susceptibilities of S. aureus strains to CIP were significantly augmented, and the antibacterial kinetics of CIP in the S. aureus strains were markedly promoted. This enhancing effect of Rh2 towards CIP was also observed in S. aureus infected peritonitis mice, with elevated survival rate and reduced bacteria counts in blood. However, Rh2 did not influence the plasma concentrations of CIP. Further analysis indicated that Rh2 significantly promoted the accumulations of CIP in S. aureus, and inhibited the NorA mediated efflux of pyronin Y. The expressions of NorA gene on S. aureus were positively correlated with the enhancing effect of Rh2 with CIP. This is the first report of the enhancing effect of Rh2 with CIP for S. aureus infection in vitro and in vivo, of which it is probably that Rh2 inhibited NorA-mediated efflux and promoted the accumulation of CIP in the bacteria. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Robert Adrian X / Robert Adrian X ; interv. Tilman Baumgärtel

    Index Scriptorium Estoniae

    Adrian X, Robert

    2006-01-01

    1997. a. Ljubljanas tehtud intervjuu 1972. aastast Viinis elava kanada kunstniku Robert Adrian X-ga (sünd. 1935), kes töötas 1970-ndate lõpul ja 1980-ndate alguses telefoni, faksi ja varaste kirjakstisüsteemidega kunstiprojektide kallal, osales 1970-ndate ja 1980-ndate multimeediaprojektides

  15. Introduction to special issue: Robert Jay Kastenbaum (1932-2013).

    Science.gov (United States)

    Fulton, Robert; Klass, Dennis; Doka, Kenneth J; Kastenbaum, Beatrice

    The three pieces in this section introduce the Festschrift celebrating the works and influence of Omega: Journal of Death and Dying's founding editor, Robert Kastenbaum. Robert Fulton, an early Associate Editor of the Journal begins with some personal reflections on Kastenbaum. Klass and Doka then describe the nature of the Festschrift. A closing coda by Robert Kastenbaum's wife, Beatrice Kastenbaum, reminds us of the person behind the work.

  16. Attaching NorA efflux pump inhibitors to methylene blue enhances antimicrobial photodynamic inactivation of Escherichia coli and Acinetobacter baumannii in vitro and in vivo.

    Science.gov (United States)

    Rineh, Ardeshir; Bremner, John B; Hamblin, Michael R; Ball, Anthony R; Tegos, George P; Kelso, Michael J

    2018-02-24

    Resistance of bacteria to antibiotics is a public health concern worldwide due to the increasing failure of standard antibiotic therapies. Antimicrobial photodynamic inactivation (aPDI) is a promising non-antibiotic alternative for treating localized bacterial infections that uses non-toxic photosensitizers and harmless visible light to produce reactive oxygen species and kill microbes. Phenothiazinium photosensitizers like methylene blue (MB) and toluidine blue O are hydrophobic cations that are naturally expelled from bacterial cells by multidrug efflux pumps, which reduces their effectiveness. We recently reported the discovery of a NorA efflux pump inhibitor-methylene blue (EPI-MB) hybrid compound INF55-(Ac)en-MB that shows enhanced photodynamic inactivation of the Gram-positive bacterium methicillin-resistant Staphylococcus aureus (MRSA) relative to MB, both in vitro and in vivo. Here, we report the surprising observation that INF55-(Ac)en-MB and two related hybrids bearing the NorA efflux pump inhibitors INF55 and INF271 also show enhanced aPDI activity in vitro (relative to MB) against the Gram-negative bacteria Escherichia coli and Acinetobacter baumannii, despite neither species expressing the NorA pump. Two of the hybrids showed superior effects to MB in murine aPDI infection models. The findings motivate wider exploration of aPDI with EPI-MB hybrids against Gram-negative pathogens and more detailed studies into the molecular mechanisms underpinning their activity. Copyright © 2018 Elsevier Ltd. All rights reserved.

  17. Robert Smithsoni ülevaade

    Index Scriptorium Estoniae

    1999-01-01

    Ameerika maakunstniku Robert Smithsoni (1938-1973) retrospektiivnäitus 12. sept.-ni Stockholmi Moodsa Kunsti Muuseumis. Kunstnikule maailmakuulsuse toonud tööst, 1970. a. Utah' osariigi Suurde Soolajärve ehitatud spiraalmuulist "Spiral Jetty".

  18. Improved Potency of Indole-Based NorA Efflux Pump Inhibitors: From Serendipity toward Rational Design and Development.

    Science.gov (United States)

    Buonerba, Federica; Lepri, Susan; Goracci, Laura; Schindler, Bryan D; Seo, Susan M; Kaatz, Glenn W; Cruciani, Gabriele

    2017-01-12

    The NorA efflux pump is a potential drug target for reversal of resistance to selected antibacterial agents, and recently we described indole-based inhibitor candidates. Herein we report a second class of inhibitors derived from them but with significant differences in shape and size. In particular, compounds 13 and 14 are very potent inhibitors in that they demonstrated the lowest IC 50 values (2 μM) ever observed among all indole-based compounds we have evaluated.

  19. Synergistic effects of baicalein with ciprofloxacin against NorA over-expressed methicillin-resistant Staphylococcus aureus (MRSA) and inhibition of MRSA pyruvate kinase.

    Science.gov (United States)

    Chan, Ben C L; Ip, Margaret; Lau, Clara B S; Lui, S L; Jolivalt, Claude; Ganem-Elbaz, Carine; Litaudon, Marc; Reiner, Neil E; Gong, Huansheng; See, Raymond H; Fung, K P; Leung, P C

    2011-09-01

    Baicalein, the active constituent derived from Scutellaria baicalensis Georgi., has previously been shown to significantly restore the effectiveness of β-lactam antibiotics and tetracycline against methicillin-resistant Staphylococcus aureus (MRSA). With multiple therapeutic benefits, the antibacterial actions of baicalein may also be involved in overcoming other bacterial resistance mechanisms. The aim of the present study was to further investigate antibacterial activities of baicalein in association with various antibiotics against selected Staphylococcus aureus strains with known specific drug resistance mechanisms. A panel of clinical MRSA strains was used for further confirmation of the antibacterial activities of baicalein. The effect of baicalein on inhibiting the enzymatic activity of a newly discovered MRSA-specific pyruvate kinase (PK), which is essential for Staphylococcus aureus growth and survival was also examined. In the checkerboard dilution test and time-kill assay, baicalein at 16 μg/ml could synergistically restore the antibacterial actions of ciprofloxacin against the NorA efflux pump overexpressed SA-1199B, but not with the poor NorA substrate, pefloxacin. Moreover, synergistic effects were observed when baicalein was combined with ciprofloxacin against 12 out of 20 clinical ciprofloxacin resistant strains. For MRSA PK studies, baicalein alone could inhibit the enzymatic activity of MRSA PK in a dose-dependent manner. Our results demonstrated that baicalein could significantly reverse the ciprofloxacin resistance of MRSA possibly by inhibiting the NorA efflux pump in vitro. The inhibition of MRSA PK by baicalein could lead to a deficiency of ATP which might further contribute to the antibacterial actions of baicalein against MRSA. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  20. Radiographic Assessment of the Robert and Lateral Views in Trapeziometacarpal Osteoarthrosis.

    Science.gov (United States)

    Oheb, Jonathan; Lansinger, Yuri; Jansen, Joshua A; Nguyen, Jimmy Q; Porembski, Margaret A; Rayan, Ghazi M

    2015-01-01

    To evaluate the effectiveness of the Robert view in assessing trapeziometacarpal arthrosis and to compare the accuracy of the Robert and lateral views in staging trapeziometacarpal (TM) joint arthrosis. Patient demographics were obtained. Four participating raters reviewed 62 randomly selected thumb x-rays of patients presenting with thumb TM joint pain. Lateral and Robert-hyperpronation views were assessed using an analysis of 13 criteria. X-rays of 62 thumbs for 58 patients were evaluated. The average patients' age was 64 (47-87) and 51 (80%) were females. The majority of X-rays evaluated fell into stage 3. Stage 2 was the second most common level of arthritis encountered and the least was stage 1. More osteophytes were encountered in the trapezium than metacarpal on both the Robert and lateral views. The Robert view was superior in detecting osteophytes on the trapezium than the lateral view. Osteophyte size varied from 1.7 to 2 mm. The lateral view displayed 61 cases with dorsal metacarpal subluxation (98%). The Robert view displayed 48 cases (77%) with radial metacarpal subluxation and 9 cases (15%) with ulnar metacarpal subluxation. Thumb metacarpal adduction deformity was encountered on the lateral view in 20 cases (32%) whereas on the Robert view it was encountered in 14 cases (23%). Subchondral sclerosis was encountered on the Robert view in 56 thumbs (90%) while it was seen on the lateral view in 52 thumbs (84%). Pantrapezial arthritis involving the STT joint was encountered equally in 16 cases (26%) on the Robert view and the lateral views. The study found a moderate level of interrater reliability on both the lateral and Robert views. With the exception of osteophytes encountered on the trapezium versus the metacarpal, there were no other statistically significant findings. This study confirms that each of the Robert and lateral views offer unique information and combining both views enhances the ability to assess radiographic disease severity, and

  1. An Architecture for the Electronic Church: Oral Roberts University in Tulsa, Oklahoma.

    Science.gov (United States)

    Grubiak, Margaret M

    2016-04-01

    More than a university, Oral Roberts University in Tulsa, Oklahoma, was also the headquarters for evangelist Oral Roberts's electronic church. The electronic church in America, dominated by Christian evangelicals, used technology to spread the Gospel over radio airways and television signals to a dispersed audience. Yet evangelicals like Roberts also constructed ambitious campuses in real space and time. The architecture of Oral Roberts University visualized a modern and "populuxe" image for the electronic church in the 1960s and 1970s. The university's Prayer Tower purposely alluded to the Seattle Space Needle, aligning religion and the Space Age, and the campus's white, gold, and black color palette on late modern buildings created an image of aspirational luxury, conveying Roberts's health and wealth gospel. Oral Roberts University served as a sound stage for Roberts's radio and television shows, a pilgrimage point for his audience, and a university dedicated to training evangelicals in the electronic church.

  2. Lahkunud maailmaparandaja Robert Lepikson jäi igavesti otsijaks / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2006-01-01

    Ülevaade riigikogu liikme, endise siseministri, Tallinna linnapea ja Võru maavanema Robert Lepiksoni elukäigust, meenutused tuntud ühiskonnategelastelt. Lisad: Robert Lepikson; Kõva sõnaga mees. Vt. samas: Turvavaatleja vastutusrikas töö viimasel rallil; Ivar Raidam: Lepiksoni panus autosporti oli tohutu; Hans H. Luik: Respect, Robert!

  3. 76 FR 48898 - Robert Leigh Kale, M.D., Decision and Order

    Science.gov (United States)

    2011-08-09

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration Robert Leigh Kale, M.D., Decision and Order... Enforcement Administration, issued an Order to Show Cause to Robert Leigh Kale, M.D. (Registrant), of Fort... Certificate of Registration, BK9514375, issued to Robert Leigh Kale, M.D., be, and it hereby is, revoked. I...

  4. Two intercultural performances: Double Nora and Resurrection Day

    Directory of Open Access Journals (Sweden)

    Mitsuya Mori

    2015-02-01

    Full Text Available I have so far directed two plays of Ibsen as the intercultural performance, that is, the collaboration of the modern theatre with noh, a traditional Japanese theatre, which was established as an artistic theatre form in the 14th century. The first production was Double Nora, based on A Doll’s House, which premiered at a noh theatre in Tokyo in 2005, and the second was Resurrection Day, based on When We Dead Awaken, performed at the Ibsen Festival in Tokyo in 2010. In both productions, professional noh and modern theatre actors appeared together in their own acting styles. At the Ibsen Conference in Tromsø in June 2012, brief scenes of the two productions were shown. But here in the present article the performances are partly described, and the interactive relationship between different acting styles of noh and modern theatre is examined. A new and difficult experiment of Resurrection Day was to try a conversation between the main noh actor and the modern actress. The experiment was possible because the performance took place not on a noh stage in a unique form but on an ordinary stage in a modern theatre. Thus, some problems involved in the intercultural performance of Ibsen are investigated.

  5. Genetics Home Reference: Roberts syndrome

    Science.gov (United States)

    ... feet are located very close to the body (phocomelia). People with Roberts syndrome may also have abnormal ... may live into adulthood. A condition called SC phocomelia syndrome was originally thought to be distinct from ...

  6. Tetra-amelia and splenogonadal fusion in Roberts syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Ravel, T.J.L. de; Seftel, M.D.; Wright, C.A. [Univ. of the Witwatersrand, Johannesburg (South Africa)

    1997-01-20

    Roberts-SC phocomelia syndrome comprises limb deficiencies of variable severity, facial clefts, and other anomalies. Tetra-amelia may also be associated with facial clefts and similar anomalies. We report on a female infant with severe tetra-amelia, micrognathia, cleft palate, splenogonadal fusion, and premature centromere separation. We propose that this represents the severe expression of the Roberts-SC phocomelia syndrome. 18 refs., 6 figs.

  7. Robert Lepiksoni maailm / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-

    2000-01-01

    Näitus "Minu maailm. Robert Lepikson fotograafina ja kollektsionäärina" galeriis "Vaal". Väljas on loodusfotod, fotod autodest, kunstikogust Eduard Steinbergi (1937) ja Vladimir Nemuhhini (1925) maalid, paar Salvador Dali värvilist litograafiat

  8. Remembering Robert Seydel

    Directory of Open Access Journals (Sweden)

    Lauren van Haaften­-Schick

    2011-06-01

    Full Text Available This January, while preparing a new course, Robert Seydel was struck and killed by an unexpected heart attack. He was a critically under-appreciated artist and one of the most beloved and admired professors at Hampshire College.At the time of his passing, Seydel was on the brink of a major artistic and career milestone. His Book of Ruth was being prepared for publication by Siglio Press. His publisher describes the book as: “an alchemical assemblage that composes the life of his alter ego, Ruth Greisman— spinster, Sunday painter, and friend to Joseph Cornell and Marcel Duchamp. Through collages, drawings, and journal entries from Ruth’s imagined life, Seydel invokes her interior world in novelistic rhythms.”This convergence of his professional triumph with the tragedy of his death makes now a particularly appropriate time to think about Robert Seydel and his work. This feature contains a selection of excerpts from Book of Ruth (courtesy of Siglio Press alongside a pair of texts remembering him and giving critical and biographical insights into his art and his person. These texts, from a former student and a colleague respectively, were originally prepared for Seydel's memorial at Hampshire College and have since been revised for publication in continent.

  9. Roberts 22: a bipolar nebula with OH emission

    International Nuclear Information System (INIS)

    Allen, D.A.; Hyland, A.R.; Caswell, J.L.

    1980-01-01

    Roberts 22 is a bipolar reflection nebula illuminated by a hidden A2 Ie star. Most of its energy is radiated at infrared wavelengths. It also shows strong OH maser emission (OH 284.18 - 0.79) on the 1612 and 1665 MHz transitions, generally similar to the masers associated with M stars having infrared excesses. But the system contains no late-type star. This remarkable assemblage of attributes makes Roberts 22 unique; however, it is probably a key member of the newly-recognized population of bipolar nebulae. From an analysis of the properties of Roberts 22 some published interpretations of other bipolar nebulae are questioned, in particular the derivation of spectral types for their underlying stars by the assumption of photo-ionization of the gas, and their evolutionary description as proto-planetary nebulae. (author)

  10. Magnetohydrodynamics and the earth's core selected works by Paul Roberts

    CERN Document Server

    Soward, Andrew M

    2003-01-01

    Paul Roberts'' research contributions are remarkable in their diversity, depth and international appeal. Papers from the Paul Roberts'' Anniversary meeting at the University of Exeter are presented in this volume. Topics include geomagnetism and dynamos, fluid mechanics and MHD, superfluidity, mixed phase regions, mean field electrodynamics and the Earth''s inner core. An incisive commentary of the papers puts the work of Paul Roberts into historical context. Magnetohydrodynamics and the Earth''s Core provides a valuable source of reference for graduates and researchers working in this area of geoscience.

  11. [Roberts-SC phocomelia syndrome].

    Science.gov (United States)

    Musfeld, D A; Bühler, E M; Heinzl, S

    2001-01-01

    The Roberts-SC phocomelia syndrome is a rare autosomal recessive inherited disorder clinically manifested by tetraphocomelia, pre- and postnatal growth retardation, and craniofacial abnormalities (skull, eyes, lip, and palate), accompanied at times by centromer puffing and splitting, renal abnormalities, heart defect, clitoral or penile enlargement, and bilateral corneal opacities. Mental retardation is common in surviving patients.

  12. Max Weber and Robert Michels.

    Science.gov (United States)

    Scaff, Lawrence A.

    1981-01-01

    This paper investigates the unique intellectual partnership of Max Weber and Robert Michels, with particular emphasis on Weber's influence on Michel's inquiry into the sociology of parties and organization. Concludes with an evaluation of the import of Weber's critique of Michels' work. (DB)

  13. Patterns of practice of regional nodal irradiation in breast cancer: results of the European Organization for Research and Treatment of Cancer (EORTC) NOdal Radiotherapy (NORA) survey

    NARCIS (Netherlands)

    Belkacemi, Y.; Kaidar-Person, O.; Poortmans, P.; Ozsahin, M.; Valli, M.-C.; Russell, N.; Kunkler, I.; Hermans, J.; Kuten, A.; van Tienhoven, G.; Westenberg, H.

    2015-01-01

    Predicting outcome of breast cancer (BC) patients based on sentinel lymph node (SLN) status without axillary lymph node dissection (ALND) is an area of uncertainty. It influences the decision-making for regional nodal irradiation (RNI). The aim of the NORA (NOdal RAdiotherapy) survey was to examine

  14. Steven Hawking with Robert Aymar

    CERN Multimedia

    Maximilien Brice

    2006-01-01

    Steven Hawking is seen meeting with CERN's Director-General, Robert Aymar. Hawking visited CERN between 24 September and 1 October 2006. During his stay he gave two lectures and toured the LHC, which may provide insights into Hawking's most famous area of study, black holes.

  15. Anthony ROBERTS 5 March 1948 – 16 January 2008

    CERN Multimedia

    TS Department

    2008-01-01

    We deeply regret to announce the death of Mr Anthony ROBERTS on 16 January 2008. Mr ROBERTS, born on 05.03.1948, worked in the HR Department and had been employed at CERN since 01.06.1973. The Director-General has sent his family a message of condolence on behalf of the CERN staff. Social Affairs Service Human Resources Department

  16. The inauguration of Robert-Bourassa Park at James Bay

    International Nuclear Information System (INIS)

    Valiquette, M.

    1997-01-01

    Robert Bourassa's contributions to the hydroelectric development at James Bay were acknowledged with the inauguration of a park in the ex-prime minister's name. Phase 1 of the James Bay hydroelectric project constituted the world's biggest construction site, employing more than 180,000 people from beginning to project completion. The James Bay project allowed Hydro-Quebec to gain one of the world's largest electric power utilities and to gain significant competitive edge over its competitors. The Robert Bourassa Park contains a picnic area and a visitor interpretation centre which describes the history of the project. A sequence of 5 signposts summarize the contributions that Robert Bourassa made to the megaproject which cost over $20.6 billion. The complex consists of 65 turbines which produce 15,235 megawatts of electricity. 1 fig

  17. Conferencias a la Memoria de la Dra. Lydia J. Roberts 1967, 1969-1973 (Conferences in Memory of Dr. Lydia J. Roberts 1967, 1969-1973).

    Science.gov (United States)

    Puerto Rico Univ., Rio Piedras.

    This publication includes eleven lectures presented as part of a conference given honoring Dr. Lydia J. Roberts. Seven of the papers are written in the English language and four in Spanish. Most of the papers relate to the topic of nutrition, but a few pay tribute to Dr. Roberts in recognition of her distinguished leadership and teacher of human…

  18. Robert Wilson's Invitation to Insanity.

    Science.gov (United States)

    Stephens, Judith L.

    The plays of stage director Robert Wilson are devices presenting alternative modes of perception to theatre audiences accustomed to verbal/aural structures of experience. Uniting his interests in the arts and therapy, his plays create a theatrical event promoting empathy with the perceptions of the mentally or physically handicapped and…

  19. Double trisomy (48,XXX,+18) with features of Roberts syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Descartes, M.; Longshore, J.W.; Crawford, E. [Univ. of Alabama, Birmingham, AL (United States)] [and others

    1994-09-01

    We report an infant with double trisomy 48,XXX,+18, who also displayed features of Roberts syndrome. All previously published cases with similar double trisomy have presented with features of trisomy 18 syndrome. The chromosome analysis done at birth revealed the double trisomy; parental chromosomes were normal. The proband presented with microbrachycephaly, unilateral cleft lip and palate, choanal atresia, midfacial capillary hemanioma, thin nares, shallow orbits, malformed ears, sparse hair, hypomelia of the upper limbs, rocker-bottom feet, auricular septal defect and agenesis of the corpus callosum. Characteristic features of Roberts syndrome included hypomelia, midfacial defects, and severe growth deficiency. Among the many different features reported in the literature for patients with trisomy 18 syndrome, the most consistent were growth deficiency, clenched fingers and congenital heart defects (e.g. VSD, ASD, PDA). Although some of our patient`s features such as cleft lip and cleft palate, low-set malformed ears, ASD, defects of the corpus callosum, choanal atresia, radial aplasia could also be seen in trisomy 18 syndrome (in 10-50% of the cases), her phenotype was more typical of Roberts syndrome because of symmetrical hypomelia and midfacial defects. Our patient`s chromosomes did not show premature separation of centromeric heterochromatin, a feature reported to occur in approximately one-half of individuals with Roberts syndrome. Sporadic aneuploidy involving different chromosomes has been found in lymphocyte cultures from some Roberts syndrome patients and is considered by some authors as a mitotic mutant. This aneuploidy is most likely to be chromosome gain. The simultaneous occurrence of trisomy X and 18 is extremely rare with only 11 cases having been reported in the literature. Our patient is unique since she has the double trisomy in addition to the characteristic features of Roberts syndrome.

  20. Robert Nemiroff: Communicating Astronomy 365 Days a Year

    Science.gov (United States)

    Pullen, L.; Russo, P.

    2010-06-01

    Few astronomy communication projects are as well known or as widely disseminated as the Astronomy Picture of the Day (or APOD for short). Since its creation in 1995, it has popularised thousands of images and helped to explain the cosmos through informative captions. Impressively, the site shows no signs of slowing down and has amassed many loyal supporters. This success can be attributed to the two astronomers behind the project: Robert Nemiroff and Jerry Bonnell. CAPjournal has interviewed Robert to discover his view of APOD, and the lesser known issues that surround it.

  1. The Timeless Legacy of Robert Koch

    Indian Academy of Sciences (India)

    Robert Koch was a German physician and scientist who made wide-ranging .... methods of bacterial staining so that bacteria could be visualized more easily and .... of whom became outstanding scientists in their own right, such as Friedrich.

  2. Leaving Libertarianism: : Social Ties in Robert Nozick's New Philosophy

    OpenAIRE

    Herbjørnsrud, Dag

    2002-01-01

    SUMMARY This thesis Leaving Libertarianism: Social Ties in Robert Nozick s New Philosophy challenges the general and most widespread portrayals of the American philosopher Robert Nozick (1938-2002) by studying the notion of social ties in his later philosophy. The point of departure is the present descriptions of Nozick s philosophy. Mostly these depictions are based upon three postulates: That Nozick is an extreme individualist, that the libertarian Anarchy, State, and Utopia (1...

  3. Tomographic and analog 3-D simulations using NORA. [Non-Overlapping Redundant Image Array formed by multiple pinholes

    Science.gov (United States)

    Yin, L. I.; Trombka, J. I.; Bielefeld, M. J.; Seltzer, S. M.

    1984-01-01

    The results of two computer simulations demonstrate the feasibility of using the nonoverlapping redundant array (NORA) to form three-dimensional images of objects with X-rays. Pinholes admit the X-rays to nonoverlapping points on a detector. The object is reconstructed in the analog mode by optical correlation and in the digital mode by tomographic computations. Trials were run with a stick-figure pyramid and extended objects with out-of-focus backgrounds. Substitution of spherical optical lenses for the pinholes increased the light transmission sufficiently that objects could be easily viewed in a dark room. Out-of-focus aberrations in tomographic reconstruction could be eliminated using Chang's (1976) algorithm.

  4. Boeravinone B, A Novel Dual Inhibitor of NorA Bacterial Efflux Pump of Staphylococcus aureus and Human P-Glycoprotein, Reduces the Biofilm Formation and Intracellular Invasion of Bacteria.

    Science.gov (United States)

    Singh, Samsher; Kalia, Nitin P; Joshi, Prashant; Kumar, Ajay; Sharma, Parduman R; Kumar, Ashok; Bharate, Sandip B; Khan, Inshad A

    2017-01-01

    This study elucidated the role of boeravinone B, a NorA multidrug efflux pump inhibitor, in biofilm inhibition. The effects of boeravinone B plus ciprofloxacin, a NorA substrate, were evaluated in NorA-overexpressing, wild-type, and knocked-out Staphylococcus aureus (SA-1199B, SA-1199, and SA-K1758, respectively). The mechanism of action was confirmed using the ethidium bromide accumulation and efflux assay. The role of boeravinone B as a human P -glycoprotein ( P -gp) inhibitor was examined in the LS-180 (colon cancer) cell line. Moreover, its role in the inhibition of biofilm formation and intracellular invasion of S. aureus in macrophages was studied. Boeravinone B reduced the minimum inhibitory concentration (MIC) of ciprofloxacin against S. aureus and its methicillin-resistant strains; the effect was stronger in SA-1199B. Furthermore, time-kill kinetics revealed that boeravinone B plus ciprofloxacin, at subinhibitory concentration (0.25 × MIC), is as equipotent as that at the MIC level. This combination also had a reduced mutation prevention concentration. Boeravinone B reduced the efflux of ethidium bromide and increased the accumulation, thus strengthening the role as a NorA inhibitor. Biofilm formation was reduced by four-eightfold of the minimal biofilm inhibitory concentration of ciprofloxacin, effectively preventing bacterial entry into macrophages. Boeravinone B effectively inhibited P -gp with half maximal inhibitory concentration (IC 50 ) of 64.85 μM. The study concluded that boeravinone B not only inhibits the NorA-mediated efflux of fluoroquinolones but also considerably inhibits the biofilm formation of S. aureus. Its P -gp inhibition activity demonstrates its potential as a bioavailability and bioefficacy enhancer.

  5. Roberts syndrome: clinical and cytogenetic aspects

    OpenAIRE

    Mann, N P; Fitzsimmons, J; Fitzsimmons, E; Cooke, P

    1982-01-01

    Roberts syndrome is reported in two sibs of consanguineous parents. Both infants had severe tetraphocomelia, facial clefting, and other serious malformations. In addition they were found to have an unusual cytogenetic abnormality with distortion of the normal sister chromatid relationship in many chromosomes.

  6. Arvo Pärt: Kui kannatab üks inimene, siis kannatab kogu maailm! / Arvo Pärt, Nora Pärt ; intervjueerinud Yana Toom, Maarja-Liis Arujärv, Aleksandr Zukerman ; kommenteerinud Edgar Savisaar

    Index Scriptorium Estoniae

    Pärt, Arvo, 1935-

    2010-01-01

    Arvo Pärt ja tema abikaasa Nora Pärt andsid Türgis enne Pärdi uudisteose "Aadama itk" esiettekannet intervjuu, kus rääkisid nii nende raskustest Läände elama asumisel kui uudisteose sügavamast mõttest

  7. The Timeless Legacy of Robert Koch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 9. The Timeless Legacy of Robert Koch - Founder of Medical Microbiology. Jaya S Tyagi. General Article Volume 11 Issue 9 September 2006 pp 20-28. Fulltext. Click here to view fulltext PDF. Permanent link:

  8. The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1961-06-22

    The text of the Supply Agreement between the Agency and the Governments of Norway and of the United States of America, and the text of the related Project Agreement between the Agency and the Government of Norway concerning an Agency project for cooperation in carrying out a joint program of research in reactor physics with the zero power reactor 'NORA', are reproduced in this document for the information of all Members of the Agency.

  9. The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'

    International Nuclear Information System (INIS)

    1961-01-01

    The text of the Supply Agreement between the Agency and the Governments of Norway and of the United States of America, and the text of the related Project Agreement between the Agency and the Government of Norway concerning an Agency project for cooperation in carrying out a joint program of research in reactor physics with the zero power reactor 'NORA', are reproduced in this document for the information of all Members of the Agency

  10. Intrapartum diagnostic of Roberts syndrome - case presentation.

    Science.gov (United States)

    Socolov, Răzvan Vladimir; Andreescu, Nicoleta Ioana; Haliciu, Ana Maria; Gorduza, Eusebiu Vlad; Dumitrache, Florentin; Balan, Raluca Anca; Puiu, Maria; Dobrescu, Mihaela Amelia; Socolov, Demetra Gabriela

    2015-01-01

    Roberts syndrome is a rare disease, with multiple limb and skeletal abnormalities (called "pseudothalidomide disease"). There are only around 150 cases described in literature. We present a case of Roberts syndrome, diagnosed in moment of delivery, after a pregnancy without prenatal follow-up. The stillborn baby was naturally delivered by a 17-year-old primiparous woman at 38 weeks of amenorrhea. The pregnancy was not followed due to socioeconomic and family situation, and no prenatal ultrasound was performed. The male baby has 2650 g and presented several morphological abnormalities and tight double umbilical abdominal loop. The macroscopic evaluation showed: dolichocephaly, hypoplastic inferior maxilla with micrognathia, antimongoloid palpebral slant, pterygium colli, abnormal and lower implanted ears, superior limbs phocomelia, syndactyly at lower left limb and tetradactyly in all limbs, bilateral cryptorchidism, pancreatic aplasia. Roberts syndrome is a rare genetic disease with recessive autosomal transmission generated by mutations in ESCO2 gene, located on chromosome 8. The disease should be easy to diagnose by antenatal ultrasound examination, but in our case, the lack of prenatal follow-up determined the diagnostic at term. We believe consider this case is an argument towards introducing ultrasound-screening compulsory to all pregnancies. To identify a possible genetic mutation, further investigations of the parents are in progress, but classically the disease has a recessive autosomal transmission.

  11. Evaluation report of the Nordic emergency exercise Nora - January 14, 1993

    International Nuclear Information System (INIS)

    Salo, A.; Singer, K.; Aakesson, T.; Valfells, A.; Backe, S.; Kallhagen, B.

    1993-01-01

    Nordic countries are signatories to the Convention on Early Notification of a Nuclear Accident and to the Convention on Assistance in Case of a Nuclear Accident or Radiological Emergency. In addition to these international conventions the states, except Iceland, have bilateral agreements on early notification and exchange of information with each other and with neighbouring countries. The bilateral agreements also require notification if levels of radionuclide contamination are observed which prompt information to the public or activation of the emergency organization or part of it. The main objective of the exercise NORA was to test and harmonize the overall decision making in the responsible Nordic approach to the emergency response, to improve co-operation in assessing rumour-, threat- and accident-situations, to improve co-operation in making decisions on intervention levels and on interventions in a Nordic perspective, to enhance harmony in information policy concerning information to the public in order to avoid ''double messages'', to improve information exchange between the Nordic countries and internationally. The objectives of the exercise were considered to have been met satisfactorily and the exercise made a valuable contribution to further develop the Nordic co-operation. (EG)

  12. Robert Frost: Teacher "Earner, Learner, Yearner."

    Science.gov (United States)

    Vogel, Nancy Sue

    An account of Robert Frost's teaching, along with an assessment of it, are presented. Material consulted includes Frost's published letters, prose, and poetry; Lawrance Thompson's authorized biography; Lesley Frost's "New Hampshire's Child: The Derry Journals of Lesley Frost;" and additional sources such as films and periodicals,…

  13. The meanings of J. Robert Oppenheimer

    CERN Document Server

    Banco, Lindsey Michael

    2016-01-01

    He called the first atomic bomb “technically sweet,” yet as he watched its brilliant light explode over the New Mexico desert in 1945 in advance of the black horrors of Hiroshima and Nagasaki, he also thought of the line from the Hindu epic The Bhagavad Gita: “I am become Death, the destroyer of worlds.” Physicist J. Robert Oppenheimer, the scientific director of the Manhattan Project, the single most recognizable face of the atomic bomb, and a man whose name has become almost synonymous with Cold War American nuclear science, was and still is a conflicted, controversial figure who has come to represent an equally ambivalent technology. The Meanings of J. Robert Oppenheimer examines how he has been represented over the past seven decades in biographies, histories, fiction, comics, photographs, film, television, documentaries, theater, and museums. Lindsey Michael Banco gathers an unprecedented group of cultural texts and seeks to understand the multiple meanings Oppenheimer has held in American popul...

  14. The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'. Modification of the Supply Agreement

    International Nuclear Information System (INIS)

    1961-01-01

    Pursuant to Section 15 of the 'Contract for the Lease of Enriched Uranium' for the NORA reactor, the United States Atomic Energy Commission has reduced, with effect from 1 January 1962, the rates of the Use Charge specified in Section II(a) and of the Consumption Charge specified in Section II(b)

  15. The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Programme of Research with the Zero Power Reactor 'NORA'. Text of a Supplementary Agreement

    International Nuclear Information System (INIS)

    1962-01-01

    The text of a Supplementary Agreement to amend the Supply Agreement concerning the NORA project, which Supplementary Agreement was approved by the Board of Governors on 18 June 1962 and which entered into force on 3 September 1962, is reproduced in this document for the information of all Members of the Agency

  16. Kirjavahetus Kaarel Robert Pustaga / Karl Ast Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2009-01-01

    Kirjavahetus Rio de Janeiros elava Karl Ast Rumori ja New Yorgis elava Kaarel Robert Pusta vahel Eesti kongressi kokkukutsumise vajalikkuse, väliseesti ühingute ja nõukogude, ajakirjanduse ning üldise poliitilise olukorra teemadel

  17. Lieutenant General Robert L. Bullard: Understanding Small and Large Conflicts

    Science.gov (United States)

    2012-12-06

    Publishing, 1925). 11 Robert L. Bullard, American Soldiers Also Fought ( Garden City, NY: Longmens and Green, 1936). 12 Ibid., V. 13 Ibid., VI...2005, 41-45. 53 Robert L. Bullard, “Among the Savage Moros,” Metropolitan Magazine, vol. XXIV:III (June 1906), 264. 19 increased during his...59 Bullard, “Among the Savage Moros,” 264. 22 intuitively knew that if he was to assist a partner, help the deprived, or fight an adversary, he

  18. Robert Putnam : miks peaksime naabritega rohkem rääkima? / Robert Putnam ; interv. Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Putnam, Robert

    2006-01-01

    26. mail Tallinnas toimuva Avatud Ühiskonna Foorumi peaesineja, Harvardi Ülikooli professor väidab, et mida paremini tuntakse oma naabreid, mida aktiivsemalt osaletakse kohalikus elus ning mida rohkem inimesed omavahel suhtlevad, seda paremaks ja turvalisemaks muutub nende elukeskkond. Lisad: Robert Putnam (sünd 1941); Kuidas kasvatada sotsiaalset kapitali?

  19. “Trickster” and “Republican”: Robert Harley’s Political Career in the 1690s

    Directory of Open Access Journals (Sweden)

    Kiselev Aleksandr

    2014-12-01

    Full Text Available Despite the fact that Robert Harley is known as Tory politician, he began his career as a Whig politician. His grandfather and father were Presbyterians, and Robert Harley himself was a Presbyterian during his entire life. Harley’s family supported the Glorious Revolution of 1688. In 1689 Robert Harley was first elected to the House of Commons as a representative of the Whig party. Thanks to his wife’s Foley family, Robert Harley was elected as a commissioner of public accounts in the House of Commons. In 1689 Britain entered the “war of King William” which was a burden for many gentry (Whigs or Tories. Robert Harley became famous in the parliament as a critic of the war and corruption in the army. In 1693 the Whig leaders headed the ministry and continued the war. Their policy divided the Whigs party in two factions: “Court Whigs” and “Country Whigs”. Robert Harley and his supporters became “Country Whigs”, and they criticized the “Court Whigs”. By 1700 Robert Harley joined the Tory party. The article also describes the evolution of historiography of Harley‘s policy. Victorian historians have called the Prime Minister a “stupid person”. The same opinion was repeated by Russian historians of the 19th century. But in the 20th century the assessment of Robert Harley’s activity was changed by the works of K. Feiling, G. Holmes, B.W. Hill and other historians. Soviet historians (for example M.A. Barg also called R.Harley a “mediocre politician”, but modern Russian historians (L.I. Ivonina, T.L. Labutina and others consider him a “clever statesman” and a “master of political intrigues and parliamentary diplomacy”.

  20. Cytogenetic diagnosis of Roberts SC phocomelia syndrome: First ...

    African Journals Online (AJOL)

    Tahir M. Malla

    2015-07-14

    /licenses/by-nc-nd/4.0/). 1. Introduction. Roberts SC phocomelia syndrome is an autosomal recessive developmental disorder characterized by pre and postnatal growth retardation, microcephaly, craniofacial anomalies,.

  1. Roberts-SC phocomelia syndrome.

    Science.gov (United States)

    Maheshwari, A; Kumar, P; Dutta, S; Narang, A

    2001-06-01

    A severely growth retarded baby was born at 38 weeks gestation. He had multiple craniofacial anomalies, microbrachycephaly, phocomelia in the upper limbs and renal cysts visible on ultrasound. He died of recurrent apneas. The autopsy showed left sided multicystic dysplastic kidney and absence of one testis. Cytogenetic studies did not reveal any abnormality. The phenotypic features match those described in the Roberts-SC phocomelia syndrome. A literature review revealed that 50% of these patients have chromosomal defects and antenatal detection is possible on ultrasound and by chromosome analysis of the amniocytes.

  2. Embracing the Humanistic Vision: Recurrent Themes in Peter Roberts' Recent Writings

    Science.gov (United States)

    Reveley, James

    2018-01-01

    Running like a leitmotif through Peter Roberts' recently published philosophico-educational writings there is a humanistic thread, which this article picks out. In order to ascertain the quality of this humanism, Roberts is positioned in relation to a pair of extant humanisms: radical and integral. Points of comparability and contrast are…

  3. Testing of a De Nora polymer electrolyte fuel cell stack of 1 kW for naval applications

    Science.gov (United States)

    Schmal, D.; Kluiters, C. E.; Barendregt, I. P.

    In a previous study calculations were carried out for a navy frigate with respect to the energy consumption of a propulsion/electricity generation system based on fuel cells. The fuel consumption for the 'all-fuel cell' ship was compared with the consumption of the current propulsion/electricity generation system based on gas turbines and diesel engines; it showed potential energy savings of a fuel cell based system amounting from 25 to 30%. On the basis of these results and taking into account various military aspects it was decided to start tests with a polymer electrolyte fuel cell (PEFC) stack. For this purpose a De Nora 1 kW PEFC was chosen. Results of the first tests after installation are satisfying.

  4. Two autographs: Cecile Dewitt and Robert Hawking (for Steven Hawking)

    Science.gov (United States)

    Gaina, Alex

    2007-12-01

    Two autographs given to author by professor Cecile Dewitt and Robert Hawking (the son of Steven Hawking for his father) in 1987 during the Quantum Gravity Seminar in Moscow are presented. The first was given during a visit to Physical Institute of the Academy of sciences of the USSR, where a seminar held in the Theoretical department. the second was given during a lunch with Steven Hawking, Andrei Linde and Robert Hawking at the 2-nd floor of the Conference floor.

  5. Robert Knox, transcendentální anatomie a imaginace rasové války / Robert Knox, transcendental anatomy and imagination of racial war

    Directory of Open Access Journals (Sweden)

    Ivo Budil

    2016-12-01

    Full Text Available The main aim of the study is to emphasize the role and contribution of the Scottish physician and surgeon Robert Knox to the emergence and expansion of modern racial thinking and the concept of a racial war which became later influential as a result of the works of representatives of Social Darwinism. The main ideas outlined in the book The Races of Men: A Philosophical Enquiry into the Influence of Race over the Destinies of Nations, published by Robert Knox in 1850, will be analyzed in the historical and intellectual context of transcendental anatomy and Eurasian revolution.

  6. Cytogenetic diagnosis of Roberts SC phocomelia syndrome: First report from Kashmir

    Directory of Open Access Journals (Sweden)

    Tahir M. Malla

    2016-01-01

    Full Text Available There are several syndromes in which specific mitotic chromosomal abnormalities can be seen, like premature centromere separation, premature (sister chromatid separation, and somatic aneuploidies. Identifications of such specific cytogenetic findings can be the key factor that leads towards the diagnosis of syndromes like Roberts SC phocomelia. The case presented here as Roberts SC phocomelia syndrome was identified as a child with multiple congenital anomalies and dysmorphic features. Conventional cytogenetic analysis of the case revealed premature sister chromatid separation. The premature centromeric separation was also confirmed by C banding analysis of the child. It is the first and the only case of Roberts SC phocomelia diagnosed from this part of the world. The present case report emphasizes the importance of conventional cytogenetics in the diagnosis of such syndromes.

  7. THANK GOD FOR BOBBY: ROBERT KENNEDY AND THE CUBAN MISSILE CRISIS

    Science.gov (United States)

    2017-06-01

    nomination and later confirmation of Robert Kennedy as United States Attorney General. The second was the failure of the Bay of Pigs operation in...Cuba. In nominating his brother, the President defied popular opinion and made a decision that would prove integral to his presidency. Although...and in place prior to the discovery of Soviet missiles in Cuba. Together, these two events gave Robert Kennedy a position from which to advise

  8. Cytogenetic diagnosis of Roberts SC phocomelia syndrome: First report from Kashmir

    OpenAIRE

    Tahir M. Malla; Arshad A. Pandith; Fayaz A. Dar; Mahrukh H. Zargar

    2016-01-01

    There are several syndromes in which specific mitotic chromosomal abnormalities can be seen, like premature centromere separation, premature (sister) chromatid separation, and somatic aneuploidies. Identifications of such specific cytogenetic findings can be the key factor that leads towards the diagnosis of syndromes like Roberts SC phocomelia. The case presented here as Roberts SC phocomelia syndrome was identified as a child with multiple congenital anomalies and dysmorphic features. Conve...

  9. NorA efflux pump inhibitory activity of coumarins from Mesua ferrea.

    Science.gov (United States)

    Roy, Somendu K; Kumari, Neela; Pahwa, Sonika; Agrahari, Udai C; Bhutani, Kamlesh K; Jachak, Sanjay M; Nandanwar, Hemraj

    2013-10-01

    The purpose of this investigation was to study the modulator and efflux pump inhibitor activity of coumarins isolated from Mesua ferrea against clinical strains as well as NorA-over expressed strain of Staphylococcus aureus 1199B. Seven coumarins were tested for modulator activity using ethidium bromide (EtBr) as a substrate. Compounds 1, 4-7 modulated the MIC of EtBr by ≥ 2 fold against wild type clinical strains of S. aureus 1199 and S. aureus 1199B, whereas compounds 4-7 modulated the MIC of EtBr by ≥ 16 fold against MRSA 831. Compounds 1, 4-7 also reduced the MIC of norfloxacin by ≥ 8 fold against S. aureus 1199B, and 4-6 reduced the MIC of norfloxacin by ≥ 8 fold against MRSA 831 at half of their MICs. Inhibition of EtBr efflux by NorA-overproducing S. aureus 1199B and MRSA 831 confirmed the role of compounds 4-6 as NorA efflux pump inhibitors (EPI). Dose-dependent activity at sub-inhibitory concentration (6.25 μg/mL) suggested that compounds 4 and 5 are promising EPI compared to verapamil against 1199B and MRSA 831 strains. © 2013.

  10. Roberts-SC syndrome, a rare syndrome and cleft palate repair

    Directory of Open Access Journals (Sweden)

    Murthy Jyotsna

    2008-01-01

    Full Text Available Roberts SC syndrome is a rare syndrome with only 17 previously recognized patients reported in medical literature. The syndrome is characterized by multiple malformations, particularly, symmetrical limb reduction, craniofacial anomalies such as bilateral cleft lip and palate, micrognathia, and severe growth and mental retardation. Our patient, a young child of five years having Roberts-SC, was successfully operated for cleft palate under general anesthesia. The main features of the syndrome and the technical problems of anesthesia and surgery are discussed in this report.

  11. American Prometheus. The Triumph and Tragedy of J. Robert Oppenheimer. Biography; J. Robert Oppenheimer. Die Biographie

    Energy Technology Data Exchange (ETDEWEB)

    Bird, Kai; Sherwin, Martin J.

    2009-07-01

    A definitive portrait of legendary scientist J. Robert Oppenheimer, the ''father'' of the atomic bomb, discusses his seminal role in the twentieth-century scientific world, as well as his lesser-known roles as family man, supposed communist, and head of Princeton's Institute for Advanced Studies. ''American Prometheus'' is a rich evocation of America in mid-century and a compelling portrait of scientist J. Robert Oppenheimer, a man shaped by its major events--the Depression, World War II, and the Cold War. (orig.) [German] J. Robert Oppenheimer (1904-1967), der ''Vater der Atombombe'', zaehlt zu den schillerndsten Figuren der juengeren Zeitgeschichte. Fuer ihre glaenzende Biographie des ''amerikanischen Prometheus'' erhielten der Journalist Kai Bird und der Historiker Martin J. Sherwin den Pulitzer-Preis. Exemplarisch lassen sie das Drama eines Forschers lebendig werden, der sich zwischen Erkenntnisdrang und ethischer Verantwortung entscheiden muss. Oppenheimer leitete das streng geheime Manhattan-Projekt in der Wueste von New Mexico, wo am 16. Juli 1945 die erste Atombombe gezuendet wurde. Kurz darauf starben in Hiroshima und Nagasaki mehr als 200 000 Menschen durch die neue ''Wunderwaffe'' - die Menschheit war ins Atomzeitalter eingetreten. Erschuettert von der Zerstoerungskraft seiner Schoepfung, engagierte sich Oppenheimer fortan gegen den Einsatz nuklearer Waffen. Das machte ihn im Amerika der McCarthy-Aera verdaechtig. Er geriet ins Visier des FBI, wurde als Spion der Sowjetunion verleumdet und musste den Staatsdienst quittieren. Sein Privatleben wurde an die Oeffentlichkeit gezerrt, seine Wohnung verwanzt, sein Telefon abgehoert. Erst 1963 rehabilitierte ihn Praesident Kennedy. Ueber dreissig Jahre hinweg haben die Autoren Interviews mit Oppenheimers Angehoerigen, Freunden und Kollegen gefuehrt, FBI-Akten gesichtet, Tonbaender von Reden und Verhoeren

  12. Robert Aymar, Director-General of CERN

    CERN Document Server

    Patrice Loïez

    2003-01-01

    Robert Aymar, photographed in 2003 before taking his position as Director-General at CERN, succeeding Luciano Maiani in 2004. At this time, Aymar was director of the International Thermonuclear Experimental Reactor (ITER) although he had already been involved with developments at CERN, chairing the External Review Committee, set up in 2001 in response to the increased cost of the LHC.

  13. Attaching the NorA Efflux Pump Inhibitor INF55 to Methylene Blue Enhances Antimicrobial Photodynamic Inactivation of Methicillin-Resistant Staphylococcus aureus in Vitro and in Vivo.

    Science.gov (United States)

    Rineh, Ardeshir; Dolla, Naveen K; Ball, Anthony R; Magana, Maria; Bremner, John B; Hamblin, Michael R; Tegos, George P; Kelso, Michael J

    2017-10-13

    Antimicrobial photodynamic inactivation (aPDI) uses photosensitizers (PSs) and harmless visible light to generate reactive oxygen species (ROS) and kill microbes. Multidrug efflux systems can moderate the phototoxic effects of PSs by expelling the compounds from cells. We hypothesized that increasing intracellular concentrations of PSs by inhibiting efflux with a covalently attached efflux pump inhibitor (EPI) would enhance bacterial cell phototoxicity and reduce exposure of neighboring host cells to damaging ROS. In this study, we tested the hypothesis by linking NorA EPIs to methylene blue (MB) and examining the photoantimicrobial activity of the EPI-MB hybrids against the human pathogen methicillin-resistant Staphylococcus aureus (MRSA). Photochemical/photophysical and in vitro microbiological evaluation of 16 hybrids carrying four different NorA EPIs attached to MB via four linker types identified INF55-(Ac)en-MB 12 as a lead. Compound 12 showed increased uptake into S. aureus cells and enhanced aPDI activity and wound healing effects (relative to MB) in a murine model of an abrasion wound infected by MRSA. The study supports a new approach for treating localized multidrug-resistant MRSA infections and paves the way for wider exploration of the EPI-PS hybrid strategy in aPDI.

  14. Numerical Methods in Atmospheric and Oceanic Modelling: The Andre J. Robert Memorial Volume

    Science.gov (United States)

    Rosmond, Tom

    Most people, even including some in the scientific community, do not realize how much the weather forecasts they use to guide the activities of their daily lives depend on very complex mathematics and numerical methods that are the basis of modern numerical weather prediction (NWP). André Robert (1929-1993), to whom Numerical Methods in Atmospheric and Oceanic Modelling is dedicated, had a career that contributed greatly to the growth of NWP and the role that the atmospheric computer models of NWP play in our society. There are probably no NWP models running anywhere in the world today that do not use numerical methods introduced by Robert, and those of us who work with and use these models everyday are indebted to him.The first two chapters of the volume are chronicles of Robert's life and career. The first is a 1987 interview by Harold Ritchie, one of Robert's many proteges and colleagues at the Canadian Atmospheric Environment Service. The interview traces Robert's life from his birth in New York to French Canadian parents, to his emigration to Quebec at an early age, his education and early employment, and his rise in stature as one of the preeminent research meteorologists of our time. An amusing anecdote he relates is his impression of weather forecasts while he was considering his first job as a meteorologist in the early 1950s. A newspaper of the time placed the weather forecast and daily horoscope side by side, and Robert regarded each to have a similar scientific basis. Thankfully he soon realized there was a difference between the two, and his subsequent career certainly confirmed the distinction.

  15. Robert Klopstock and Franz Kafka--the friends from Tatranské Matliare (the High Tatras).

    Science.gov (United States)

    Mydlík, M; Derzsiová, K

    2007-01-01

    The paper summarises the accessible literature on the life and work of well-known American lung surgeon, Professor Dr. Med. Robert Klopstock, who was in the years 1920-1924 a friend Franz Kafka. Professor Klopstock was of Hungarian origin and he got acquainted with Franz Kafka at the end of the year 1920 in Tatranské Matliare (The High Tatras). They were both patients treated for lung tuberculosis. They became close friends and their mutual correspondence shows their real friendship. Robert Klopstock was present at Franz Kafka's death-bed on June 3, 1924 in Kierling, near Klosterneuburg, not far from Vienna. Robert Klopstock studied at Medical Faculties of the Universities in Budapest, Prague, Kiel and Berlin. After his graduation in 1933 in Berlin, he worked as a lung surgeon at various surgical clinics and departments in Budapest and Berlin. In 1936 Robert Klopstock together with his wife visited the High Tatras and Tatranské Matliare. In 1937 Robert Klopstock with his wife Gizela, a writer and a translator, who translated the first chapters of Franz Kafka's novel "Trial" into Hungarian language, went to United States of America. During his stay in U.S.A. Dr. Med. Robert Klopstock was very active as a lung surgeon and a scientist. He published 64 specialized scientific papers, mostly in American medical journals. He became Professor of Lung Surgery at Downstate Medical Centre in New York-Brooklyn. He died on June 15, 1972 in New York.

  16. Robert Aymar receives one of the highest Finnish distinctions

    CERN Multimedia

    2008-01-01

    On 9 December 2008 Robert Aymar, CERN Director-General, was awarded the decoration of Commander, first class, of the Order of the Lion of Finland by the President of the Republic of Finland. This decoration, one of the highest of Finland, was presented in a ceremony by the Ambassador Hannu Himanen, Permanent Representative of Finland to the UN and other international organisations in Geneva. Robert Aymar was honoured for his service to CERN, the LHC, his role in the cooperation between Finland and CERN, as well as his contribution to science in general. In his speech the ambassador underlined CERN’s efforts in the field of education, mentioning the High school teachers programme.

  17. Robert Eisenstein joins the ATLAS collaboration at CERN

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    Robert Eisenstein, former assistant director for mathematical and physical sciences (MPS) at the US National Science Foundation (NSF), has stepped down from the job to spend a year at CERN as a member of the ATLAS collaboration.

  18. Intervjuu American Wind Symphony Orchestra dirigendi Robert Austin Boudreau'ga = Interview with Mr. Robert Austin Boudreau, director of the American Wind Symphony Orchestra / Robert Austin Boudreau ; interv. Heli Ojamaa

    Index Scriptorium Estoniae

    Boudreau, Robert Austin

    2007-01-01

    11. IV 2007. a. tehtud telefoniintervjuu Robert A. Boudreau'ga, kellele arhitekt Louis I. Kahn disainis kontserdilaevad Point Counterpoint I (valmis 1961) ja Point Counterppoint II (kavandamist alustati 1966, valmis 1975). Louis I. Kahnist, koostööst arhitektiga ja laevadest. Selgitav kaaskiri arhitekt Heli Ojamaalt. Ill.: I laeva makett, II laeva joonised ja 4 värv. fotot

  19. Robert Henry Thurston: Professionalism and Engineering Education

    Science.gov (United States)

    Nienkamp, Paul

    2016-01-01

    Robert Henry Thurston is presented in this article. He provides one the most significant examples of professionalizing engineering through innovative education and promoting scientific education practices in the late nineteenth century. The son of a draftsmen and steam engine mechanic, Thurston spent his early years in Providence, Rhode Island.…

  20. La Corte Roberts e la questione della “preghiera municipale”

    Directory of Open Access Journals (Sweden)

    Adelaide Madera

    2017-02-01

     The Roberts Court and the “municipal prayer” Abstract: In the USA, few topics are more divisive than the government’s use of religious expressions and symbols. The Supreme Court has tried to find a balance between the Establishment Clause of the U.S. Constitution and the inclusion of religious expressions in government activities. In Town of Greece v. Galloway, the Roberts Court upheld a town’s practice of opening board meetings with prayers from invited speakers. The essay critically examines the various opinions in the case, and looks at where this decision suggests the Establishment Clause doctrine is moving award.

  1. American Prometheus. The Triumph and Tragedy of J. Robert Oppenheimer. Biography

    International Nuclear Information System (INIS)

    Bird, Kai; Sherwin, Martin J.

    2009-01-01

    A definitive portrait of legendary scientist J. Robert Oppenheimer, the ''father'' of the atomic bomb, discusses his seminal role in the twentieth-century scientific world, as well as his lesser-known roles as family man, supposed communist, and head of Princeton's Institute for Advanced Studies. ''American Prometheus'' is a rich evocation of America in mid-century and a compelling portrait of scientist J. Robert Oppenheimer, a man shaped by its major events--the Depression, World War II, and the Cold War. (orig.) [de

  2. Robert Lawson (?1846-1896).

    Science.gov (United States)

    Larner, A J; Gardner-Thorpe, C

    2012-04-01

    Various descriptions of what would now be called Korsakoff Syndrome may be found in the medical literature predating the eponymous reports of Sergei Korsakoff (1854-1900) that date from 1887 onwards. Of these, it has been stated that the "most promising account" (Draaisma in Disturbances of the mind 163-164, 2009) may be that of Dr. Robert Lawson, published in 1878 in the journal Brain in its inaugural year of publication (Lawson in Brain 1:182-194, 1878). As Lawson is likely to be an unfamiliar name to most neurologists, and does not appear in the Oxford Dictionary of National Biography, we offer this brief account of his life and work.

  3. 75 FR 32740 - Action Affecting Export Privileges; Aaron Robert Henderson and Valhalla Tactical Supply

    Science.gov (United States)

    2010-06-09

    ... Robert Henderson and Valhalla Tactical Supply In the Matter of: Aaron Robert Henderson, 740 Jessie St., North Liberty, IA 52317. Respondent and Valhalla Tactical Supply, 740 Jessie Street, North Liberty, IA... is the owner, operator and president of Valhalla Tactical Supply (``Valhalla''), Valhalla is related...

  4. Robert Rodrigueze verejugadega õudusfilm tuleb Igavuse planeedilt / Mihkel Raud

    Index Scriptorium Estoniae

    Raud, Mihkel, 1969-

    2007-01-01

    Filmiprojekt "Grindhouse" koosneb Robert Rodrigueze retroõudukast "Grindhouse : Õuduste planeet" ("Planet Terror") ja Quentin Tarantino 70-ndatest inspireeritud õudusfilmist "Surmakindel" ("Death Proof") : Ameerika Ühendriigid 2007. R. Rodrigueze filmist

  5. Astronaut Robert L. Crippen prepares for underwater training session

    Science.gov (United States)

    1983-01-01

    Astronaut Robert L. Crippen, STS-7 crew commander, adjusts his extravehicular mobility unit's (EMU) gloves prior to donning his helmet for a training session in the weightless environment test facility (WETF).

  6. Das Fortbildungsangebot der Bibliothek des Robert Koch-Instituts: Dienstleistung im Publikationsprozess

    Directory of Open Access Journals (Sweden)

    Senst, Henriette

    2013-12-01

    Full Text Available [english] Robert Koch-Institute’s scientists are supported during the publishing process in different ways. Relating to frequently asked questions the library offers trainings, which are integrated in the training program of the institute.How does a good literature research work? How do I manage my literature and how do I cite correctly? What do I have to consider during the publishing process? These and other questions are answered in trainings on literature research, managing bibliographies with EndNote and “Scientific Publishing in the Robert Koch-Institute” which take place regularly.

  7. Expanding the mutation and clinical spectrum of Roberts syndrome.

    Science.gov (United States)

    Afifi, Hanan H; Abdel-Salam, Ghada M H; Eid, Maha M; Tosson, Angie M S; Shousha, Wafaa Gh; Abdel Azeem, Amira A; Farag, Mona K; Mehrez, Mennat I; Gaber, Khaled R

    2016-07-01

    Roberts syndrome and SC phocomelia syndrome are rare autosomal recessive genetic disorders representing the extremes of the spectrum of severity of the same condition, caused by mutations in ESCO2 gene. We report three new patients with Roberts syndrome from three unrelated consanguineous Egyptian families. All patients presented with growth retardation, mesomelic shortening of the limbs more in the upper than in the lower limbs and microcephaly. Patients were subjected to clinical, cytogenetic and radiologic examinations. Cytogenetic analysis showed the characteristic premature separation of centromeres and puffing of heterochromatic regions. Further, sequencing of the ESCO2 gene identified a novel mutation c.244_245dupCT (p.T83Pfs*20) in one family besides two previously reported mutations c.760_761insA (p.T254Nfs*27) and c.764_765delTT (p.F255Cfs*25). All mutations were in homozygous state, in exon 3. The severity of the mesomelic shortening of the limbs and craniofacial anomalies showed variability among patients. Interestingly, patient 1 had abnormal skin hypopigmentation. Serial fetal ultrasound examinations and measurements of long bones diagnosed two affected fetuses in two of the studied families. A literature review and case comparison was performed. In conclusion, we report a novel ESCO2 mutation and expand the clinical spectrum of Roberts syndrome. © 2015 Japanese Teratology Society.

  8. Aitab hädaldamisest / Robert Antropov

    Index Scriptorium Estoniae

    Antropov, Robert, 1965-

    2006-01-01

    Endine politseijuht on seisukohal, et politseinike ja päästjate nappuses ei saa süüdistada ainult väikseid palku, küsimus on valikutes: kuidas ja millesse ressursse paigutada. Kalle Laanet ja Raivo Aeg vastavad küsimusele, mis on nende haldusalas konkreetselt kavas, et politsei saaks täita oma tegevusprioriteeti 100% ja tagada sisejulgeoleku. Vt. ka Robert Antropovi kommentaari 7. aug. Eesti Päevaleht lk. 2

  9. Discovering Moral Engagement: An Interview with Robert Coles.

    Science.gov (United States)

    Scott, Bradwell D.

    1995-01-01

    Educator Robert Coles argues that there is a need for a basis on which to teach and cultivate moral awareness in parents and children. Active parenting requires both inner-directed and outer-directed focuses to take advantage of the everyday events through which morality is developed. (SLD)

  10. Transitioning Natures: Robert Schuller’s Garden Grove Experiment

    Directory of Open Access Journals (Sweden)

    Antonio Petrov

    2016-09-01

    Full Text Available Through the lens of Evangelist Reverend Robert H. Schuller’s Garden Grove drive-in walk-in church, this paper aims to exemplify how his architecture has transcended existing geographies that have long been anchored by the epistemology of what can be referred to as traditional “religious” architecture. This paper examines how Schuller instrumentalized broader imbrications of political contexts to change or manipulate the traditional religious subject. It also presents how Robert Schuller’s Garden Grove experiment reconceptualized “territory” as an evolving ideological dimension; not as a trajectory, or as transitory space, but as inhabitable third nature. My analysis challenges established readings of religious architecture as being interiorized manifestations. To do so, it poses the following questions: how does this meta-geographical dimension shed new light on questions of (traditional architectural aesthetics in Protestant architecture? What spaces and politics does it produce? Does the third nature have a history of its own?

  11. Introduction : The scope of Robert Buijtenhuis' work

    NARCIS (Netherlands)

    Binsbergen, van W.M.J.; Konings, P.J.J.; Hesseling, G.S.C.M.; Konings, P.J.J.; Binsbergen, van W.M.J.; Hesseling, G.S.C.M.

    2000-01-01

    Cet ouvrage présente onze contributions rédigées par des africanistes qui ont collaboré étroitement avec l'anthropologue politique néerlandais Robert Buijtenhuijs et ont été influencés par ses travaux et sa personnalité. Le livre est un hommage à un auteur qui a été productif dans beaucoup de

  12. Robert Sternberg's mental self-government theory and its ...

    African Journals Online (AJOL)

    Robert Sternberg's mental self-government theory and its contribution to our understanding of first-year distance learners' multiple thinking style preferences. ... This intelligence (the perception we have of information systems and the way we manage them) will influence the way we think and learn. This also applies to ...

  13. Sir Robert Sidney’s Poems Revisited: the alternative sequence

    OpenAIRE

    Relvas, Maria de Jesus C.

    1997-01-01

    The essay approaches the lyric sequence written by Sir Robert Sidney (1563-1626) in the Elizabethan age, by mainly exploring its unique formal structure, which encloses an alternative sequence formed by a re-numbering of several poems.

  14. Ravel and Robert-Houdin, Magicians

    DEFF Research Database (Denmark)

    Fillerup, Jessie

    2013-01-01

    ,” which resonates with accounts of Ravel's Baudelairean artifice in life and work. For magicians, “illusion” was interchangeable with “effect.” The word “effect” recurs in both Ravel's writings and “The Philosophy of Composition,” a theoretical-didactic essay by Edgar Allan Poe, whom Ravel cited as one...... of his most important artistic influences. Ravel's appreciation of Poe has a much richer grain than has been imagined, extending beyond compositional artisanship to include literary and theatrical stratagems. Robert-Houdin, who started his career as a clockmaker, featured automata at his Soiréé...

  15. Quality of life research: interview with Professor Robert Cummins

    Directory of Open Access Journals (Sweden)

    Robert Cummins

    2013-09-01

    Full Text Available Health-related quality of life (HRQOL is a fundamental concept in the field of clinical medicine and has been studied during the last years by psychologists, sociologists, economists and managers. The concept of HRQOL includes those aspects of overall QOL that can be indicated to have an impact on patients’ health, either physical or psychological. Concerning the individuals, this incorporates physical and mental health cognitions, including sociodemographic factors, sexual functioning, fatigue, sleep disorders and functional status. One of the most eminent experts in the world in the field of QOL is Prof. Robert Cummins [Professor of Psychology at Deakin University in Australia (School of Psychology, Deakin University, 221 Burwood Highway, Victoria 3125 Melbourne, Australia. E-mail: robert.cummins@deakin.edu.au] who kindly accepted to answer our questions in the con- text of this special edition.

  16. Robert Schuman, principal architect of the European Union

    NARCIS (Netherlands)

    Margriet Krijtenburg

    2015-01-01

    A tangible proof of the meaning and scope of human flourishing that can change not only organizations but also entire societies, is given by Robert Schuman, the French Minister of Foreign Affairs who launched the Schuman Declaration (1950) that gave birth to the EU. His leitmotiv was to be a

  17. N,N'-disubstituted cinnamamide derivatives potentiate ciprofloxacin activity against overexpressing NorA efflux pump Staphylococcus aureus 1199B strains.

    Science.gov (United States)

    Radix, Sylvie; Jordheim, Anne Doléans; Rocheblave, Luc; N'Digo, Serge; Prignon, Anne-Laure; Commun, Carine; Michalet, Serge; Dijoux-Franca, Marie-Geneviève; Mularoni, Angélique; Walchshofer, Nadia

    2018-04-25

    A multi-step procedure has been described which afforded satisfactory yields of N,N'-disubstituted cinnamamides derived from N-Boc-protected amino acids (Boc-Gly, Boc-Val, Boc-Phe). The key step of this synthesis was a regioselective RedAl reduction of an amide function in presence of a carbamate group. Next, these cinnamamides were evaluated in co-admnistration with ciprofloxacin as efflux pump inhibitors against two S. aureus strains, NorA overexpressing SA1199B and wild type SA1199. In parallel, their intrinsic toxicity was appreciated on human lung fibroblast MRC5 cells. Therefore, the cinnamamide combining both carbamate and indol-3-yl groups, was found to be the most active and one of the less toxic EPI and constituted a promising hit. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  18. Research Ship Robert Gordon Sproul Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Research Ship Robert Gordon Sproul Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and...

  19. Zombilood / Robert Kirkman ; intervjueerinud Margit Tõnson, Peeter Helme

    Index Scriptorium Estoniae

    Kirkman, Robert

    2010-01-01

    Režissöör George A. Romero kultusfilmid zombidest "Elavate surnute öö", "Surnute koidik", "Surnute päev" jpt. on inspiratsiooniks koomiksikirjutaja Robert Kirklandile. Režissöör Frank Darabont on teinud tema tuntuimast koomiksiseeriast "The Walking Dead" teleseriaali "Kõndivad surnud". Zombiteema kasvavast populaarsusest ning intervjuu koomiksikirjutajaga

  20. Patterns of practice of regional nodal irradiation in breast cancer: results of the European Organization for Research and Treatment of Cancer (EORTC) NOdal Radiotherapy (NORA) survey.

    Science.gov (United States)

    Belkacemi, Y; Kaidar-Person, O; Poortmans, P; Ozsahin, M; Valli, M-C; Russell, N; Kunkler, I; Hermans, J; Kuten, A; van Tienhoven, G; Westenberg, H

    2015-03-01

    Predicting outcome of breast cancer (BC) patients based on sentinel lymph node (SLN) status without axillary lymph node dissection (ALND) is an area of uncertainty. It influences the decision-making for regional nodal irradiation (RNI). The aim of the NORA (NOdal RAdiotherapy) survey was to examine the patterns of RNI. A web-questionnaire, including several clinical scenarios, was distributed to 88 EORTC-affiliated centers. Responses were received between July 2013 and January 2014. A total of 84 responses were analyzed. While three-dimensional (3D) radiotherapy (RT) planning is carried out in 81 (96%) centers, nodal areas are delineated in only 51 (61%) centers. Only 14 (17%) centers routinely link internal mammary chain (IMC) and supraclavicular node (SCN) RT indications. In patients undergoing total mastectomy (TM) with ALND, SCN-RT is recommend by 5 (6%), 53 (63%) and 51 (61%) centers for patients with pN0(i+), pN(mi) and pN1, respectively. Extra-capsular extension (ECE) is the main factor influencing decision-making RNI after breast conserving surgery (BCS) and TM. After primary systemic therapy (PST), 49 (58%) centers take into account nodal fibrotic changes in ypN0 patients for RNI indications. In ypN0 patients with inner/central tumors, 23 (27%) centers indicate SCN-RT and IMC-RT. In ypN1 patients, SCN-RT is delivered by less than half of the centers in patients with ypN(i+) and ypN(mi). Twenty-one (25%) of the centers recommend ALN-RT in patients with ypN(mi) or 1-2N+ after ALND. Seventy-five (90%) centers state that age is not considered a limiting factor for RNI. The NORA survey is unique in evaluating the impact of SLNB/ALND status on adjuvant RNI decision-making and volumes after BCS/TM with or without PST. ALN-RT is often indicated in pN1 patients, particularly in the case of ECE. Besides the ongoing NSABP-B51/RTOG and ALLIANCE trials, NORA could help to design future specific RNI trials in the SLNB era without ALND in patients receiving or not PST.

  1. Education and Utopia: Robert Owen and Charles Fourier

    Science.gov (United States)

    Leopold, David

    2011-01-01

    The aims of education, and the appropriate means of realising them, are a recurring preoccupation of utopian authors. The utopian socialists Robert Owen (1771-1858) and Charles Fourier (1772-1837) both place human nature at the core of their educational views, and both see education as central to their wider objective of social and political…

  2. Unusually Gothic : Robert Sigl's Laurin (1987)

    OpenAIRE

    Stiglegger, Marcus

    2010-01-01

    Marcus Stiglegger revives a lost Gothic treasure in this brief discussion of Robert Sigl's Laurin—a rare case of German genre film-making and the heir to FW Murnau's legacy. Phantastic genre cinema is very rare in contemporary Germany—especially in the 1980s, the time when Italian horror reached another peak with Dario Argento's Opera (1985). The cliché of the German "easy comedy" ruled mainstream film production at the time, and so it appeared a kind of miracle when 27-year-old writer/direct...

  3. Architecture of (impossibilities: Robert Smithson's expositive spaces

    Directory of Open Access Journals (Sweden)

    Bráulio Romeiro

    2012-06-01

    Full Text Available This work investigates the North American artist Robert Smithson’s considerations on traditional expositive spaces: the museum and art gallery, as well as unusual and unexplored spaces by art up to that time. Looking through his texts we notice some enhanced perspectives and reset others, increasing limitation set on White Cube’s abstract and neutral quality and the substantiation on ideologies behind of these spaces manifestation.

  4. Robert Hooke, 1635-1703.

    Science.gov (United States)

    Rowbury, Robin

    2012-01-01

    Robert Hooke was a polymath whose expertise during the 17th century spanned many different scientific areas. As a schoolboy on the Isle of Wight he was obsessed with the possibility of human flight and later became equally absorbed in cosmology and planetary motion. His skills as an artist were put to good use both as an architect following the Great Fire of London and before that in Micrographia. Although that book is best known for demonstrating the power of Hooke's microscope, Micrographia describes distant planetary bodies, the wave theory of light, the organic origin of fossils, and various other philosophical and scientific interests of its author The following thumbnail sketches of Hooke reveal him to be a man of enormous energy and imagination whose ideas were often pirated or under-rated.

  5. Assessment of the risk of African swine fever introduction into Finland using NORA-a rapid tool for semiquantitative assessment of the risk.

    Science.gov (United States)

    Kyyrö, J; Sahlström, L; Lyytikäinen, T

    2017-12-01

    The NORA rapid risk assessment tool was developed for situations where there is a change in the disease status of easily transmissible animal diseases in neighbouring countries or in countries with significant interactions with Finland. The goal was to develop a tool that is quick to use and will provide consistent results to support risk management decisions. The model contains 63 questions that define the potential for entry and exposure by nine different pathways. The magnitude of the consequences is defined by 23 statements. The weight of different pathways is defined according to the properties of the assessed disease. The model was built as an Excel spreadsheet and is intended for use by animal health control administrators. As an outcome, the model gives the possible pathways of disease entry into the country, an overall approximation for the probability of entry and the subsequent exposure, an overall estimate for the consequences and a combined overall risk estimate (probability multiplied by magnitude of consequences). Model validity was assessed by expert panels. Outside Africa, African swine fever is currently established in Russia and Sardinia. In addition, there have been cases in both wild boar and domestic pigs in Latvia, Lithuania, Poland and Estonia. Finland has frequent contacts with Russia and Estonia, especially through passengers. The risk of African swine fever (ASF) introduction into Finland was tested with NORA for the situation in December 2015, when ASF was endemic in many parts of Russia, Africa and Sardinia and was present in Baltic countries and in Poland. African swine fever was assessed to have a high probability of entry into Finland, with high consequences and therefore a high overall risk. © 2017 Blackwell Verlag GmbH.

  6. Stylistic Analysis of Robert Browning's Poem "Patriot into Traitor

    Science.gov (United States)

    Ahmed, Mumtaz; Irshad, Ayesha

    2015-01-01

    The stylistic analysis of Robert Browning's poem "Patriot into Traitor" is done by using graphological, phonological, morphological and lexico-syntactic patterns. This analysis is helpful in decoding the underlying meanings of the poem. It clearly brings to surface what the poet really wants to impart.

  7. The auriferous placer at Mount Robert, Pietersburg Greenstone belt

    International Nuclear Information System (INIS)

    Saager, R.; Muff, R.

    1986-01-01

    The Mount Robert gold placer near Potgietersrus occurs in coarse, matrix-supported conglomerates of the Uitkyk Formation within the Pietersburg greenstone belt. Sedimentological and mineralogical investigations indicate that the conglomerates and the ore minerals were derived from a greenstone provenance, and that they were deposited in a braided river environment within a rapidly subsiding trough. Lack of sedimentological concentration of the heavy minerals is considered to be the main reason for the low and erratic gold grades encountered (usually below 1 g/t) and, thus, the failure of all past mining ventures. The mineralogical composition of the Mount Robert ore closely resembles that of the Witwatersrand deposits. However, uraninite is absent, probably as a result of its complete removal by weathering processes. Remaining small uranium concentrations can still be detected within the conglomerates where they occur associated with grains of carbonaceous matter, leucoxene aggregates, and secondary iron-hydroxides. U3O8 values found in the conglomerates are given

  8. TBT recommends : Vera Bila. The No Smoking Orchestra. Robert Plant

    Index Scriptorium Estoniae

    2005-01-01

    Mustlasansambli Kale ja Vera Bila kontserdist 8. apr Tallinnas. Bosnia filmirežissööri Emir Kusturica ja tema ansambli No Smoking Orchestra kontserdist 12. apr. Riias. Inglise rocklaulja Robert Planti kontserdist 10. apr. Vilniuses

  9. Kventin Tarantino + Robert Rodriges = Grainhaus, ili Kinonostalgija po-amerikanski / Andrei Sozinov

    Index Scriptorium Estoniae

    Sozinov, Andrei

    2007-01-01

    Filmiprojekt "Grindhouse" koosneb Robert Rodrigueze retroõudukast "Grindhouse : Õuduste planeet" ("Planet Terror") ja Quentin Tarantino 70-ndatest inspireeritud õudusfilmist "Surmakindel" ("Death Proof") : Ameerika Ühendriigid 2007

  10. De 'wraak van de geografie' volgens Robert D. Kaplan

    NARCIS (Netherlands)

    Mamadouh, V.

    2013-01-01

    De Amerikaanse publicist Robert D. Kaplan heeft een nieuwe bestseller, De wraak van de geografie, waarin hij het belang van geografie voor de internationale politiek uit de doeken doet. Zijn roep om meer aandacht voor geografie is echter erg eenzijdig en een miskenning van alles waar ons vak voor

  11. Antes de los Estudios Culturales. Robert Warshow y la experiencia

    Directory of Open Access Journals (Sweden)

    Antonio Lastra

    2008-01-01

    Full Text Available Este artículo estudia la influencia del concepto de experiencia que desarrolla Robert Warshow. Warshow ha supuesto el contrapunto americano a las teorías desarrolladas por Walter Benjamien en Europa. Si bien ambos insistieron en la pobreza de la experiencia, como resultado de la tecnificación de la sociedad, Warshow supo introducir matizaciones que influyeron en todo el círculo de intelectuales concentrados en Nueva York durante la etapa de consolidación de los Estudios Culturales. This paper studies the influence of the experience concept by Robert Warshow. Warshow is the American counterpoint to theories developed by Walter Benjamin in Europe. Although both insisted in the poverty of experience, as a result of technique, Warshow knew how to introduce nuances that influenced intellectuals in New York as Cultural Studies emerged.

  12. The Elusive Search for Nora Luca: Tony Gatlif's Adventures in Gypsy Land

    Directory of Open Access Journals (Sweden)

    Sylvie Eve Blum-Reid

    2005-08-01

    Full Text Available This essay examines Gypsy filmmaker Tony Gatlif and his 1997 film Gadjo Dilo (The Crazy Foreigner. The film ventures on the icy roads of Romania and casts a young French man in search for Nora Luca’s voice, a woman taped by his musicologist father. The young man is adopted by a Romanian Gypsy community and initiated to Gypsy culture. The film reverts stereotypes associated to Gypsies and questions the place of the white traveler in late 20th century Europe. Questions of otherness and exoticism are raised amidst the Western urge to preserve and collect other cultures. The essay is informed by current Gypsies studies on Gypsy law that locate the interaction Rom cultures have had with non-Rom cultures. The film may be seen as a trilingual road movie set in Eastern Europe, yet Gatlif, a man for whom “the road is his country” stretches the limits of the genre, usually situated in the vast open spaces of North America. Gender is important in the analysis of the film as Rom women encountered act as mediators between two different cultures and spaces. Last, the essay reconsiders the place of Tony Gatlif, a now recognized French filmmaker, a spokesperson for Gypsies who delocalised the story and traveled to Eastern Europe. An analysis of the reception of the film adds to the discussion of a filmmaker, born in Algeria, of Berber and Andalusian descent.

  13. Improvement on The Ellis and Roberts Viability Model

    Directory of Open Access Journals (Sweden)

    Guoyan Zhou

    2016-05-01

    Full Text Available With data sets of germination percent and storage time of seed lot of wheat and sorghum stored at three different storage temperature(t, °C with three different water content (m, % of seeds, together with data set of buckwheat and lettuce reported in literatures, the possibility that seed survival curve were transformed into line by survival proportion and the relationship that logarithm of average viability period (logp50 and standard deviation of seed death distribution in time (δwith t, m and interaction between t and m were analysed. Result indicated that survival proportion transformed seed survival curve to line were much easier than the probability adopted by Ellis and Roberts, and the most important factor affecting logp50 and δ of seed lot was interaction between t and m. Thus, Ellis and Roberts viability model were suggested to be improved as Ki=Vi-p/10K-CWT (t×m to predict longevity of seed lot with initial germination percent unknown, a new model of Gi/G0=A-P/10K-CWT(t×m was constructed to predict longevity of seed lot with initial germination percent already known.

  14. Percy Julian, Robert Robinson, and the Identity of Eserethole

    Science.gov (United States)

    Ault, Addison

    2008-01-01

    The Nova production "Percy Julian--Forgotten Genius" included the very public disagreement between Percy Julian, an unknown American chemist, and Robert Robinson, possibly the best known organic chemist of the day, as to the identity of "eserethole", the key intermediate for the synthesis of the alkaloid physostigmine. The Nova production,…

  15. John Bingham Roberts and the first American monograph on human brain surgery.

    Science.gov (United States)

    Stone, J L

    2001-10-01

    JOHN BINGHAM ROBERTS (1852-1924) of Philadelphia was an active general surgeon in the latter 19th and early 20th centuries. He made pioneering contributions to a number of areas of surgery. From 1880 until the end of his career, he was one of the few American surgeons to advocate an aggressive exploratory approach to cranial fractures in an effort to avoid consequences such as infection, delayed seizures, and insanity. In his 1885 article in the Transactions of the American Surgical Association titled "The Field and Limitation of the Operative Surgery of the Human Brain," he predicted that with antiseptic precautions and the growing knowledge of cerebral localization, operations on the brain would become commonplace. This work predated that of Horsley, Keen, and many others. Roberts had a continuing interest in head injuries, cranial fractures, and the development of trephines and burrs for reconstructive cranial work, but his active enthusiasm for brain surgery diminished in the 1890s. Nevertheless, Roberts was a very prolific teacher and leader in American surgery who is perhaps best remembered for his monographs and textbooks on general, orthopedic, plastic, and reconstructive surgery.

  16. PRENATAL DIAGNOSIS OF ROBERT/SC SYNDROME IN A DIABETIC MOTHER WITH A HISTORY OF MEBENDAZOLE AND GLIBENCLAMIDE INTAKE

    Directory of Open Access Journals (Sweden)

    M. Pourissa

    2003-07-01

    Full Text Available The Robert/SC (pseudothalidomide syndrome is a rare autosomal recessive disorder, associated with phocomelia and craniofacial abnormalities. An anomalous fetus with lower limb phocomelia and micromelia, lumbar myeloschisis, upper limb and ribs defects and craniofacial abnormalities is reported whose diabetic mother took mebendazole and glibenclamide in early pregnancy. Ultrasonographic findings of syndromes with phocomelia are discussed as well as Robert/SC syndrome which is the most probable diagnosis. Robert/SC phocomelia syndrome is a rare autosomal recessive condition characterized by severe pre and postnatal growth deficiency, symmetric limb reductions of variable severity and craniofacial anomalies including hypertelorism, hypoplastic nasal alae, cleft lip and palate. About half of the reported cases presented chromosomal abnormalities. We think that findings in our case are consistent with Robert/SC syndrome with additional abnormalities.

  17. 78 FR 12357 - Brockway Mould, Inc., a Division of Ross International Ltd. Including Robert Lerch From BJR...

    Science.gov (United States)

    2013-02-22

    ... Division of Ross International Ltd. Including Robert Lerch From BJR Trucking, Brockport, PA; Amended..., applicable to workers and former workers of Brockway Mould, Inc., a division of Ross International Ltd... Brockway Mould, Inc., a division of Ross International Ltd., including Robert Lerch from BJR Trucking...

  18. Robert Aymar seals the last interconnect in the LHC

    CERN Multimedia

    Maximilien Brice

    2007-01-01

    The LHC completes the circle. On 7 November, in a brief ceremony in the LHC tunnel, CERN Director General Robert Aymar (Photo 1) sealed the last interconnect between the main magnets of the Large Hadron Collider (LHC). Jean-Philippe Tock, leader of the Interconnections team, tightens the last bolt (Photos 4-8).

  19. Robert Nozick's entitlement theory of justice: a critique | Nnajiofor ...

    African Journals Online (AJOL)

    The burden of this paper is to critique Robert Nozick's entitlement theory of justice which was drafted as an argument against traditional distribution theories. Nozick's theory of justice claims that whether a distribution is just or not depend entirely on how it came about. By contrast, justice according to equality, need, desert or ...

  20. The strange trial of Robert Oppenheimer; L'etrange proces de Robert Oppenheimer

    Energy Technology Data Exchange (ETDEWEB)

    Kevles, D.J. [Yale Univ., New Haven, CT (United States); Institut de Technologie de Californie (United States)

    2004-04-01

    Robert Oppenheimer has become the symbol of the scientist tormented and anguished by the consequences of his discoveries. R.Oppenheimer took a major part in the Manhattan project for the designing of the first atomic bomb. During this period he considered the thermonuclear bomb as the next step to reach but after Japan's surrender he reconsidered his position and favoured a more moderate atomic policy. R.Oppenheimer began to militate in favour of an international control of nuclear energy and wanted that Usa relinquish to design the hydrogen bomb. In 1953 in full Mac-Carthysm era, he was accused of being a communist and of spying for Ussr and as a consequence he was deprived of his office in AEC (atomic energy committee) but in 1963 president Lyndon Johnson rehabilitated him and R.Oppenheimer was awarded the highest reward of AEC: the Enrico Fermi prize. (A.C.)

  1. Robert Spitzer and psychiatric classification: technical challenges and ethical dilemmas.

    Science.gov (United States)

    Jacob, K S

    2016-01-01

    Dr Robert Leopold Spitzer (May 22, 1932-December 25, 2015), the architect of modern psychiatric diagnostic criteria and classification, died recently at the age of 83 in Seattle. Under his leadership, the American Psychiatric Association's (APA) Diagnostic and Statistical Manuals (DSM) became the international standard.

  2. Wikinews interviews World Wide Web co-inventor Robert Cailliau

    CERN Multimedia

    2007-01-01

    "The name Robert Caillau may not ring a bell to the general pbulic, but his invention is the reason why you are reading this: Dr. Cailliau together with his colleague Sir Tim Berners-Lee invented the World Wide Web, making the internet accessible so it could grow from an academic tool to a mass communication medium." (9 pages)

  3. Conceptualising Childhood: Robert Louis Stevenson's "A Child's Garden of Verses."

    Science.gov (United States)

    Webb, Jean

    2002-01-01

    Discusses the construct of childhood in Robert Louis Stevenson's collection of poems, "A Child's Garden of Verses," by employing notions of child development drawn from Jean Piaget and Lev Vygotsky. Finds, from a literary perspective, Stevenson's collection located on the boundaries of romanticism and modernism. (BT)

  4. 75 FR 53861 - Airworthiness Directives; Robert E. Rust, Jr. Model DeHavilland DH.C1 Chipmunk 21, DH.C1 Chipmunk...

    Science.gov (United States)

    2010-09-02

    ... Airworthiness Directives; Robert E. Rust, Jr. Model DeHavilland DH.C1 Chipmunk 21, DH.C1 Chipmunk 22, and DH.C1...). ACTION: Final rule. SUMMARY: We are adopting a new airworthiness directive (AD) for all Robert E. Rust... CFR part 39) to include an AD that would apply to all Robert E. Rust, Jr. Models DeHavilland DH.C1...

  5. Robert Lacoste's the darker side practical applications for electronic design concepts from circuit cellar

    CERN Document Server

    Lacoste, Robert

    2009-01-01

    Robert Lacoste's The Darker Side column has quickly become a must read among Circuit Cellar devotees. His column provides readers with succinct theoretical concepts and practical applications on topics as far reaching as digital modulation to antenna basics. Difficult concepts are demystified as Robert shines a light on complex topics within electronic design.This book collects sixteen Darker Side articles that have been enriched with new, exclusive content from the author. An intro into The Darker Side will give examples of material that can enhance and optimize the way you design. A

  6. Sprawl: A Compact History (Author: Robert Bruegmann)

    OpenAIRE

    Hayter, Jason Alexander

    2006-01-01

    Search a well-stocked library or bookstore for works on urban form and you might reach the same conclusion drawn by Robert Bruegmann: "Most of what has been written about sprawl to date has been written about com­ plaints" (p. 3). But what separates Bruegmann, a professor of art history, architecture, and urban planning at the University of Illinois at Chicago, from most people is what he does next. "[S]o many 'right-minded' people were so vociferous on the subject that I began to suspect tha...

  7. Evaluation of the tannic acid inhibitory effect against the NorA efflux pump of Staphylococcus aureus.

    Science.gov (United States)

    Tintino, Saulo R; Oliveira-Tintino, Cícera D M; Campina, Fábia F; Silva, Raimundo L P; Costa, Maria do S; Menezes, Irwin R A; Calixto-Júnior, João T; Siqueira-Junior, José P; Coutinho, Henrique D M; Leal-Balbino, Tereza C; Balbino, Valdir Q

    2016-08-01

    During the early periods of antibiotic usage, bacterial infections were considered tamed. However, widespread antibiotic use has promoted the emergence of antibiotic-resistant pathogens, including multidrug resistant strains. Active efflux is a mechanism for bacterial resistance to inhibitory substances, known simply as drug efflux pumps. The bacterium Staphylococcus aureus is an important pathogenic bacterium responsible for an array of infections. The NorA efflux pump has been shown to be responsible for moderate fluoroquinolone resistance of S. aureus. The inhibition of the efflux pump was assayed using a sub-inhibitory concentration of standard efflux pump inhibitors and tannic acid (MIC/8), where its capacity to decrease the MIC of Ethidium bromide (EtBr) and antibiotics due to the possible inhibitory effect of these substances was observed. The MICs of EtBr and antibiotics were significantly reduced in the presence of tannic acid, indicating the inhibitory effect of this agent against the efflux pumps of both strains causing a three-fold reduction of the MIC when compared with the control. These results indicate the possible usage of tannic acid as an adjuvant in antibiotic therapy against multidrug resistant bacteria (MDR). Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Invited commentary on 'Robert G Edwards and the Roman Catholic Church'.

    Science.gov (United States)

    Head, Ivan Francis

    2011-06-01

    In this issue of Reproductive BioMedicine Online, Benagiano, Carrara and Filippi have produced a clearly written and comprehensive account of why the Roman Catholic Church has not welcomed the award of the 2010 Nobel Prize in Physiology and Medicine to Dr Robert G Edwards for the development of human IVF. I commend the article for its clarity and lucidity but attempt to point out some areas where disagreement even with its nuanced opposition to IVF may be legitimate. I try to make some simple comments that explain why this is so and I suggest some areas to which contemporary theology and philosophy can commit itself. But it is good to see even a nuanced response to the work of Robert G Edwards rather than a blanket condemnation. Copyright © 2011 Reproductive Healthcare Ltd. Published by Elsevier Ltd. All rights reserved.

  9. Introduction : L'étendue des travaux de Robert Buijtenhuis

    NARCIS (Netherlands)

    Binsbergen, van W.M.J.; Konings, P.J.J.; Binsbergen, van W.M.J.; Hesseling, G.S.C.M.

    2000-01-01

    Cet ouvrage présente onze contributions rédigées par des africanistes qui ont collaboré étroitement avec l'anthropologue politique néerlandais Robert Buijtenhuijs et ont été influencés par ses travaux et sa personnalité. Le livre est un hommage à un auteur qui a été productif dans beaucoup de

  10. Robert J. Aumann - matemaatikust Nobeli preemia laureaat / Peeter Puusemp

    Index Scriptorium Estoniae

    Puusemp, Peeter, 1947-

    2006-01-01

    2005. a. Nobeli preemia majanduse alal silmapaistva panuse eest mänguteooria ülesannete lahendamisse saanud Robert J. Aumannist ja D. Saari loetelu matemaatikutest - Nobeli preemia laureaatidest: John Nash'ist, Herbert Hauptman'ist, John Pople'ist, Bertrand Arthur William Russell'ist, Kenneth Joseph Arrow'ist, Gerard Debreu'ist, Leonid Vitaljevitš Kantorovitš'ist, Reinhard Selten'ist, Jan Tinbergen'ist

  11. Kablilt Casablancasse : Eesti suurim seikleja John Robert Ignace Lepp 100 / Vello Salo

    Index Scriptorium Estoniae

    Salo, Vello, 1925-

    2009-01-01

    Eesti päritolu seikleja John Robert Lepp, Prantsusmaal tuntud kui katoliku kiriku preester Ignace Lepp, avaldas prantsuse ja saksa keeles hulgaliselt raamatuid psühholoogia, filosoofia ja religiooni valdkonnast

  12. Underwater EVA training in the WETF with astronaut Robert L. Stewart

    Science.gov (United States)

    1983-01-01

    Underwater extravehicular activity (EVA) training in the weightless environment training facility (WETF) with astronaut Robert L. Stewart. Stewart is simulating a planned EVA using the mobile foot restraint device and a one-G version of the Canadian-built remote manipulator system.

  13. A Pedagogy of Sight: Microscopic Vision in Robert Hooke's "Micrographia"

    Science.gov (United States)

    Jack, Jordynn

    2009-01-01

    Robert Hooke's "Micrographia" (1665) holds an important place in the history of scientific visual rhetoric. Hooke's accomplishment lies not only in a stunning array of engravings, but also in a "pedagogy of sight"--a rhetorical framework that instructs readers how to view images in accordance with an ideological or epistemic program. Hooke not…

  14. 76 FR 71369 - Robert G. Crummie, M.D.; Decision and Order

    Science.gov (United States)

    2011-11-17

    ... agencies to perform meaningless tasks. See Layfe Robert Anthony, M.D., 67 FR 35582 (DEA 2002); Michael G.... Kirk v. Mullen, 749 F.2d 297 (6th Cir. 1984); Puerto Rico Aqueduct and Sewer Auth. v. EPA, 35 F.3d 600...

  15. [Robert Koch was right. Towards a new interpretation of tuberculin therapy].

    Science.gov (United States)

    Cardona, Pere J

    2006-01-01

    At the centenary of Robert Koch's Nobel Prize award, tuberculosis treatment with tuberculin, which was announced in Berlin in 1890, is still considered a failure. Nevertheless, there is now sufficient information supporting the idea that tuberculin therapy was widely used until the second half of the twentieth century; thus, the impact of this treatment should be studied and related to the decrease in tuberculosis-related mortality recorded in that period. Moreover, tuberculin therapy has inspired at least two new immunotherapies; these, however, were directed toward precisely the opposite effect: suppression of the Koch phenomenon. Thus, inoculation of Mycobacterium vaccae polarizes the immune response towards the Th1 type; and inoculation of RUTI avoids local immunodepression after short-term chemotherapy without inducing toxicity. For this reason, Robert Koch's work on antituberculosis therapy should be reread and proper recognition given to his contribution in this field.

  16. Doctor Julius Robert Mayer and Energy Processes in Living Systems

    Science.gov (United States)

    Erlichson, Herman

    2007-01-01

    The overwhelming majority of important papers in physics are written by physicists. But the physician Julius Robert Mayer (1814-1878, see photo) did a valid theoretical calculation of the mechanical equivalent of heat just before Joule reported on his results from his well-known paddle-wheel experiments. Joule is well-known to physics people and…

  17. ROBERT autonomous navigation robot with artificial vision

    International Nuclear Information System (INIS)

    Cipollini, A.; Meo, G.B.; Nanni, V.; Rossi, L.; Taraglio, S.; Ferjancic, C.

    1993-01-01

    This work, a joint research between ENEA (the Italian National Agency for Energy, New Technologies and the Environment) and DIGlTAL, presents the layout of the ROBERT project, ROBot with Environmental Recognizing Tools, under development in ENEA laboratories. This project aims at the development of an autonomous mobile vehicle able to navigate in a known indoor environment through the use of artificial vision. The general architecture of the robot is shown together with the data and control flow among the various subsystems. Also the inner structure of the latter complete with the functionalities are given in detail

  18. Remediating Language Deficient/Dyslexic College Students: An Interview with Robert Nash.

    Science.gov (United States)

    Lundquist, Arlene J.; Nash, Robert

    1988-01-01

    Robert Nash responds to questions concerning his personal and professional background, the Simultaneous Multisensory Instructional Procedure for Teaching the Complete Sound Structure of the Language, problems associated with dyslexia, the social/emotional impact of learning disabilities, and the University of Wisconsin's Project Success for…

  19. Kollaaž ja kontekst. Robert Rumase liiklusmärgid Tallinnas / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2004-01-01

    Sekkuv kunst. Poola kunstniku Robert Rumase (1966) rahvusvahelisest kunstiprojektist "Linnamanöövrid", Kai Kaljo videost "One way to see America", Krzysztof Wodicko "Kodutute projektsioonist" ja New York City Unioni väljaku ümberkorraldamisest

  20. Must, valge + hall : Sam Wagstaffi ja Robert Mapplethorpe'i portree / Madis Palm

    Index Scriptorium Estoniae

    Palm, Madis

    2008-01-01

    Dokumentaalfilm "Black, White & Gray: Sam Wagstaff and Robert Mapplethorpe" : autor ja režissöör James Crump : Ameerika Ühendriigid 2007. Filmi näidati filminädala "Art in America" raames Tallinnas

  1. Drawings of fossils by Robert Hooke and Richard Waller

    Science.gov (United States)

    Kusukawa, Sachiko

    2013-01-01

    The drawings of fossils by Robert Hooke and Richard Waller that were the basis of the engravings in Hooke's Posthumous works (1705) are published here for the first time. The drawings show that both Hooke and Waller were proficient draftsmen with a keen eye for the details of petrified objects. These drawings provided Hooke with a polemic edge in making the case for the organic origins of ‘figured stones’.

  2. Lydia J. Roberts's Nutrition Research and the Rhetoric of "Democratic" Science

    Science.gov (United States)

    Jack, Jordynn

    2009-01-01

    This article examines nutritionist Lydia J. Roberts's use of the "democratic approach" as a rhetorical strategy both to build solidarity among scientists and to enact participatory research in a rural Puerto Rican community. This example suggests that participatory scientific methodologies are not necessarily democratic but may function…

  3. Gay theatre, AIDS, and taboo: reconsidering Robert Chesley.

    Science.gov (United States)

    Gavrila, Rebecca

    2013-01-01

    Theatre was among the first popular culture forms to address HIV/AIDS and did so memorably in such works as The Normal Heart, As Is, Love! Valor! Compassion!, and March of the Falsettos. As a response to criticisms of stage dramas focusing on HIV/AIDS in the main as undifferentiated and melodramatic, the author suggests critical consideration of two works by playwright Robert Chesley. In her analysis of Night Sweats and Jerker, the author argues Chesley offers an alternative perspective that is both liberatory and sex-positive.

  4. Robert Hooke (1635-1703), in his own words.

    Science.gov (United States)

    Breathnach, C S

    2003-11-01

    The diaries and other writings of Robert Hooke (1635-1703), as well as those of his contemporaries, are drawn upon to sketch his social and scientific life. An account is presented of his involvement with the Royal Society from its earliest days, and of his relations with notable scientists. In exploring the similarity between combustion and respiration, he established that air is composed of different gases, and that it is not motion of the lungs but a supply of fresh air that is necessary for life.

  5. The importance of chromosome studies in Roberts syndrome/SC phocomelia and other cohesinopathies.

    Science.gov (United States)

    Gerkes, Erica H; van der Kevie-Kersemaekers, Anne-Marie F; Yakin, Mariam; Smeets, Dominique F C M; van Ravenswaaij-Arts, Conny M A

    2010-01-01

    Roberts syndrome/SC phocomelia is a rare, autosomal recessive syndrome characterised by pre- and postnatal growth retardation, microcephaly, craniofacial anomalies, mental retardation, and tetraphocomelia in varying degrees of severity. The clinical diagnosis can be challenging in phenotypically mild cases. In the extremely mild case presented here, specific mitotic abnormalities were detected and proved to be very helpful, since Roberts syndrome/SC phocomelia could be diagnosed after finding premature centromere separation and somatic aneuploidy at routine karyotyping. We discuss these and other mitotic cytogenetic abnormalities that can be of significant diagnostic importance, but which will be missed if only array studies are performed. We also discuss the difference between premature centromere separation and premature (sister) chromatid separation. Copyright (c) 2009 Elsevier Masson SAS. All rights reserved.

  6. [Robert Schweitzer. Finnland, das Zarenreich und die Deutschen] / Karsten Bgüggemann

    Index Scriptorium Estoniae

    Brüggemann, Karsten, 1965-

    2011-01-01

    Arvustus: Robert Schweitzer. Finnland, das Zarenreich und die Deutschen : gesammelte Studien zum europäischen Nordosten. Festgabe zum 60. Geburtstag des Verfassers. Hrsg. von Uta-Maria Liertz. (Veröffentlichungen der Aue-Stiftung. Bd. 20) Verlag Schmidt-Römhild

  7. A biography of Robert de Kersauson, French volunteer with the ...

    African Journals Online (AJOL)

    One of the most colourful foreign volunteers in the Boer army in 1900-1902 was Robert de Kersauson de Pennendreff; young, handsome, gallant and devoted to the Boer cause until the bitter end of the war. His love for South Africa brought him after an absence of almost 40 years back to this country to find a quiet place to ...

  8. Marian Roberts, Developing the Craft of Mediation: Reflections on Theory and Practice

    Directory of Open Access Journals (Sweden)

    Ghislaine M. Lanteigne

    2008-10-01

    Full Text Available In Developing the Craft of Mediation, Marian Roberts proposes that mediation is akin to a craft with its focus on learning from experience and from others working in the field to develop and master knowledge and skills.

  9. Tüli Robert Smithsoni "Spiraalse muuli" taastamise ümber / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2004-01-01

    Ameerika maakunstniku Robert Smithsoni (1938-1973) töö "Spiral Jetty" / "Spiraalne muul", mis on ligi 30 aastat seisnud nähtamatult Utah' osariigis Suure Soolajärve põhjas, on praegu kogu ulatuses näha. Teose omanik Dia kunstikeskus on dilemma ees, kas muul restaureerida või mitte

  10. Estudo de dois mapas do geógrafo Robert de Vaugondy relativos ao Reino de Portugal do Século XVIII (1751

    Directory of Open Access Journals (Sweden)

    Marco Pais Neves dos Santos

    2013-07-01

    Full Text Available Analisamos dois mapas alusivos ao reino de Portugal, datados de 1751, publicados em Paris e assinados pelo geógrafo Robert de Vaugondy, a saber: Partie Septentrionale du Royaume de Portugal, par le Sr. Robert, Geographe ordinaire du Roy. Avec Privilege. 1751. e Partie Meridionale du Royaume de Portugal, par le Sr. Robert, Geographe ordinaire du Roy. Avec Privilege. 1751., com o objetivo de propor uma explicação para as divisões administrativas cartografadas. Como suporte ao objeto do trabalho, caracterizamos de forma concisa a evolução dos limites administrativos do reino de Portugal, desde a sua formação até a atualidade, e abordamos a vida e obra de Robert de Vaugondy. Concluímos ser o mais consentâneo com a lógica representarem divisões eclesiásticas.

  11. Problem in Two Unknowns: Robert Hooke and a Worm in Newton's Apple.

    Science.gov (United States)

    Weinstock, Robert

    1992-01-01

    Discusses the place that Robert Hooke has in science history versus the scientific contributions he made. Examines the relationship between Hooke and his contemporary, Isaac Newton, and Hooke's claims that Newton built on his ideas without receiving Newton's recognition. (26 references) (MDH)

  12. A Study of Nora and Eliza from the Perspective of Feminism%女性主义视角下娜拉与伊莉莎的对比思考

    Institute of Scientific and Technical Information of China (English)

    卢青青

    2012-01-01

    易卜生笔下《玩偶之家》中的娜拉和萧伯纳《格梅利翁》中的伊莉莎生活背景迥然不同,但她们有着极其相似的经历,她们都有很强的觉醒意识,是追求独立自主、平等和谐的女性代言人。从女性主义视角走进娜拉和伊莉莎的世界,探索在男权社会中女性的人生和命运,以寻求现代女性在家庭、社会中如何关注个体发展,形成自己的独立人格,实现真正的自强自立。%The protagonists Nora in A Doll ' s House and Eliza in Pygmalion have quite different living background, but they possess similar experience. Both of them, having strong self-awareness, are the spokespersons who pursue self-independent, free and harmony life. From the perspective of feminism, it goes into the world of Nora and Eliza to explore the life and of the females in the situation of patriarchy. From the, modern women may have a better and right judgment of how to pay attention to their individual development and their family and social roles, by which they can develop their own independent personalities and truly achieve self-improvement and self-support and self-reliance in modern society.

  13. Novel insight into antimicrobial resistance and sensitivity phenotypes associated to qac and norA genotypes in Staphylococcus aureus.

    Science.gov (United States)

    Marchi, Emmanuela; Furi, Leonardo; Arioli, Stefania; Morrissey, Ian; Di Lorenzo, Valeria; Mora, Diego; Giovannetti, Luciana; Oggioni, Marco Rinaldo; Viti, Carlo

    2015-01-01

    Staphylococcus aureus strains harboring QacA, QacB, QacC, QacG transporters and norA promoter up-regulating mutations were characterized by phenotype microarray (PM), standard methods for susceptibility testing, and ethidium bromide efflux assays, in order to increase knowledge on phenotypes associated to efflux pumps and their substrates. PM data and standard susceptibility testing lead to the identification of new potential efflux targets, such as guanidine hydrochloride or 8-hydroxyquinoline for QacA and QacC pumps, respectively. The identification of compounds to which the presence of efflux pumps induced increased susceptibility opens new perspectives for potential adjunct anti-resistance treatment (i.e. strains bearing QacB transporters showed increased susceptibility to thioridazine, amitriptyline and orphenadrine). Although the tested isolates were characterized by high degree of heterogeneity, a hallmark of clinical isolates, direct ethidium bromide efflux assays were effective in highlighting differences in efflux efficiency among strains. These data add to characterization of substrate specificity in the different classes of staphylococcal multidrug efflux systems conferring specific substrate profiles and efflux features to each of them. Copyright © 2014 Elsevier GmbH. All rights reserved.

  14. The importance of chromosome studies in Roberts syndrome/SC phocomelia and other cohesinopathies.

    NARCIS (Netherlands)

    Gerkes, E.H.; Kevie-Kersemaekers, A.M. van der; Yakin, M.; Smeets, D.F.C.M.; Ravenswaaij-Arts, C.M.A. van

    2010-01-01

    Roberts syndrome/SC phocomelia is a rare, autosomal recessive syndrome characterised by pre- and postnatal growth retardation, microcephaly, craniofacial anomalies, mental retardation, and tetraphocomelia in varying degrees of severity. The clinical diagnosis can be challenging in phenotypically

  15. The importance of chromosome studies in Roberts syndrome/SC phocomelia and other cohesinopathies

    NARCIS (Netherlands)

    Gerkes, Erica H.; van der Kevie-Kersemaekers, Anne-Marie F.; Yakin, Mariam; Smeets, Dominique F. C. M.; van Ravenswaaij-Arts, Conny M. A.

    2010-01-01

    Roberts syndrome/SC phocomelia is a rare, autosomal recessive syndrome characterised by pre- and postnatal growth retardation, microcephaly, craniofacial anomalies, mental retardation, and tetraphocomelia in varying degrees of severity. The clinical diagnosis can be challenging in phenotypically

  16. Robert Aymar awarded the Légion d’honneur

    CERN Multimedia

    CERN Bulletin

    2011-01-01

      On 24 May, Robert Aymar, CERN Director-General from 2004 to 2008, was awarded the Légion d’honneur by the French authorities in recognition of his outstanding scientific career. A renowned French physicist, he was Director of the superconducting tokamak Tore Supra from 1977 to 1988, Director of Material Sciences at the CEA in 1990 and Director of the ITER project in 1994. His term of office as CERN Director-General was marked in particular by the commissioning and start-up of the LHC machine, which he inaugurated on 21 October 2008.        

  17. Robert Hooke, inventor of the vacuum pump and the first altitude chamber (1671).

    Science.gov (United States)

    Harsch, Viktor

    2006-08-01

    Robert Hooke (1635-1703), an assistant researcher to Robert Boyle (1627-1691), invented the first functional British air pump. Applying it to scientific research, Hooke operated the world's first hypobaric chamber in 1671, using it for self-experimentation. He recorded the first physiological observations in an artificial altitude-equivalent environment up to 2400 m. Though Hooke's experiment showed some methodological insufficiencies, his imaginative experimental techniques were remarkable for their time and were indicative of the lively intellectual atmosphere of the Royal Society and the significant contributions of Hooke, who was a member. Two centuries passed before the French physiologist Paul Bert (1830-1886) conducted his famous laboratory-supported investigations of high altitude physiology. Bert played a decisive role in the discovery of the causes of decompression sickness; a contribution Hooke could not make due to the technical deficiencies of the 17th century.

  18. Hodorkovski advokaat : Venemaa ei ole õigusriik / Robert R. Amsterdam ; interv. Aleksei Günter

    Index Scriptorium Estoniae

    Amsterdam, Robert R.

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 24. juuli lk. 10. Naftamagnaadi Mihhail Hodorkovski advokaat vastab küsimustele, mis puudutavad ärimehe olukorda ja elamistingimusi vanglas ning tema võimalust ennetähtaegselt vabaneda. Lisa: Robert R. Amsterdam

  19. An Environment for Treating Youthful Offenders: The Robert F. Kennedy Youth Center

    Science.gov (United States)

    Johnson, V. Scott

    1977-01-01

    Describes goals of the Robert F. Kennedy Youth Center (KYC) and the philosophical stance and the implementation of that philosophy within the center. Issues discussed range from administrative structure through descriptions of inmate classification and treatment. Educational and vocational programs as well as the token economy systems are…

  20. Saksa filmilootusega tänavaelust ja hullusest / Robert Stadlober ; interv. Janno Zõbin

    Index Scriptorium Estoniae

    Stadlober, Robert

    2002-01-01

    Pimedate Ööde Filmifestivalil näidatud saksa mängufilmis "Engel & Joe" (režissöör Vanessa Jopp) ühes peaosas esines festivali külastanud saksa näitleja Robert Stadlober (1982). Näitleja Engeli rollist ja oma elukogemusest, mis aitas seda rolli kehastada

  1. American Community Colleges in Crisis--A Conversation with Robert H. McCabe.

    Science.gov (United States)

    Dubocq, Tom

    1981-01-01

    Educational reform by Miami-Dade Community College is discussed by its president, Robert H. McCabe. In an action that is considered unusual for two-year schools, it has tightened controls on its curriculum, faculty, and students. A commitment to achieving higher levels of literacy is advocated. (MLW)

  2. Looking Forward: Texas and Its Elderly. Highlights of the Robert Lee Sutherland Seminar (4th, Austin, Texas, May 12, 1984).

    Science.gov (United States)

    Coleman, Marion Tolbert, Ed.; And Others

    This document presents the program agenda and highlights from the one-day Robert Lee Sutherland Seminar held to examine the current status and the future of the elderly population of Texas. Included is the speech, "The Longevity Revolution" by Robert N. Butler, in which is discussed the gain in life expectancy, the feminization of aging,…

  3. 78 FR 51802 - Culturally Significant Objects Imported for Exhibition Determinations: “Robert Motherwell: The...

    Science.gov (United States)

    2013-08-21

    ... ``Robert Motherwell: The Early Collages,'' imported from abroad for temporary exhibition within the United... the Solomon R. Guggenheim Museum, New York, New York, from on or about September 27, 2013, until on or...

  4. Robert Priddle talking straight

    International Nuclear Information System (INIS)

    Anon

    2000-01-01

    A keynote speaker at Outlook 2001 conference, Robert Priddle, Executive Director of the International Energy Agency, provided a realistic assessment of the opportunities for a change in the energy supply mix in the light of the growing international debate about the design of a sustainable energy future. World energy supply today is based firmly on fossil fuels. Furthermore, projections of future supply, such as that made in the reference case of the recent World Energy Outlook by the IEA, indicate little change. Yet government's remain deeply engaged in efforts to reshape energy markets including (despite the failure of COP-6 in The Hague last November) efforts to curb national emissions of greenhouse gases, in particular from the energy sector. Australia has made considerable progress in developing and applying life cycle analysis to the energy sector. This effort demonstrates opportunities to combine, for example, coal seam methane capture, coal and biomass co-combustion, coal power generation and steel production and thus to reduce emissions by up to 15%. The prospect is that even with effective carbon constraints reflected in fuel prices, coal can remain a competitive fuel choice for longer than many analysts imagine. The outcome does not rely on exotic technology development, rather it requires the necessary market signals to create new business partnerships

  5. Robert Owen: A Historiographic Study of a Pioneer of Human Resource Development

    Science.gov (United States)

    Hatcher, Tim

    2013-01-01

    Purpose: The purpose of this paper is to investigate the ideals and activities of the nineteenth century Welsh industrialist and reformer Robert Owen (1771-1858), and how they informed modern human resource development (HRD) concepts and practices and provided evidence of Owen as a HRD pioneer. Design/methodology/approach: Historiography provided…

  6. Research, Learning Theory, and the Ideas of Robert G. Sidnell. Special Issue.

    Science.gov (United States)

    Alexander, David, Ed.; And Others

    1987-01-01

    Intended as a memorial to Robert G. Sidnell, this special issue contains articles about areas of music education which he promoted. In "The Dimensions of Research in Music Education," Sidnell concluded that music education research encompasses all humanistic disciplines as well as the behavioral and social sciences. James Carlsen, in…

  7. The molecular mechanism underlying Roberts syndrome involves loss of ESCO2 acetyltransferase activity

    NARCIS (Netherlands)

    Gordillo, Miriam; Vega, Hugo; Trainer, Alison H.; Hou, Fajian; Sakai, Norio; Luque, Ricardo; Kayserili, Hülya; Basaran, Seher; Skovby, Flemming; Hennekam, Raoul C. M.; Uzielli, Maria L. Giovannucci; Schnur, Rhonda E.; Manouvrier, Sylvie; Chang, Susan; Blair, Edward; Hurst, Jane A.; Forzano, Francesca; Meins, Moritz; Simola, Kalle O. J.; Raas-Rothschild, Annick; Schultz, Roger A.; McDaniel, Lisa D.; Ozono, Keiichi; Inui, Koji; Zou, Hui; Jabs, Ethylin Wang

    2008-01-01

    Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced growth

  8. Using Performance as an Interpretive Strategy in Teaching Robert Browning's "My Last Duchess."

    Science.gov (United States)

    Schevera, Nicholas

    1997-01-01

    Uses role-playing, dramatic monologues, and "tableaux vivant" to interpret Robert Browning's poem "My Last Duchess" in an introductory literature class at Westchester Community College. Notes that performative strategies illustrate connections in the poem that often remain unnoticed on a first reading. (PA)

  9. The strange trial of Robert Oppenheimer

    International Nuclear Information System (INIS)

    Kevles, D.J.

    2004-01-01

    Robert Oppenheimer has become the symbol of the scientist tormented and anguished by the consequences of his discoveries. R.Oppenheimer took a major part in the Manhattan project for the designing of the first atomic bomb. During this period he considered the thermonuclear bomb as the next step to reach but after Japan's surrender he reconsidered his position and favoured a more moderate atomic policy. R.Oppenheimer began to militate in favour of an international control of nuclear energy and wanted that Usa relinquish to design the hydrogen bomb. In 1953 in full Mac-Carthysm era, he was accused of being a communist and of spying for Ussr and as a consequence he was deprived of his office in AEC (atomic energy committee) but in 1963 president Lyndon Johnson rehabilitated him and R.Oppenheimer was awarded the highest reward of AEC: the Enrico Fermi prize. (A.C.)

  10. Summary Robert Noyce and the invention of Silicon Valley

    CERN Document Server

    2014-01-01

    This work offers a summary of the book "THE MAN BEHIND THE MICROCHIP: Robert Noyce and the Invention of Silicon Valley""by Leslie Berlin.The Man behind the Microchip is Leslie Berlin's first book. This author is project historian for the Silicon Valley Archives, a division of the Stanford University Department of Special Collections. This book tells the story of a giant of the high-tech industry: the multimillionaire Bob Noyce. This co-founder of Fairchild Semiconductor and Intel co-invented the integrated circuit which became the electronic heart of every modern computer, automobile, advance

  11. Robert Wiltrout Says Goodbye to NCI in 2015 | Poster

    Science.gov (United States)

    After 34 years at NCI, Robert Wiltrout, Ph.D., said he is looking forward to trading his I-270 commute for another type of commute: exploring the waterways of Maryland, Alaska, and Wyoming to fulfill his love of fishing. Wiltrout officially retired as director of the NCI Center for Cancer Research (CCR) on July 2 of last year. Throughout his college academic career, Wiltrout had an interest in science, but it was not until he was working on a research project for his master’s degree that he considered a career in scientific research.

  12. Welcoming the Sunlight: A Conversation with Mary Kay Zabel and Robert Zabel

    Science.gov (United States)

    Teagarden, James; Kaff, Marilyn

    2018-01-01

    Professors Emeriti Mary Kay and Robert Zabel share their reflections on their long and productive careers working with students and teachers. Their respective careers share much of the same history and complement each other. The Zabels share their advice with those entering the field and the challenges they see for the education of students with…

  13. The scientific careers of Robert Sinclair and Nestor Zaluzec - A brief sketch

    Energy Technology Data Exchange (ETDEWEB)

    Fraser, Hamish L. [The Ohio State University (United States); Smith, David J., E-mail: david.smith@asu.edu [Arizona State University (United States); Wittig, James E. [Vanderbilt University (United States)

    2017-05-15

    Robert (Bob) Sinclair and Nestor Zaluzec have been working for many years at the leading edge of developments in electron microscopy techniques and applications. Their distinguished careers and some of their notable scientific achievements are briefly highlighted. - Highlights: • Biographical sketch of Bob Sinclair • Biographical Sketch of Nestor Zaluzec • Scientific career highlights.

  14. The scientific careers of Robert Sinclair and Nestor Zaluzec - A brief sketch

    International Nuclear Information System (INIS)

    Fraser, Hamish L.; Smith, David J.; Wittig, James E.

    2017-01-01

    Robert (Bob) Sinclair and Nestor Zaluzec have been working for many years at the leading edge of developments in electron microscopy techniques and applications. Their distinguished careers and some of their notable scientific achievements are briefly highlighted. - Highlights: • Biographical sketch of Bob Sinclair • Biographical Sketch of Nestor Zaluzec • Scientific career highlights

  15. Investigation of noble metal deposition behaviour in boiling water reactors. The NORA project

    International Nuclear Information System (INIS)

    Ritter, Stefan; Karastoyanov, Vasil; Abolhassani-Dadras, Sousan; Guenther-Leopold, Ines; Kivel, Niko

    2010-01-01

    NobleChem trademark is a technology developed by General Electric to reduce stress corrosion cracking (SCC) in reactor internals and recirculation pipes of boiling water reactors (BWRs) while preventing the negative side effects of classic hydrogen water chemistry. Noble metals (Pt, Rh) acting as electrocatalysts for the recombination of O 2 and H 2 O 2 with H 2 to H 2 O and thus reducing the corrosion potential more efficiently are injected into the feedwater during reactor shutdown (classic method) or on-line during power operation. They are claimed to deposit as very fine metallic particles on all water-wetted surfaces, including the most critical regions inside existing cracks, and to stay electrocatalytic over long periods of time. The effectiveness of this technology in plants still remains to be demonstrated. Based on highly credible laboratory experiments down to the sub-μg . kg -1 Pt concentration range, SCC mitigation may be expected, provided that a stoichiometric excess of H 2 and a sufficient surface coverage with very fine Pt particles exist simultaneously at the critical locations [1]. Very little is known about the deposition and (re-)distribution behaviour of the Pt in the reactor. For the validation of this technique the research project NORA (noble metal deposition behaviour in BWRs) has been started at the Paul Scherrer Institute (PSI) with two main objectives: (i) to gain phenomenological insights and a better basic understanding of the Pt distribution and deposition behaviour in BWRs; (ii) to develop and qualify a non-destructive technique to characterise the size and distribution of the Pt particles and the local concentration of Pt on reactor components. This paper presents the objectives of the project, the planned work and a brief description of the status of the project. (orig.)

  16. James George Frazer’s Anthropologic Heritage in the Work of Robert Graves

    Directory of Open Access Journals (Sweden)

    Tomislav M. Pavlović

    2016-02-01

    Full Text Available The works of Sir James George Frazer had an outstanding influence on the literature of modernism. Among those who benefited from Frazer’s ritualism were W. B. Yeats, T. S. Eliot. James Joyce, Ernest Hemingway, D. H. Lawrence, Ezra Pound, Mary Renault, Joseph Campbell, Robert Graves and many others. Robert Graves was known for his famous adaptation of Frazer’s concept of the sacred king who is sacrificed for the benefit of his subjects thus forming the narrative frame for the one of his most controversial novels. The dying king is also identified with the poet striving to attain the favour of the Triple Muse Goddess - who represents the embodiment of true poetic inspiration. The aforementioned concept is not the only thing that Graves inherited from his famous ancestor. In our analysis we laid stress on the customs, rituals, magic symbols and deities both authors dealt with. We also observed a striking resemblance of the style Greves and Frazer developed and their euchemeristic approach to myths as well.

  17. Tim, Jan Lucas ja Karl Robert - vennad üheks kuuks / Maris Laurits

    Index Scriptorium Estoniae

    Laurits, Maris

    2009-01-01

    Rakvere Teatri suvelavastuse "Vennad Lõvisüdamed" kaks Karli osatäitjat Jan Lucas Videvik ja Tim Leesnurm ning Joonatani osatäitja Karl Robert Saaremäe tegid Loksal Kaldmaa talus ratsasõiduproove. Üllar Saaremäe lavastuse "Vennad Lõvisüdamed" (Astrid Lindgreni samanimelise jutustuse järgi) esietendus on 11. juunil Rakvere teatri taga aias

  18. Robert Lévy-Mandel (1923-2010)

    CERN Multimedia

    2010-01-01

    Former CERN Director Robert Lévy-Mandel passed away on 3 July at the age of 87.   After obtaining a diploma from the Institut polytechnique in Grenoble, in 1948 he started work at the CEA, and was involved in the development and construction of the Saclay institute's first particle accelerator, a Van de Graaff machine. From 1954 to 1957 he was responsible for the coordination, development and construction of the CEA’s Saturne synchrotron, which entered service in 1958. In 1963 he was appointed head of the Saturne Synchrotron Department. The team led the construction of the Gargamelle bubble chamber, which was installed at CERN, and made contributions to other major facilities, including the Big European Bubble Chamber (BEBC). In 1971 he was invited to come to Geneva by John Adams, who was in charge of the SPS accelerator project. With the start of the SPS project, CERN had two laboratories, one at Meyrin and one at Prévessin, each with its own Director General: ...

  19. Robert Musil y los Estados desunificados de Europa

    Directory of Open Access Journals (Sweden)

    Bayón, Fernando

    2006-12-01

    Full Text Available This article is a study of Robert Musil´s work “The Man Without Qualities” from philosophical sources. It is a novel that has produced so many overriding metaphors through which we can better understand the crises of the social identity on the horizont of the last modernity in Europe. Much of the key-concepts that helped in creating the so called “Leyend of Modernity” start to vanish in an irremediable way: not only did Musil trace the disappearance of the support for national aspirations and social cohesion, he also showed us how culture is a mad carrousel of collapsed expectations, and how the prevailing idea of “subjectivity” lacks today any solid or essential nucleus. In the middle of this disenchanted landscape of Europe, where all the modern and clasical illusions became nothing, appears however “a new human being”, since the man “without qualities” is the man with endless possibilities too.El presente ensayo es una interpretación de la novela de Robert Musil “El hombre sin atributos” a partir de fuentes filosóficas. Se trata de una obra que ha producido algunas metáforas decisivas para comprender las crisis de la identidad social en el horizonte de la última modernidad europea. Muchos de los conceptos clave que ayudaron a crear la leyenda de la modernidad empiezan a erosionarse de modo irreversible: se descomponen las aspiraciones nacionales, el sujeto pierde su núcleo sustancial y la cultura es un carrusel de esperanzas abortadas incapaces de responder a ninguna idea rectora. Y, sin embargo, en el paisaje de esta Europa tardomoderna en que se han agotado las pasadas ilusiones surge la idea de que el “hombre sin atributos” es también el “hombre de las posibilidades”.

  20. Robert Hooke: early respiratory physiologist, polymath, and mechanical genius.

    Science.gov (United States)

    West, John B

    2014-07-01

    Robert Hooke (1635-1703) was a polymath who made important contributions to respiratory physiology and many other scientific areas. With Robert Boyle, he constructed the first air pump that allowed measurements on small animals at a reduced atmospheric pressure, and this started the discipline of high-altitude physiology. He also built the first human low-pressure chamber and described his experiences when the pressure was reduced to the equivalent of an altitude of ∼2,400 m. Using artificial ventilation in an animal preparation, he demonstrated that movement of the lung was not essential for life. His book Micrographia describing early studies with a microscope remains a classic. He produced an exquisite drawing of the head of a fly, showing the elaborate compound eye. There is also a detailed drawing of a flea, and Hooke noted how the long, many-jointed legs enable the insect to jump so high. For 40 years, he was the curator of experiments for the newly founded Royal Society in London and contributed greatly to its intellectual ferment. His mechanical inventions covered an enormous range, including the watch spring, the wheel barometer, and the universal joint. Following the Great Fire of London in 1666, he designed many of the new buildings in conjunction with Christopher Wren. Unfortunately, Hooke had an abrasive personality, which was partly responsible for a lack of recognition of his work for many years. However, during the last 25 years, there has been renewed interest, and he is now recognized as a brilliant scientist and innovator. ©2014 Int. Union Physiol. Sci./Am. Physiol. Soc.

  1. Robert Frazure mälestuspuu Sõpruse pargis sai graniitpotil tähistuse / Raivo Feldmann

    Index Scriptorium Estoniae

    Feldmann, Raivo

    2007-01-01

    Esimese USA suursaadiku sõjajärgses Eestis, Robert Frazure' mälestuspuu sai Sõpruse pargis tähise, vajaliku raha ettevõtmise heaks annetasid Ameerika Suursaatkonna töötajad, nende delegatsioon viibis Põltsamaal Sõpruse pargis toimunud üritusel

  2. Improvements to the Understanding of the Fire Performance of Wood over the Past 30 Years-A Tribute to Robert Hawthorne White

    Science.gov (United States)

    Samuel L. Zelinka; Mark A. Dietenberger; Laura E. Hasburgh; Keith J. Bourne; Charles Boardman

    2015-01-01

    Dr. Robert Hawthorne White had a 31 year career researching the fire performance of wood and wood composites at the USDA Forest Products Laboratory. Over his career, Dr. White made substantial contributions to codes, standards, and regulations pertaining to the design of wood structures. This review article summarizes Robert’s major accomplishments as a tribute to his...

  3. The man behind the microchip Robert Noyce and the invention of Silicon Valley

    CERN Document Server

    Berlin, Leslie

    2005-01-01

    Robert Noyce was a brilliant inventor, a leading entrepreneur and a daring risk taker, who piloted his own jets and skied mountains accessible only by helicopter. This book captures not only this colorful individual, but also the vibrant interplay of technology, business, money, politics and culture that defines the Silicon Valley.

  4. USA kaitseminister Robert Gates süüdistas liitlasvägesid oskamatuses / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2008-01-01

    USA kaitseminister Robert Gates väitis ajalehes The Los Angeles Times avaldatud intervjuus, et Lõuna-Afganistani olukord on halvenenud seal võitlevate USA liitlasvägede puuduliku väljaõppe tõttu. Liitlasriikide reageeringuid. Arvamust avaldavad Jaak Aaviksoo, Kaarel Kaas

  5. Changements à la tête du CERN - Robert Aymar aux commandes pour 5 ans.

    CERN Multimedia

    2003-01-01

    "Une nouvelle équipe prendra les rênes du CERN à partir du 1er janvier. Le Francais Robert Aymar, anciennement directeur du Projet de reacteur thermonucleaire experimental international (ITER), dirigera le centre de recherche pour la periode 2004-2008" (1 page).

  6. Cosmic Thing: Astrology, Space Science, and Personal Cartography in Robert Rauschenberg's Autobiography

    Science.gov (United States)

    Carey, C. L.

    2011-06-01

    The following paper undertakes an iconographic analysis of Robert Rauschenberg's large scale print, Autobiography (1967). The artist's interest in astronomy and astrology, visual metaphors aligning the body with the cosmos, and the cartographic representation of self are discussed. Autobiography is placed in cultural and historical context with other works by the artist, elaborated as a personal narrative-an alternative to traditional self portraiture.

  7. Homosexual orientation-from nature, not abuse: A critique of Roberts, Glymour, and Koenen (2013).

    Science.gov (United States)

    Rind, Bruce

    2013-11-01

    Roberts, Glymour, and Koenen (2013), using instrumental variable models, argued that child abuse causes homosexual orientation, defined in part as any same-sex attractions. Their instruments were various negative family environment factors. In their analyses, they found that child sexual abuse (CSA) was more strongly related to homosexual orientation than non-sexual maltreatment was, especially among males. The present commentary therefore focused on male CSA. It is argued that Roberts et al.'s "abuse model" is incorrect and an alternative is presented. Male homosexual behavior is common in primates and has been common in many human societies, such that an evolved human male homosexual potential, with individual variation, can be assumed. Cultural variation has been strongly influenced by cultural norms. In our society, homosexual expression is rare because it is counternormative. The "counternormativity model" offered here holds that negative family environment weakens normative controls and increases counternormative thinking and behavior, which, in combination with sufficient homosexual potential and relevant, reinforcing experiences, can produce a homosexual orientation. This is a benign or positive model (innate potential plus release and reinforcement), in contrast to Roberts et al.'s negative model (abuse plus emotional compensation or cognitive distortion). The abuse model is criticized for being based on the sexual victimological paradigm, which developed to describe the female experience in rape and incest. This poorly fits the gay male experience, as demonstrated in a brief non-clinical literature review. Validly understanding male homosexuality, it is argued, requires the broad perspective, as employed here.

  8. Color and Contingency in Robert Boyle's Works.

    Science.gov (United States)

    Baker, Tawrin

    2015-01-01

    This essay investigates the relationship between color and contingency in Robert Boyle's Experiments and Considerations Touching Colours (1664) and his essays on the unsuccessfulness of experiments in Certain Physiological Essays (1661). In these two works Boyle wrestles with a difficult practical and philosophical problem with experiments, which he calls the problem of contingency. In Touching Colours, the problem of contingency is magnified by the much-debated issue of whether color had any deep epistemic importance. His limited theoretical principle guiding him in Touching Colours, that color is but modified light, further exacerbated the problem. Rather than theory, Boyle often relied on craftsmen, whose mastery of color phenomena was, Boyle mentions, brought about by economic forces, to determine when colors were indicators of important 'inward' properties of substances, and thus to secure a solid foundation for his experimental history of color.

  9. The creativity of Crumb: research on the effects of psychedelic drugs on the comic art of Robert Crumb.

    Science.gov (United States)

    Jones, Matthew T

    2007-09-01

    This article investigates the influence of perception that is altered by psychedelic drugs on processes of creativity through a case study of the work of well-known comic artist Robert Crumb. Samples of Crumb's work before, during, and after the period of his use of psychedelic drugs are content analyzed and compared according to the categorization offered by Janiger and Dobkin de Rios (1989). The results of the comparison indicate that Robert Crumb's drug use significantly altered the stylistic approach of his artwork not only during the period of his drug use, but long after he had stopped using drugs.

  10. Robert Kramer: técnica, paixão e ideologia

    Directory of Open Access Journals (Sweden)

    Jorge La Ferla

    2011-01-01

    Full Text Available Uma revisão crítica da obra do cineasta Robert Kramer, considerando as relações que propõe sua obra, a partir da utilização virtuosa de diversas máquinas audiovisuais em suas especificidades e combinações. O cinema, o vídeo, a televisão e as novas tecnologias constituem, em Kramer, processos de criação que dão origem a um trabalho expressivo com os dispositivos fotoquímicos, eletrônicos e digitais.

  11. [Margaret Cavendish vs Robert Hooke: An impossible duel].

    Science.gov (United States)

    Aït-Touati, Frédérique

    2016-12-01

    In 1665, Robert Hooke published his major work in microscopy, Micrographia, a defense of experimental philosophy. The following year, Margaret Cavendish, Duchess of Newcastle, published at her own expense a treatise and a novel that undermined the basis of this new science. The dispute broke out at the initiative of the Duchess, in the context of a vast controversy about the legitimacy and the efficiency of optical instruments in natural philosophy. All the figures of the dual are used, except one: the counterattack. Cavendish, indeed, was alone on the battlefield. Is it possible to call a dual a battle with only one combatant? This particular case of dispute that stops owing to the shortage of combatants is the subject of this article.

  12. Biological Characteristics and Medical Treatment of Breast Cancer in Young Women—A Featured Population: Results from the NORA Study

    Directory of Open Access Journals (Sweden)

    P. Pronzato

    2011-01-01

    Full Text Available Background. The present paper described the biological characteristics and clinical behavior of young women in the cohort NORA study Patients and Methods. From 2000–2002, patients (>3500 were enrolled at 77 Italian hospitals. Women aged ≤50 years (=1013 were stratified into age groups (≤35, 36–40, 41–45, and 46–50 years. The relationship between age and patient characteristics, cancer presentation, and treatment was analyzed. Results. Younger women more frequently had tumors with ER/PgR-negative(2=7.07; =.008, HER2 amplification (2=5.76; =.01, and high (≥10% Ki67 labelling index (2=9.53; =.002. Positive nodal status, large tumors, and elevated Ki67 all associated with the choice for chemotherapy followed by endocrine therapy in hormone receptor-positive patients (40 versus ≤40, <.0001, resp.. At multivariate analysis, after adjustment for significant clinical and pathological factors, age remains a significant prognostic variable (HR=0.93, =.0021. Conclusion. This cohort study suggests that age per sè is an important prognostic factor. The restricted role of early diagnosis and the aggressive behavior of cancer in this population make necessary the application of targeted medical strategies crucial.

  13. Biological Characteristics and Medical Treatment of Breast Cancer in Young Women-A Featured Population: Results from the Nora Study

    International Nuclear Information System (INIS)

    Pronzato, P.; Mustacchi, G.; De Matteis, A.; Di Costanzo, F.; Rulli, E.; Floriani, I; Cazzaniga, M.E.

    2011-01-01

    Background. The present paper described the biological characteristics and clinical behavior of young women in the cohort NORA study Patients and Methods. From 2000-2002, patients (N>3500) were enrolled at 77 Italian hospitals. Women aged =50 years (N=1013) were stratified into age groups (=35, 36-40, 41-45, and 46-50 years). The relationship between age and patient characteristics, cancer presentation, and treatment was analyzed. Results. Younger women more frequently had tumors with ER/PgR-negative(x 2 =7.07; P=.008), HER2 amplification (x 2 =5.76; P=.01), and high (≤10%) Ki67 labelling index (x 2 =9.53; P=.002). Positive nodal status, large tumors, and elevated Ki67 all associated with the choice for chemotherapy followed by endocrine therapy in hormone receptor-positive patients (P 40 versus =40, P<.0001, resp.). At multivariate analysis, after adjustment for significant clinical and pathological factors, age remains a significant prognostic variable (HR=0.93, P=.0021). Conclusion. This cohort study suggests that age per se is an important prognostic factor. The restricted role of early diagnosis and the aggressive behavior of cancer in this population make necessary the application of targeted medical strategies crucial. human epidermal growth factor receptor

  14. USA mõtleja : vaid rikkus riiki koos ei hoia / Robert Putnam ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Putnam, Robert

    2006-01-01

    USA Harvardi ülikooli politoloogiaprofessori Robert Putnami arvates on etniliselt mitmekesistes riikides ühtsustunde loomine raske, selle saavutamisele aitaksid kaasa ühiskonna pingevabam enesemääratlus ning paindlikumad töögraafikud naistele ühendamaks pere tööga. Lisa: Üksi või koos?

  15. Empirical Asset Pricing: Eugene Fama, Lars Peter Hansen, and Robert Shiller

    OpenAIRE

    Campbell, John Y.

    2016-01-01

    The Nobel Memorial Prize in Economic Sciences for 2013 was awarded to Eugene Fama, Lars Peter Hansen, and Robert Shiller for their contributions to the empirical study of asset pricing. Some observers have found it hard to understand the common elements of the laureates research, preferring to highlight areas of disagreement among them. This paper argues that empirical asset pricing is a coherent enterprise, which owes much to the laureates seminal contributions, and that important themes in ...

  16. Investigation of the noble metal deposition behaviour in boiling water reactors - the NORA project

    International Nuclear Information System (INIS)

    Ritter, S.; Karastoyanov, V.; Abolhassani-Dadras, S.; Guenther-Leopold, I.; Kivel, N.

    2010-01-01

    NobleChem™ is a technology developed by General Electric to reduce stress corrosion cracking (SCC) in reactor internals and recirculation pipes of boiling water reactors (BWRs) while preventing the negative side effects of classical hydrogen water chemistry. Noble metals (Pt, Rh) acting as electrocatalysts for the recombination of O 2 and H 2 O 2 with H 2 to H 2 O and thus reducing the corrosion potential more efficiently are injected into the feed water during reactor shut-down (classical method) or on-line during power operation. They are claimed to deposit as very fine metallic particles on all water-wetted surfaces including the most critical regions inside existing cracks and to stay electrocatalytic over long periods of time. The effectiveness of this technology in plants remains still to be demonstrated. Based on highly credible laboratory experiments down to the sub-ppb Pt concentration range, SCC mitigation may be expected, provided that a stoichiometric excess of H 2 and a sufficient surface coverage with very fine Pt particles exist simultaneously at the critical locations. Very little is known about the deposition and (re-)distribution behaviour of the Pt in the reactor. For the validation of this technique the research project NORA (noble metal deposition behaviour in BWRs) has been started at PSI with two main objectives: (i) to gain phenomenological insights and a better basic understanding of the Pt distribution and deposition behaviour in BWRs; (ii) to develop and qualify a non-destructive technique to characterise the size and distribution of the Pt particles and its local concentration on reactor components. This paper presents the objectives of the project, the planned work and a brief description of the status of the project. (author)

  17. Kolm vaadet Tallinna vanalinnale / Villem Tomiste, Martin Aunin, Robert Treufeldt ; intervjueerinud Ingrid Ruudi

    Index Scriptorium Estoniae

    Tomiste, Villem, 1975-

    2009-01-01

    Tallinna vanalinna ja kesklinna piiril asuv kvartal 57B, mis piirneb Aia, Vana-Viru, Inseneri tänava ja Mere Puiesteega, ajendas vanalinna hoonestuspõhimõtete ja tulevikulahenduste üle arutama arhitekte Villem Tomistet, Martin Auninit ning arhitektuuriajaloolast, ICOMOSi Eesti komitee esimeest Robert Treufeldti. Pikemalt korterelamust Aia 4/Vana-Viru 13, Aia 6 ja 8 detailplaneeringu eskiisist

  18. More Misbehavior of Organisms: A Psi Chi Lecture by Marian and Robert Bailey

    Science.gov (United States)

    Bihm, Elson M.; Gillaspy, J. Arthur, Jr.; Abbott, Hannah J.; Lammers, William J.

    2010-01-01

    In 1992, Dr. Marian Breland Bailey, assisted by her husband Robert E. Bailey, gave the following presentation at the Psi Chi Banquet of the University of Central Arkansas. She and her first husband, Keller Breland, were students of B. F. Skinner and established Animal Behavior Enterprises (ABE) in 1947 and the IQ Zoo in 1955. Unknown to many…

  19. Robert Aymar awarded Global Energy prize

    CERN Multimedia

    2006-01-01

    CERN Director-General Robert Aymar was recently named one of three laureates of the 2006 Global Energy International Prize for 'the development of scientific and engineering foundation for the ITER project.' ITER is an experiment planned to be built in Europe at Cadarache (South of France) and designed to show the scientific and technological feasibility of a full-scale fusion power reactor. The other two laureates, who worked with Aymar on the project, are former President of the ITER Council, Russian Academician Evgeny Velikhov, and Japan's Dr Masaji Yoshikawa, ITER's former Vice President. Aymar headed ITER from 1994 to 2003. 'This prize is not only a great honour for me and my friends and colleagues of many years at ITER, Evgeny Velikhov and Masaji Yoshikawa,' Aymar said. 'It is above all a recognition of the effort of all those who have been involved with the ITER project and worked over the years to ensure the first step in proving that fusion will provide a new sustainable energy source for the plane...

  20. 76 FR 2412 - Notice of Intent To Amend the Grand Junction Resource Management Plan, Prepare an Environmental...

    Science.gov (United States)

    2011-01-13

    ... initiates a Notice of Realty Action (NORA) to assist the BLM in determining whether granting the requested..., RMP Amendment, and NORA. DATES: Comments on this project, the NORA, or the proposed transfer of title...

  1. Teorizando o mundo contemporâneo: Robert Brenner; Giovanni Arrighi; David Harvey

    Directory of Open Access Journals (Sweden)

    Moishe Postone

    2008-07-01

    Full Text Available O artigo busca apreender as profundas transformações sociais, políticas, econômicas e culturais que marcaram as três últimas décadas, em contraste com o período de prosperidade subseqüente à Segunda Guerra Mundial. Para tanto, o autor analisa criticamente três obras específicas que abordam o período: "The economics of global turbulence", de Robert Brenner, O longo século XX, de Giovanni Arrighi, e A condição pós-moderna, de David Harvey. O procedimento metateórico adotado permite apontar os requisitos de uma teoria crítica adequada ao capitalismo contemporâneo.The article aims to apprehend the deep social, political, economic and cultural transformations that characterized the three last decades, in contrast with the prosperity period following the Second World War. Therefore, the author critically analyses three specific works that deal with that period: "The economics of global turbulence", by Robert Brenner, The long Twentieth Century, by Giovanni Arrighi, and The conditions of postmodernity, by David Haravey. The metatheoric procedure adopted allows him to indicate the requisites of an adequate critical theory of contemporary capitalism.

  2. Robert Bartini and His Contribution to the Development of Transport and Aviation

    Science.gov (United States)

    Težak, Sergej

    2017-10-01

    After the First World War, the young Soviet Union (USSR) desperately needed new engineers and scientists who would provide the new country with development of modern industry and transportation. At that time, Western European countries had knowledge and experience, especially in the field of aviation. One of the young engineers was Robert Bartini, who was educated in Austria-Hungary and Italy, and graduated from Milan Polytechnic Institute. In 1923, he fled Italy to escape Fascists and emigrated in Soviet Union. This article is a brief description of aircraft designer Robert Bartini and his role in the development of the military, passenger and transport aviation. In addition, it presents his vision of the intercontinental and continental high-speed transport, which was his focus in the last years of his work and creation. He worked as a researcher and expert in the former Soviet Union, therefore, more detailed and relevant information on his work has been revealed to the public in recent years. In Russia, he is very popular as a researcher and developer. There are many books about him in Russian and Italian language, but not in English. Thus, his work is still quite unknown in the West. He was born in Kanjiza (today Serbia) in 1897, and spent his youth in Fiume (Rijeka, today Croatia).

  3. Los orígenes del grial en la literatura medieval: de Chrétien de Troyes a Robert de Boron

    Directory of Open Access Journals (Sweden)

    Mario Martín Botero

    2010-12-01

    Full Text Available Este artículo muestra el origen literario del tema del Grial en la literatura medieval francesa, abordando dos textos esenciales para el surgimiento y consolidación de la “literatura del Grial”: Le Conte du Graal de Chrétien de Troyes y Le Roman de l’Estoire dou Graal de Robert de Boron. Los autores de estas obras establecen las bases para el desarrollo de toda una temática que gira alrededor del Grial a partir del siglo XII hasta nuestros días. El artículo muestra cómo de un objeto apenas sagrado en el texto de Chrétien de Troyes se pasa a una reliquia de la sangre de Cristo en la versión de Robert de Boron.This paper studies the literary origin of the Grail legend in medieval French literature, taking into account two important romances: Le Conte du Graal by Chrétien de Troyes and Le Roman de l’Estoire dou Graal by Robert de Boron. In these two texts the authors established the basis for the development of a new subject matter around the mysterious object called “Grail” from the Middle Ages to the present times. It will also be shown how an object, not totally sacred in Chrétien de Troyes, becomes a relic related with Jesus’s blood in Robert de Boron.

  4. The Impossibility of Maintaining the Minimal State of Robert Nozick

    Directory of Open Access Journals (Sweden)

    Virgílio Queiroz de Paula

    2015-12-01

    Full Text Available In this paper we analyze how Robert Nozicks minimal state proposed would invariably end, unless its members were coerced by the central government to contribute to its maintenance. And, in this case, rights and freedom protected under the philosophers state would obviously be violated. We also analyze the flaws in Nozicks model through economic bias in order to show - through game theory and logic of collective action  how an organization that provides nonexclusive public goods is vulnerable to the action of free-riders, thus increasing the costs of its performance, and decreasing motivation for its existence.

  5. Taasavatud mälestuskivi väärtustab Robert von Tolli tegemisi / Külli Kriis

    Index Scriptorium Estoniae

    Kriis, Külli, 1961-

    2007-01-01

    26. juulil taasavati Kukruse külas mälestuskivi, mille Kukruse mõisa omanik Robert von Toll sinna aastal 1866 pargi rajamise puhul püstitas. Ilmunud ka: Severnoje Poberezhje, 28. juuli 2007 (Vnov ustanovlennõi kamen - dan pamjati dejatelnosti Roberta fon Tollja)

  6. Robert Williams Wood: pioneer of invisible light.

    Science.gov (United States)

    Sharma, Shruti; Sharma, Amit

    2016-03-01

    The Wood's lamp aids in the diagnosis of multiple infectious, inflammatory and neoplastic dermatologic conditions. Although the Wood's lamp has many applications, which have improved both the diagnosis and management of disease, the man credited for its invention is relatively unknown in medicine. Robert Williams Wood, a prominent physicist of the early 20th century, is credited for the invention of the Wood's lamp. Wood was the father of infrared and ultraviolet photography and made significant contributions to other areas in optics and spectroscopy. Wood's work encompassed the formative years of American Physics; he published over 200 original papers over his lifetime. A few years after the invention of the Wood's lamp for ultraviolet photography, physicians in Europe adopted the Wood's lamp for dermatologic applications. Wood's lamp remains popular in clinics globally, given its ease of use and ability to improve diagnostic precision. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  7. Reproduction of the San Joaquin kit fox (Vulpes velox macrotis) on Camp Roberts Army National Guard Training Site, California

    International Nuclear Information System (INIS)

    Spencer, K.A.; Berry, W.H.; Standley, W.G.; O'Farrell, T.P.

    1992-09-01

    The reproduction of a San Joaquin kit fox population (Vulpes velox macrotis) was investigated at Camp Roberts Army National Guard Training Site, California, from November 1988 through September 1991. Of 38 vixens radiocollared prior to parturition, 12 (32%) were successful in raising pups from conception to the point where pups were observed above ground. No yearling vixens were known tb be reproductively active. The mean litter size during 1989 - 1991 was 3.0 (n = 21, SE = 0.28) and ranged from one to six pups. Both the proportion of vixens successfully raising pups and the mean litter size observed at Camp Roberts during this study were lower than those reported at other locations. Sex ratios of kit fox pups were male biased two of the three years, but did not differ statistically from 1:1 throughout the study. Whelping was estimated to occur between February 15 and March 5. Results of this study support previous reports that kit foxes are primarily monogamous, although one case of polygamy may have occurred. Both the proportion of dispersing radiocollared juveniles (26%) and the mean dispersal distance (5.9 km) of juveniles at Camp Roberts appeared low compared to other locations

  8. Robert Michels y las teorías elitista-competitivas de la democracia

    OpenAIRE

    Caparrós Valderrama, Rafael

    2008-01-01

    Robert Michel's main work is "Political parties. A Sociological Study on the Oligarchical Tendencies of Modern Democracy", issued in 1911, which is an analysis on the internal organization evolving dynamics of the German Social-Democrat Party (SDP), to which the author was intensely attached for several years. The aim of this essay is hte sociological study of the leadership emergence, power psicology and the organizational oligarchical tendencies. In it all argumentation can be found on the ...

  9. O EPÍLOGO DA TEORIA DOS DIREITOS FUNDAMENTAIS EM ROBERT ALEXY

    OpenAIRE

    Araújo Silveira, Whenry Hawlysson; Bruno da Silva, Alexandre Antônio

    2014-01-01

    Com o advento da Constituição Federal de 1988, foram implementados novos conceitos concernentes à Teoria do Direito por consequência de um fenômeno mundialmente conhecido como Neoconstitucionalismo. Uma destas mutações se dá por seu caráter axiológico e diz respeito à teoria dos direitos fundamentais. Robert Alexy inova seu pensamento a afirmar que o conflito entre direitos e garantias fundamentais deve ser resolvido pelo instituto da ponderação e afirma que esse instituto não se trata de um ...

  10. Robert Hare's Theory of Galvanism: A Study of Heat and Electricity in Early Nineteenth-Century American Chemistry.

    Science.gov (United States)

    Fisher, Amy

    2018-04-09

    As a professor of chemistry at the University of Pennsylvania, Robert Hare actively shaped early American science. He participated in a large network of scholars, including Joseph Henry, François Arago, and Jacob Berzelius, and experimented with and wrote extensively about electricity and its associated chemical and thermal phenomena. In the early nineteenth century, prominent chemists such as Berzelius and Humphry Davy proclaimed that a revolution had occurred in chemistry through electrical research. Examining Robert Hare's contributions to this discourse, this paper analyzes how Hare's study of electricity and the caloric theory of heat led him to propose a new theory of galvanism. It also examines the reception of Hare's work in America and Great Britain, highlighting the contributions of early American chemists to the development of electrochemistry.

  11. Discussing compliance. Summary report from discussions with Robert Bernero and Chris Whipple regarding compliance with the Swedish HLW Regulations from meetings in Stockholm May 3 and 4, 1999

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Mikael

    1999-06-01

    Summary report from discussions with Robert Bernero and Chris Whipple regarding compliance with the Swedish HLW Regulations from meetings in Stockholm. The report also contains bibliographical information and preliminary observations made by Robert Bernero and Chris Whipple.

  12. Discussing compliance. Summary report from discussions with Robert Bernero and Chris Whipple regarding compliance with the Swedish HLW Regulations from meetings in Stockholm May 3 and 4, 1999

    International Nuclear Information System (INIS)

    Jensen, Mikael

    1999-06-01

    Summary report from discussions with Robert Bernero and Chris Whipple regarding compliance with the Swedish HLW Regulations from meetings in Stockholm. The report also contains bibliographical information and preliminary observations made by Robert Bernero and Chris Whipple

  13. Sir Robert Ball: Victorian Astronomer and Lecturer par excellence

    Science.gov (United States)

    Jones, R. I. G.

    2005-12-01

    Between 1875 and 1910 Sir Robert Stawell Ball gave an estimated 2,500 lectures in towns and cities all over the British Isles and abroad. This paper traces his lecturing career from its beginnings in Ireland to the triumphs of the Royal Institution, and on lecture tours in the United States of America. After a period in mathematics and mechanics, he became a populariser of science, especially astronomy, and found fame and fortune among the working classes and the aristocracy. What motivated him to tireless travels is uncertain, but it might have been that it was rewarding, financially and to his reputation. Whatever his motives, contemporary accounts are clear that BallÕs lectures were extremely popular and well-received.

  14. CBO Testimony: Statement of Robert F. Hale, Assistant Director, National Security Division, Congressional Budget Office

    National Research Council Canada - National Science Library

    Hale, Robert F

    1991-01-01

    .... This testimony, by Robert F. Hale, Congressional Budget Office, covers the following topics: Socioeconomic Backgrounds of Enlisted Recruits, Racial Mix of Enlisted Recruits, Shifts in Recruiting during the 1980s, Altering the Composition of the Military: Reserve Mobilization and Conscription, and Should the Social Composition of the Military be a Concern?

  15. Science, Beliefs and Knowledge: A Personal Reflection on Robert J. Aumann’s Approach

    OpenAIRE

    Gil Kalai

    2006-01-01

    On the occasion of Robert J. Aumann's being awarded the 2005 Nobel Prize in Economics, this paper gives a personal view on some of Aumann's contributions, and primarily on his approach to foundational issues in game theory, economics, and science as a whole. It is based on numerous discussions and e-mail exchanges we had in the 1990's, dealing with various scientific and political matters, including our long debate on the ``Bible Code'' controversy.

  16. Modification of Roberts' Theory for Rocket Exhaust Plumes Eroding Lunar Soil

    Science.gov (United States)

    Metzger, Philip T.; Lane, John E.; Immer, Christopher D.

    2008-01-01

    Roberts' model of lunar soil erosion beneath a landing rocket has been updated in several ways to predict the effects of future lunar landings. The model predicts, among other things, the number of divots that would result on surrounding hardware due to the impact of high velocity particulates, the amount and depth of surface material removed, the volume of ejected soil, its velocity, and the distance the particles travel on the Moon. The results are compared against measured results from the Apollo program and predictions are made for mitigating the spray around a future lunar outpost.

  17. Robert Molesworth's An Account of Denmark as it was in 1692

    DEFF Research Database (Denmark)

    Olden-Jørgensen, Sebastian

    2008-01-01

    Robert Moleswort's An Account of Denmark as it was in 1692 is a violent political pamphlet in the early British Whig-tradition aimed at underscoring republican values by pointing to the dreadful example of Danish Absolutist slavery. It was a bestseller on an international scale. In his book...... of these was Ludvig Holberg's Description of Denmark and Norway (1729) which counters Molesworth on the basis of history and natural law - and in a witty style. Thus the republican manifesto of Molesworth became instrumental in shaping the political outlook and language of the very moderate, loyal and anything...

  18. Justice, Integrity and Fairness: Relevant Questions About Robert Nozick Political Theory

    Directory of Open Access Journals (Sweden)

    Carlos Fernando Cruz da Silva

    2016-11-01

    Full Text Available The present work develops and analysis about Robert Nozick political theory based in thesis defended by Ronald Dworkin. The central objective of this paper is to investigate the validity or the invalidity of the justice principles proposed by Nozick under the integrity theory. The methodology utilized to construct the definitive hypothesis was based, initially, in a theoretical search, developed through of an bibliographical lifting of the principal involved authors texts. After the survey, a descriptive analysis of the texts was executed and, then, was executed and critical analysis. At the end, an definitive proposal was constructed with an deductive reasoning.

  19. Contemporary Hegelian Scholarship: Robert Stern’s Holistic Reading of Hegel

    Directory of Open Access Journals (Sweden)

    Paniel Reyes Cardenas

    2015-12-01

    Full Text Available This is a monographic presentation in which the author depicts the guidelines of Professor Robert Stern’s interpretation of Hegelian Metaphysics by emphasizing in its characteristic holistic reading. The proposal is that some key fundamental topics of Hegelian scholarship will emerge with a clarified understanding after this reading: the concept of Truth and absolute knowledge are reassessed by showing the necessary connection of Epistemology and Metaphysics in Hegel. Hegelian Metaphysics, accordingly, appears ultimately as the principle for a reading of Hegel’s entire philosophy and illuminates its nature of general metaphysical inquiry. Finally, this reading allows drawing on the connection of Hegel’s Idealism with the Pragmatist tradition initiated by Peirce.

  20. Fermilab's Helen Edwards receives prestigious 2003 Robert R. Wilson prize from the American Physical Society

    CERN Multimedia

    2002-01-01

    Helen Edwards has been awarded the 2003 Robert R. Wilson prize. She was cited for "her pivotal achievement and critical contribution as the leader in the design, construction, commissioning and operation of the Tevatron, and for her continued contributions to the development of high gradient superconducting linear accelerators as well as bright and intense electron sources." (1/2 page).

  1. US Navy Transfers Research Vessel to Philippine Navy > U.S. Pacific Command

    Science.gov (United States)

    , 2016 EMAIL PRINT Photos 1 of 1 SAN DIEGO (April 27, 2016) - Vice Adm. Nora Tyson, left, commander of Philippines oceanographic research and study capabilities. SAN DIEGO (April 27, 2016) - Vice Adm. Nora Tyson part in that relationship," said Vice Adm. Nora Tyson, commander, U.S. 3rd Fleet. "Today, we

  2. Business ethics and virtue: on Robert C. Solomon's many ways of being ethical.

    OpenAIRE

    Gallego Salvador, Francisco

    2013-01-01

    The present Thesis explores the possibility of applying a virtue ethics framework, based upon the Aristotelian tradition, into business ethics. The purpose of the Thesis is twofold: to give an overview of virtue ethics through Richard Taylor’s portrait and to offer a specific account of virtue ethics focused on the business realm. The examination of this virtue ethics proposal is largely founded on Robert C. Solomon’s works, which constitute the cornerstone of this Thesis. However, the critic...

  3. A gift of prophecy essays in celebration of the life of Robert Eugene Marshak

    CERN Document Server

    1994-01-01

    Robert Eugene Marshak (1916-92) devoted much of his life to helping other people carry out scientific research and gather to discuss their work. In addition to his scientific statesmanship, he was an extraordinarily gifted research scientist, and many of his scientific contributions have been prophetic. This book pays homage to his creativity and continuing work, with contributions from many of the people whose lives have been influenced by him.

  4. The Aspiring Adept: Robert Boyle and His Alchemical Quest (Lawrence M. Principe)

    Science.gov (United States)

    Kovac, Jeffrey

    1999-10-01

    Robert Boyle is widely regarded as the Father of Modern Chemistry, who broke once and for all from the irrational, misguided alchemy that preceded him. One of the goals of this carefully researched and argued new book by Lawrence M. Principe, Assistant Professor in the Department of Chemistry and the Institute for the History of Science, Medicine, and Technology at The Johns Hopkins University, is to refute the two errors in this characterization of Boyle and to understand his life, thought, and work in the intellectual and social context of his time. This book is not for the casual reader; it is a detailed scholarly treatise in the history of science, but it provides a fresh and interesting perspective on Boyle and on the development of chemistry in the 17th century. Boyle is usually characterized as a modern scientist and his most famous book, The Skeptical Chymist, as a critique of traditional alchemy. Principe demonstrates that this characterization is based on a selective and sometimes incorrect reading of Boyle's works. Like Newton, Boyle was deeply involved in traditional transmutational alchemy, reading the works of other alchemists, performing experiments, and even witnessing transmutations. Alchemy, however, was not a monolith and Boyle adhered to what Principe tentatively identifies as a uniquely English school of supernatural alchemy. According to Principe, The Skeptical Chymist was mainly a criticism of the Paracelsians interested in chemical medicine rather than a defense of what we would now regard as modern chemistry. To further support his characterization of Boyle and to better reveal Boyle's involvement in alchemyparticularly the transmutation of base metals to gold, termed chrysopoeiaPrincipe has reconstructed from some 20 fragments one of Boyle's alchemical manuscripts, his Dialogue on the Transmutation of Metals. The full text of this lost work is included as Appendix 1. Two other primary sources, Interview Accounts of Transmutations and

  5. Robert Schumann and translation: poetic creativity, simultaneity and movement

    Directory of Open Access Journals (Sweden)

    João Azenha Junior

    2012-07-01

    Full Text Available In diesem Aufsatz werden die Gesammelten Schriften über Musik und Musiker von Robert Schumann untersucht, insbesondere die Rezensionen, die der Komponist zwischen 1834 und 1836 verfasst hat. Es soll festgestellt werden, inwiefern sich darin die wichtigsten Auffassungen über Sprache und Übersetzung, die Ende des 18. und Beginn des 19. Jahrhunderts in Deutschland entstanden, wiederfinden. Im Vordergrund der Untersuchung steht die Dimension der Bewegung, die sich sowohl im Individuum als auch in der Zeit festmachen lässt. Im Individuum manifestiert sich die Bewegung als ein sehr persönlicher Vorgang, da es sich innerhalb verschiedener Zeichensysteme bewegt, die seine Gedanken ausdrücken; oder aber es bewegt sich innerhalb verschiedener Sprachen. Die Zeitdimension wiederum bedeutet, in ein Umfeld einzutauchen, das die Zeitbarrieren überwindet und die Vergangenheit auf einen Schlag mit der Gegenwart und der Zukunft verbindet.

  6. Hooke's figurations: a figural drawing attributed to Robert Hooke.

    Science.gov (United States)

    Hunter, Matthew C

    2010-09-20

    The experimental philosopher Robert Hooke (1635-1703) is known to have apprenticed to the leading painter Peter Lely on his first arrival in London in the late 1640s. Yet the relevance of Hooke's artistic training to his mature draughtsmanship and identity has remained unclear. Shedding light on that larger interpretive problem, this article argues for the attribution to Hooke of a figural drawing now in Tate Britain (T10678). This attributed drawing is especially interesting because it depicts human subjects and bears Hooke's name functioning as an artistic signature, both highly unusual features for his draughtsmanship. From evidence of how this drawing was collected and physically placed alongside images by leading artists in the early eighteenth century, I suggest how it can offer new insight into the reception of Hooke and his graphic work in the early Enlightenment.

  7. Professor Barrie Vernon-Roberts, AO, MD, BSc, PhD, FRCPath, FRCPA, FAOrthA (Hon), FRS.SA.

    Science.gov (United States)

    Rainsford, K D; Haynes, D R

    2013-08-01

    This issue of Inflammopharmacology contains papers that have been submitted to commemorate the life and work of Professor Barrie Vernon-Roberts, an outstanding clinical scientist in the field of bone pathology and its pharmacological regulation. This review briefly summarizes his major works and achievements as well as a list of his publications.

  8. Field building: lessons from the Robert Wood Johnson Foundation's anthology series.

    Science.gov (United States)

    Isaacs, Stephen L; Knickman, James R

    2005-01-01

    As editors of the Robert Wood Johnson Foundation's (RWJF's) anthology series, we have examined the entire range of the foundation's grant making since 1972. We found that the RWJF has enjoyed considerable success in building fields--from nurse practitioners to tobacco control to end-of-life care. The RWJF has done this by shaping fields as they were emerging, by adopting a wide-ranging "bear hug" approach, and by staying the course. The lessons from the RWJF's field-building efforts are relevant for both large and small foundations: Small funders can develop strategic plans aimed at building fields in their home state or locality.

  9. Brasil, estudos pós-coloniais e contracorrentes análogas: entrevista com Ella Shohat e Robert Stam

    NARCIS (Netherlands)

    dos Santos, E.R.S.; Schor, P.

    2013-01-01

    Interview with Ella Shohat and Robert Stam (Portuguese translation). Original version: Brazil is not Traveling Enough”: On Postcolonial Theory and Analogous Counter-Currents (http://www2.let.uu.nl/solis/psc/P/PVOLUMEFOUR/PVOLUMEFOURPAPERS/P4SHOHAT-STAM-INTERVIEW.pdf)

  10. Building and Maintaining Organizational Infrastructure to Attain Clinical Excellence.

    Science.gov (United States)

    Lebak, Kelly; Lane, Jason; Taus, Richard; Kim, Hansol; Stecker, Michael S; Hall, Michael; Lane-Fall, Meghan B; Weiss, Mark S

    2017-12-01

    Active maintenance of highly functional teams is critical to ensuring safe, efficient patient care in the non-operating room anesthesia (NORA) suite. In addition to developing collaborative relationships and patient care protocols, individual and team training is needed. For anesthesiologists, this training must begin during residency. The training should be supplemented with continuing education in this field for providers who find themselves working in the NORA space. As NORA continues to grow, robust NORA-specific quality assurance and improvement programs will empower anesthesiologists with the tools they need to best care for these patients. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Análisis Epistemológico del Modelo de Aprendizaje Acumulativo de Robert Gagne

    OpenAIRE

    Meza, Anibal; Lazarte, Carmen

    2013-01-01

    The authors review fundamental aspects of Robert Gagné's Leaming Theory, highlighting its philosophical (positivism and pragmatism) and scientific bases (behaviorism and information processing). Using an epistemological framework, these aspects are assessed in terrns of its theoretical and topical validity, as well as its technical efficiency. It is concluded that Gagné's Theory is eclectic and that its scientific contribution is taxonomic. It represents a theoretical model rather than a theo...

  12. Der Schurke ist kein Schurke mehr. Form und Rollenkonzeption in Robert Walsers "Schneewittchen"

    OpenAIRE

    Ochoa Savic, Tania

    2015-01-01

    Robert Walser (1878-1956) fue un escritor suizo que permaneció en el olvido durante décadas tanto para los lectores como para la crítica literaria. Siendo aún joven publicó varias obras como "Schneewittchen" (1901) y "Aschenbrödel" (1901) en revistas renombradas como Die Insel, pero sin llegar a alcanzar la fama literaria. Por otro lado, también intentó, durante su estancia en Stuttgart, probar suerte en el mundo del teatro como actor, mientras trabajaba como oficinista para p...

  13. The Poetry of Robert Burns: “A Melancholy not unallied to Mirth.”

    Directory of Open Access Journals (Sweden)

    Karyn COSTA

    2006-06-01

    Full Text Available When Allan Cunningham concluded his 1834 Life of Burns with this critical judgement of Robert Burns’s poetry he was in fact summing up the schizophrenic nature of the Scottish character and identity. Scottish duality is still prevalent in the Highland-Lowland divide, the Catholic-Protestant rivalry, the linguistic differences Scots versus Gaelic, the English and Scottish competition for power, the past battling with the present in the search for a national identity free from myth and a sense ...

  14. Negotiating Primitivist Modernisms: Louis Armstrong, Robert Goffin, and the Transatlantic Jazz Debate

    Directory of Open Access Journals (Sweden)

    Daniel Stein

    2011-10-01

    Full Text Available “Dear Pal Goffin,” Louis Armstrong wrote to his Belgian acquaintance, the lawyer, hobby journalist, and jazz historian Robert Goffin, on July 19, 1944. “‘Man—I’ve been trying to get in touch with you […]. Here’s another hundred dollars toward the five hundred. […] So accept this hundred and I’ll send the other before a ‘Black Cat can ‘Lick his ‘Bu‘hind’ ….. haw haw haw…” (80. Sending Goffin a batch of money along with this playfully worded missive, Armstrong was hoping for quick results. He ...

  15. Quotation. Paratext and Romantic Orientalism: Robert Southey's "The Curse of Kehama" (1810

    Directory of Open Access Journals (Sweden)

    Ourania Chatsiou

    2010-12-01

    Full Text Available To a considerable extent, Romantic Orientalist literature is founded on scholasticism, authentication, quotation of antiquarian sources, in other words, on paratext. It constitutes in many respects an oxymoronic, though fascinating and dynamic, symbiosis of repetition / replication and creative imagination / invention. By focusing on Robert Southey’s art of quotation in his extraordinarily abundant notes to his orientalist narrative verse this essay seeks to establish paratext as an integral, formative aspect of Romantic Orientalism and Romantic-period poetics, illustrating the hybridity of the Romantic genius and Romantic poetic creation, and challenging common assumptions about a sublime, universal Romantic-period poetry.

  16. Robert Heath Lock and his textbook of genetics, 1906.

    Science.gov (United States)

    Edwards, A W F

    2013-07-01

    Robert Heath Lock (1879-1915), a Cambridge botanist associated with William Bateson and R. C. Punnett, published his book Recent Progress in the Study of Variation, Heredity, and Evolution in 1906. This was a remarkable textbook of genetics for one appearing so early in the Mendelian era. It covered not only Mendelism but evolution, natural selection, biometry, mutation, and cytology. It ran to five editions but was, despite its success, largely forgotten following Lock's early death in 1915. Nevertheless it was the book that inspired H. J. Muller to do genetics and was remembered by A. H. Sturtevant as the source of the earliest suggestion that linkage might be related to the exchange of parts between homologous chromosomes. Here we also put forward evidence that it had a major influence on the statistician and geneticist R. A. Fisher at the time he was a mathematics student at Cambridge.

  17. Redefining U.S. Arctic Strategy

    Science.gov (United States)

    2015-05-15

    responsibility shifts 21 Barno, David and Nora Bensahel. The Anti-Access Challenge you’re not thinking...International Affairs 85, no. 6 (2009). 38 Barno, David and Nora Bensahel. THE ANTI-ACCESS CHALLENGE YOU’RE NOT THINKING ABOUT, 05 May 2015...and Rescue in the Arctic, 22 June 2011. Arctic Council Secretariat. About the Arctic Council, Arctic Council, 2011. Barno, David and Nora

  18. Study, Stance, and Stamina in the Research on Teachers' Lives: A Rejoinder to Robert V. Bullough, Jr.

    Science.gov (United States)

    Kelchtermans, Geert

    2008-01-01

    Robert V. Bullough, Jr.'s article demonstrated in an impressive way how autobiographical accounts, as well as single person narratives, are intertwined with much larger issues in society, international politics, and economical interests, as well as consequences for people in general and educators in particular. The way he proves capable of…

  19. Work and vulnerability: the social question on Robert Castel’s thought

    Directory of Open Access Journals (Sweden)

    Fabrício Maciel

    2015-02-01

    Full Text Available The article emphasizes the centrality of the concept of work in the thought of the French sociologist Robert Castel. Despite being best known in Brazil for his concepts of social question and social disaffiliation, the concept of work is crucial in the articulation of the author's thought, notably in his latest writing. The article is divided into four parts. First, it provides a general introduction to the work of Castel. Then, it demonstrates how work can be considered the main social question of contemporary global capitalism. Following, it resumes the relationship between work and social vulnerability. The study concludes by pointing out the importance of understanding work as the main contemporary social issue.

  20. Automatic program development a tribute to Robert Paige

    CERN Document Server

    Danvy, Olivier; Mairson, Harry; Pettorossi, Alberto

    2008-01-01

    This work, a tribute to renowned researcher Robert Paige, is a collection of revised papers published in his honor in the Higher-Order and Symbolic Computation Journal in 2003 and 2005.Among them there are two key papers: a retrospective view of his research lines, and a proposal for future studies in the area of the automatic program derivation.The book also includes some papers by members of the IFIP Working Group 2.1 of which Bob was an active member.All of the papers are related to the research interests of Dr Paige, who died in 1999, and, in particular, to the transformational development of programs and their algorithmic derivation from formal specifications.His colleagues, who include Olivier Danvy of the University of Aarhus in Denmark, and Alberto Pettorossi of the University of Rome 'Tor Vergata' in Italy, believe the book provides a renewed stimulus for continuing and deepening Dr Paige's research vision.Prof. Olivier Danvy is editor in chief of the Higher Order for Symbolic Computation journal.

  1. Between genres and styles in the films of Robert Bresson

    Directory of Open Access Journals (Sweden)

    Luíza Beatriz Alvim

    2016-02-01

    Full Text Available The films of French director Robert Bresson are considered sober and transcendental. However, in A gentle woman (1969 and in Four nights of a dreamer (1972, he included extracts of quite different genres, like a libertine comedy (the extract of film Benjamim by Michel Deville, 1968, a Shakespearean tragedy (a performance of Shakespeare´s Hamlet and a gangster film (When love possesses us, produced by Bresson himself. In a way, those excerpts represent exactly the opposite of Bresson´s cinema. On the other hand, they still have some familiarity with it. We analyze the approach of those genres in the sequences in Bresson´s films, as well of the styles present in them by the use of music and images of paintings.

  2. The South Pacific in the works of Robert Dean Frisbie

    Directory of Open Access Journals (Sweden)

    Nataša Potočnik

    2001-12-01

    In Tahiti he had ambitious writing plans but after four years of living in Tahiti, he left his plantation and sailed to the Cook Islands. He spent the rest of his life in the Cook Islands and married a local girl Ngatokorua. His new happiness gave him the inspiration to write. 29 sketches appeared in the United States in 1929, collected by The Century Company under the title of The Book of Puka-Puka. His second book My Tahiti, a book of memories, was published in 1937. After the death of Ropati 's beloved wife his goals were to bring up his children. But by this time Frisbie was seriously ill. The family left Puka-Puka and settled down on the uninhabited atoll of Suwarrow. Later on they lived on Rarotonga and Samoa where Frisbie was medically treated. Robert Dean Frisbie died of tetanus in Rarotonga on November 18, 1948. Frisbie wrote in a vivid, graceful style. His characters and particularly the atoll of Puka-Puka are memorably depicted. Gifted with a feeling for language and a sense of humor, he was able to capture on paper the charm, beauty, and serenity of life of the small islands in the South Pacific without exaggerating the stereotypical idyllic context and as such Frisbie's contribution to South Pacific literature went far deeper than that of many writers who have passed through the Pacific and wrote about their experiences. Frisbie's first book The Book of Puka-Puka was published in New York in 1929. It is the most endearing and the most original of his works. It was written during his lifetime on the atoll Puka-Puka in the Cook Islands. It is a collection of 29 short stories, episodic and expressively narrative in style. This is an account of life on Puka-Puka that criticizes European and American commercialism and aggressiveness, and presents the themes of the praise of isolation, the castigation of missionaries, and the commendation of Polynesian economic collectivism and sexual freedom. At the same time, the book presents a portrait of Frisbie himself

  3. [Robert Koch, eminent medical bacteriologist, creator of the applied microbiology and its technnology].

    Science.gov (United States)

    Suárez Fernández, Guillermo

    2012-01-01

    In our communication we wish consider to bring at a first instance the egregious figure of Robert Koch a hundred of years after his dead. Nobody else had contributed so much in the development of the bacteriology as unic and independent science. Several books and biographical sketchs had been published about Koch in german, english and french, mainly, with differents detais and interpretations, about his life. However, nobody doubred about his innovator spirit and scientist at highest level. This communication revise and discuss diverse chapters about his life as innovator, researcher, groups leader and Magister.

  4. The molecular mechanism underlying Roberts syndrome involves loss of ESCO2 acetyltransferase activity

    DEFF Research Database (Denmark)

    Gordillo, M.; Vega, H.; Trainer, A.H.

    2008-01-01

    Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced growth...... and nonsense mutations associated with decreased levels of mRNA and absence of protein. We found decreased proliferation capacity in RBS cell lines associated with cell death, but not with increased cell cycle duration, which could be a factor in the development of phocomelia and cleft palate in RBS...

  5. DIRECTOR/PRODUCER ROBERT ZEMECKIS DURING FILMING OF 'CONTACT' AT LC39 PRESS SITE

    Science.gov (United States)

    1997-01-01

    Robert Zemeckis, director/producer, and other Warner Bros. crew members oversee the filming of scenes for the movie 'Contact' at Kennedy Space Center's Launch Complex 39 Press Site on January 30. The screenplay for 'Contact' is based on the best-selling novel by the late astronomer Carl Sagan. The cast includes Jodie Foster, Matthew McConaughey, John Hurt, James Woods, Tom Skerritt, David Morse, William Fichtner, Rob Lowe and Angela Bassett. Described by Warner Bros. as a science fiction drama, 'Contact' will depict humankind's first encounter with evidence of extraterrestrial life.

  6. The dilemmas of indefiniteness: Utopia, fluidity and subjectivity in Stone, by Adam Roberts

    OpenAIRE

    André Cabral de Almeida Cardoso; Carla de Figueiredo Portilho

    2017-01-01

    http://dx.doi.org/10.5007/2175-8026.2017v70n2p107 Ae, the narrator-protagonist of the novel Stone, by Adam Roberts, is the only criminal in a post-human utopian society in which the use of nanotechnology has allowed humanity to reach its plenitude. Isolated from the rest of society, one day Ae is offered freedom and wealth if he agrees to kill the population of a whole planet. After accepting this offer, Ae must try to fulfil his mission at the same time that he questions himself and trie...

  7. A diagnosis of modern life: Robert Musil’s Der Mann ohne Eigenschaften as a critical-utopian project

    NARCIS (Netherlands)

    de Cauwer, S.

    2012-01-01

    Robert Musil wrote Der Mann ohne Eigenschaften as a critical intervention in the intellectual debates of his time. There are three general questions which prevail in the Musil scholarship: 1. What exactly did he want to critique and how is this critique at work in the novel? 2. What were his aims

  8. LOS DERECHOS FUNDAMENTALES COMO NORMAS JURÍDICAS MATERIALES EN LA TEORÍA DE ROBERT ALEXY

    Directory of Open Access Journals (Sweden)

    María Dolores Pérez Jaraba

    2011-12-01

    Full Text Available RESUMEN. La teoría de los derechos fundamentales de Robert Alexy se fundamenta en un concepto material de norma jurídica que es de carácter doble. Por un lado, se define por los rasgos propios de los principios, en consonancia con la idea de argumentación correcta. Pero, por otro lado, sigue teniendo peso la validez jurídica de las normas que contienen derechos fundamentales, consideradas como reglas constitucionales. Tal y como se argumenta en el trabajo, esta ambigüedad de la teoría de la norma de Alexy permite distintos acercamientos, positivistas y no positivistas, que es signo de su riqueza teórica. ABSTRACT. The theory of the civil rights of Robert Alexy is based on a material concept of rule of law. It is two-fold. On the one hand, is defined by the traits of the principles, consistent with the idea of ??correct argument. But on the other hand, weight is still the legal validity of the rules contained civil rights, constitutional rules considered. As argued in the work, this ambiguity of the norm theory allows for different approaches Alexy, positivist and positivist, which is a sign of its theoretical richness

  9. Charles Robert Darwin and Alfred Russel Wallace: their dispute over the units of selection.

    Science.gov (United States)

    Ruse, Michael

    2013-12-01

    Charles Darwin and Alfred Russel Wallace independently discovered the mechanism of natural selection for evolutionary change. However, they viewed the working of selection differently. For Darwin, selection was always focused on the benefit for the individual. For Wallace, selection was as much something of benefit for the group as for the individual. This difference is traced to their different background political-economic views, with Darwin in favor of Adam Smith's view of society and Wallace following Robert Owen in being a socialist.

  10. Robert J. Flaherty and Seáinín Tom Ó Dioráin: Lights, Camera, and (Not Too Much Action

    Directory of Open Access Journals (Sweden)

    Tomás Ó h-Íde (Ihde

    2016-03-01

    Full Text Available Famed director Robert Flaherty’s first direct sound film, Oidhche Sheanchais, was recently discovered at Harvard University. This article discusses the impact that the discovery will have on our understanding of this short film, especially as concerns film studies and folklore. It notes several misunderstandings reported in the literature over the years that have now been set right with the finding of the film. The article points to resources held in archives in Ireland and the United States that can additionally address questions related to this film. While a noteworthy contribution to the filmography of Robert Flaherty, the short ‘talkie’ must be approached with caution by folklorists due to the coaching of actors and cinematographic editing.

  11. Accuracy evaluation of pendulum gravity measurements of Robert von Sterneck

    Directory of Open Access Journals (Sweden)

    Alena Pešková

    2015-06-01

    Full Text Available The accuracy of first pendulum gravity measurements in the Czech territory was determined using both original surveying notebooks of Robert Daublebsky von Sterneck and modern technologies. Since more accurate methods are used for gravity measurements nowadays, our work is mostly important from the historical point of view. In previous  works, the accuracy of Sterneck’s gravity measurements was determined using only a small dataset. Here we process all Sterneck’s measurements from the Czech territory (a dataset ten times larger than in the previous works, and we complexly assess the accuracy of these measurements. Locations of the measurements were found with the help of original notebooks. Gravity in the site was interpolated using actual gravity models. Finally, the accuracy of Sterneck’s measurements was evaluated as the difference between the measured and interpolated gravity.

  12. CRAFTING THE MICROWORLD: HOW ROBERT HOOKE CONSTRUCTED KNOWLEDGE ABOUT SMALL THINGS.

    Science.gov (United States)

    Lawson, Ian

    2016-03-20

    This paper investigates the way in which Robert Hooke constructed his microscopical observations. His Micrographia is justifiably famous for its detailed engravings, which communicated Hooke's observations of tiny nature to his readers, but less attention has been paid to how he went about making the observations themselves. In this paper I explore the relationship between the materiality of his instrument and the epistemic images he produced. Behind the pictures lies an array of hidden materials, and the craft knowledge it took to manipulate them. By investigating the often counter-theoretical and conflicting practices of his ingenious microscope use, I demonstrate the way in which Hooke crafted the microworld for his readers, giving insight into how early modern microscopy was understood by its practitioners and audience.

  13. Robert Beuka. American Icon: Fitzgerald’s The Great Gatsby in Critical and Cultural Context.

    Directory of Open Access Journals (Sweden)

    Theodora Tsimpouki

    2012-02-01

    Full Text Available What new can another critical study on F. Scott Fitzgerald’s The Great Gatsby contribute to the already existing abundance of books concerning this national classic?  Yet, in this slim and elegant volume, Robert Beuka has managed to encompass not only the formal scholarship on Gatsby but also a complete and thorough survey of the impact of the novel into the world of popular culture. This parallel attempt throws light on the changing modes of interpretation that have affected our understandin...

  14. Abstract – IT Robert Lepage: anatomia di un regista

    Directory of Open Access Journals (Sweden)

    Giulio Boato

    2012-01-01

    Full Text Available Abstract – ITRobert Lepage è uno dei registi più rilevanti del panorama teatrale internazionale contemporaneo. L’articolo cerca di fornire una sintetica analisi della poetica del regista soffermandosi in particolar modo sulle nozioni di “montaggio” e di “immagine” al fine di definire il rapporto tra tecnologia e linguaggio in teatro. L’analisi di due spettacoli di Lepage presentati in occasione del Napoli Teatro Festival Italia(edizioni 2010 e 2011 alimenta la riflessione teorica che si snoda seguendo una metafora anatomica:analizzare separatamente (sezionando come il chirurgo le varie componenti narrative e formali del modus operandi lepagiano permette di comprendere più agevolmente l’architettura organica dell’insieme Abstract – FR Robert Lepage est un des metteurs en scène les plus remarqués de la scène théâtrale internationale contemporaine. L’article cherche à fournir une analyse synthétique de l’art poétique du metteur en scèneen se concentrant en particulier sur les notions de « montage » et « image » afin d’en définir le rapportentre technologie et langage au théâtre. L’analyse de deux spectacles de Lepage présentés pendant leNapoli Teatro Festival Italia (éditions 2010 et 2011 alimente la réflexion théorique qui se développeselon une métaphore anatomique : à la manière d'un chirurgien disséquant un corps, on analyseraséparément les différentes composantes narratives et formelles utilisées par Lepage afin de comprendreplus facilement l’architecture organique de l’ensemble. Abstract – EN Robert Lepage is one of the most significant directors on the international and contemporary theatrescene. The article tries to provide a synthetic analysis of the director’s work: focusing on the notions of “editing” and “image”, it defines the relation between technology and language in theatre. The analysis oftwo pieces of theatre presented at the Napoli Teatro Festival Italia

  15. David Roberts en Córdoba. Vistas de paisaje y arquitectura hacia 1833

    Directory of Open Access Journals (Sweden)

    Gámiz Gordo, Antonio

    2015-12-01

    Full Text Available David Roberts' views of Córdoba were carried out in 1833 and later redrafted as lithographs, engravings, and oils. These artworks enjoyed great commercial success and international diffusion due to their thematic and undoubted artistic value. The authors analyze their documentary value as a graphic record -prior to the advent of photography- of the urban landscape and architecture of Cordoba, a city now denominated a World Heritage Site. These images are studied here for the first time as a group, since they are either virtually untraceable or dispersed in museums throughout the world. In addition, these views have been contextualized with information concerning the artist and his Spanish journey, including a letter that he wrote from Córdoba. The documentary reliability of every image is also assessed, while the significant transformations of the places represented are indicated.Las vistas realizadas en Córdoba por David Roberts en 1833, reelaboradas como litografías, grabados y óleos, han gozado de gran éxito comercial y difusión internacional por su temática e indudable interés artístico. Esta investigación profundiza en su valor documental como registros gráficos previos a la aparición de la fotografía, del paisaje y la arquitectura de una ciudad hoy considerada Patrimonio de la Humanidad. Las imágenes presentadas se analizan por primera vez como conjunto, pues algunas son de difícil localización o están dispersas en museos de todo el mundo, y se contextualizan con datos sobre el pintor y su viaje por España, considerando una carta que éste escribió desde Córdoba. También se valora la fiabilidad documental de cada vista, a la vez que se detectan significativas transformaciones de los lugares representados.

  16. Kas noore õpetaja lähtetoetus motiveerib maakooli minema? / Robert Ossipov, Kerstin Kirmjõe, Liina Lüüs...[jt.

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastasid TLÜ õpetajakoolituse magistriõppe üliõpilane Robert Ossipov, TÜ üliõpilane Kerstin Kirmjõe, Tartu Mart Reiniku gümnaasiumi sotsiaalpedagoog Liina Lüüs, Tapa gümnaasiumi füüsikaõpetaja Henrik Sova, TÜ üliõpilane Ott Maidre

  17. Robert L. Oprisko’s Honor: A Phenomenology and Holden Caulfield

    Directory of Open Access Journals (Sweden)

    Eliza Quincey

    2015-07-01

    Full Text Available Robert L. Oprisko’s book, “Honor: A Phenomenology” challenges ones of the most obvious social norms in contemporary society. The concept of honor is one that the “generic” as Sergei Prozorov would say, simply cannot comprehend, nor even make efforts to define. Though fluently used in infamous works such as “The Iliad”, honor has yet to be so explicitly dissected until now. Dr. Oprisko’s book takes a promiscuous and brutally honest approach to “Honor” en generale as well as the many facets associated with such. Similar to fine cuisine and wine, there are many literary accompaniments that serve as wonderful pairings to broaden the kaleidoscope perspectives presented in the book. The contested novel by J.D. Salinger, “The Catcher in the Rye”, although by no means consists of any political or metaphysical theory, contains a stark personification of what is actively presented in every chapter of Dr. Oprisko’s book. Holden Caufield serves as a terrific litmus test for the concepts defined in Oprisko’s work. Holden is by no means a likeable character in the literary world, but however he is raw enough to be able to internalize and beholden things like, “honorableness”, “dignity”, and most importantly for Holden, “face”. Though to the naked eye and untrained mind these “things” which Holden can in fact internalize may seem fairly simple; it challenges the reader to humble oneself and accept that which is the raw. There is no space for semantics and lies in Oprisko’s work. In fact it is so shockingly explicit, one may find themselves utterly offended. Holden Caufield offended readers for years after Sallinger brought him to life over the span of 200 or more so pages, so much that the book was condemned in certain places. Robert L. Oprisko’s, “Honor: A Phenomenology”, in my utmost opinion, contains this same potential. By critically engaging in Oprisko’s spar with “honor”, one may find themselves

  18. Topics in mathematical economics and game theory essays in honor of Robert J. Aumann

    CERN Document Server

    Wooders, Myrna H

    1999-01-01

    Since the publication of Theory of Games and Economic Behavior by von Neumann and Morgenstern, the concept of games has played an increasing role in economics. It also plays a role of growing importance in other sciences, including biology, political science, and psychology. Many scientists have made seminal advances and continue to be leaders in the field, including Harsanyi, Shapley, Shubik, and Selten. Professor Robert Aumann, in addition to his important contributions to game theory and economics, made a number of significant contributions to mathematics. This volume provides a collection

  19. Versiones transgresoras y polémicas de Blancanieves: de Robert Walser a João César Monteiro

    OpenAIRE

    García-Manso, Angélica

    2017-01-01

    Este artículo analiza dos versiones heterodoxas del cuento de hadas Blancanieves: de un lado, la obra de teatro homónima escrita en 1901 por el suizo Robert Walser; y de otro, la película dirigida en el año 2000 por el cineasta portugués João Cé

  20. Le paysage chez Robert Melançon. Entre milieu citadin et scène baroque

    Directory of Open Access Journals (Sweden)

    Élise Lepage

    2015-11-01

    Full Text Available Cet article interroge le paysage urbain dans Le paradis des apparences (2004 de Robert Melançon en mobilisant tour à tour les concepts de « milieu » (Berque et d’« espaces mineur et majeur » (Desportes, qui invitent à une conception ouverte et dynamique du paysage. Soulignant tout d’abord l’intérêt du sujet melançonien pour les paysages « pauvres » de l’univers citadin, la réflexion se concentre ensuite sur l’importance de la médiation picturale et la valorisation toute baroque des apparences, des jeux d’illusions et autres trompe-l’œil dont fait son miel cette poésie par ailleurs pétrie d’une sobriété toute classique. This article questions the cityscape in Le paradis des apparences (2004 by Robert Melançon by discussing the concepts of « milieu » (Berque and « minor and major places » (Desportes that foster an open and dynamic conception of landscape. It first highlights the subject’s interest for “poor” and marginal cityscapes, before concentrating on the importance of the pictorial mediation and the baroque valorization of appearances, illusions, and other deceptive trompe-l’oeil, which are the very matter of this poetry that may not be as classical and understated as it first appears.

  1. CTD and Water Sample Data from Research Vessel Robert Gordon Sproul in the NE Pacific, 24 October 2013 (NCEI Accession 0157082)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The expedition by research vessel Robert Gordon Sproul from 23 to 25 October 2013 had the objective to recover a broken mooring from the CORC project (Consortium on...

  2. Lessons in power: Lyndon Johnson revealed. A conversation with historian Robert A. Caro.

    Science.gov (United States)

    Caro, Robert A

    2006-04-01

    No one can lead who does not first acquire power, and no leader can be great who does not know how to use that power. The trouble is that the combination of the two skills is rare. Amassing power requires ambition, a focused pragmatism, and a certain ruthlessness that is often at odds with the daring, idealistic vision needed to achieve great things with that power. The tension is as real in business as it is in politics. This magazine is replete with examples of successful senior managers who could not make the switch from ambitious executive to corporate leader because they did not know what to do with the power they had so expertly accumulated. Robert Caro is a student of power. For the past 27 years, the two-time Pulitzer prize-winning biographer of Robert Moses and Lyndon Johnson has focused on the question of how Johnson amassed and wielded power. Caro's deep understanding of the inner workings of power offers senior executives a nuanced picture of leadership at the highest level. In this wide-ranging conversation, Caro shares his insights about the nature of power, the complexity of ambition, and the role that the greater good can play in the making of a leader. Power doesn't always corrupt, he insists. But what it invariably does is reveal a leader's true nature. "Today, when CEOs have acquired more and more power to change our lives," Caro says,"they have become like presidents in their own right, and they, too, need to align themselves with something greater than themselves if they hope to become truly great leaders."

  3. 76 FR 9814 - Proposed Collection, Comment Request

    Science.gov (United States)

    2011-02-22

    ... 25, 2011. ADDRESSES: Send comments to Nora Kincaid, BLS Clearance Officer, Division of Management... INFORMATION CONTACT: Nora Kincaid, BLS Clearance Officer, at 202-691-7628 (this is not a toll free number...

  4. 78 FR 50449 - Proposed Collection, Comment Request

    Science.gov (United States)

    2013-08-19

    ... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS...

  5. 77 FR 36296 - Proposed Collection, Comment Request

    Science.gov (United States)

    2012-06-18

    ... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS...

  6. 75 FR 55612 - Proposed Collection, Comment Request

    Science.gov (United States)

    2010-09-13

    ... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid...

  7. 78 FR 29383 - Proposed Collection, Comment Request

    Science.gov (United States)

    2013-05-20

    ... comments to Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics... by fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora...

  8. 76 FR 2149 - Proposed Collection, Comment Request

    Science.gov (United States)

    2011-01-12

    ... comments to Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics... by fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora...

  9. Aasta 2000 - meteoor, mis ohustab maailma : Nobeli majanduspreemia värske laureaat soovitab 1. detsembrist külmutada valuutakursid / Robert Mundell ; interv. Marshall Loeb

    Index Scriptorium Estoniae

    Mundell, Robert

    1999-01-01

    Nobeli majanduspreemia laureaadi Robert Mundelli intervjuu ajakirja Fortune endisele toimetajale Marshall Loebile teleprogrammis Marketwatch. Aasta 2000 probleem rahaturgudel. Jack Kempi kiri USA presidendile Bill Clintonile

  10. Robert Wood Johnson Foundation Nurse Faculty Scholars program leadership training.

    Science.gov (United States)

    Campbell, Jacquelyn C; McBride, Angela Barron; Etcher, LuAnn; Deming, Katie

    The Robert Wood Johnson Foundation Nurse Faculty Scholars program was created to address the nursing shortage via development of the next generation of national leaders in academic nursing. The leadership training combined development at the scholar's home institution with in-person didactic and interactive sessions with notable leaders in nursing and other disciplines. A curriculum matrix, organized by six domains, was evaluated quantitatively and qualitatively. What set this program apart is that it immersed junior faculty in concerted leadership development with regard to all aspects of the faculty role so that teaching interactively, making use of the latest in information technology, giving testimony before a policy-making group, participating in strategic planning, and figuring out how to reduce the budget without jeopardizing quality were all envisioned as part of the faculty role. The domains covered by this program could easily be used as the framework to plan other leadership-development programs for the next generation of academic leaders. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Anthony (Tony) ROBERTS 5 March 1948 – 16 January 2008

    CERN Multimedia

    2008-01-01

    Tony came from Netherton, a small town near Birmingham in the English West Midlands, where he grew up with his parents, who ran the local grocery store, "T.W. Roberts & Son". This is where he regularly liked to return, firstly to help his parents and later simply to spend time with them. Here undoubtedly lie the roots of his organizational skills and his ability to get on so well with others. He soon became interested in the rapidly-developing field of computing and this was how he first came to CERN, during the summer of 1973, at the age of 25. He joined the DD Division as an operator responsible for the "calculators" of that time, where he stayed until 1979 when he joined the Fellows and Associates Section of Personnel Division. He participated in the general computerisation of the Administration and continued his career in the Records Office of HR Department, a post he held until the end. Though still very British – ob...

  12. The diffident naturalist Robert Boyle and the philosophy of experiment

    CERN Document Server

    Sargent, Rose-Mary

    2009-01-01

    In a provocative reassessment of one of the quintessential figures of early modern science, Rose-Mary Sargent explores Robert Boyle's philosophy of experiment, a central aspect of his life and work that became a model for mid- to late seventeenth-century natural philosophers and for many who followed them. Sargent examines the philosophical, legal, experimental, and religious traditions-among them English common law, alchemy, medicine, and Christianity-that played a part in shaping Boyle's experimental thought and practice. The roots of his philosophy in his early life and education, in his religious ideals, and in the work of his predecessors-particularly Bacon, Descartes, and Galileo-are fully explored, as are the possible influences of his social and intellectual circle. Drawing on the full range of Boyle's published works, as well as on his unpublished notebooks and manuscripts, Sargent shows how these diverse influences were transformed and incorporated into Boyle's views on and practice of experiment.

  13. 77 FR 11593 - Proposed Collection, Comment Request

    Science.gov (United States)

    2012-02-27

    ... in the Addresses section of this notice on or before April 27, 2012. ADDRESSES: Send comments to Nora... (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS Clearance Officer...

  14. Living with Hearing Loss

    Science.gov (United States)

    ... version of this page please turn Javascript on. Nora Woodruff and her family, including dad Bob, have ... hearing, balance, smell, taste, voice, speech, and language. Nora Woodruff, daughter of ABC newsman Bob Woodruff and ...

  15. Obituary: Robert Mowbray Walker, 1929-2004

    Science.gov (United States)

    Schoenherr, Neil T.

    2004-12-01

    Robert M. Walker, PhD, Professor of Physics in Arts & Sciences and a faculty fellow of the McDonnell Center for the Space Sciences, died of stomach cancer Thursday, 12 February 2004, in Brussels, Belgium. He was 75. Walker worked on the frontiers of space research for more than four decades. Robert Walker was born in Philadelphia on 6 February 1929. His mother was Dorothy Potter and he considered Roger Potter his father though he was not his biological father. His early years were spent in New York City and in upstate New York. He attended the Bronx High School of Science, earned his BS in physics from Union College and in 1954, he received his PhD in particle physics from Yale University. He subsequently joined the General Electric Laboratory in Schenectady, New York where he studied the radiation effects in solids. His work on defects in irradiated copper is still regarded as the definitive work on the topic. In the early 1960s, Walker's discovery of fossil nuclear particle tracks in minerals was instrumental to new developments in geo-chronology and cosmic ray physics. In particular, his discovery of tracks from nuclei heavier than iron opened a new frontier of cosmic ray physics. He subsequently pioneered the use of plastics to detect and count such nuclei in cosmic ray balloon flights. Beginning in 1966, when he moved to Washington University and became the first McDonnell Professor of Physics, his research interests turned more toward space physics. He was the inaugural director of the McDonnell Center, which was established in 1975 by a gift from aerospace pioneer James S. McDonnell. Walker was a member of the NASA committee that allocated samples of the first returned lunar materials, and his laboratory led the way in deciphering their record of lunar, solar system and galactic evolution. Together with Ghislaine Crozaz and other colleagues, Walker made path breaking laboratory studies of the first moon rocks revealing the history of solar radiation and

  16. Statistical ultrasonics: the influence of Robert F. Wagner

    Science.gov (United States)

    Insana, Michael F.

    2009-02-01

    An important ongoing question for higher education is how to successfully mentor the next generation of scientists and engineers. It has been my privilege to have been mentored by one of the best, Dr Robert F. Wagner and his colleagues at the CDRH/FDA during the mid 1980s. Bob introduced many of us in medical ultrasonics to statistical imaging techniques. These ideas continue to broadly influence studies on adaptive aperture management (beamforming, speckle suppression, compounding), tissue characterization (texture features, Rayleigh/Rician statistics, scatterer size and number density estimators), and fundamental questions about how limitations of the human eye-brain system for extracting information from textured images can motivate image processing. He adapted the classical techniques of signal detection theory to coherent imaging systems that, for the first time in ultrasonics, related common engineering metrics for image quality to task-based clinical performance. This talk summarizes my wonderfully-exciting three years with Bob as I watched him explore topics in statistical image analysis that formed a rational basis for many of the signal processing techniques used in commercial systems today. It is a story of an exciting time in medical ultrasonics, and of how a sparkling personality guided and motivated the development of junior scientists who flocked around him in admiration and amazement.

  17. Robert Alexy's Rules Ponderation and Narciso Baez's Theory Of Double Size of Human Rights in Analysis of Rights in Conflict Infanticide Concrete Case in Indigenous Villages

    OpenAIRE

    Rogério Gesta Leal; Fabio Biasi Pavão

    2015-01-01

    O presente artigo tem por objetivo analisar o tema da colisão de princípios e direitos fundamentais sob o prisma da teoria de Robert Alexy e de reflexões sobre a dupla dimensão dos direitos humanos de Narciso Leandro Xavier Baez. Para tanto, propõe uma análise dos conceitos elaborados por Robert Alexy sobre normas e princípios e situações de conflitos entre direitos. Alexy propõe regras de ponderação como alternativa à solução de conflitos entre princípios, proporcionando a prevalência de um ...

  18. Robert Mandell: a pioneer and giant in the art and science of contact lenses.

    Science.gov (United States)

    Polse, Kenneth A

    2008-10-01

    Robert B. Mandell is the quintessential modern clinical scientist. Over his long academic career, he has pioneered many advances in contact lens practice, ranging from a more complete understanding of corneal shape to the effects of contact lenses on corneal health. His classic text, Contact Lens Practice, first published in 1965, was reprinted 14 times in four editions up to 1988. Mandell's contributions to the advancement of the profession of optometry have always been characterized by a genuine concern for the patient and a steadfast belief that his research must have relevance to the practice of optometry.

  19. Obituary: Robert H. Koch (1929-2010)

    Science.gov (United States)

    Koch, Joanne; Corcoran, Michael; Holenstein, Bruce; Sion, Edward

    2011-12-01

    Robert H. Koch, emeritus professor of astronomy and astrophysics at the University of Pennsylvania, passed away at his home in Ardmore, Pennsylvania on 11 October 2010 after a brief illness. Bob was 80 years old and remained sharp and intellectually engaged with the astronomical community up until the onset of complications from a brain tumor. Bob was born in York, Pennsylvania on 19 December 1929, and graduated from York Catholic High School in 1947. He attended the University of Pennsylvania on a senatorial scholarship, graduating in 1951. After two years in the United States Army, he enrolled in graduate school at the University of Pennsylvania, doing his doctoral research on the photoelectric photometry of R CMa, AO Cas, AS Eri, and XY Leo at the Steward Observatory, University of Arizona in Tucson. Bob would continue this exploration of close binary stars, their atmospheres and interactions, for the rest of his career. Bob met his future spouse, Joanne C. Underwood, while in graduate school in 1957 and they were married in 1959. Bob received his PhD in astronomy in 1959 and moved to Amherst, Massachusetts, where he taught as a member of the Four College Astronomy Department until 1966. Following a year at the University of New Mexico in Albuquerque, Bob joined the Astronomy Department at Penn, teaching and doing research there until his retirement in 1996. Bob's main interests were the study of close and eclipsing binary stars, stellar envelopes and winds, intrinsic variables, transits and occultations, and the Milky Way Galaxy, producing well over 100 refereed publications. Bob was partial to photoelectric photometry and polarimetry, conducting most of his observational research at the University of Pennsylvania Flower and Cook Observatory, and at other ground- and space-based observatories. As an international figure in the area of binary stars, Bob had widespread collaborations with scientists at other institutions, in the US and throughout the world, and

  20. Robert S(trange McNamara (junho de 1916 a julho de 2009: a ascensão imperfeita da tecnocracia

    Directory of Open Access Journals (Sweden)

    Virgílio Caixeta Arraes

    2009-08-01

    Full Text Available o artigo trata da biografia de Robert McNamara,
    falecido em julho de 2009. Ele foi Secretário de Defesa durante a gestão de John Kennedy e Lyndon
    Johnson. Nesse sentido, ele foi um dos responsáveis
    pelo fracasso da Guerra do Vietnã.

  1. Spontaneous intracranial hemorrhage and multiple intracranial aneurysms in a patient with Roberts/SC phocomelia syndrome.

    Science.gov (United States)

    Wang, Anthony C; Gemmete, Joseph J; Keegan, Catherine E; Witt, Cordelie E; Muraszko, Karin M; Than, Khoi D; Maher, Cormac O

    2011-11-01

    Roberts/SC phocomelia syndrome (RBS) is a rare but distinct genetic disorder with an autosomal recessive inheritance pattern. It has been associated with microcephaly, craniofacial malformation, cavernous hemangioma, encephalocele, and hydrocephalus. There are no previously reported cases of RBS with intracranial aneurysms. The authors report on a patient with a history of RBS who presented with a spontaneous posterior fossa hemorrhage. Multiple small intracranial aneurysms were noted on a preoperative CT angiogram. The patient underwent emergency craniotomy for evacuation of the hemorrhage. A postoperative angiogram confirmed the presence of multiple, distal small intracranial aneurysms.

  2. LOS DERECHOS FUNDAMENTALES COMO NORMAS JURÍDICAS MATERIALES EN LA TEORÍA DE ROBERT ALEXY

    Directory of Open Access Journals (Sweden)

    María Dolores Pérez Jaraba

    2011-12-01

    ABSTRACT. The theory of the civil rights of Robert Alexy is based on a material concept of rule of law. It is two-fold. On the one hand, is defined by the traits of the principles, consistent with the idea of ??correct argument. But on the other hand, weight is still the legal validity of the rules contained civil rights, constitutional rules considered. As argued in the work, this ambiguity of the norm theory allows for different approaches Alexy, positivist and positivist, which is a sign of its theoretical richness

  3. An experimental ‘Life’ for an experimental life : Richard Waller's biography of Robert Hooke (1705)

    OpenAIRE

    Moxham, Noah

    2016-01-01

    Richard Waller's ‘Life of Dr Robert Hooke’, prefixed to his edition of Hooke's Posthumous Works (1705), is an important source for the life of one of the most eminent members of the early Royal Society. It also has the distinction of being one of the earliest biographies of a man of science to be published in English. I argue that it is in fact the first biography to embrace the subject's natural-philosophical work as the centre of his life, and I investigate Waller's reasons for adopting thi...

  4. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Process Funding Priorities Research Training News & Events News Nora's Blog NIDA in the News NIDA Notes Podcasts ... of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director The Link ...

  5. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects Contact the ... News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects National Drug & ...

  6. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  7. Publications - GMC 234 | Alaska Division of Geological & Geophysical

    Science.gov (United States)

    following North Slope wells: Itkillik River Unit #1, Nora Fed #1, Toolik Fed #1, Kemik Unit #1, Lupine Unit following North Slope wells: Itkillik River Unit #1, Nora Fed #1, Toolik Fed #1, Kemik Unit #1, Lupine Unit

  8. Number theory and modular forms papers in memory of Robert A Rankin

    CERN Document Server

    Ono, Ken

    2003-01-01

    Robert A. Rankin, one of the world's foremost authorities on modular forms and a founding editor of The Ramanujan Journal, died on January 27, 2001, at the age of 85. Rankin had broad interests and contributed fundamental papers in a wide variety of areas within number theory, geometry, analysis, and algebra. To commemorate Rankin's life and work, the editors have collected together 25 papers by several eminent mathematicians reflecting Rankin's extensive range of interests within number theory. Many of these papers reflect Rankin's primary focus in modular forms. It is the editors' fervent hope that mathematicians will be stimulated by these papers and gain a greater appreciation for Rankin's contributions to mathematics. This volume would be an inspiration to students and researchers in the areas of number theory and modular forms.

  9. Antibacterial activity of berberine-NorA pump inhibitor hybrids with a methylene ether linking group.

    Science.gov (United States)

    Samosorn, Siritron; Tanwirat, Bongkot; Muhamad, Nussara; Casadei, Gabriele; Tomkiewicz, Danuta; Lewis, Kim; Suksamrarn, Apichart; Prammananan, Therdsak; Gornall, Karina C; Beck, Jennifer L; Bremner, John B

    2009-06-01

    Conjugation of the NorA substrate berberine and the NorA inhibitor 5-nitro-2-phenyl-1H-indole via a methylene ether linking group gave the 13-substituted berberine-NorA inhibitor hybrid, 3. A series of simpler arylmethyl ether hybrid structures were also synthesized. The hybrid 3 showed excellent antibacterial activity (MIC Staphylococcus aureus, 1.7 microM), which was over 382-fold more active than the parent antibacterial berberine, against this bacterium. This compound was also shown to block the NorA efflux pump in S. aureus.

  10. Essay in honor of Robert Motherwell's centenary: “temporalized form”: mediating Romanticism and American Expressionism—Robert Motherwell, Henri Bergson, and the ontological origins of abstraction around 18001

    Directory of Open Access Journals (Sweden)

    Manfred Milz

    2016-02-01

    Full Text Available The influence of process metaphysics on the development of abstraction between 1800 and the second half of the 20th century can best be exemplified with the case of the American Expressionist painter and theoretician Robert Motherwell (1915–1991. Taking as its starting point Motherwell's exposure to the History of Idea of Romanticism, Arthur O. Lovejoy's yearlong seminar at Harvard (1937–38, the artist's affinity with fluid forms through motion brushstrokes in Romanticist painting is analyzed as a preformative stage of his own transitory creations. This is done by structural comparison between Motherwell's written reflections and Romanticist art theory. Motherwell's specific perception through Bergson's and Whitehead's lens of immanence and multiplicity, I argue, resonates Lovejoy's principle of “Romantic Evolutionism,” in its turn from being to becoming, derived from the philosophies of the Spiritualist Maine de Biran and the Idealist–Empiricist George Berkeley.

  11. Análisis Epistemológico del Modelo de Aprendizaje Acumulativo de Robert Gagne

    OpenAIRE

    Anibal Meza; Carmen Lazarte

    1993-01-01

    Se reseñan aspectos fundamentales de la psicología del aprendizaje de Robert Gagné, destacando sus bases filosóficas (positivismo y pragmatismo) y científicas ( conductismo y modelo de procesamiento de la información) y luego se evalúan dichos aspectos desde una perspectiva epistemológica en términos de sus <

  12. Wearing the crown of Solomon? Chief Justice Roberts and the Affordable Care Act "tax".

    Science.gov (United States)

    Muise, Robert J; Yerushalmi, David

    2013-04-01

    Attempting to play the role of King Solomon in his PPACA decision, Chief Justice John Roberts split the baby perversely by ruling it was not a tax under the Anti-Injunction Act, which would have likely deprived the Court of jurisdiction to hear this pre-enforcement challenge to the individual mandate, but it was a tax for taxing and spending purposes even though Congress said it was a "penalty" and not a tax. And the Chief Justice had to twist further his "wisdom" to hold that it was not an unconstitutional direct tax, even though that is exactly what it is, if it is a tax in the first instance.

  13. The remarkable vision of Robert Hooke (1635-1703): first observer of the microbial world.

    Science.gov (United States)

    Gest, Howard

    2005-01-01

    Robert Hooke played important roles in the early development of the Royal Society of London. As Curator of Experiments of the Society, he became a pioneering microscopist, prolific inventor, astronomer, geologist, architect, and an effective surveyor of the City of London following the Great Fire of 1666. Hooke's Micrographia (1665) revealed the microscopic structures of numerous biological and inorganic objects and became an important source of information for later studies. Aside from the body of detailed observations reported and depicted in Micrographia, the Preface is in itself an extraordinary document that exhibits Hooke's fertile mind, philosophical insights, and rare ability to look into the future.

  14. Robert Boyle, Transmutation, and the History of Chemistry before Lavoisier: A Response to Kuhn.

    Science.gov (United States)

    Newman, William R

    2014-01-01

    In an influential article of 1952, Thomas Kuhn argued that Robert Boyle had little or no influence on the subsequent development of chemistry. This essay challenges Kuhn's view on two fronts. First, it shows that Johann Joachim Becher developed his hierarchical matter theory under the influence of Boyle and then transmitted it to the founder of the phlogiston theory, G. E. Stahl. Second, this essay argues that transmutational matter theories were not necessarily opposed to the existence of stable chemical species, pace Kuhn. Boyle's corpuscular theory descended largely from the tradition of "chymical atomism," which often advocated both chrysopoeia and the reality of robust chemical substances.

  15. Robert Boyle and the representation of imperceptible entities.

    Science.gov (United States)

    Wragge-Morley, Alexander

    2018-03-01

    In this essay, I examine Robert Boyle's strategies for making imperceptible entities accessible to the senses. It is well known that, in his natural philosophy, Boyle confronted the challenge of making imperceptible particles of matter into objects of sensory experience. It has never been noted, however, that Boyle confronted a strikingly similar challenge in his natural theology - he needed to make an equally imperceptible God accessible to the senses. Taking this symmetrical difficulty as my starting point, I propose a new approach to thinking about the interconnections between Boyle's natural philosophy and natural theology. For the most part, studies of science and religion in the early modern period work by seeking out the influence of explicitly stated religious beliefs on scientific ideas. I argue, by contrast, that we need to focus on Boyle's representational practices, using his attempts to represent imperceptible entities as a means of uncovering metaphysical and theological presuppositions that he did not always articulate when stating his religious beliefs. With new interpretations of both A Discourse of Things Above Reason (1681) and Some Physico-Theological Considerations about the Possibility of the Resurrection (1675), I show that there were crucial similarities between Boyle's practices for representing both God and atoms. I go on to show, moreover, that Boyle used these practices to enact an ontological stance at odds with one of his most important professed beliefs.

  16. Cinema and the Great War - Andrew Kelly, 1997. History by Hollywood. The use and abuse of the American past - Robert Brant Toplin, 1996

    NARCIS (Netherlands)

    Kester, Bernadette

    1998-01-01

    textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.

  17. Midlatitude Cirrus Clouds Derived from Hurricane Nora: A Case Study with Implications for Ice Crystal Nucleation and Shape.

    Science.gov (United States)

    Sassen, Kenneth; Arnott, W. Patrick; O'C. Starr, David; Mace, Gerald G.; Wang, Zhien; Poellot, Michael R.

    2003-04-01

    Hurricane Nora traveled up the Baja Peninsula coast in the unusually warm El Niño waters of September 1997 until rapidly decaying as it approached southern California on 24 September. The anvil cirrus blowoff from the final surge of tropical convection became embedded in subtropical flow that advected the cirrus across the western United States, where it was studied from the Facility for Atmospheric Remote Sensing (FARS) in Salt Lake City, Utah, on 25 September. A day later, the cirrus shield remnants were redirected southward by midlatitude circulations into the southern Great Plains, providing a case study opportunity for the research aircraft and ground-based remote sensors assembled at the Clouds and Radiation Testbed (CART) site in northern Oklahoma. Using these comprehensive resources and new remote sensing cloud retrieval algorithms, the microphysical and radiative cloud properties of this unusual cirrus event are uniquely characterized.Importantly, at both the FARS and CART sites the cirrus generated spectacular halos and arcs, which acted as a tracer for the hurricane cirrus, despite the limited lifetimes of individual ice crystals. Lidar depolarization data indicate widespread regions of uniform ice plate orientations, and in situ particle replicator data show a preponderance of pristine, solid hexagonal plates and columns. It is suggested that these unusual aspects are the result of the mode of cirrus particle nucleation, presumably involving the lofting of sea salt nuclei in strong thunderstorm updrafts into the upper troposphere. This created a reservoir of haze particles that continued to produce halide-salt-contaminated ice crystals during the extended period of cirrus cloud maintenance. The inference that marine microbiota are embedded in the replicas of some ice crystals collected over the CART site points to the longevity of marine effects. Various nucleation scenarios proposed for cirrus clouds based on this and other studies, and the

  18. Publications - GMC 183 | Alaska Division of Geological & Geophysical

    Science.gov (United States)

    materials: AK State C #1, Bush Federal #1, Echooka Unit #1, Fin Creek Unit #1, E. De K. Leffingwell #1, Nora materials: AK State C #1, Bush Federal #1, Echooka Unit #1, Fin Creek Unit #1, E. De K. Leffingwell #1, Nora

  19. Overview of the Robert Wood Johnson Foundation Nurse Faculty Scholars program.

    Science.gov (United States)

    Campbell, Jacquelyn; Ladden, Maryjoan D; McBride, Angela Barron; Cimino, Andrea; Kostas-Polston, Elizabeth; Deming, Katie

    The Robert Wood Johnson Foundation Nurse Faculty Scholars program was created to address the nursing faculty shortage and thereby decrease the nursing shortage. The purpose of the study was to describe the program development, implementation, and ongoing outcome evaluation. Data on scholarly productivity, impact of research, research funding, and leadership positions were compiled, including an h-index (impact of publications) comparison with a comparison group of other interdisciplinary faculty at the same institutions of the 90 current and alumni scholars. There is evidence of the achievements of the individual scholars; however, the effect of the synergy of the multiple components of the program is difficult to capture in traditional evaluation strategies. The sense of possibility and responsibility (to the profession, to improving the health of all Americans, and to one's school of nursing and university) was a significant outcome of the program. Lessons learned from the program are important for the leadership development and retention of nursing faculty. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. 75 FR 57846 - Airworthiness Directives; Robert E. Rust, Jr. Model DeHavilland DH.C1 Chipmunk 21, DH.C1 Chipmunk...

    Science.gov (United States)

    2010-09-23

    ... Aircraft Certification Office (ACO), 1701 Columbia Avenue, College Park, Georgia 30337; telephone: (404... Airworthiness Directives; Robert E. Rust, Jr. Model DeHavilland DH.C1 Chipmunk 21, DH.C1 Chipmunk 22, and DH.C1... the Docket Office (phone: 800-647-5527) is Document Management Facility, U.S. Department of...

  1. Publications - GMC 155 | Alaska Division of Geological & Geophysical

    Science.gov (United States)

    : Brontosaur U.S. #1, Northstar #1, Nora Fed #1, OCS Y-0180-1 (Seal Island A-4), OCS Y-0338-1, Beli Unit #1 following seven North Slope wells: Brontosaur U.S. #1, Northstar #1, Nora Fed #1, OCS Y-0180-1 (Seal Island

  2. 78 FR 40958 - Amendment of Restricted Areas R-2504A & R-2504B; Camp Roberts, CA, and Restricted Area R-2530...

    Science.gov (United States)

    2013-07-09

    ...-0515; Airspace Docket No. 13-AWP-8] RIN 2120-AA66 Amendment of Restricted Areas R-2504A & R-2504B; Camp Roberts, CA, and Restricted Area R-2530; Sierra Army Depot, CA AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends the descriptions of restricted areas R...

  3. Pena de muerte, peso de la ley, justicia simbólica y cultura jurídica escocesa en “El Weir de Hermiston” de Robert Louis Stevenson (Death Penalty, Force of the Law, Symbolic Justice and Scottish Legal Culture in Robert L. Stevenson's ‘Weir of Hermiston'

    Directory of Open Access Journals (Sweden)

    Iker Nabaskues

    2017-12-01

    Full Text Available La novela El Weir de Hermiston del autor escocés Robert Louis Stevenson es una valiosa fuente para el análisis del campo del Derecho y Literatura (Law and Literature. En la obra del autor escocés se retratan personajes basados en importantes juristas de la historia de Escocia y se plasma una cultura jurídica con fuertes influencias de la Escuela de la Ilustración Escocesa, proyectando sobre la novela un sentido de la justicia particular, ambiguo y sutil característicos tanto de Escocia como del genial escritor y moralista.Robert Louis Stevenson´s novel Weir of Hermiston is an interesting source for the analysis from the Law and Literature approach. Stevenson shows characters based on important jurists in the Scottish history and a legal culture rooted in the Scottish enlightenment tradition, projecting on the novel a particular, ambiguous and subtle sense of justice, characteristic of Scotland and the great writer and moralist.DOWNLOAD THIS PAPER FROM SSRN: http://ssrn.com/abstract=3067289

  4. Understanding Robert Lucas (1967-1981: his influence and influences

    Directory of Open Access Journals (Sweden)

    Alexandre F.S. Andrada

    2017-05-01

    Full Text Available This paper analyzes Robert Lucas's contribution to economic theory between 1967 (year of his first solo publication and 1981 (the year before the emergence of Real Business Cycle approach, and it has two parts. The first one, using citation data from three different sources, we try to answer two questions: (i What are Lucas's most influential papers currently? (ii How has this influence changed through time? We show, for instance, that according to two of those three sources, Lucas's most influential paper today is not from his business cycle research agenda, which gave him his Nobel Prize in 1995. Moreover, it is clear the loss of influence of Lucas's macroeconomic theory since the early 1980s. In the second part, by cataloging all the works that Lucas had used as bibliographical references in his papers and separating them in two categories (positive and negative, we try to understand who exerted influence on him. We show that the author that Lucas most cited in a positive context were John Muth, Milton Friedman and Edmund Phelps. The authors more often cited in a negative context were John M. Keynes and A. W. Phillips. We discuss the reasons behind this data.

  5. Caruso St John y Robert Smithson: Interferencias

    Directory of Open Access Journals (Sweden)

    Emilia Hernández Pezzi

    2016-05-01

    Full Text Available Resumen Los discursos cruzados son el soporte común del presente número de Cuadernos. El cruce que planteamos tiene como protagonistas al artista Robert Smithson y a los arquitectos Adam Caruso y Peter St John. Estos últimos hacen mención del trabajo del artista norteamericano para explicar su proyecto de remodelación de Stortorget, la plaza de la catedral en el centro de Kalmar, Suecia. A partir de aquí, comenzamos una exploración del trabajo y las preocupaciones de ambos que nos permite dibujar convergencias y sintonías procesuales por encima de las diferencias temáticas, ideológicas y estilísticas. Al disponer en paralelo la obra de Smithson y Caruso St John descubrimos vibraciones y resonancias que muestran una interacción productiva de sus preocupaciones. La materia se convierte en sus propuestas en un objeto activo y sensible, un depósito energético con el que operar. El traslado de piedras en Stortorget convoca la memoria de la ciudad del mismo modo que el basalto y la sal del Spiral Jetty, erosionados por el tiempo, nos hablan de procesos abiertos. El tiempo y la memoria pasan a ser soportes estratégicos con los que construyen sus miradas. Los objetos se disuelven en las relaciones que establecen con su entorno produciendo equilibrios frágiles e instantáneos. De esta manera el artículo pretende generar un vórtice de reflexión, una espiral en cuyo recorrido se manifiesten las tensiones parciales del cruce propuesto, sus fijezas momentáneas.

  6. Chromatid repulsion associated with Roberts/SC phocomelia syndrome is reduced in malignant cells and not expressed in interspecies somatic-cell hybrids.

    Science.gov (United States)

    Krassikoff, N E; Cowan, J M; Parry, D M; Francke, U

    1986-01-01

    Different cell types from a female patient with Roberts/SC phocomelia syndrome were evaluated quantitatively for the presence of repulsion of heterochromatin and satellite regions of mitotic chromosomes. Whereas EBV-transformed lymphoblasts from an established cell line revealed these phenomena at frequencies equal to those in PHA-stimulated lymphocytes and cultured skin fibroblasts, aneuploid cells from a metastatic melanoma displayed them at 50% lower frequency. Cocultivation of the patient's fibroblasts with either an immortal Chinese hamster cell line or with a human male fibroblast strain carrying a t(4;6)(p14;q21) translocation showed that the phenomenon was not corrected or induced by a diffusible factor or by cell-to-cell contact. In each experiment, only the patient's metaphase spreads revealed chromatid repulsion. In fusion hybrids between the patient's fibroblasts and an established Chinese hamster cell line, the human chromosomes behaved perfectly normally, suggesting that the gene product which is missing or mutant in Roberts/SC phocomelia syndrome is supplied by the Chinese hamster genome. Images Fig. 1 Fig. 2 Fig. 3 PMID:3788975

  7. Health aspects of Arctic exploration – Alaska's medical history based on the research files of Dr. Robert Fortuine

    Directory of Open Access Journals (Sweden)

    Kathleen Murray

    2013-08-01

    Full Text Available Background . Robert Fortuine provided basic medical care to Alaska Native people, chronicled the Health Aspects of Arctic Exploration and through a number of influential publications, was the first to thoroughly document and analyse Alaska's Medical History. This overview of his published work will provide the reader with a detailed overview, so that they can begin to explore Dr. Fortuine's many published works in more detail. Objective . This review will explore Alaska's Medical History and the Health Aspects of Arctic Exploration through the research files and the 10 most significant publications of Dr. Robert Fortuine. Design . Review of Dr. Fortuine's major works and the master bibliography has over 3,000 references and 81 subjects. The master bibliography is a merger of 55 separate bibliographies, which provides a wealth of bibliographic information. This paper will describe his 10 most significant publications, 2 of which began as a journal issue. Results . Dr. Fortuine was a prolific writer throughout his career, publishing 134 articles and books. He wrote papers and books on Alaska's medical history, tuberculosis and health care delivery from Russian–America through the Public Health Service efforts in the territory and then the State of Alaska. The master bibliography has over 3,000 references and 81 subjects. This list has a significant number of entries for tuberculosis with almost one-third of the entries including this heading. Others dwell on the history of “pre-contact” health, the history of Alaska Native health care, the history of the Alaska Department of Health, especially the tuberculosis programme, the role of the US Public Health Service and traditional medicine. He completely reviewed every Governors’ and the US Surgeon General's reports in regard to Alaska content. This paper describes his 10 most significant publications. Conclusions . Robert Fortuine's published works offer a wealth of information and insight

  8. Robert Lowell’s Culturally Coded Lexis

    Directory of Open Access Journals (Sweden)

    Lidija Davidovska

    2014-12-01

    Full Text Available In this paper, I will examine how a vital ele­ment of Robert Lowell’s descriptive and narrative struc­tures, i.e., the lexis, promise to unfold the “layers” of the culture that served as context for Life Studies. This in­volves exploring both the denotations and connotations of his culturally encoded lexis, that is, the external mean­ings of certain words and phrases before they “en­ter” the poem and the internal meanings they acquire after entering the poem. This process of “verbal osmo­sis”, when words absorb meaning from these different contexts, is, what I believe, critic and linguist Winifred Nowottny describes as “give and take between those patterns” (Fowler, 2009: 31. My analysis will focus on the sociolinguistic patina accrued on certain units of Lowell’s poetic lexis, such as names of historical people, events and concepts belonging to American and Euro­pean spiritual cultures and traditions, as well as brand names from popular material culture of the first half of the twentieth century. The analysis will also dwell on the use of idioms, catch phrases and other verbal clichés which reflect the culture that generated them. They func­tion as verbal “ready-mades” that additionally rein­force Lowell’s well-known anecdotal, colloquial and infor­mal poetic language. The choice of these particular lexical items is significant as they reflect the categoriza­tion of the world and the experience of the poetic voice or the “language user” in broader linguistic terms. At the same time, the categorization of the experience reflects the ideational position, the worldview of the language user. In the context of his poetics of immanence and experi­ence, this culturally coded poetic diction is ana­lyzed as another authentic and documented presenta­tion of immanent narrator’s “lived experience”.

  9. Robert J. Shiller: Nobel prize for 2013: Capital market efficiency

    Directory of Open Access Journals (Sweden)

    Pantelić Svetlana

    2015-01-01

    Full Text Available In 2013 the Nobel Prize in Economic Sciences was awarded to the American economists, Eugene Fama, Lars Peter Hansen and Robert Shiller. The monetarists, Fama and Hansen, from the University of Chicago, and the Neo- Keynesian, Shiller, from the Yale University, according to the Swedish Royal Academy, won this prestigious prize for their research providing mathematical and economic models to determine (irregularities in the stock value trends at the stock exchanges. With his colleagues, in the 1960s Fama established that, in the short term, it is extremely difficult to forecast stock prices, given that new information gets embedded in the prices rather quickly. Shiller, however, determined that, although it is almost impossible to predict the stock prices for a period of few days, this is not true for a period of several years. He discovered that the stock prices fluctuate much more substantially than corporation dividents, and that the relationship between prices and dividends tends to decline when high, and to grow when low. This pattern does not apply only to stocks, but also to bonds and other forms of capital.

  10. Convergent evolution of argonaute-2 slicer antagonism in two distinct insect RNA viruses.

    NARCIS (Netherlands)

    Mierlo, J.T. van; Bronkhorst, A.W.; Overheul, G.J.; Sadanandan, S.A.; Ekstrom, J.O.; Heestermans, M.; Hultmark, D.; Antoniewski, C.; Rij, R.P. van

    2012-01-01

    RNA interference (RNAi) is a major antiviral pathway that shapes evolution of RNA viruses. We show here that Nora virus, a natural Drosophila pathogen, is both a target and suppressor of RNAi. We detected viral small RNAs with a signature of Dicer-2 dependent small interfering RNAs in Nora virus

  11. Publications - GMC 164 | Alaska Division of Geological & Geophysical

    Science.gov (United States)

    Staines St. 10-09-23, Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 , Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 (Orion #1), OCS Y-0334

  12. OF SOCIAL NETWORKS AND LINGUISTIC INFLUENCE: THE LANGUAGE OF ROBERT LOWTH AND HIS CORRESPONDENTS

    Directory of Open Access Journals (Sweden)

    Ingrid Tieken-Boon van Ostade

    2005-06-01

    Full Text Available Analysing the unpublished correspondence of Robert Lowth, author of A Short Introduction to English Grammar (1762, this article attempts to find evidence of linguistic influence between people belonging to the same social network. Such evidence is used to try and determine where Lowth found the linguistic norm he presented in his grammar. Adding to the data presented by Nevalainen and Raumolin Bmnberg (2003 on the basis of their study of fourteen morphosyntactic items in the Corpus of Early English Correspondence, a detailed analysis is presented of eighteenth-century English. One of the results is an explanation for the presence in Lowth's grammar of the stricture against double negation at a time when double negation was no longer in current use.

  13. Análisis Epistemológico del Modelo de Aprendizaje Acumulativo de Robert Gagne

    Directory of Open Access Journals (Sweden)

    Anibal Meza

    1993-12-01

    Full Text Available Se reseñan aspectos fundamentales de la psicología del aprendizaje de Robert Gagné, destacando sus bases filosóficas (positivismo y pragmatismo y científicas ( conductismo y modelo de procesamiento de la información y luego se evalúan dichos aspectos desde una perspectiva epistemológica en términos de sus <

  14. Human radiation studies: Remembering the early years. Oral history of biophysicist Robert Edmund Rowland, Ph.D., January 27, 1995

    International Nuclear Information System (INIS)

    1995-06-01

    This report provides a transcript of an oral interview with Dr. Robert Edmund Rowland by representatives of the US DOE Office of Human Radiation Research on January 27, 1995. Dr. Rowland was involved with the study of radium in the human body since 1950 and relates his knowledge of over 40 years of study of radium in the human body including dial painters, inmates of Elgin State Hospital, and other treated therapeutically with radium

  15. spareparts.exchange: Rahim and Robert, Stitched Together in Silence (Creative Intervention

    Directory of Open Access Journals (Sweden)

    Monir Moniruzzaman

    2016-12-01

    Full Text Available Spare Parts (spareparts.exchange is an art installation created collaboratively by Heather Dewey-Hagborg, Jim Ruxton, Camille Turner, and Monir Moniruzzaman. Based on Monir Moniruzzaman’s ethnographic research on the illicit organ trade, Spare Parts explores the ethics of organ trafficking and the emergence of bodily inequality in times of transplant tinkering. In this installation, the viewer is confronted with life sized video projections of Rahim Sheikh, a Bangladeshi kidney seller and Robert Zurrer, a Canadian kidney transplant recipient/buyer, whose kidneys were commodified in the marketplace. The video projections are installed so that the individuals sit in silence facing each other.  Spare Parts highlights the intimacy of spare parts, the economy of the global marketplace, the perils of techno-medicine, and what is means to be human in the 21st century. The installation captures that the buying and selling of body parts is not just a market transaction, but rather represents the desperation, dis/connection, and inequality that exists in the trade.

  16. Something black in the American Psyche: formal innovation and Freudian imagery in the comics of Winsor McCay and Robert Crumb.

    Science.gov (United States)

    Shannon, Edward A

    2010-01-01

    Winsor McCay’s Little Nemo in Slumberland anticipates Robert Crumb’s work. McCay’s innocent dreamscapes seem antithetical to the sexually explicit work of anti-capitalist Crumb, but Nemo looks forward to Crumb in subject and form. Nemo’s presentation of class, gender, and race, and its pre-Freudian sensibility are ironic counterpoints to Crumb’s political, Freudian comix.

  17. Statement of Robert Bernero, Deputy Director, Office of Nuclear Material Safety and Safeguards, Nuclear Regulatory Commission: Accompanied by Robert Browning, Director, Division of High-Level Waste Management

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    Mr. Chairman, members of the Committee, thank you for this opportunity to present the views of the Nuclear Regulatory Commission (NRC) on the Department of Energy's (DOE) program for disposal of civilian high-level wastes. I have with me Mr. Robert Browning, Director of NRC's Division of High-Level Waste Management. As you know, we are in the pre-licensing consultation phase of the repository program. DOE has the responsibility to conduct site characterization activities to acquire data necessary to evaluate the suitability of each candidate site for an application to the Commission for construction authorization. I would like to discuss some of our concerns about site characterization at the three sites recommended to an approved by the President for characterization as candidate sites. It will then discuss our comments on DOE's Draft Mission Plan Amendment dated January, 1987 and, more generally, our interaction with DOE. Finally, I would like to describe our quality assurance activities. I will be happy to respond to any questions from the Committee

  18. The Robert Wood Johnson Foundation Nurse Faculty Scholars Program: An opportunity for junior nurse faculty

    Science.gov (United States)

    Coffman, Maren J.; Goodman, Janice H.; Thomas, Tami L.; Roberson, Donna

    2014-01-01

    The Robert Wood Johnson Foundation Nurse Faculty Scholars program provides promising junior faculty extramural funding, expert mentoring, and the training needed to be successful in the academic role. The Nurse Faculty Scholars program, which admitted its first cohort in 2008, is designed to address the nursing faculty shortage by enhancing leadership, educational, and research skills in junior nursing faculty. This article provides an overview of the program, its purpose, and its eligibility requirements. The authors give strategies for selecting mentors, developing the written application, and preparing for an oral interview. Finally, the authors provide an analysis of funded institutions, research design and methods from current and recently funded projects, and rank and positions held by nursing mentors. PMID:22818282

  19. Direitos fundamentais, ponderação e racionalidade jurídica nas decisões judiciais brasileiras: uma leitura a partir de Robert Alexy / Fundamental rights, balancing and legal rationality in brazilian judicial decisions: a reading from Robert Alexy

    OpenAIRE

    Heletícia Leão de Oliveira

    2016-01-01

    Este artigo analisa aspectos relevantes da dogmática dos direitos fundamentais e do seu sopesamento a partir do pensamento de Robert Alexy, cuja teoria tenta responder de forma racional e fundamentada as questões axiológicas. Alega-se que a ponderação utilizada pelos tribunais brasileiros foi transformada em um princípio e está longe da fórmula alexyana original, pois ela leva à discricionariedade. Para que as decisões judiciais não sejam acusadas de serem arbitrárias e ilegítimas, é necessár...

  20. Bookshelf (Conceptual Foundations of Modern Particle Physics, by Robert E. Marshak)

    International Nuclear Information System (INIS)

    Fritzsch, Harald

    1994-01-01

    Particle physics really began as an independent scientific discipline after the Second World War. Robert Marshak was one of its pioneers on the theoretical front, starting out his career with important contributions on meson theory (together with Hans Bethe). The life of Marshak, who died in December 1992, was intimately interwoven with the post-war development of particle physics. His work on weak interaction theory was an important step towards the formulation of the V-A theory, the main pillar on which the modern electroweak theory rests erected. He is also remembered as the founder of the biennial 'Rochester' conference series (March 1993, page 24). Just before his death Robert Marshak finished writing his book on the concepts of particle physics. The book starts out with an historical account of the development of the field. He divides it into the startup period (1945-60) - the period of meson physics, the physics of strange particles, parity violation etc; the heroic period (1960-1975) when the Standard Model of the electroweak and strong interactions was developed; and finally the period of consolidation and speculation (since 1975). Marshak's recollection of the development of particle physics represents a personal view, worth reading by young researchers, although it does not attempt to provide a complete picture. After the historical chapter Marshak introduces the reader to the basics of quantum field theory (space-time symmetries, global internal symmetries and their breaking, gauge symmetries). Later he turns to a description of QCD and the gauge theory of the electroweak interactions. A whole chapter is devoted to the problems related to anomalies. In the last part of the book Marshak discusses various hypotheses of unifying the strong and electroweak interactions, especially the various facets of the SO(10) theory, followed by a long discussion of the fermion generation problem and of preon models. The book concludes with an extensive

  1. Implementation of Robert's Coping with Labor Algorithm© in a large tertiary care facility.

    Science.gov (United States)

    Fairchild, Esther; Roberts, Leissa; Zelman, Karen; Michelli, Shelley; Hastings-Tolsma, Marie

    2017-07-01

    to implement use of Roberts' Coping with Labor Algorithm © (CWLA) with laboring women in a large tertiary care facility. this was a quality improvement project to implement an alternate approach to pain assessment during labor. It included system assessment for change readiness, implementation of the algorithm across a 6-week period, evaluation of usefulness by nursing staff, and determination of sustained change at one month. Stakeholder Theory (Friedman and Miles, 2002) and Deming's (1982) Plan-Do-Check-Act Cycle, as adapted by Roberts et al (2010), provided the framework for project implementation. the project was undertaken on a labor and delivery (L&D) unit of a large tertiary care facility in a southwestern state in the USA. The unit had 19 suites with close to 6000 laboring patients each year. full, part-time, and per diem Registered Nurse (RN) staff (N=80), including a subset (n=18) who served as the pilot group and champions for implementing the change. a majority of RNs held a positive attitude toward use of the CWLA to assess laboring women's coping with the pain of labor as compared to a Numeric Rating Scale (NRS). RNs reported usefulness in using the CWLA with patients from a wide variety of ethnicities. A pre-existing well-developed team which advocated for evidence-based practice on the unit proved to be a significant strength which promoted rapid change in practice. this work provides important knowledge supporting use of the CWLA in a large tertiary care facility and an approach for effectively implementing that change. Strengths identified in this project contributed to rapid implementation and could be emulated in other facilities. Participant reports support usefulness of the CWLA with patients of varied ethnicity. Assessment of change sustainability at 1 and 6 months demonstrated widespread use of the algorithm though long-term determination is yet needed. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Book Review by Daniel Moran of The Iraq War: Strategy, Tactics, and Military Lessons, by Anthony H. Cordesman, and The Iraq War: A Military History, by Williamson Murray and Major General Robert H. Scales

    OpenAIRE

    Moran, Daniel

    2004-01-01

    Reviewed: TThe Iraq War: Strategy, Tactics, and Military Lessons, by Anthony H. Cordesman, and The Iraq War: A Military History, by Williamson Murray and Major General Robert H. Scales The United States and its allies went to war against Iraq in 2003, as Williamson Murray and Robert Scales reasonably propose, “to make an example out of Saddam’s regime, for better or worse” (p. 44). Exactly what the war exemplified, and whether the results are better or worse than might have be...

  3. Elsa Baxter, head of the Swiss Post Office's Stamps and Philately Unit, presents to Robert Aymar, CERN's Director-General, the Swiss commemorative stamp dedicated to CERN

    CERN Multimedia

    Patrice Loiez

    2004-01-01

    'I am delighted to offer you a special stamp which commemorates your Laboratory's fifty-year history and pays tribute to its achievements, its pioneering spirit and its perseverance' said Mrs Baxter to Robert Aymar, CERN's Director-General.

  4. Friedrich Robert Helmert, founder of modern geodesy, on the occasion of the centenary of his death

    Science.gov (United States)

    Ihde, Johannes; Reinhold, Andreas

    2017-08-01

    Friedrich Robert Helmert died in Potsdam in 1917 at the age of 74 after serving for over 30 years as director of the Royal Prussian Geodetic Institute and of the Central Bureau of the Internationale Erdmessung, the forerunner of today's International Association of Geodesy. He dedicated his life and his scientific career to the field of geodesy. His teachings on theoretical and physical geodesy were incorporated into university curricula around the world and hence into international endeavours to measure planet Earth. The purpose of this article is to illustrate the impact he has had on the development of modern geodesy and on the related sciences.

  5. A CONVERSATİON ON INSTRUCTİONAL DESİGN WİTH ROBERT GAGNÉ AND DAVİD MERRİLL NO:1

    OpenAIRE

    Necmi Esgi; Omer Arslan

    2016-01-01

    The purpose of the study is to bring in the first part of diachronic conversation on instructional design with Robert Gagné and David Merrill to transcripts. This conversation was hosted by Utah State University, in the United States of America, in July 10, 1989. Throughout the history of instructional design, these two scientists are considered as the pioneers of the field and in these sessions, they summarize and compare their studies. In the first session, Gagné and Merrill represent their...

  6. Dr Robert Aymar, Director of the International Thermonuclear Experimental Reactor (ITER), was nominated to succeed Professor Luciano Maiani as CERN's Director General, to take office on 1 January 2004.

    CERN Document Server

    2002-01-01

    Dr Robert Aymar, Director of the International Thermonuclear Experimental Reactor (ITER), was nominated to succeed Professor Luciano Maiani as CERN's Director General, to take office on 1 January 2004.

  7. White goddess--the unspeakable name. An inquiry into Robert Graves' King Jesus.

    Science.gov (United States)

    Nakano, N

    1984-03-01

    Robert Graves is a poet-mythographer, well-known in the U. K. and the U. S. A., but not in Japan despite his huge amount of poetic, mythographical, prose and critical works. Furthermore, even in the U. S. A. and the U. K., some people have been shunning him politely as a versatile iconoclast possessed of the White Goddess. In fact, it is not difficult to imagine that when King Jesus, a life story of Christ, was published, people were shocked at his extraordinary mythographical Christology derived from his enthusiasm towards the White Goddess Cult. In Christ he discovered the fragments of maternal doctrine as a new concept in opposition to the Apollonian theory of Judaism, but they seemed to be quite incomplete in the author's eyes lacking in something most essential in life, recognition of love and hatred discipline. This paper is an inquiry into how the author developed his own hermaneutics of Christ through his wide and thorough scholarship on mythology, history, the Bible and Celtic poetry.

  8. Rib fracture as a predictor of future fractures in young and older postmenopausal women: National Osteoporosis Risk Assessment (NORA)

    Science.gov (United States)

    Sajjan, S. G.; Barrett-Connor, E.; McHorney, C. A.; Miller, P. D.; Sen, S. S.; Siris, E.

    2013-01-01

    Summary A rib fracture history after age 45 was associated with a 5.4-fold increase in new rib fracture risk and a 2.4-fold increase in risk of any new clinical fracture in 155,031 postmenopausal women. A rib fracture history suggests osteoporosis and should be considered when evaluating patients for interventions to prevent fractures. Introduction Until recently, little attention was paid to rib fracture as an osteoporosis marker. Emerging evidence suggests rib fracture may be an osteoporotic fracture in men and women. We report the 5-year independent association between baseline rib fracture histories and self-reported future fractures by age (decade) in the NORA cohort (155,031 postmenopausal women, 50–99 years). Methods Participants reported fracture history and responded to follow-up surveys at years 1, 3, or 6. Women with a baseline rib fracture history without other fractures were compared with women with no fracture. Results At baseline, 4,758 (3.07%) women reported a rib fracture history without other fractures; 6,300 women reported 6,830 new clinical fractures, including wrist (2,271), rib (1,891), spine (1,136), hip (941), and forearm (591). Adjusted relative risk (ARR) values (95% confidence interval [CI]) for future fractures in women with rib fracture history versus women with no fracture history were 5.4 (4.8–6.1) at the rib, 2.1 (1.7–2.6) at the spine, and 1.4 (1.1–1.7) at the wrist, and not significant for forearm or hip fractures. Future fracture risk was at least doubled in women with a rib fracture history in all ages: ARR (95% CI) 3.4 (2.8–4.0) for ages 50–59, 2.5 (2.1–3.0) for ages 60–69, 2.0 (1.7–2.3) for ages 70–79, and 2.0 (1.6–2.6) for ages >80. Conclusions Rib fracture, the second most common clinical fracture in women (after wrist fracture), predicted future fractures of the rib, wrist, and spine at all ages. Women presenting with rib fractures should be evaluated for appropriate management to prevent future

  9. The discovery of microorganisms by Robert Hooke and Antoni Van Leeuwenhoek, fellows of the Royal Society.

    Science.gov (United States)

    Gest, Howard

    2004-05-01

    The existence of microscopic organisms was discovered during the period 1665-83 by two Fellows of The Royal Society, Robert Hooke and Antoni van Leeuwenhoek. In Micrographia (1665), Hooke presented the first published depiction of a microganism, the microfungus Mucor. Later, Leeuwenhoek observed and described microscopic protozoa and bacteria. These important revelations were made possible by the ingenuity of Hooke and Leeuwenhoek in fabricating and using simple microscopes that magnified objects from about 25-fold to 250-fold. After a lapse of more than 150 years, microscopy became the backbone of our understanding of the roles of microbes in the causation of infectious diseases and the recycling of chemical elements in the biosphere.

  10. Sobre o Conceito de Justiça em John Rawls e Robert Nozick

    Directory of Open Access Journals (Sweden)

    Keberson Bresolin

    2015-03-01

    Full Text Available O presente artigo tem como objetivo apresentar o pensamento e o conceito de justiça como equidade presente na obra Uma Teoria da Justiça (1971 de John Rawls. Para isso, demonstraremos como o autor relaciona os conceitos de posição original e véu de ignorância como procedimento da escolha racional. Além disso, pretendemos apresentar também o conceito de justiça presente na obra Anarquia, estado e utopia (1974 de Robert Nozick. Por isso, abordaremos a concepção libertária nozickiana dos direitos individuais e o estado mínimo, o qual deve ser fundamentado para proteger estes direitos. Desta forma, procederemos expondo os princípios que subjazem no pensamento político de ambos os autores e como estes constroem seu arcabouço conceitual. Ao fazer isso, colocaremos as duas propostas em diálogo.

  11. Predictive factors for the success of McRoberts' manoeuvre and suprapubic pressure in relieving shoulder dystocia: a cross-sectional study.

    Science.gov (United States)

    Lok, Zara Lin Zau; Cheng, Yvonne Kwun Yue; Leung, Tak Yeung

    2016-10-29

    McRoberts' and suprapubic pressure are often recommended as the initial choices of manoeuvres to manage shoulder dystocia, as they are believed to be less invasive compared to other manoeuvres. However, their success rates range from 23 to 40 %. This study aims to investigate the predictive factors for the success of McRoberts' manoeuvre with or without suprapubic pressure (M+/-S). All cases of shoulder dystocia in a tertiary hospital in South East Asia were recruited from 1995 to 2009. Subjects were analysed according to either 'success' or 'failure' of M+/-S. Maternal and fetal antenatal and intrapartum factors were compared by univariate and multivariate analysis. Among 198 cases of shoulder dystocia, M+/-S as the primary manoeuvre was successful in 25.8 %. The other 74.2 % needed either rotational or posterior arm manoeuvres or combination of manoeuvres. Instrumental delivery was the single most significant factor associated with an increased risk of failed M+/-S on logistic regression (p dystocia occurred after instrumental delivery but was 47.7 % after spontaneous vaginal delivery. When shoulder dystocia occurs after instrumental vaginal delivery, the chance of failure of M+/-S is 85 %, which is 4.7 times higher than that after spontaneous vaginal delivery. Hence all operators performing instrumental delivery should be proficient in performing all manoeuvres to relieve shoulder dystocia when M+/-S cannot do so.

  12. Una época de frío moral: La sociología comunitarista de Robert N. Bellah

    Directory of Open Access Journals (Sweden)

    HELENA BÉJAR

    1996-01-01

    Full Text Available A partir de la actualidad del comunitarismo, el presente artículo plantea un análisis crítico de la obra de Robert N. Bellah, uno de los líderes de dicho movimiento intelectual y político. así, se tratan las diversas tradiciones que conforman los valores de la vida pública y privada de los americanos, tales como el individualismo o la ciudadanía. el artículo desbroza también los diversos sentidos del término "comunidad", como parte de una urdimbre teórica que se contrapone al liberalismo utilitario.

  13. Distribution and origin of authigenic smectite clays in Cape Roberts Project Core 3, Victoria Land Basin, Antarctica

    Science.gov (United States)

    Priestas, A.W.; Wise, S.W.

    2007-01-01

    Of some 800 m of lower Oligocene marine sediments cored continuously from the seafloor in the Victoria Land Basin of Antarctica at Cape Roberts Site CRP-3, the lower 500 m exhibit authigenic smectite clay coats on shallow-water sandstone grains. A scanning electron microscope/EDS study of 46 fracture sections confirms that the distribution of the clay coats through the unit is not uniform or evenly distributed, but rather varies with depth, original porosity, and the kinds and abundance of source materials. Our results suggest that smectite emplacement resulted from in-situ, low-temperature burial diagenesis rather than hydrothermal or fault-focused thermobaric fluids.

  14. Sobre la obra de Robert M. MacIver. La acción social entre la comunidad y el Estado

    Directory of Open Access Journals (Sweden)

    Herrera Gómez, Manuel

    2004-12-01

    Full Text Available Sociology, science and political philosophy are the disciplinary fields that have guided Robert M. Maclver's investigation. This is based on accurate intuition always present in his thought: to study human social action in order to set up a realistic theory on democracy with important federal contents by reason of an understanding of the relation between society and state. At this relation, state is a simple mean belonging to the sphere of civilization and society is an original reality (a "network of groups and communities", in which the primary interests of any social being are expressed.

    Sociología, ciencia y filosofía política son los ámbitos disciplinares que han guiado y alimentado, compenetrándose, la investigación de Robert M. Maclver. Todo esto es debido a una intuición bien precisa que está presente en la base de su pensamiento: estudiar la acción social para fundar una teoría realista de la democracia con importantes contenidos federales en virtud de una concepción de la relación entre sociedad y Estado en la que este último es un simple medio perteneciente a la esfera de la civilización respecto a la sociedad entendida como realidad originaria (como red de grupos y comunidades, en la que se constituyen y encuentran expresión los intereses primarios de todo ser social.

  15. A Multicultural Glimpse of Rural and Urban Adolescence in Robert Newton Peck's "A Day No Pigs Would Die" and Paul Zindel's "The Pigman."

    Science.gov (United States)

    Agnello, Mary Frances Linden

    "A Day No Pigs Would Die" by Robert Newton Peck and "The Pigman" by Paul Zindel are 2 short novels that offer treasures in the form of many lessons in life to share in the language arts classroom. These two rich novels can serve as sources for multicultural understanding of rural and urban life, as well as for interpreting the…

  16. Number theory Diophantine problems, uniform distribution and applications : festschrift in honour of Robert F. Tichy’s 60th birthday

    CERN Document Server

    Grabner, Peter

    2017-01-01

    This volume is dedicated to Robert F. Tichy on the occasion of his 60th birthday. Presenting 22 research and survey papers written by leading experts in their respective fields, it focuses on areas that align with Tichy’s research interests and which he significantly shaped, including Diophantine problems, asymptotic counting, uniform distribution and discrepancy of sequences (in theory and application), dynamical systems, prime numbers, and actuarial mathematics. Offering valuable insights into recent developments in these areas, the book will be of interest to researchers and graduate students engaged in number theory and its applications.

  17. Homage to Robert Hooke (1635-1703): new insights from the recently discovered Hooke Folio.

    Science.gov (United States)

    Gest, Howard

    2009-01-01

    Microorganisms were first observed by Robert Hooke and Antoni van Leeuwenhoek between 1665 and 1678. In 1665, Hooke published Micrographia, which depicted the details of 60 objects as seen in the microscope. One chapter was devoted to the microfungus Mucor, the first microbe observed by the human eye. Leeuwenhoek, despite having no scientific training, became the first to observe protozoa, red blood cells, the sperm cells of animals, and bacteria, which he described in numerous letters to the Royal Society of London. In 1677, Hooke became Secretary of the Royal Society and, in the same year, confirmed some of Leeuwenhoek's discoveries. The discovery in 2006 of more than 650 pages of Hooke's missing records (the "Hooke Folio") allows us to verify the proceedings of Royal Society meetings and promises to be an important new source of Hooke's views on the renaissance of science in the 17th century.

  18. Memória digital e o futuro da comunicação: entrevista com Robert Darnton

    Directory of Open Access Journals (Sweden)

    Aline Strelow

    2013-06-01

    Full Text Available Robert Darnton é diretor da Biblioteca da Universidade Harvard e referência internacional nos estudos de história da comunicação e história cultural. Dirige também, atualmente, a Digital Public Library of America, biblioteca digital lançada em abril de 2013, que reúne acervos de bibliotecas, arquivos e museus. Autor de dezenas de livros, nesta entrevista, ele fala sobre o desenvolvimento da DPLA, sobre os desafios enfrentados pelos projetos de digitalização, sobre o futuro do livro, do jornalismo e da pesquisa em história da comunicação diante das novas tecnologias. A entrevista foi realizada em outubro de 2012, no escritório do autor na Universidade Harvard.

  19. Beck x Roberts: Comparativos do Diagrama do Metrô de Londres

    Directory of Open Access Journals (Sweden)

    Joaquim Redig

    2015-06-01

    Full Text Available Este artigo foi originalmente dirigido à disciplina Design e Visualização da Informação, ministrada pelo Prof. André Monat no curso de Doutorado em Design da ESDI-UERJ, Escola Superior de Desenho Industrial da Universidade do Estado do Rio de Janeiro, em 2013, a partir da proposta do professor de se examinar a pertinência da estrutura radial proposta por Maxwell J. Roberts para o design de mapas de redes de transporte. No artigo, procuro demonstrar que, por ser uma forma padrão pré-convencionada e abstrata, não valorizando a relação visual analógica com o objeto representado – a rede geo-espacial do sistema de transporte, variável para cada cidade – a estrutura radial não facilita a compreensão e o uso da rede, relativamente ao sistema ortogonal/diagonal projetado por Harry Beck para o assim chamado Diagrama do metrô londrino, que, partindo do código mais universal e ancestral de orientação que é a Rosa dos Ventos, se baseia nos eixos dos percursos. Por isso, este sistema se tornou um paradigma mundial no campo do Design de Informação, ainda não superado.

  20. [Robert Schweitzer. Eine Unveröffentlichte Quelle zur Schulgeschichte von Reval Ferdinand Wiedemanns Geschichte des Revaler Gouvernementsgymnasiums aus dem Jahr 1856] / Paul Kaegbein

    Index Scriptorium Estoniae

    Kaegbein, Paul

    2008-01-01

    Arvustus: Robert Schweitzer. Eine Unveröffentlichte Quelle zur Schulgeschichte von Reval Ferdinand Wiedemanns Geschichte des Revaler Gouvernementsgymnasiums aus dem Jahr 1856. - Buch und Bildung im Baltikum. Münster : LIT, 2005. lk. 495-525. Kubermangugümnaasiumi vanemõpetaja Ferdinand Wiedemann kirjutas 1856. aastal kooli ajaloo, mis mingitel põhjustel jäi avaldamata. Tema tööd on kasutanud 1881. aastal Gotthard von Hansen

  1. Celebrando São Besso ou o que Robert Hertz e a Escola Francesa de Sociologia têm a nos dizer sobre festas, rituais e simbolismo

    Directory of Open Access Journals (Sweden)

    Renata de Castro Menezes

    2009-01-01

    Full Text Available Este artigo apresenta reflexões sobre as possibilidades e as dificuldades do estudo de festas religiosas através da interpretação de um texto de Robert Hertz (um dos pesquisadores da Escola Francesa de Sociologia, originalmente publicado em 1913, que versa sobre a festa de São Besso, um evento religioso que ocorre nos alpes italianos. O objetivo do presente trabalho é destacar as pistas que Hertz deixou abertas em seu estudo e sugerir maneiras de nos apropriarmos de seus insights em nossas análises atuais.This article presents some reflections about the possibilities and difficulties in the study of religious festivals. It does so by reinterpreting a text written by Robert Hertz, one of the researches of the French School of Sociology. It is a text about Saint Besso’s festival, originally published in 1913. The aim of the article is to stress some of the clues that Hertz opened with his work and to suggest how his insights can be useful for our own analyses about festivals.

  2. Contemporary Studies Network Roundtable: Responding to Robert Macfarlane’s ‘Generation Anthropocene’

    Directory of Open Access Journals (Sweden)

    Rachel Sykes

    2017-02-01

    Full Text Available In April 2016, 'The Guardian' published ‘Generation Anthropocene: How humans have altered the planet forever’ by the celebrated academic and nature writer Robert Macfarlane. Reflecting on the article’s importance as a critical experiment and, perhaps, a vital form of public engagement, Contemporary Studies Network (CSN asked six of its members, working across very different areas of literary and cultural studies, to respond to and extend Macfarlane’s article, mapping the different ways in which literary scholars might approach the age of the Anthropocene. Conducted via email, this roundtable conversation asks to what extent the Anthropocene marks a new era in literary criticism, how exactly it extends preexisting strands of ecocriticism and trauma studies, and what the global scope of the term might be beyond the confines of the Western literary canon. Discussion ranges from issues of temporality to genre and form and it also addresses Macfarlane’s rhetoric, his call to arms for those working in the humanities, for a more comprehensive investigation in to the roles of literature and art in responding to and representing what may become a new epoch.

  3. A capital Scot: microscopes and museums in Robert E. Grant's zoology (1815-1840).

    Science.gov (United States)

    Quick, Tom

    2016-06-01

    Early nineteenth-century zoology in Britain has been characterized as determined by the ideological concerns of its proponents. Taking the zoologist Robert E. Grant as an exemplary figure in this regard, this article offers a differently nuanced account of the conditions under which natural-philosophical knowledge concerning animal life was established in post-Napoleonic Britain. Whilst acknowledging the ideological import of concepts such as force and law, it points to an additional set of concerns amongst natural philosophers - that of appropriate tool use in investigation. Grant's studies in his native Edinburgh relied heavily on the use of microscopes. On his arrival in London, however, he entered a culture in which a different set of objects - museum specimens - held greater persuasive power. This article relates changes in Grant's ideas and practices to the uneven emphases on microscopic and museological evidence amongst European, Scottish and English natural philosophers at this time. In so doing, it identifies the reliance of London-based natural philosophers on museology as constituting a limiting effect on the kinds of claim that Grant sought to make regarding the nature of life.

  4. Engineering approaches to transdermal drug delivery: a tribute to contributions of prof. Robert Langer.

    Science.gov (United States)

    Mitragotri, S

    2013-01-01

    Transdermal drug delivery continues to provide an advantageous route of drug administration over injections. While the number of drugs delivered by passive transdermal patches has increased over the years, no macromolecule is currently delivered by the transdermal route. Substantial research efforts have been dedicated by a large number of researchers representing varied disciplines including biology, chemistry, pharmaceutics and engineering to understand, model and overcome the skin's barrier properties. This article focuses on engineering contributions to the field of transdermal drug delivery. The article pays tribute to Prof. Robert Langer, who pioneered the engineering approach towards transdermal drug delivery. Over a period spanning nearly 25 years since his first publication in the field of transdermal drug delivery, Bob Langer has deeply impacted the field by quantitative analysis and innovative engineering. At the same time, he has inspired several generations of engineers by collaborations and mentorship. His scientific insights, innovative technologies, translational efforts and dedicated mentorship have transformed the field. © 2013 S. Karger AG, Basel.

  5. Challenging Expertise: Paul Feyerabend vs. Harry Collins & Robert Evans on democracy, public participation and scientific authority: Paul Feyerabend vs. Harry Collins & Robert Evans on scientific authority and public participation.

    Science.gov (United States)

    Sorgner, Helene

    2016-06-01

    This paper compares Feyerabend's arguments in Science in a Free Society to the controversial theory of expertise proposed by Harry Collins and Robert Evans as a Third Wave of Science Studies. Is the legitimacy of democratic decisions threatened by the unquestioned authority of scientific advice? Or does, on the contrary, science need protection from too much democratic participation in technical decisions? Where Feyerabend's political relativism envisions democratic society as inherently pluralist and demands equal contribution of all traditions and worldviews to public decision-making, Collins and Evans hold a conception of elective modernism, defending the reality and value of technical expertise and arguing that science deserves a privileged status in modern democracies, because scientific values are also democratic values. I will argue that Feyerabend's political relativism provides a valuable framework for the evaluation of Collins' and Evans' theory of expertise. By constructing a dialog between Feyerabend and this more recent approach in Science and Technology Studies, the aim of this article is not only to show where the two positions differ and in what way they might be reconciled, but also how Feyerabend's philosophy provides substantial input to contemporary debate. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. A System-Wide Approach to Physician Efficiency and Utilization Rates for Non-Operating Room Anesthesia Sites.

    Science.gov (United States)

    Tsai, Mitchell H; Huynh, Tinh T; Breidenstein, Max W; O'Donnell, Stephen E; Ehrenfeld, Jesse M; Urman, Richard D

    2017-07-01

    There has been little in the development or application of operating room (OR) management metrics to non-operating room anesthesia (NORA) sites. This is in contrast to the well-developed management framework for the OR management. We hypothesized that by adopting the concept of physician efficiency, we could determine the applicability of this clinical productivity benchmark for physicians providing services for NORA cases at a tertiary care center. We conducted a retrospective data analysis of NORA sites at an academic, rural hospital, including both adult and pediatric patients. Using the time stamps from WiseOR® (Palo Alto, CA), we calculated site utilization and physician efficiency for each day. We defined scheduling efficiency (SE) as the number of staffed anesthesiologists divided by the number of staffed sites and stratified the data into three categories (SE 1). The mean physician efficiency was 0.293 (95% CI, [0.281, 0.305]), and the mean site utilization was 0.328 (95% CI, [0.314, 0.343]). When days were stratified by scheduling efficiency (SE 1), we found differences between physician efficiency and site utilization. On days where scheduling efficiency was less than 1, that is, there are more sites than physicians, mean physician efficiency (95% CI, [0.326, 0.402]) was higher than mean site utilization (95% CI, [0.250, 0.296]). We demonstrate that scheduling efficiency vis-à-vis physician efficiency as an OR management metric diverge when anesthesiologists travel between NORA sites. When the opportunity to scale operational efficiencies is limited, increasing scheduling efficiency by incorporating different NORA sites into a "block" allocation on any given day may be the only suitable tactical alternative.

  7. O PROCESSO CRIATIVO EM THE BROTHER, DE ROBERT COOVER: UMA RELEITURA DO SAGRADO NA CONTEMPORANEIDADE

    Directory of Open Access Journals (Sweden)

    Fernanda Aquino Sylvestre

    2014-05-01

    Full Text Available Robert Coover é um importante escritor norte-americano preocupado com as perspectivas sociais, psicológicas, econômicas e políticas contemporâneas e com o modo como elas se configuram na formação da sociedade do seu país. Essa preocupação se reflete tanto nas técnicas de construção de suas histórias, quanto nas críticas apresentadas em suas narrativas. O trabalho em questão discute a reescrita que Coover faz de mitos bíblicos dentro do contexto pós-moderno, globalizado, compondo novos textos que subvertem os elementos tradicionais da narrativa. Mais especificamente, este artigo analisa a reescrita que o autor norte-americano empreende acerca da passagem bíblica da Arca de Noé no conto “The Brother”.

  8. Les « Photo Poche » de Robert Delpire : un exemple d’édition culturelle

    Directory of Open Access Journals (Sweden)

    Gaëlle Morel

    2010-06-01

    Full Text Available « Accessible, maniable, élégante, soigneusement photogravée et imprimée », la collection « Photo Poche » de Robert Delpire apparaît vingt-cinq ans après sa création comme une grande réussite éditoriale. Fondée en 1982 et subventionnée à l’époque par le ministère de la Culture, la série des petits livres noirs constitue également un objet emblématique du processus de légitimation culturelle de la photographie en France. Éditeur expérimenté, Delpire est nommé à la tête de la principale institut...

  9. The work of Charles Rennie Mackintosh and Robert Lorimer within national and international tendencies in design at the turn of the century [dissertation

    OpenAIRE

    Milne, Jason E.

    1992-01-01

    This dissertation examines the designs of two of Scotland's most important architects, Charles Rennie Mackintosh and Robert Lorimer, based in Glasgow and Edinburgh respectively at the turn of the century. Their work is viewed in relation to international tendencies in progressive architecture and design, namely the Arts and Crafts Movement; also in relation to the existing strand of Romanticism in Scotland and the Scottish Baronial Revival which in some respects reported a particular manifest...

  10. Comparing two maps by Geographer Robert de Vaugondy that represent the Kingdom of Portugal in the 18th century (1751 with the current mapping of the country as regards its topography, hydrography, shoreline definition and settlements

    Directory of Open Access Journals (Sweden)

    Marco Pais Neves Dos Santos

    2014-07-01

    Full Text Available In our paper “Estudo de dois Mapas do Geografo Robert de Vaugondy relativos ao Reino de Portugal do Século XVIII (1751” (Study on two maps by Geographer Robert de Vaugondy representing the Kingdom of Portugal in the 18th century, published in Revista Semina: Ciências Sociais e Humanas, Vol. 34, Issue No 1, 2013, we tried to give an explanation for the administrative divisions that appear in those maps. After having studied a number of texts dedicated to the period in question and other related documents, we came to the conclusion that the most logic explanation for those divisions is that they represent ecclesiastical divisions. In this paper, we go further in our analysis and compare these two maps with some current maps of Portugal, taking into account its topography, hydrography, shoreline definition and settlements. Although there are some errors in his maps, we can conclude that Robert de Vaugondy’s work, in terms of his knowledge and geographic representation of Portugal, was the best anyone could do at the time, and we restate the idea that the two maps represent ecclesiastical divisions.

  11. Seeking a Second Opinion: Robert McNamara’s Distrust of the U.S. Intelligence Community During Operation Rolling Thunder

    Directory of Open Access Journals (Sweden)

    Thomas A. Reinstein

    2016-04-01

    Full Text Available Thomas A. Reinstein reexamines how military intelligence was evaluated and employed during the Vietnam War, especially by Secretary of Defense Robert McNamara. Reinstein takes a relatively unexplored approach by delving into the Secretary’s personal policy predilections and efforts to retain cabinet influence as factors determining his use of intelligence reports. These considerations guided his changing positions on the bombing campaign known as Rolling Thunder. The article’s focus on personal considerations in policy making adds complexity to our views of decision making but also raises very serious concerns about the flawed nature of those processes and the dangers of miscalculation at the highest levels of government.

  12. Essay: Robert H. Siemann As Leader of the Advanced Accelerator Research Department

    Energy Technology Data Exchange (ETDEWEB)

    Colby, Eric R.; Hogan, Mark J.; /SLAC

    2011-11-14

    Robert H. Siemann originally conceived of the Advanced Accelerator Research Department (AARD) as an academic, experimental group dedicated to probing the technical limitations of accelerators while providing excellent educational opportunities for young scientists. The early years of the Accelerator Research Department B, as it was then known, were dedicated to a wealth of mostly student-led experiments to examine the promise of advanced accelerator techniques. High-gradient techniques including millimeter-wave rf acceleration, beam-driven plasma acceleration, and direct laser acceleration were pursued, including tests of materials under rf pulsed heating and short-pulse laser radiation, to establish the ultimate limitations on gradient. As the department and program grew, so did the motivation to found an accelerator research center that brought experimentalists together in a test facility environment to conduct a broad range of experiments. The Final Focus Test Beam and later the Next Linear Collider Test Accelerator provided unique experimental facilities for AARD staff and collaborators to carry out advanced accelerator experiments. Throughout the evolution of this dynamic program, Bob maintained a department atmosphere and culture more reminiscent of a university research group than a national laboratory department. His exceptional ability to balance multiple roles as scientist, professor, and administrator enabled the creation and preservation of an environment that fostered technical innovation and scholarship.

  13. Essay: Robert H. Siemann As Leader of the Advanced Accelerator Research Department

    International Nuclear Information System (INIS)

    Colby, Eric R.; Hogan, Mark J.

    2008-01-01

    Robert H. Siemann originally conceived of the Advanced Accelerator Research Department (AARD) as an academic, experimental group dedicated to probing the technical limitations of accelerators while providing excellent educational opportunities for young scientists. The early years of the Accelerator Research Department B, as it was then known, were dedicated to a wealth of mostly student-led experiments to examine the promise of advanced accelerator techniques. High-gradient techniques including millimeter-wave rf acceleration, beam-driven plasma acceleration, and direct laser acceleration were pursued, including tests of materials under rf pulsed heating and short-pulse laser radiation, to establish the ultimate limitations on gradient. As the department and program grew, so did the motivation to found an accelerator research center that brought experimentalists together in a test facility environment to conduct a broad range of experiments. The Final Focus Test Beam and later the Next Linear Collider Test Accelerator provided unique experimental facilities for AARD staff and collaborators to carry out advanced accelerator experiments. Throughout the evolution of this dynamic program, Bob maintained a department atmosphere and culture more reminiscent of a university research group than a national laboratory department. His exceptional ability to balance multiple roles as scientist, professor, and administrator enabled the creation and preservation of an environment that fostered technical innovation and scholarship.

  14. Lesnoi tsvetok : [luuletused] / Anna Haava ; lühibiograafia: O. K. [Oskar Kruus

    Index Scriptorium Estoniae

    Haava, Anna, pseud., 1864-1957

    1999-01-01

    Sisu: Lesnoi tsvetok 1-2 / tlk. Bronislav Kezhun ; Net, stih ne vetrõ navevajut / tlk. Nora Javorskaja ; Odin lish raz ljubov bõvajet / tlk. B. Kezhun ; "Zabotõ svoi shoronila..." / tlk. Marina Tervonen ; Sodom i Gomorra / tlk. V. Sokolov ; Oh, rodina ; Vetra, tshto mansardu moju produvali / tlk. Nora Javorskaja. Orig.: Nõmmelill 1-2 ; Ei tule luule tuulest ; Üks ainus kord ; Mu mured kõik matsin ma maha ; Sina, Soodom ja Gomorra ; Oh kodumaa ; Kui puhus mu katusekambri tuul

  15. EDITORIAL: Roberts Prize for the best paper published in 2012 Roberts Prize for the best paper published in 2012

    Science.gov (United States)

    Cherry, Simon; Ruffle, Jon

    2013-08-01

    The publishers of Physics in Medicine and Biology (PMB), IOP Publishing, in association with the journal owners, the Institute of Physics and Engineering in Medicine (IPEM), jointly award the Roberts prize for the best paper published in PMB during the previous year. The procedure for deciding the winner is a two-stage process. First, a shortlist of contenders is drawn up based on those papers that had the best referees' quality assessments, with a further quality check and endorsement by the Editorial Board. The papers on the shortlist are then reviewed by a specially convened IPEM committee consisting of members with fellow status. This committee reads the shortlisted papers and selects the winner. We have much pleasure in advising readers that the Roberts Prize for the best paper published in 2012 is awarded to Michel Defrise, Ahmadreza Rezaei and Johan Nuyts from the Vrije Universiteit Brussels and the Katholieke Universiteit Leuven, Belgium for their breakthrough paper that describes how the information needed for attenuation correction in PET imaging can be extracted, to within a constant, from time-of-flight emission data: Time-of-flight PET data determine the attenuation sinogram up to a constant 2012 Phys. Med. Biol. 57 885 Michel Defrise1, Ahmadreza Rezaei2 and Johan Nuyts2 1Department of Nuclear Medicine, Vrije Universiteit Brussel, B-1090 Brussels, Belgium 2Department of Nuclear Medicine, Katholieke Universiteit Leuven, B-3000 Leuven, Belgium This paper represents an important and timely contribution to the literature as time-of-flight PET scanners are now offered by several manufacturers. In hybrid PET/CT scanners, the PET attenuation correction, necessary for quantitative reconstruction of the tracer distribution, can be derived directly from the CT data. Sometimes, however, the PET and CT scans may be poorly aligned due to patient motion and other approaches are needed. In addition, hybrid PET/MRI scanners also, have been developed recently, and in

  16. Diversity dynamics: The experience of male Robert Wood Johnson Foundation nurse faculty scholars.

    Science.gov (United States)

    Brody, Abraham A; Farley, Jason E; Gillespie, Gordon L; Hickman, Ronald; Hodges, Eric A; Lyder, Courtney; Palazzo, Steven J; Ruppar, Todd; Schiavenato, Martin; Pesut, Daniel J

    Managing diversity dynamics in academic or clinical settings for men in nursing has unique challenges resulting from their minority status within the profession. The purpose of this study was to share challenges and lessons learned identified by male scholars in the Robert Wood Johnson Foundation Nurse Faculty Scholars program and suggest strategies for creating positive organizations promoting inclusive excellence. Multiple strategies including informal mentored discussions and peer-to-peer dialogue throughout the program, formal online surveys of scholars and National Advisory Committee members, and review of scholar progress reports were analyzed as part of the comprehensive evaluation plan of the program. Diversity dynamic issues include concerns with negative stereotyping, microaggression, gender intelligence, and differences in communication and leadership styles. Male nurse faculty scholars report experiencing both opportunities and challenges residing in a predominately female profession. This article attempts to raise awareness and suggest strategies to manage diversity dynamics in service of promoting the development of a culture of health that values diversity and inclusive excellence for both men and women in academic, research, and practice contexts. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. The two faces of Robert Fitzroy, Captain of HMS Beagle and governor of New Zealand.

    Science.gov (United States)

    Paul, Diane B; Stenhouse, John; Spencer, Hamish G

    2013-09-01

    Robert FitzRoy, Captain of HMS Beagle and second governor of New Zealand, has two contradictory reputations among modern academics. Evolutionary biologists and Darwin scholars generally view FitzRoy as a supporter of slavery, famously quarrelling with the abolitionist Darwin over that topic during a Brazilian stopover early in the voyage of HMS Beagle. He is also regarded as a political and religious reactionary, taking a biblically creationist position at the infamous 1860 Oxford meeting of the British Association for the Advancement of Science. New Zealand historians, however, view his record as governor much more positively. They emphasize that FitzRoy was wildly unpopular with the British settlers because of his enlightened insistence that the native Maori should be treated fairly. We outline the history of these seemingly inconsistent views and examine the evidence for each. We conclude by suggesting that a more nuanced account of FitzRoy's career would surely be more thought-provoking as well as respectful of the facts.

  18. Dr. Robert G. Heath: a controversial figure in the history of deep brain stimulation.

    Science.gov (United States)

    O'Neal, Christen M; Baker, Cordell M; Glenn, Chad A; Conner, Andrew K; Sughrue, Michael E

    2017-09-01

    The history of psychosurgery is filled with tales of researchers pushing the boundaries of science and ethics. These stories often create a dark historical framework for some of the most important medical and surgical advancements. Dr. Robert G. Heath, a board-certified neurologist, psychiatrist, and psychoanalyst, holds a debated position within this framework and is most notably remembered for his research on schizophrenia. Dr. Heath was one of the first physicians to implant electrodes in deep cortical structures as a psychosurgical intervention. He used electrical stimulation in an attempt to cure patients with schizophrenia and as a method of conversion therapy in a homosexual man. This research was highly controversial, even prior to the implementation of current ethics standards for clinical research and often goes unmentioned within the historical narrative of deep brain stimulation (DBS). While distinction between the modern practice of DBS and its controversial origins is necessary, it is important to examine Dr. Heath's work as it allows for reflection on current neurosurgical practices and questioning the ethical implication of these advancements.

  19. Diagnostic Overlap between Fanconi Anemia and the Cohesinopathies: Roberts Syndrome and Warsaw Breakage Syndrome

    Directory of Open Access Journals (Sweden)

    Petra van der Lelij

    2010-01-01

    Full Text Available Fanconi anemia (FA is a recessively inherited disease characterized by multiple symptoms including growth retardation, skeletal abnormalities, and bone marrow failure. The FA diagnosis is complicated due to the fact that the clinical manifestations are both diverse and variable. A chromosomal breakage test using a DNA cross-linking agent, in which cells from an FA patient typically exhibit an extraordinarily sensitive response, has been considered the gold standard for the ultimate diagnosis of FA. In the majority of FA patients the test results are unambiguous, although in some cases the presence of hematopoietic mosaicism may complicate interpretation of the data. However, some diagnostic overlap with other syndromes has previously been noted in cases with Nijmegen breakage syndrome. Here we present results showing that misdiagnosis may also occur with patients suffering from two of the three currently known cohesinopathies, that is, Roberts syndrome (RBS and Warsaw breakage syndrome (WABS. This complication may be avoided by scoring metaphase chromosomes—in addition to chromosomal breakage—for spontaneously occurring premature centromere division, which is characteristic for RBS and WABS, but not for FA.

  20. Folk Narratives and the Reflection of (UTU Humanness in Shaaban Robert Adili na Nduzuze

    Directory of Open Access Journals (Sweden)

    J.P. Madoshi

    2015-08-01

    Full Text Available This paper examines the novel Adili na Nduguze by Shaaban Robert. It seeks to explain how humanness is embedded in the plot of this prose fiction. The study uses Utu/Ubuntu as a theory of analyzing and explaining the events and the actions within this novel. The focus of the paper is to explore the plot of the novel in order to see how it reflects humanness (Utu/Ubuntu as it is perceived among the Bantu. The analysis is done by examining the reason of characters appellation and the author attention to diction which shows how royal characters intervene a conflict within this creative work. Also the study examines the novel in order to provide an account of the ontological conflict of two opposing beliefs in which a city is turned into stones (Mji Uliogeuka Mawe. Lastly, the paper attempts to inspect and explain reasons why Hasidi and Mwivu, Adili two brothers are turned into baboons, subjected to severe whipping from Adili and the cause of the removal of the curse placed upon them which subsequently makes them humans again.

  1. Book review: The man who saved the whooping crane: The Robert Porter Allen story

    Science.gov (United States)

    King, Sammy L.

    2013-01-01

    Kathleen Kaska has done a remarkable job of capturing the life of Robert Porter Allen, truly one of the premier biologist/conservationists of the twentieth century. Allen, born in 1905, grew up reading outdoor adventure books and playing in the woods of northern Pennsylvania with his brother. At a young age, he was encouraged to join the Junior Audubon club and his passion for ornithology soon crystallized. He attended Lafayette College to study ornithology, but he was disinterested in academics and fared poorly. He dropped out after two years and joined the Merchant Marines. Not an auspicious beginning for such a highly respected scientist and conservationist! Soon, however, he landed a librarian job with Audubon and his diligence, acumen, and communication skills allowed him to take more and more responsibilities. He became one of the youngest Audubon sanctuary directors ever appointed, and he was also able to secure a fellowship through Cornell to work on Roseate Spoonbills (Platalea ajaja). Audubon later appointed him to lead their Whooping Crane (Grus americana) studies.

  2. CERN 50th Anniversary Official Celebration : welcome by CERN Director General Robert Aymar to French President Jacques Chirac, to King of Spain Juan Carlos and to President of the Swiss Confederation Joseph Deiss

    CERN Multimedia

    Patrice Loiez; Michel Blanc

    2004-01-01

    CERN 50th Anniversary Official Celebration : welcome by CERN Director General Robert Aymar to French President Jacques Chirac, to King of Spain Juan Carlos and to President of the Swiss Confederation Joseph Deiss

  3. To Leave, or not to Leave: That Is the Problem in A Doll’s House and Candida

    Directory of Open Access Journals (Sweden)

    Naghmeh Varghaiyan

    2015-06-01

    Full Text Available This paper explores representation of Woman Question in Henrik Ibsen’s A Doll’s House and George Bernard Shaw’s Candida. The paper argues that unlike many studies that have read Candida and Nora as two disparate characters, they can be considered as the same New Woman represented only from different perspectives. In the previous studies, Candida is usually labelled a philistine who chooses to stay at home in order to defend blindly the convention of marriage bond while Nora is commonly called a rebel who chooses to abandon the conventional matrimonial life in order to find her true identity. This study, nonetheless, holds that both female characters’ ensuing decisions, although in different forms, similarly make their husbands reflect deeply on their situation in a way that in general the relation between them changes considerably afterwards. The female characters’ socio-familial states, nevertheless, may not change considerably in the near future. Thus, the textual analysis in the present study reveals that there is no basis for establishing a dualism when discussing Candida and Nora, the former standing for conspiracy against her own gender while the latter being a symbol of female redemption. Instead, it could be argued that their seemingly different final decisions are different solutions to one problem without implying a certificate of authenticity at the end.  Keywords: Problem Play, Woman Question, New Woman, Nora, Candida

  4. Robert Dicke and the naissance of experimental gravity physics, 1957-1967

    Science.gov (United States)

    Peebles, Phillip James Edwin

    2017-06-01

    The experimental study of gravity became much more active in the late 1950s, a change pronounced enough be termed the birth, or naissance, of experimental gravity physics. I present a review of developments in this subject since 1915, through the broad range of new approaches that commenced in the late 1950s, and up to the transition of experimental gravity physics to what might be termed a normal and accepted part of physical science in the late 1960s. This review shows the importance of advances in technology, here as in all branches of natural science. The role of contingency is illustrated by Robert Dicke's decision in the mid-1950s to change directions in mid-career, to lead a research group dedicated to the experimental study of gravity. The review also shows the power of nonempirical evidence. Some in the 1950s felt that general relativity theory is so logically sound as to be scarcely worth the testing. But Dicke and others argued that a poorly tested theory is only that, and that other nonempirical arguments, based on Mach's Principle and Dirac's Large Numbers hypothesis, suggested it would be worth looking for a better theory of gravity. I conclude by offering lessons from this history, some peculiar to the study of gravity physics during the naissance, some of more general relevance. The central lesson, which is familiar but not always well advertised, is that physical theories can be empirically established, sometimes with surprising results.

  5. ‘Bagley among the Germans’: Robert Bagley, Gombrich among the Egyptians and Other Essays in the History of Art, Seattle: Marquand Books, 2016

    Directory of Open Access Journals (Sweden)

    Andrei Pop

    2016-12-01

    Full Text Available Robert Bagley’s Gombrich among the Egyptians is an ambitious challenge to business as usual in the teaching and practice of art history, tackling subjects from style and iconography to pedagogy and cross-cultural comparison, all in light of an original account of artist’s materials and techniques centred on prehistoric China. The book concludes on a polemic confrontation with the Anglo-Austrian art historian E.H. Gombrich, which is flawed but offers plenty of grist for further thinking.

  6. ¿Qué significa pensar moralmente? Dos maneras actuales de entender a Kant: Robert B. Brandom y Jürgen Habermas

    Directory of Open Access Journals (Sweden)

    Martínez de Velasco, Luis

    2004-06-01

    Full Text Available Two hundred years often I. Kant's death, his influence grows more and more each day. The list of such past and present philosophers as have received, in a way or another, the Kantian heritage cannot be easily encompassed. Among them all, there are two outstanding philosophers whose intellectual origin -analytic philosophy and Frankfurtian thought respectively- would not in principle betray any Kantian lineage. However they have been able to reach a rare mustering of the problematic essence of Kant' s reflexion, chiefly as regards the self-grounding of counterfactual thought within the framework of a pragmatic-transcendental view of language use. We are referring to Robert B. Brandom and Jürgen Habermas.

    A los doscientos años del fallecimiento de Immanuel Kant, su influencia no hace sino crecer cada día que pasa. La nómina de filósofos pasados y presentes que han recibido, de alguna manera, herencias kantianas resulta difícilmente abarcable con la mirada. De entre todos estos filósofos destacan dos cuyo origen -filosofía analítica y pensamiento frankfurtiano, respectivamente- no parece delatar, en principio, la filiación kantiana de su pensamiento. Y, sin embargo, pocos pensadores han logrado captar como ellos la esencia problemática de la reflexión de Kant, sobre todo en lo concerniente a la autofundamentación de un pensamiento contrafáctico en el marco de una consideración pragmático-transcendental del uso del lenguaje. Nos referimos a Robert B. Brandom y a Jürgen Habermas.

  7. Les rites de la mort à Bornéo : séparation ou renaissance ? Actualité de Robert Hertz Death Rites in Borneo: Separation or Rebirth? Robert Hertz’ Legacy

    Directory of Open Access Journals (Sweden)

    Pascal Couderc

    2012-12-01

    Full Text Available La publication récente par le Borneo Research Council d’un ouvrage collectif sur la mort fournit l’occasion de réévaluer l’apport de Robert Hertz à la compréhension des rites funéraires à Bornéo. Si la traduction en anglais, dans les années 1960, de l’essai de Hertz sur la représentation collective de la mort avait consacré, grâce notamment aux travaux de Peter Metcalf sur les Berawan, la puissance du modèle analytique hertzien, ce nouvel ouvrage semble signaler que le moment de la célébration finale est venu, où les héritiers se libèrent de l’emprise spirituelle du défunt. Tout en conservant une grande part de sa valeur comme théorie du deuil, le paradigme transitionnel ou « réactif » de Hertz révèle ses limites, mises ici en lumière par des données ethnographiques encore peu connues ou inédites, qui démontrent, par exemple, l’existence d’une circulation des composantes de la personne par delà l’opposition entre la vie et la mort, ou encore l’influence directe des secondes funérailles sur la renaissance des défunts. Cet article aborde le dépassement du modèle hertzien en retournant à la lettre de l’essai, dont il met en relief l’intelligence ethnographique et la finesse théorique.The recent publication by the Borneo Research Council of a collection of essays on death provides an opportunity to reassess the heritage of Robert Hertz, whose theory of the double obsequies relies heavily on the ethnography of the Ngaju and other Borneo peoples. The translation of Hertz’s essay on the collective representation of death in the 1960s, prompting in particular Peter Metcalf’s work on the Berawan, has consecrated the explanatory power of Hertz’s model. With this new book, however, time seems to have come for the final celebration that marks the heirs’ liberation from the deceased’s spiritual influence. While still largely valid as a general theory of mourning, Hertz’s paradigm of

  8. Théorie mathématique des catégories en biologie et notion d'équivalence naturelle chez Robert Rosen

    OpenAIRE

    Varenne , Franck

    2011-01-01

    L'objectif de cet article est de rendre compte de la justification épistémologique de la proposition faite, dès 1958, par le biomathématicien Robert Rosen d'introduire le concept mathématique de " catégorie " et celui - corrélatif - d'" équivalence naturelle " dans la modélisation mathématique appliquée au vivant. Nos questions sont les suivantes : en quoi la notion mathématique de catégorie permet-elle, selon Rosen, de donner accès à des formalismes plus " naturels " pour la modélisation du ...

  9. Obituary: Ralph Robert Robbins, Jr., 1938-2005

    Science.gov (United States)

    Hemenway, Mary Kay; Jefferys, William H.; Lambert, David L.

    2007-12-01

    Ralph Robert Robbins, Jr., died on 2 December 2005, in Kyle, Texas. His wife, Maria Elena Robbins, his daughters Julia Robbins Kelso and Stephanie Juarez Balles, his son Matthew Juarez, and five grandchildren survive him. Bob was on the faculty at the University of Texas from 1968 until his retirement in 2003. Bob was born in Wichita, Kansas, on 2 September 1938, the only son of Mildred and Ralph Robert Robbins, Sr. Guided by his high school's policy to provide a practical education to children of working-class parents, Bob began high school with a heavy dose of vocational courses until the results of a test indicated his special talent in mathematics. He was awarded a full scholarship to Yale University, graduating magna cum laude in mathematics in 1960. He won the Warner Prize in Mathematics at Yale that year. He received his Ph.D. in 1966 with a dissertation entitled "The Triplet Spectrum of Neutral Helium in Expanding Nebulae" from the University of California at Berkeley. His interest in college teaching was ignited at this time through summer teaching positions at San Mateo California Junior College and the Ohio State University. Following a year at Texas as a McDonald Observatory Post-doctoral Fellow, Bob taught for a year in the physics department of the University of Houston before returning to the University of Texas at Austin as an Assistant Professor of Astronomy in 1968. He was promoted to Associate Professor in 1972. Bob's research in the early 1970s on theoretical studies of helium was of vital importance to astronomers for over three decades. These pioneering calculations became vital to observational astronomers in the mid-1990s as interest grew in the primordial helium produced by the Big Bang. Bob's interest and influence in education was international in scope. In the summers 1968-1970, he was a government consultant in Mathematics in East Pakistan (now Bangladesh). He consulted with the government that was preparing a master plan for technical

  10. Dr Hiroshi Ikukawa Director Planning and Evaluation Division Science and Technology Policy Bureau Ministry of Education, Culture, Sports, Science and Technology (MEXT) of Japan and Mr Robert Aymar signed an accord for the CERN.

    CERN Multimedia

    Claudia Marcelloni

    2007-01-01

    Dr Hiroshi Ikukawa Director Planning and Evaluation Division Science and Technology Policy Bureau Ministry of Education, Culture, Sports, Science and Technology (MEXT) of Japan and Mr Robert Aymar signed an accord for the CERN.

  11. Nopcsa, Baron Franz. 2014. Traveler, Scholar, Politician, Adventurer – A Transylvanian Baron at the Birth of Albanian Independence (ed. and trans. from German Robert Elsie. Budapest: Central European University Press. 227 pp.

    Directory of Open Access Journals (Sweden)

    David Mandler

    2015-01-01

    Full Text Available Nopcsa, Baron Franz. 2014. Traveler, Scholar, Politician, Adventurer – A Transylvanian Baron at the Birth of Albanian Independence (ed. and trans. from German Robert Elsie. Budapest: Central European University Press. 227 pp.  Reviewed by David Mandler, Independent Scholar

  12. Establishment and characterization of Roberts syndrome and SC phocomelia model medaka (Oryzias latipes).

    Science.gov (United States)

    Morita, Akihiro; Nakahira, Kumiko; Hasegawa, Taeko; Uchida, Kaoru; Taniguchi, Yoshihito; Takeda, Shunichi; Toyoda, Atsushi; Sakaki, Yoshiyuki; Shimada, Atsuko; Takeda, Hiroyuki; Yanagihara, Itaru

    2012-06-01

    Roberts syndrome and SC phocomelia (RBS/SC) are genetic autosomal recessive syndromes caused by establishment of cohesion 1 homolog 2 ( ESCO 2) mutation. RBS/SC appear to have a variety of clinical features, even with the same mutation of the ESCO2 gene. Here, we established and genetically characterized a medaka model of RBS/SC by reverse genetics. The RBS/SC model was screened from a mutant medaka library produced by the Targeting Induced Local Lesions in Genomes method. The medaka mutant carrying the homozygous mutation at R80S in the conserved region of ESCO2 exhibited clinical variety (i.e. developmental arrest with craniofacial and chromosomal abnormalities and embryonic lethality) as characterized in RBS/SC. Moreover, widespread apoptosis and downregulation of some gene expression, including notch1a, were detected in the R80S mutant. The R80S mutant is the animal model for RBS/SC and a valuable resource that provides the opportunity to extend knowledge of ESCO2. Downregulation of some gene expression in the R80S mutant is an important clue explaining non-correlation between genotype and phenotype in RBS/SC. © 2012 The Authors Development, Growth & Differentiation © 2012 Japanese Society of Developmental Biologists.

  13. ANTHROPOLOGY AT WAR: ROBERT H. LOWIE AND THE TRANSFORMATION OF THE CULTURE CONCEPT, 1904 to 1954.

    Science.gov (United States)

    Bargheer, Stefan

    2017-03-01

    The concept of culture used in American anthropology has fundamentally transformed throughout the first half of the twentieth century. The changing resonance of the work of Robert H. Lowie offers revealing insights into this development. Lowie was part of the first generation of students of Franz Boas that highlighted the importance of individual variation for the study of both primitive and civilized societies. Yet, its initial resonance notwithstanding, the culture concept that prevailed in the discipline went into a different direction as the result of anthropologists' involvement in the war effort. It was advanced by the second generation of Boas' students such as Ruth Benedict and Margaret Mead, who stressed the homogeneity of cultures. The contrast highlights the diversity of approaches available within anthropology in the first half of the century and the crucial impact of World War II in determining which of these possibilities became institutionalized in the decades after the war. © 2017 Wiley Periodicals, Inc.

  14. Review: Local Government in England: Centralisation, Autonomy and Control by Colin Corpus, Mark Roberts, Rachel Wall

    Directory of Open Access Journals (Sweden)

    Jonathan Carr-West

    2018-04-01

    Full Text Available Local Government in England: Centralisation, Autonomy and Control is a serious book and an important contribution to the scholarship around local government. It opens however, with a pleasingly comic tableau as academics from England, Portugal and Poland bicker amiably at a conference and on Twitter about whose country is really the most centralised. The rest of the book is devoted to showing why the English academics were right, why it matters and what should be done about it. The main thrust of the text is an analysis of the impact of the dominant policy narratives around centralism and localism. The argument that Copus, Wall and Roberts put forward could be boiled down to the assertion that the problem with local government in England is that it is neither local nor government. But to make this case they first helpfully unpack several sets of concepts that are all too often elided together.

  15. Direitos fundamentais, ponderação e racionalidade jurídica nas decisões judiciais brasileiras: uma leitura a partir de Robert Alexy / Fundamental rights, balancing and legal rationality in brazilian judicial decisions: a reading from Robert Alexy

    Directory of Open Access Journals (Sweden)

    Heletícia Leão de Oliveira

    2016-02-01

    Full Text Available Este artigo analisa aspectos relevantes da dogmática dos direitos fundamentais e do seu sopesamento a partir do pensamento de Robert Alexy, cuja teoria tenta responder de forma racional e fundamentada as questões axiológicas. Alega-se que a ponderação utilizada pelos tribunais brasileiros foi transformada em um princípio e está longe da fórmula alexyana original, pois ela leva à discricionariedade. Para que as decisões judiciais não sejam acusadas de serem arbitrárias e ilegítimas, é necessária a sua devida justificação. Por isto, surgem as tentativas de aperfeiçoar a consistência metodológica dessa técnica e a fixação de parâmetros que permitam um controle de argumentação.

  16. Aplikace logistických technologií Just-in-Time a Just-in-Sequence ve společnosti Robert Bosch spol. s r.o.

    OpenAIRE

    ŠTEFKOVÁ, Iveta

    2009-01-01

    This work is mostly oriented to define theory and application of principle Just in Time ( JIT ), Just in Sequence (JIS ) and related methods in Robert Bosch Ltd.Part goals are define theoretical basis of JIT and JIS from knowledge of Czech and foreign literature and detailed analysis of particular methods. Each method is well evaluated with all its pros and cons. Further observations engaged method of Kanban, Heijunka, MRPI, MRPII, which are close related to JIT and JIS. This work precisely d...

  17. [Regulation of behavior in the period between the world wars: Robert Musil and Kurt Lewin].

    Science.gov (United States)

    Innerhofer, Roland; Rothe, Katja

    2010-12-01

    The paper attempts to reconstruct the proto-cybernetic concept of regulation which emerged in early 20th century both in biology and psychology, and was critically reflected in literature. The basic premise is that Kurt Lewin's field-theoretical psychology played a crucial role in the development of behavioral self-regulation concepts. The goal is to show (1) that Lewin's early experiments and theories were based on the idea of a dynamic process of self-regulation determined by the actors and their personal motivation and interaction, (2) that this concept of self-regulation functioned as a camouflage for power-strategies that aimed to regulate and optimize the economic production and social reproduction processes, (3) that in Robert Musil's fragmentary, 'fringing' novel The Man without Qualities the attempt to optimize the social and economic behavior and to establish a homeostatic state proved to be a complete failure. As a notable result, this 'literary test' of behavioral self-regulation revealed the violence and imbalance of power inherent in this concept of self-regulation and its practical implementation.

  18. AcEST: BP913708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ial protein cyt-4 OS=Neurospora c... 32 1.3 sp|P23975|SC6A2_HUMAN Sodium-dependent nora...drenaline transporter... 30 4.9 sp|O55192|SC6A2_MOUSE Sodium-dependent noradrenaline transporter... 29...+ Sbjct: 237 LLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFV 273 >sp|O55192|SC6A2_MOUSE Sodium-dependent nora...RERHA-------KTLANI 982 Query: 183 N--NKALFQALV 212 + N+ + QALV Sbjct: 983 DGRNELILQALV 994 >sp|P23975|SC6A2_...HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens GN=SLC6A2 PE=1 S

  19. Popular culture and sporting life in the rural margins of late eighteenth-century England: the world of Robert Anderson, "The Cumberland Bard".

    Science.gov (United States)

    Huggins, Mike

    2012-01-01

    This study sets out to extend and challenge existing historiography on late eighteenth century British popular culture, customary sports, class and cultural identity, focusing upon the rural geo-political borderland of England. It suggests that prevailing class-based and more London-biased studies need to be balanced with more regionalist-based work, and shows the importance of northern regional leisure variants. The textual and historical analysis draws largely on the published works of a neglected working-class dialect poet, Robert Anderson, living and working in Cumberland, arguing that he represented a strain of ''bardic regionalism,'' a variant of Katie Trumpener’s ''bardic nationalism.''

  20. Parole et silence pour l’expression de l’éthique dans La mort est mon métier de Robert Merle

    Directory of Open Access Journals (Sweden)

    María Badiola Dorronsoro

    2015-11-01

    Full Text Available Thanks to a daring and original exercise of focusing the narrative in first person, Robert Merle makes a historical Nazi the hero and narrator of his novel La mort est mon métier. Adding to this fact a careful choice of what is said and what is omitted, the author shows that the “final solution to the Jewish problem” by Hitler was not a massacre organized by some bloodthirsty or revengeful individuals, but a «hard task» accomplished by a group of de¬humanized beings for whom the honor –and morals– consisted of total dedication to blind obe¬dience to their superiors.

  1. Temperature profile and water depth data collected from USS ROBERT G. BRADLEY using BT and XBT casts in the Red Sea and other seas from 26 September 1988 to 28 September 1988 (NODC Accession 8800288)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The accession contains data collected from USS Robert G Bradley from September 26, 1988 to September 29, 1988. The real time data of water temperature at varying...

  2. Phenotypic variability in 49 cases of ESCO2 mutations, including novel missense and codon deletion in the acetyltransferase domain, correlates with ESCO2 expression and establishes the clinical criteria for Roberts syndrome

    DEFF Research Database (Denmark)

    Vega, H; Trainer, A H; Gordillo, M

    2010-01-01

    Roberts syndrome (RBS) and SC phocomelia are caused by mutations in ESCO2, which codes for an acetyltransferase involved in the regulation of sister chromatid cohesion. Of 26 mutations described to date, only one missense mutation has been reported and all others are predicted to be truncating...

  3. Phenotypic variability in 49 cases of ESCO2 mutations, including novel missense and codon deletion in the acetyltransferase domain, correlates with ESCO2 expression and establishes the clinical criteria for Roberts syndrome

    NARCIS (Netherlands)

    Vega, H.; Trainer, A.H.; Gordillo, M.; Crosier, M.; Kayserili, H.; Skovby, F.; Uzielli, M.L.G.; Schnur, R.E.; Manouvrier, S.; Blair, E.; Hurst, J.A.; Forzano, F.; Meins, M.; Simola, K.O.J.; Raas-Rothschild, A; Hennekam, R.C.M.; Jabs, E.W.

    2010-01-01

    Background Roberts syndrome (RBS) and SC phocomelia are caused by mutations in ESCO2, which codes for an acetyltransferase involved in the regulation of sister chromatid cohesion. Of 26 mutations described to date, only one missense mutation has been reported and all others are predicted to be

  4. Projecting Dynastic Majesty: State Ceremony in the Reign of Robert Bruce

    Directory of Open Access Journals (Sweden)

    Lucinda Dean

    2015-07-01

    Full Text Available Following the murder of his rival John Comyn on 10 February at Greyfriars in Dumfries, and the crisis this act incited, Robert the Bruce’s inaugural ceremony took place at Scone in late March 1306. Much about this ceremony is speculative; however, subsequent retrospective legitimisation of the Bruce claims to the royal succession would suggest that all possible means by which Robert’s inauguration could emulate his Canmore predecessors and outline his right to rule on a level playing field with his contemporaries were amplified, particularly where they served the common purpose of legitimising Robert’s highly questioned hold on power. Fourteenth-century Scottish history is inextricably entwined in the Wars of Independence, civil strife and an accelerated struggle for autonomous rule and independence. The historiography of this period is unsurprisingly heavily dominated by such themes and, while this has been offset by works exploring subjects such as the tomb of Bruce and the piety of the Bruce dynasty, the ceremonial history of this era remains firmly in the shadows. This paper will address three key ceremonies through which a king would, traditionally, make powerful statements of royal authority: the inauguration or coronation of Bruce; the marriage of his infant son to the English princess Joan of the Tower in 1328, and his extravagant funeral ceremony in 1329. By focusing thus this paper hopes to shed new light on the ‘dark and drublie days’ of fourteenth-century Scotland and reveal that glory, dynastic majesty and pleasure were as central to the Scottish monarchy in this era as war and political turbulence.

  5. The Honorable William Nelson, Senior Senator from Florida, Chairman, Senate Committee on Space, Aeronautics and Related Sciences signing the golden book. Greeting by Mr Robert Aymar, CERN Director General and Prof. Samuel Ting from the MIT.

    CERN Multimedia

    Maximilien Brice

    2008-01-01

    The Honorable William Nelson, Senior Senator from Florida, Chairman, Senate Committee on Space, Aeronautics and Related Sciences signing the golden book. Greeting by Mr Robert Aymar, CERN Director General and Prof. Samuel Ting from the MIT.

  6. The dilemmas of indefiniteness: Utopia, fluidity and subjectivity in Stone, by Adam Roberts

    Directory of Open Access Journals (Sweden)

    André Cabral de Almeida Cardoso

    2017-06-01

    Full Text Available http://dx.doi.org/10.5007/2175-8026.2017v70n2p107 Ae, the narrator-protagonist of the novel Stone, by Adam Roberts, is the only criminal in a post-human utopian society in which the use of nanotechnology has allowed humanity to reach its plenitude. Isolated from the rest of society, one day Ae is offered freedom and wealth if he agrees to kill the population of a whole planet. After accepting this offer, Ae must try to fulfil his mission at the same time that he questions himself and tries to discover who his employers are. In developing the conflict between this deviant individual and the utopia in which he lives, Stone examines the limits of the utopia itself, which is based on the idea of flux and indefiniteness. The novel also explores the models of subjectivity created in the context of this utopia. The notion of utopia as a well-defined social project is replaced by the image of utopian bodies, influenced by technologies that challenge the definitions of the human and of the post-human. In establishing this network of tensions and indefiniteness, the novel offers the possibility that the marginalized sociopath might be the only one capable of examining in depth the reality of a world anesthetized by its own comfort.

  7. Temperature profile and water depth data collected from USS ROBERT G. BRADLEY using BT and XBT casts in the NE/NW Atlantic Ocean and other seas from 03 May 1988 to 31 May 1988 (NODC Accession 8800213)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile and water depth data were collected using BT and XBT casts from the USS ROBERT G. BRADLEY in the Northwest / Northeast Atlantic Ocean, Arabian...

  8. CASTEL, Robert; et al. (2013. Individuación, Precariedad, Inseguridad: ¿desinstitucionalización del presente? Buenos Aires, Paidos. 176 pp.

    Directory of Open Access Journals (Sweden)

    Maximiliano E. Korstanje

    2014-12-01

    Full Text Available Individuación, precariedad, Inseguridad es una obra editada en cinco secciones, escritas por reconocidos sociólogos quienes se convocaron el 1 de marzo de 2011 en una conferencia organizada por la Casa Argentina en París. Robert Castel, Denis Merklen, Numa Murard y Gabriel Kessler focalizan en el tema de la vulnerabilidad ciudadana del presente, las relaciones productivas en la modernidad y el rol del riesgo en la vida social de las personas, entre los temas más importantes. Si bien a primera vista, cada argumento parece (por tratarse de diversas personas contradictorio con los restantes, lo cierto es que una lectura profunda revela todo lo contrario.

  9. Anomia, normalidad y función del crimen desde la perspectiva de Robert Merton y su incidencia en la criminología

    Directory of Open Access Journals (Sweden)

    Omar Huertas Díaz

    2010-06-01

    Full Text Available El presente artículo expone la teoría criminológica desarrollada por Robert Merton, a partir del estudio del delito en la sociedad norteamericana. Para ello, en la introducción se hace referencia a las condiciones económicas, sociales y jurídicas de la época, contextualizando la teoría de la anomia desarrollada por Merton en el marco del pensamiento estructural funcionalista; luego, se menciona la importancia de sus planteamientos, relacionándolos con formulaciones posteriores y la teoría sistémica de la prevención integradora, y por último, se dan a conocer las conclusiones.

  10. Robert Castel, Gabriel Kessler, Denis Merklen, Numa Murard (2013: Individuación, Precariedad, Inseguridad: ¿desinstitucionalización del Presente? Buenos Aires, Paidós

    Directory of Open Access Journals (Sweden)

    Maximiliano E. Korstanje

    2014-09-01

    Full Text Available Un libro editado en cinco secciones, cada una de ellas escritas por reconocidos sociólogos quienes se convocaron el 01 de Marzo de 2011 en una conferencia organizada por la Casa Argentina en París. Robert Castel, Denis Merklen, Numa Murard y Gabriel Kessler focalizan en el tema de la vulnerabilidad ciudadana del presente, las relaciones productivas en la modernidad y el rol del riesgo en la vida social de las personas entre los temas más importantes.

  11. Robert Plant (1818–1858: A Victorian plant hunter in Natal, Zululand, Mauritius and the Seychelles

    Directory of Open Access Journals (Sweden)

    Donal P. McCracken

    2011-03-01

    Full Text Available In the 1850s Robert William Plant collected plants and other natural specimens in what is now KwaZulu-Natal. This one-time Englishman compiled a dictionary for gardeners before emigrating to Natal in 1850. There he worked as the agent for Samuel Stevens, the London dealer in ‘curiosities of natural history’. Though Plant collected mainly plants, he also sent consignments of beetles, butterflies, bird skins and shells back to Britain. He published the first scientific paper on Zululand and was requested by the Royal Botanic Gardens at Kew to write the first Flora natalensis. It was while collecting for this never-to-be-completed treatise that Plant contracted malaria in Maputaland. He died in St Lucia in 1858 and in doing so became South Africa’s martyr to botany. What emerges from this study is a picture of the difficulties faced by plant hunters in mid-19th-century South Africa, the sort of plants they collected and the necessity for them sometimes to diversify into other natural history products to survive.

  12. Turning point: the Robert Wood Johnson Foundation's effort to revitalize public health at the state level.

    Science.gov (United States)

    Hassmiller, Susan

    2002-01-01

    The Robert Wood Johnson (RWJ) Foundation initiated Turning Point in collaboration with the W.K. Kellogg Foundation (Kellogg) in 1997. The purpose of this major national initiative was to strengthen the public health infrastructure in the United States so that states, local communities, and their public health agencies might respond to the challenge to protect and improve the public's health in the 21st century. RWJ funded 21 states and Kellogg funded 43 communities to work together to create a new way of thinking about how health could be improved and who should be involved. Although the ultimate outcome was to improve health, both foundations expected diverse partnerships to work together to create strategic health improvement plans at both the community and state levels. The foundations funded a variety of strategies within those health improvement plans during an implementation phase. The premise in funding partnerships, as opposed to a single entity, was that effective public health systems would be developed best through a shared responsibility (including the private sector) for the health of a community.

  13. Substituted dihydronaphthalenes as efflux pump inhibitors of Staphylococcus aureus

    DEFF Research Database (Denmark)

    Thota, Niranjan; Reddy, Mallepally V; Kumar, Ashwani

    2010-01-01

    A new series of 3-(substituted-3,4-dihydronaphthyl)-2-propenoic acid amides has been prepared through convergent synthetic strategies and tested in combination with ciprofloxacin against NorA overexpressing Staphylococcus aureus 1199B as test strain for potentiating of the drug activity. Out of 24...... compounds evaluated, 12 compounds potentiated the activity of ciprofloxacin and resulted in 2-16 fold reduction in the MIC (4-0.5 microg/mL) of the drug. The failure of these efflux pump inhibitors (EPIs) to potentiate the activity of ciprofloxacin when tested against NorA knock out S. aureus SA-K1758...

  14. Mr. Wolfgang Petritsch, Austrian Ambassador

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Dr.Peter Schmid/CERN/EP, Dr.Wolfgang Petritsch, Austrian Ambassador, Permanent representative at UN, Mrs.Nora Petritsch, Dr.Kurt Hubner/CERN/AC, Mrs. Frederike Klaus-Salesin, Adviser, Mrs.Andrea Strohmeier, Secretary of the Ambassador, Mr.Heinz Klaus, Attaché, Dr.Theodor Tortschanoff/CERN/LHC, Mr.Peter Storer, Advisor. Dr.Peter Schmid/CERN/EP, Dr.Wolfgang Petritsch, Austrian Ambassador, Permanent representative at UN, Mrs.Nora Petritsch, Dr.Kurt Hubner/CERN/AC, Mrs. Frederike Klaus-Salesin, Adviser, Mrs.Andrea Strohmeier, Secretary of the Ambassador, Mr.Heinz Klaus, Attaché, Dr.Theodor Tortschanoff/CERN/LHC, Mr.Peter Storer, Advisor.

  15. Initial evaluation of the Robert Wood Johnson Foundation Nurse Faculty Scholars program.

    Science.gov (United States)

    Hickey, Kathleen T; Hodges, Eric A; Thomas, Tami L; Coffman, Maren J; Taylor-Piliae, Ruth E; Johnson-Mallard, Versie M; Goodman, Janice H; Jones, Randy A; Kuntz, Sandra; Galik, Elizabeth; Gates, Michael G; Casida, Jesus M

    2014-01-01

    The Robert Wood Johnson Foundation Nurse Faculty Scholars (RWJF NFS) program was developed to enhance the career trajectory of young nursing faculty and to train the next generation of nurse scholars. Although there are publications that describe the RWJF NFS, no evaluative reports have been published. The purpose of this study was to evaluate the first three cohorts (n = 42 scholars) of the RWJF NFS program. A descriptive research design was used. Data were derived from quarterly and annual reports, and a questionnaire (seven open-ended questions) was administered via Survey Monkey Inc. (Palo Alto, CA, USA). During their tenure, scholars had on average six to seven articles published, were teaching/mentoring at the graduate level (93%), and holding leadership positions at their academic institutions (100%). Eleven scholars (26%) achieved fellowship in the American Academy of Nursing, one of the highest nursing honors. The average ratings on a Likert scale of 1 (not at all supportive) to 10 (extremely supportive) of whether or not RWJF had helped scholars achieve their goals in teaching, service, research, and leadership were 7.7, 8.0, 9.4, and 9.5, respectively. The majority of scholars reported a positive, supportive relationship with their primary nursing and research mentors; although, several scholars noted challenges in connecting for meetings or telephone calls with their national nursing mentors. These initial results of the RWJF NFS program highlight the success of the program in meeting its overall goal-preparing the next generation of nursing academic scholars for leadership in the profession. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. Unauthorised Biographies: An Analysis Under the Perspective of Robert Alexy's External Theory

    Directory of Open Access Journals (Sweden)

    Adriana Inomata

    2015-12-01

    Full Text Available The present paperwork aimed to analyse whether or not the publication of a biography should require the prior authorisation from the subject  or their family. As there is, in this case, a collision between personality rights and freedom of speech, the proportionality test was used to solve such conflict. The first step was to define biography as a non-ficctional genre. The paperwork then aimed to define the theory of the principles, the external theory of the restriction of fundamental rights and the proportionality test developed by jurist Robert Alexy, which are largely used in Brazil by authors like Virgílio Afonso da Silva, Ingo Wolfgang Sarlet and Daniel Sarmento. It was observed that when fundamental rights collide, the proportionality must be verified and as a result there is a conditional precedence relation between the rights. In such case, the ceding right will be restricted by the preciding one. The external theory is a recognised manner of verifying whether the restriction of a fundamental right is legit or if it is a violation. The need for prior authorisation, based on the personality protection, restricts freedom of speech, on the other hand, its exemption is based on the right to freedom of speech. By applying the aforementioned method, a particular rule was developed and the conditions for it to be applicable: freedom of speech prevails over personality rights in given conditions (public figure, over suitable means, no expectation for privacy in the publication, diligence in the verification of truth or social and journalistic interest over the information

  17. Conference "Internet, Web, What's next?" on 26 June 1998 at CERN : Robert Verrue, Director general of the DGXIII of the European Commission, responsible for telecommunication in Europe, outlines the Commission's vision on the Information Society in Europe

    CERN Multimedia

    1998-01-01

    Conference "Internet, Web, What's next?" on 26 June 1998 at CERN : Robert Verrue, Director general of the DGXIII of the European Commission, responsible for telecommunication in Europe, outlines the Commission's vision on the Information Society in Europe

  18. Obituary: Robert C. Bless (1927 - 2015)

    Science.gov (United States)

    Surrounded by his loving family, Robert Charles Bless died at home on November 29th, three days before his 88th birthday. He was born in Ithaca, NY on Dec. 3, 1927 to a Russian father, Arthur Aaron Bless, and a French mother, Eva Chantrell Bless. Bob spent many summers on the family farm in the South of France, where he gained a great pride and joy in his French heritage, large extended family, and mother tongue. As a child growing up in Gainesville, FL, Bob's first job was snake wrangling, earning 10 cents per foot, with an added bonus for the more venomous species. Young Robbie took daily adventures in the Florida woods and swamps, armed only with pockets full of pecans and oranges. He enjoyed spending time at the family's lake cabin, where he learned to sail and helped his father plant acres of trees to grow their timber plantation. As a first generation immigrant, Bob's father received a PhD in physics, which inspired Bob to pursue an extensive educational route in astrophysics. Bob excelled in academics, graduating high school at the age of 16 and the University of Florida (B.Sc.) at 19. His path to graduate school was interrupted by a diagnosis of tuberculosis that forced him into a Florida sanitorium for one year. During this time, Bob made the most of what he described as the most dismal part of life by advocating for patient rights, initiating an inter-sanitorium newsletter, and gaining skills and experience in community organization and leadership - qualities that would later inform his leadership in academe. After being one of the first successfully treated tuberculosis patients in the US, Bob went on to earn a M.Sc. from Cornell University, and received his PhD degree in Astronomy from the University of Michigan in 1958. That same year, Bob joined the staff of the Astronomy Department of the University of Wisconsin (UW), Madison. It was there that Bob met Diane McQueen. Despite Bob's Dodge Dart and what has been described as the worst first date in

  19. Features phenomenon of «mental revolution» in research Robert Mandrou

    Directory of Open Access Journals (Sweden)

    E. N. Bashkeyeva

    2015-04-01

    Full Text Available The author analyzes the views on the problem of «mental revolution» Robert Mandrou, the second generation of the school of «Annals». Mandrou contribution to the study of the phenomenon of mentalities, and in particular the phenomenon of «mental» revolution is enormous. Thanks to him, the new French historiography changed its name to the historical psychology at the history of mentalities, and in interdisciplinary humanities studies of the Soviet period began to develop themes mentality. R. Mandrou explores quiet «mental revolution» XVII century. We are talking about a change of attitude to the problem of witchcraft at all the French intellectuals, among them ­ parliamentarians, representatives of experimental science, especially medicine. Reconstruction of the revolutionary mental changes in France early modern era carried out in three dimensions ­ human, social environment and activities. Basic mental strategy early modern humans ­ recourse to the all­powerful deity in whose hands is the fate of all people and things. Each social class, professional and religious groups were carriers of its characteristic mental outlook, which is composed of knowledge about nature and man, beliefs, stereotypes, prejudice resulting from education in the family and society, etc. There is a dialectical relationship between the structures of the slow evolution of the (customs and conjuncture, that is giving way to forms of psychological climate in which the developing crises, mature big problem, expressing the evolution of mentalities large extent. Area of mental conjuncture ­ an area of avant­garde, the most susceptible to updates of the society, especially business people, intellectuals, artisans. Mental conjuncture like economic, they differ in duration. Оbviously that in determining the mental climate must be treated and to the material conjuncture: hunger or a good harvest, lack of money or their abundance, health epidemics or relative order.

  20. Frank Robert Tangherlini — the Founder of an Alternative Relativistic Kinematics (On the Occasion of His 85th Birthday

    Directory of Open Access Journals (Sweden)

    Malykin G. B.

    2009-01-01

    Full Text Available Already fifty years ago, Frank Robert Tangherlini, an American theoretical physicist, suggested an original procedure which, targeting the synchronization of clocks located in two different inertial reference frames of the space, was di erent from that Einstein had introduced. As a result of these, Tangherlini had deduced the so-called the Tangher- lini transformations, which are a sort of the transformations of the spatial coordinates and time being moved from one inertial reference frame into another one. The Tangher- lini transformations differ from the Lorentz transformations (which can be meant clas- sic ones in the theory of relativity and, in particular, suggest the velocity of light to be anisotropic in a moving inertial reference frame. The Tangherlini transformations be- ing applied provide adequate explanations to all well-known interference experiments checking of the Special Theory of Relativity.

  1. Some Remarks on the Translation of Proper Names in Mark of Toledo’s and Robert of Ketton’s Latin Qur’ā Translations

    Directory of Open Access Journals (Sweden)

    Cecini, Ulisse

    2014-12-01

    Full Text Available This article presents Robert of Ketton’s (1143 and Mark of Toledo’s (1210 Latin translations of proper names appearing in the Qur’ān. Proper names represent a particular sub-group of words that challenges the translator in his task as a mediator between two cultures. Proper names are in fact tied to the person or the entity to which they belong and cannot, in absolute terms, be translated without losing their characteristic of being “proper.” In the article, the names are divided in different categories and the different methods are explained, that each translator uses to render the names in the translation. Final remarks try to formulate some hypotheses in order to explain the different choices of each translator in the context of their respective Qur’ān translation.En este artículo se presentan las traducciones latinas que Robert de Ketton (1143 y Marcos de Toledo (1210 hicieron de los nombres propios que aparecen en el Corán. Los nombres propios son un grupo particular de palabras que ponen a prueba al traductor en su tarea como mediador entre dos culturas. En efecto, los nombres propios son naturalmente vinculados a la persona o la entidad a las que pertenecen y no pueden ser traducidos sin perder su característica de ser «propios». En el artículo los nombres se dividen en diferentes categorías y se exponen de forma detallada los diferentes métodos que cada traductor utiliza para expresar los nombres en Latín. En las observaciones finales se formulan algunas hipótesis para explicar las diferentes soluciones que cada traductor ha elegido en el contexto de su propia traducción del Corán.

  2. No Bursts Detected from FRB121102 in Two 5 hr Observing Campaigns with the Robert C. Byrd Green Bank Telescope

    Science.gov (United States)

    Price, Danny C.; Gajjar, Vishal; Rosenthal, Lee; Hallinan, Gregg; Croft, Steve; DeBoer, David; Hellbourg, Greg; Isaacson, Howard; Lebofsky, Matt; Lynch, Ryan; MacMahon, David H. E.; Men, Yunpeng; Xu, Yonghua; Liu, Zhiyong; Lee, Kejia; Siemion, Andrew

    2018-02-01

    Here, we report non-detection of radio bursts from Fast Radio Burst FRB 121102 during two 5-hour observation sessions on the Robert C. Byrd 100-m Green Bank Telescope in West Virginia, USA, on December 11, 2017, and January 12, 2018. In addition, we report non-detection during an abutting 10-hour observation with the Kunming 40-m telescope in China, which commenced UTC 10:00 January 12, 2018. These are among the longest published contiguous observations of FRB 121102, and support the notion that FRB 121102 bursts are episodic. These observations were part of a simultaneous optical and radio monitoring campaign with the the Caltech HIgh- speed Multi-color CamERA (CHIMERA) instrument on the Hale 5.1-m telescope.

  3. An analysis of the writings of Janet Geister and Mary Roberts regarding the problems of private duty nursing.

    Science.gov (United States)

    Baas, L S

    1992-01-01

    Fifty years ago there were two widely circulated nursing journals, each with a unique purpose and style. The Trained Nurse and Hospital Review was the privately owned older journal, and the American Journal of Nursing was the voice of the professional organization. Each journal was edited by a strong nursing leader, Janet Geister and Mary Roberts, respectively. Each editor had many years of service to the nursing profession in varied capacities. Naturally, each had distinctly different interests, visions, and styles of communication. These editors witnessed and commented on the change in the sphere of nursing practice from a private duty and public health orientation to one that eventually became dominated by the hospital. Although their approaches differed, both recognized the need for organization, versatility, and creative problem solving. However, the legacy of these leaders must be considered in view of the gap that continues to exist between practicing nurses and the American Nurses' Association leadership.

  4. Actinic keratosis associated with squamous and basal cell carcinomas: an evaluation of neoplastic progression by a standardized AgNOR analysis

    Directory of Open Access Journals (Sweden)

    G Giuffrè

    2009-08-01

    Full Text Available In an attempt to investigate the neoplastic progression in different stages of actinic keratosis (AK, a standardized AgNOR analysis was performed in 94 cases of AK, 35 of which were associated with squamous cell carcinoma (SCC or basal cell carcinoma (BCC, and in 31 cases of SCC and 22 cases of BCC. The cases were subdivided into low- and high- AgNOR-expressing (AgNOR status AK by using the mean area of AgNORs per cell (NORA value (3.996 ?m2 as the cut-off. In AK samples, a progressive increase of the mean NORA value from Stage I to Stage IV was encountered. In addition, a significantly higher mean NORA value was found in the AK cases associated with SCC, in comparison to those without SCC; by contrast, no significant differences in the mean NORA value were noted between AK cases with or without BCC. A highly significant association between a high AgNOR quantity and the coexistence of SCC was encountered in AK; no association was appreciable between the AgNOR quantity and the co-occurrence of BCC. Moreover, when the co-existence of SCC in AK was considered as the reference point, the AK cases associated with SCC mostly (95.5% presented a high AgNOR quantity (high sensitivity, but only 57.6% of cases without SCC displayed a low AgNOR quantity (low specificity. Additionally, our data document that the standardised AgNOR analysis represents a strong negative predictor for the association between SCC and AK. Indeed, a low AgNOR quantity mostly is associated with AK cases without SCC.

  5. [Severe post-partum hemorrhage: descriptive study at the Robert-Debré Hospital maternity ward].

    Science.gov (United States)

    Reyal, F; Deffarges, J; Luton, D; Blot, P; Oury, J F; Sibony, O

    2002-06-01

    To analyze the prevalence, cause, treatment, and risk factors of severe post-partum hemorrhage (transfusion, surgery, radiology) observed at the maternity ward of the Robert-Debré Hospital, Paris. Method. This retrospective cohort was collected from a database including 19182 deliveries from 1992 to 1998. The entire medical file was reviewed in cases of severe hemorrhage. The prevalence of severe post-partum hemorrhage was 23 per 10,000 deliveries (44 patients). Transfusion was performed in 44/44 and hysterectomy in 3/44. Three patients were transferred to the intensive care unit. There were no deaths. At multivariate analysis, risk factors for severe post-partum hemorrhage were: abnormal placental insertion (OR=7.2; 95CI: 2.18-18.3), cesarean (OR=5.8; 95CI: 2.9-11.6), multiple pregnancy (OR=3.2; 95CI: 1.3-7.8), prematurity (OR=3, 95CI: 1.5-6.2), hypertension (OR=2.9; 95CI: 1.3-6.3). Twenty-six percent of the patients had no risk factors. The prevalence of severe pot-partum hemorrhage is low in our experience. The methodology used for this retrospective cohort does not enable an explanation. Intensive obstetrical care is necessary in case of abnormal placenta insertion. In 10 out of 44 cases, severe post-partum hemorrhage occurred in a context of insufficient monitoring, late or erroneous diagnosis, or incorrect treatment.

  6. AS CONTRIBUIÇÕES DE ROBERT BOYLE À QUÍMICA FACE A UMA VISÃO INTERDISCIPLINAR COM A GEOGRAFIA

    Directory of Open Access Journals (Sweden)

    L. I. Medeiros

    2007-12-01

    Full Text Available No século XVII, o físico e químico irlandês, Robert Boyle, merece um papel de destaque na química pois ele auxiliou no desenvolvimento teórico desta ciência. Em 1660, ao publicar sua primeira obra científica não-aristotélica sobre a pressão atmosférica e o vácuo, baseado nos trabalhos de Galileu, Pascal e Torricelli, Boyle travou um conflito de idéias com o aristotélico Thomas Hobbes. Em 1662, em resposta aos ataques de Hobbes, Boyle publica um livro onde consta a lei da relação entre a pressão e o volume dos gases. Em 1670, através de uma experiência feita com um tubo de vidro em forma de J, ele concluiu a lei dos gases, cuja declara que em uma temperatura constante, o volume e a pressão de um gás são inversamente proporcionais. Objetiva-se com esta pesquisa promover a interdisciplinaridade entre as disciplinas da química e da ciência geográfica, através de um resgate histórico sobre a lei dos gases, gerando uma discussão acerca da aplicabilidade, exploração, perfuração, processamento e produção do gás na atualidade. O trabalho foi desenvolvido a partir de uma pesquisa bibliográfica e na internet acerca do tema. Tomando por base os estudos de Robert Boyle, pode-se promover uma interdisciplinaridade entre as disciplinas da química e da geografia, analisando quimicamente a lei dos gases e promovendo uma discussão geográfica acerca da exploração, perfuração de poços, o processamento do gás, aplicabilidade do gás na indústria, em veículos, domicílios e como uma das principais fontes alternativas da atualidade para a ampliação da matriz energética brasileira. Palavras-chave: lei dos gases; energia alternativa e interdisciplinaridade.

  7. Robert Burns and the Re-making of National Memory in Contemporary Scotland

    Directory of Open Access Journals (Sweden)

    Josephine Dougal

    2012-05-01

    Full Text Available Robert Burns, the eighteenth-century Scottish poet and song writer, continues to maintain a substantial cultural ‘afterlife’ in the twenty first century, both within Scotland and beyond. Achieving cult status in the nineteenth century, the power of Burns as a popular cultural icon remains undiminished. Where the appropriation of Burns as national icon in the nineteenth century was made manifest in statuary, commemorative objects, and painted portraits, the twenty-first century has been marked by the proliferation of the image of Burns in new forms and technologies, with Burns as product and brand logo, museum and heritage attraction, and tourism industry selling point. This recent flourishing of interest and engagement raises questions about why and how an eighteenth-century poet continues to be the object of such extensive cultural elaboration at this time. In approaching this question, some fruitful lines of enquiry are being suggested in recent discussions that have looked at the nineteenth-century Burns as a ‘mobilizing agent in collective memory production’ (Rigney 2011, 81. One such appraisal points to how the construction of Burns in the nineteenth century as an iconic figure of Scottish cultural memory has the potential to ‘be resignified as necessary in subsequent chronological and geographical sites’ (Davis 2010, 14. It is this potential for the resignification of Burns as a symbolic site for the nation’s memory that this paper explores. In pointing to Burns’ representation in a variety of popular forms and in public discourse, the paper examines how a writer comes to be invested and reinvested as the voice and persona of the nation.

  8. Robert Malthus: un economista político convertido en demógrafo por aclamación popular

    Directory of Open Access Journals (Sweden)

    FERNANDO COLLANTES GUTIÉRREZ

    2003-01-01

    Full Text Available Tras una breve contextualización de la relevancia de la figura de Robert Malthus en los debates actuales acerca de la población mundial, se examina su pensamiento desde una doble vertiente. En la primera se argumenta que dicho pensamiento ha sido objeto de reducciones al ser clasificado de acuerdo con los criterios actuales de división académica del trabajo, en especial cuando es vinculado a la demografía; Malthus era un economista político y su interés por la demografía estuvo subordinado a sus objetivos investigadores como tal. En la segunda parte del trabajo se incide en las conexiones metodológicas existentes en el trabajo de Malthus y el de un autor tan opuesto a él, pero también economista político, como Karl Marx. Estas conexiones, que separan a ambos de la corriente neoclásica y del pensamiento llamado neomaltusiano, pueden ser relevantes de cara al análisis de problemáticas actuales.

  9. Obituary: Robert Fleischer, 1918-2001

    Science.gov (United States)

    Boyce, Peter Bradford; Saffell, Mary E.

    2003-12-01

    Robert Fleischer was born 20 August 1918 to Leon and Rose Fleischer in Flushing, NY. He was educated at Harvard, receiving his BS in 1940, MA in 1947, and PhD in 1949. He specialized in geophysics and solar-terrestrial relations. Fleischer joined the faculty at Rensselaer Polytechnic Institute advancing from Assistant to Full professor in 1958. As Director of the RPI Observatory, Fleischer attempted to bring modern astronomy to the institutions in the Albany area by procuring the funds to build a radio telescope. He left for the National Science Foundation (NSF) before the observatory was completed. It is a testament to his character that without his enormous energy, organizational, and fundraising abilities, the radio telescope project languished after he left. Fleischer joined the NSF in 1962 as the Program Director for Solar-Terrestrial Research. He was the government-wide Coordinator for the International Quiet Sun Years, and coordinated the 1966 South American Eclipse expeditions. Thereafter, he was appointed Deputy Head of the Office of International Science Activities. Fleischer is most notably remembered as the head of the Astronomy Section at the National Science Foundation. He brought astronomy into its own at NSF and involved the community in a major way through use of advisory committees. He was dedicated to helping the astronomical community understand the funding system, the political environment, and the various factors in how money is allocated. Fleischer truly believed in the concept that scientists should be making the important decisions about their field. He was instrumental in injecting science into the oversight of the National Observatories. Relations with the community say a lot about the man, the complexities of his character, and the forces that drove him. Fleischer was passionate in his beliefs and in his devotion to doing the best for astronomy. His strong approach and belief in himself served him well in many ways, but caused him grief

  10. Announcement: New Editor-In Robert C. Kennicutt

    Science.gov (United States)

    Abt, Helmut A.

    1999-06-01

    Effective 1999 July 1, all new manuscripts for Part 1 of The Astrophysical Journal and The Astrophysical Journal Supplement Series should be sent to Dr. Robert C. Kennicutt, Editor-in-Chief The Astrophysical Journal Steward Observatory University of Arizona Tucson, AZ 85721-0065 The other means of contact are telephone, (520) 621-5145 FAX, (520) 621-5153 and e-mail, apj@as.arizona.edu. For express packages please use the street address of 933 North Cherry Avenue. Dr. Kennicutt will be assisted by several of my loyal coworkers, who will move across the street. Manuscripts received before July 1 will be handled by the current editor until most of their problems have been resolved, at which point the remainder will be sent to Dr. Kennicutt's office. Manuscripts for the Letters should, as before, be sent directly to Dr. Alex Dalgarno at the Center for Astrophysics in Cambridge, MA. We are fortunate that a person with as much experience in research and proven good judgment as Dr. Kennicutt is willing to accept this difficult and time-consuming responsibility. He will be only the seventh Managing Editor or Editor-in-Chief that this Journal has had in its 104 years. Please give him the cooperation and help that you have given the current editor. It has been my privilege to work for 28 years with many of the best astrophysicists in the world and to publish their papers. This was done with the help of the AAS Publications Board and AAS officers, the efforts of Peter Boyce and Evan Owens who made the on-line edition of the Journal possible, three Associate Editors, a score of Scientific Editors, a hardworking staff of six in Tucson, up to 25 production controllers and manuscript editors at the University of Chicago Press, and the thousands of astronomers throughout the world who served as referees. The original masthead called this journal ``An International Review of Spectroscopy and Astronomical Physics.'' That subtitle is no longer appropriate because we do not publish

  11. Nuclear magnetic relaxation in picolines solutions in carbon tetrachloride

    International Nuclear Information System (INIS)

    Jurga, J.; Pajak, Z.; Jurga, K.; Jurga, S.

    1973-01-01

    Spin-lattice relaxation times of the ring and CH 3 group have been measured in order to establish the temperature dependence of the longitudinal relaxation times for picolins in carbon tetrachloride solutions. The information concerning the intramolecular contribution to the relaxation times have been obtained. The high resolution NPR spectrometer operating at 25 MHz has been used. The measurements have been performed in the temperature range from -60degC to 80degC. The experimental results are compared to the predictions given by the Nora Hill and Debye models and it has been found that the Nora Hill model fits the experimental data better than the Debye model. (S.B.)

  12. Implementation and Use of Anesthesia Information Management Systems for Non-operating Room Locations.

    Science.gov (United States)

    Bouhenguel, Jason T; Preiss, David A; Urman, Richard D

    2017-12-01

    Non-operating room anesthesia (NORA) encounters comprise a significant fraction of contemporary anesthesia practice. With the implemention of an aneshtesia information management system (AIMS), anesthesia practitioners can better streamline preoperative assessment, intraoperative automated documentation, real-time decision support, and remote surveillance. Despite the large personal and financial commitments involved in adoption and implementation of AIMS and other electronic health records in these settings, the benefits to safety, efficacy, and efficiency are far too great to be ignored. Continued future innovation of AIMS technology only promises to further improve on our NORA experience and improve care quality and safety. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Performative Environments

    DEFF Research Database (Denmark)

    Thomsen, Bo Stjerne

    2008-01-01

    The paper explores how performative architecture can act as a collective environment localizing urban flows and establishing public domains through the integration of pervasive computing and animation techniques. The NoRA project introduces the concept of ‘performative environments,' focusing on ...... of local interactions and network behaviour, building becomes social infrastructure and prompts an understanding of architectural structures as quasiobjects, which can retain both variation and recognisability in changing social constellations.......The paper explores how performative architecture can act as a collective environment localizing urban flows and establishing public domains through the integration of pervasive computing and animation techniques. The NoRA project introduces the concept of ‘performative environments,' focusing...

  14. As concepções evolutivas no Vestiges of the natural history of creation (1844) de Robert Chambers e a proposta de Lamarck: um estudo comparativo

    OpenAIRE

    Hueda, Marcelo Akira

    2009-01-01

    Publicado anonimamente em 1844, o livro Vestiges of the natural history of creation desencadeou uma das maiores discussões públicas que ocorreram durante o século XIX. Seu autor, Robert Chambers, defendeu a transmutação dos seres vivos e a origem de novas espécies através de causas naturais. O primeiro objetivo desta dissertação é descrever algumas concepções evolutivas apresentadas neste livro e o segundo é compará-las à versão final da teoria da progressão dos animais de La...

  15. UK Institute of Physics (IOP) President Sir Gareth Roberts (right) at CERN on 9 July with (right to left) IOP council vice-president and distinguished physicist Peter Kalmus, CERN engineer Tim Watson and IOP director of science Peter Cooper

    CERN Multimedia

    Patrice Loiez

    1999-01-01

    UK Institute of Physics (IOP) President Sir Gareth Roberts (right) at CERN on 9 July with (right to left) IOP council vice-president and distinguished physicist Peter Kalmus, CERN engineer Tim Watson and IOP director of science Peter Cooper

  16. The relation between creation and salvation in the Trinitarian theology of Robert Jenson

    Directory of Open Access Journals (Sweden)

    Anné H. Verhoef

    2013-02-01

    Full Text Available This article explored the relation between creation and salvation as acts of God in the theology of Robert Jenson, an American Lutheran theologian. This is important due to Jenson’s growing importance as theologian and because of the current importance of ecotheology (and related themes that were implicated by the relation between creation and salvation. Jenson’s theology is an effort to tell God’s particular story and it can be described as a Trinitarian, narrative and eschatological theology. His starting point is that God’s eternity must not be understood as timeless (this is unbiblical and incompatible with the story of creation and redemption and that creation (space and time takes place somehow within the being of God. Jenson qualified this ‘withinness’, but also emphasised that creation is an intelligible whole, a history with an intended end. It is important for him that God’s story – a story of dramatic coherence – is not separated from our own and creation’s story. Within this understanding of God’s story (as dramatic coherence, creation found its own dramatic teleology because salvation also includes creation. Creation is therefore not subjected to pointlessness any longer, but will find its final place within God. The implication of this is that we must value creation much more and act with more responsibility towards it. According to Jenson we must enjoy creation in an aesthetic fashion and delight in creation as a whole because of its dramatic teleology.

  17. Viewing past science from the point of view of present science, thereby illuminating both: Philosophy versus experiment in the work of Robert Boyle.

    Science.gov (United States)

    Chalmers, Alan

    2016-02-01

    The seventeenth century witnessed the replacement of an Aristotelian worldview by a mechanical one. It also witnessed the beginnings of significant experimental enquiry. Alerted by the fact that the methods involved in the latter, but not in the former, resemble those employed in later science, I argue the historical case that the emergence of the mechanical worldview and the emergence of science were not closely related and that it was the latter that was to develop into science as we have come to know it. The details are explored in the context of the philosophical and experimental work of Robert Boyle and the relationship between them. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. The Impossible Performance of Mass Commodity. George Maciunas, Herman Fine and Robert Watts’ Implosions Inc. (ca. 1967

    Directory of Open Access Journals (Sweden)

    Estella Noriega, Iñaki

    2016-12-01

    Full Text Available In the US context Fluxus is understood as an advance of the ‘60s radicalism. The assumption that Fluxus was opposed to consumption culture, as that embodied by Pop art, is among the interpretations that renew such a view. Examining the example of Implosions Inc., a short-lived but nevertheless interesting commercial enterprise formed by Robert Watts, Herman Fine and George Maciunas in 1967, this essay focuses its attention on the complex relationship between Fluxus and commercial culture. Implosions Inc. was a project in which many Pop artists were asked to participate along with its Fluxus founders, and it was intended as another step forward in the transformation of the artist into a commodity mass-producer. In analyzing this phenomenon, this article questions assumed principles in the Neo-avantgarde theory like the distinction between art production and culture consumption. The essay, however, will try to establish another paradigm that draws the differences between Pop art and Fluxus as the kind of audiences both these tendencies tried to conform. As a conclusion, the article fleshes out some ideas on individualism that were developed by Maciunas, which shed light on the notions surrounding the idea of collectivism as developed in Fluxus.En el contexto de los EE.UU., Fluxus ha sido entendido como avanzadilla del radicalismo de la década de los 60. La asunción de que Fluxus se oponía a la cultura comercial, tal y como era representada por el pop art, es una de las líneas que renueva dicha interpretación. Mediante el análisis de Implosions Inc., una pequeña pero fundamental empresa de Fluxus que formaron en 1967 George Maciunas, Robert Watts y Herman Fine, este ensayo pretende mostrar colaboraciones entre los artistas Fluxus y Pop y que se propuso hacer del artista un productor de mercancía de masas. Al analizar este episodio, el artículo cuestiona principios de la teoría de la neovanguardia, como la distinción entre el arte de la

  19. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Funding Opportunities Clinical Research Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's ...

  20. Drugs + HIV, Learn the Link

    Medline Plus

    Full Text Available ... Opportunities Clinical Research Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog ...