Nora: A Vocabulary Discovery Tool for Concept Extraction.

Science.gov (United States)

Divita, Guy; Carter, Marjorie E; Durgahee, B S Begum; Pettey, Warren E; Redd, Andrew; Samore, Matthew H; Gundlapalli, Adi V

2015-01-01

Coverage of terms in domain-specific terminologies and ontologies is often limited in controlled medical vocabularies. Creating and augmenting such terminologies is resource intensive. We developed Nora as an interactive tool to discover terminology from text corpora; the output can then be employed to refine and enhance natural language processing-based concept extraction tasks. Nora provides a visualization of chains of words foraged from word frequency indexes from a text corpus. Domain experts direct and curate chains that contain relevant terms, which are further curated to identify lexical variants. A test of Nora demonstrated an increase of a domain lexicon in homelessness and related psychosocial factors by 38%, yielding an additional 10% extracted concepts.

Mendoza : Rahvuslike huvide eiramine toob Euroliidule kollapsi / Alan Mendoza ; interv. Indrek Veiserik

Index Scriptorium Estoniae

Mendoza, Alan

2008-01-01

Intervjuu Henry Jacksoni Ühingu presidendiga, kes vastab küsimustele, mis puudutavad NATO laienemist, Lissaboni lepet, Euroopa Liidu kaitse- ja välispoliitikat, Eesti välispoliitikat ja suhteid Venemaaga. Vt. samas: Alan Mendoza ja Henry Jacksoni ühing

Nora

Directory of Open Access Journals (Sweden)

Ilaria Frontori

2014-08-01

Full Text Available L’Università degli Studi di Milano, sotto la direzione scientifica del Prof. G. Bejor, opera a Nora (Pula, Cagliari dal 2002, in un progetto sostenuto da quattro atenei italiani. Oggetto della ricerca sono il settore centrale della penisola e le due fasce abitative collocate sulla costa occidentale e meridionale. Nel quartiere centrale le recenti campagne di scavo stanno portando alla luce l’isolato sottostante le Terme Centrali e le domus mosaicate, dimostrando una continuità di vita dall’età repubblicana fino al periodo tardoantico.

QUALIDADE DE CHAPAS DE PARTÍCULAS DE MADEIRA AGLOMERADA FABRICADAS COM RESÍDUOS DE UMA INDÚSTRIA DE CELULOSE

OpenAIRE

Paulo Renato Schneider; Elio José Santini; Clovis Roberto Haselein; Cristiane Pedrazzi

2006-01-01

Este trabalho teve como objetivo avaliar a qualidade de chapas aglomeradas fabricadas com resíduos da madeira de Eucalyptus saligna, resultantes da picagem das toras para a confecção de cavacos utilizados na produção de celulose. As chapas foram produzidas com dois tipos de resíduos, palitos e serragem, sendo utilizados puros. O adesivo usado foi à base de uréia-formaldeído em proporções de 4; 8 e 12%, com base na massa seca das partículas, e as densidades nominais das chapas foram de 0,55; 0...

Redox-controlled dinitrosyl formation at the diiron-oxo center of NorA.

Science.gov (United States)

Cramm, Rainer; Strube, Katja

2008-01-01

In the denitrifying bacterium Ralstonia eutropha H16, the NorA protein is coproduced with the respiratory nitric oxide (NO) reductase. NorA contains a diiron-oxo center, which can form stable adducts with dioxygen and NO. In contrast to other diiron proteins, the formation of NorA-NO requires both fully reduced protein and additional electrons. A minor fraction of in vitro NorA-NO represents a paramagnetic dinitrosyl iron complex (DNIC), while the major fraction is attributed to a DNIC of the structure {Fe(NO)(2)}, which shows no electron paramagnetic resonance. The NorA-DNIC may be formed either upon direct reaction of the protein with NO or upon incubation with nitrite due to an intrinsic nitrite reduction activity of NorA that liberates NO. NorA can be purified rapidly as a six histidine-tagged derivative from overproducing cells of Escherichia coli. This chapter describes procedures for the preparation of different redox forms of NorA for the formation of NorA adducts with NO, dioxygen, and azide, as well as for the quantification of NorA-bound NO.

Fluoroquinolone resistance protein NorA of Staphylococcus aureus is a multidrug efflux transporter.

OpenAIRE

Neyfakh, A A; Borsch, C M; Kaatz, G W

1993-01-01

The gene of the Staphylococcus aureus fluoroquinolone efflux transporter protein NorA confers resistance to a number of structurally dissimilar drugs, not just to fluoroquinolones, when it is expressed in Bacillus subtilis. NorA provides B. subtilis with resistance to the same drugs and to a similar extent as the B. subtilis multidrug transporter protein Bmr does. NorA and Bmr share 44% sequence similarity. Both the NorA- and Bmr-conferred resistances can be completely reversed by reserpine.

Characterization of Nora Virus Structural Proteins via Western Blot Analysis.

Science.gov (United States)

Ericson, Brad L; Carlson, Darby J; Carlson, Kimberly A

2016-01-01

Nora virus is a single stranded RNA picorna-like virus with four open reading frames (ORFs). The coding potentials of the ORFs are not fully characterized, but ORF3 and ORF4 are believed to encode the capsid proteins (VP3, VP4a, VP4b, and VP4c) comprising the virion. To determine the polypeptide composition of Nora virus virions, polypeptides from purified virus were compared to polypeptides detected in Nora virus infected Drosophila melanogaster. Nora virus was purified from infected flies and used to challenge mice for the production of antisera. ORF3, ORF4a, ORF4b, and ORF4c were individually cloned and expressed in E. coli; resultant recombinant proteins purified and were used to make monospecific antisera. Antisera were evaluated via Western blot against whole virus particles and Nora virus infected fly lysates. Viral purification yielded two particle types with densities of ~1.31 g/mL (empty particles) and ~1.33 g/mL (complete virions). Comparison of purified virus polypeptide composition to Nora virus infected D. melanogaster lysate showed the number of proteins in infected cell lysates is less than purified virus. Our results suggest the virion is composed of 6 polypeptides, VP3, VP4a, two forms of VP4b, and two forms of VP4c. This polypeptide composition is similar to other small RNA insect viruses.

QUALIDADE DE CHAPAS DE PARTÍCULAS DE MADEIRA AGLOMERADA FABRICADAS COM RESÍDUOS DE UMA INDÚSTRIA DE CELULOSE

Directory of Open Access Journals (Sweden)

Paulo Renato Schneider

2006-05-01

Full Text Available Este trabalho teve como objetivo avaliar a qualidade de chapas aglomeradas fabricadas com resíduos da madeira de Eucalyptus saligna, resultantes da picagem das toras para a confecção de cavacos utilizados na produção de celulose. As chapas foram produzidas com dois tipos de resíduos, palitos e serragem, sendo utilizados puros. O adesivo usado foi à base de uréia-formaldeído em proporções de 4; 8 e 12%, com base na massa seca das partículas, e as densidades nominais das chapas foram de 0,55; 0,65 e 0,75 g/cm3. Foram avaliadas propriedades de flexão estática, ligação interna, arrancamento de parafusos, absorção d’água e inchamento em espessura. Os valores obtidos das propriedades de flexão estática, ligação interna e arrancamento de parafusos aumentaram com a densidade da chapa, assim como com o teor de adesivo, independentemente do tipo de resíduo. No caso da absorção d’água, os valores aumentaram com a redução da densidade, tanto para chapas produzidas com partículas tipo palitos como para serragem. Para inchamento em espessura, os valores aumentaram com a diminuição do teor de adesivo, sem considerar o do tipo de resíduo utilizado. Os resultados permitem concluir que, usando-se tanto partículas tipo palitos quanto serragem com maiores percentagens de adesivo e maiores densidades, podem ser produzidas chapas com qualidade satisfatória.

QUALIDADE DAS CHAPAS DE PARTÍCULAS AGLOMERADAS FABRICADAS COM RESÍDUOS DO PROCESSAMENTO MECÂNICO DA MADEIRA DE Pinus elliottii Engelm.

Directory of Open Access Journals (Sweden)

Leandro Calegari

2005-09-01

Full Text Available Este trabalho teve como objetivo avaliar as propriedades mecânicas de chapas de madeira aglomerada, confeccionados com resíduos de Pinus elliottii Engelm., resultantes do processamento mecânico da madeira. As chapas foram produzidas com dois tipos de resíduos, cavaco e maravalha, utilizados puros ou misturados. O adesivo utilizado foi à base de uréia-formaldeído em proporções de 4, 8 e 12% com base no peso seco das partículas de madeira, e as densidades nominais das chapas foram de 0,6 e 0,7 g/cm3. Foram avaliadas as propriedades de flexão estática, ligação interna e arrancamento de parafuso. Os valores das propriedades de flexão estática aumentaram com a proporção de maravalha, com a densidade da chapa, e com o teor de adesivo. Pode-se concluir que, usando as partículas do tipo maravalha, misturadas com maiores percentagens de adesivo e maiores densidades, são obtidas chapas com qualidade satisfatória.

A Summary of NORA Project Results Related to Reactivity Measurements

International Nuclear Information System (INIS)

Berg, J.O.; Døderlein, J-M-; Haugset, K

1969-01-01

The NORA Project has been an international undertaking within the field of reactor physics, resulting from an agreement signed by the International Atomic Energy Agency and the Norwegian Government in April 1961, and subsequently renewed for three years in 1964 and one year in 1967. A summary of the research performed in the period 1961-1964 has been published in IAEA Technical Report Series no. 67. The Project work carried out through the years 1964-1968 will be covered in a forthcoming IAEA Technical Report. The main experimental facility used in the Project has been the zero-power reactor NORA Reactor kinetics, both experimental end theoretical, has been a major item of research in the NORA Project. The present report will briefly summarize results and conclusions considered relevant to the topic discussed by this Panel. Extensive referencing will be made to the final NORA Project Report

Expression of multidrug resistance efflux pump gene norA is iron responsive in Staphylococcus aureus.

Science.gov (United States)

Deng, Xin; Sun, Fei; Ji, Quanjiang; Liang, Haihua; Missiakas, Dominique; Lan, Lefu; He, Chuan

2012-04-01

Staphylococcus aureus utilizes efflux transporter NorA to pump out a wide range of structurally dissimilar drugs, conferring low-level multidrug resistance. The regulation of norA expression has yet to be fully understood although past studies have revealed that this gene is under the control of the global transcriptional regulator MgrA and the two-component system ArlRS. To identify additional regulators of norA, we screened a transposon library in strain Newman expressing the transcriptional fusion norA-lacZ for altered β-galactosidase activity. We identify a transposon insertion in fhuB, a gene that encodes a ferric hydroxamate uptake system permease, and propose that the norA transcription is iron responsive. In agreement with this observation, addition of FeCl(3) repressed the induction of norA-lacZ, suggesting that bacterial iron uptake plays an important role in regulating norA transcription. In addition, a fur (ferric uptake regulator) deletion exhibited compromised norA transcription and reduced resistance to quinolone compared to the wild-type strain, indicating that fur functions as a positive regulator of norA. A putative Fur box identified in the promoter region of norA was confirmed by electrophoretic mobility shift and DNase I footprint assays. Finally, by employing a siderophore secretion assay, we reveal that NorA may contribute to the export of siderophores. Collectively, our experiments uncover some novel interactions between cellular iron level and norA regulation in S. aureus.

Nora virus persistent infections are not affected by the RNAi machinery.

Science.gov (United States)

Habayeb, Mazen S; Ekström, Jens-Ola; Hultmark, Dan

2009-05-29

Drosophila melanogaster is widely used to decipher the innate immune system in response to various pathogens. The innate immune response towards persistent virus infections is among the least studied in this model system. We recently discovered a picorna-like virus, the Nora virus which gives rise to persistent and essentially symptom-free infections in Drosophila melanogaster. Here, we have used this virus to study the interaction with its host and with some of the known Drosophila antiviral immune pathways. First, we find a striking variability in the course of the infection, even between flies of the same inbred stock. Some flies are able to clear the Nora virus but not others. This phenomenon seems to be threshold-dependent; flies with a high-titer infection establish stable persistent infections, whereas flies with a lower level of infection are able to clear the virus. Surprisingly, we find that both the clearance of low-level Nora virus infections and the stability of persistent infections are unaffected by mutations in the RNAi pathways. Nora virus infections are also unaffected by mutations in the Toll and Jak-Stat pathways. In these respects, the Nora virus differs from other studied Drosophila RNA viruses.

The Drosophila Nora virus is an enteric virus, transmitted via feces.

Science.gov (United States)

Habayeb, Mazen S; Cantera, Rafael; Casanova, Gabriela; Ekström, Jens-Ola; Albright, Shannon; Hultmark, Dan

2009-04-01

The biology of the Drosophila viruses has not been intensely investigated. Here we have investigated the biology of the Nora virus, a persistent Drosophila virus. We find that injected Nora virus is able to replicate in the files, reaching a high titer that is maintained in the next generation. There is a remarkable variation in the viral loads of individual flies in persistently infected stocks; the titers can differ by three orders of magnitude. The Nora virus is mainly found in the intestine of infected flies, and the histology of these infected intestines show increased vacuolization. The virus is excreted in the feces and is horizontally transmitted. The Nora virus infection has a very mild effect on the longevity of the flies, and no significant effect on the number of eggs laid and the percent of eggs that develop to adults.

PRODUÇÃO DE CHAPAS DE PARTÍCULAS ORIENTADAS “OSB” DE Eucalyptus grandis COM DIFERENTES TEORES DE RESINA, PARAFINA E COMPOSIÇÃO EM CAMADAS

Directory of Open Access Journals (Sweden)

Setsuo Iwakiri

2002-10-01

Full Text Available Este trabalho foi desenvolvido com o objetivo de avaliar a influência dos seguintes parâmetros de processo de produção sobre as propriedades das chapas “OSB”: composição das chapas em camadas cruzadas com proporções face-miolo-face de 30-40-30 e 20-60-20 em relação à composição homogênea; e, quantidades de 3, 4,5 e 6,0% de resina fenol-formaldeído, com incorporação de 0,5 e 1,0% de emulsão de parafina. Os resultados demonstraram que a composição das chapas, com a relação 20-60-20, apresentou melhor balanço das propriedades de flexão estática entre os sentidos de ensaios paralelo e perpendicular ao plano da chapa. A quantidade de 6,0% de resina foi a que resultou em melhores propriedades físico-mecânicas das chapas “OSB”. A produção de chapas “OSB” de Eucalyptus grandis, com 4,5 e 6,0% de resina fenol-formaldeído, superou as exigências mínimas de propriedades mecânicas das chapas “OSB” referendadas pela norma canadense CSA 0437-0 (1993.

Qualidade de chapas de partículas de madeira aglomerada fabricadas com resíduos de uma indústria de celulose.

Directory of Open Access Journals (Sweden)

Cristiane Pedrazzi

2010-08-01

Full Text Available Este trabalho teve como objetivo avaliar a qualidade de chapas aglomeradas fabricadas com resíduos da madeira de Eucalyptus saligna, resultantes da picagem das toras para a confecção de cavacos utilizados na produção de celulose. As chapas foram produzidas com dois tipos de resíduos, palitos e serragem, sendo utilizados puros. O adesivo usado foi à base de uréia-formaldeído em proporções de 4; 8 e 12%, com base na massa seca das partículas, e as densidades nominais das chapas foram de 0,55; 0,65 e 0,75 g/cm3. Foram avaliadas propriedades de flexão estática, ligação interna, arrancamento de parafusos, absorção d'água e inchamento em espessura. Os valores obtidos das propriedades de flexão estática, ligação interna e arrancamento de parafusos aumentaram com a densidade da chapa, assim como com o teor de adesivo, independentemente do tipo de resíduo. No caso da absorção d'água, os valores aumentaram com a redução da densidade, tanto para chapas produzidas com partículas tipo palitos como para serragem. Para inchamento em espessura, os valores aumentaram com a diminuição do teor de adesivo, sem considerar o do tipo de resíduo utilizado. Os resultados permitem concluir que, usando-se tanto partículas tipo palitos quanto serragem com maiores percentagens de adesivo e maiores densidades, podem ser produzidas chapas com qualidade satisfatória.

Qualidade das chapas de partículas aglomeradas fabricadas com resíduos do processamento mecânico da madeira de Pinus elliottii (Engelm..

Directory of Open Access Journals (Sweden)

Lourdes Patricia Elias Dacosta

2010-08-01

Full Text Available Este trabalho teve como objetivo avaliar as propriedades mecânicas de chapas de madeira aglomerada, confeccionados com resíduos de Pinus elliottii Engelm., resultantes do processamento mecânico da madeira. As chapas foram produzidas com dois tipos de resíduos, cavaco e maravalha, utilizados puros ou misturados. O adesivo utilizado foi à base de uréia-formaldeído em proporções de 4, 8 e 12% com base no peso seco das partículas de madeira, e as densidades nominais das chapas foram de 0,6 e 0,7 g/cm3. Foram avaliadas as propriedades de flexão estática, ligação interna e arrancamento de parafuso. Os valores das propriedades de flexão estática aumentaram com a proporção de maravalha, com a densidade da chapa, e com o teor de adesivo. Pode-se concluir que, usando as partículas do tipo maravalha, misturadas com maiores percentagens de adesivo e maiores densidades, são obtidas chapas com qualidade satisfatória.

Discovery of novel inhibitors of the NorA multidrug transporter of Staphylococcus aureus.

Science.gov (United States)

Brincat, Jean Pierre; Carosati, Emanuele; Sabatini, Stefano; Manfroni, Giuseppe; Fravolini, Arnaldo; Raygada, Jose L; Patel, Diixa; Kaatz, Glenn W; Cruciani, Gabriele

2011-01-13

Four novel inhibitors of the NorA efflux pump of Staphylococcus aureus, discovered through a virtual screening process, are reported. The four compounds belong to different chemical classes and were tested for their in vitro ability to block the efflux of a well-known NorA substrate, as well as for their ability to potentiate the effect of ciprofloxacin (CPX) on several strains of S. aureus, including a NorA overexpressing strain. Additionally, the MIC values of each of the compounds individually are reported. A structure-activity relationship study was also performed on these novel chemotypes, revealing three new compounds that are also potent NorA inhibitors. The virtual screening procedure employed FLAP, a new methodology based on GRID force field descriptors.

Produção de chapas de partículas orientadas “OSB” de Eucalyptus grandis com diferentes teores de resina, parafina e composição em camadas.

Directory of Open Access Journals (Sweden)

Setsuo Ivakiri

2010-08-01

Full Text Available Este trabalho foi desenvolvido com o objetivo de avaliar a influência dos seguintes parâmetros de processo de produção sobre as propriedades das chapas "OSB": composição das chapas em camadas cruzadas com proporções face-miolo-face de 30-40-30 e 20-60-20 em relação à composição homogênea; e, quantidades de 3, 4,5 e 6,0% de resina fenol-formaldeído, com incorporação de 0,5 e 1,0% de emulsão de parafina. Os resultados demonstraram que a composição das chapas, com a relação 20-60-20, apresentou melhor balanço das propriedades de flexão estática entre os sentidos de ensaios paralelo e perpendicular ao plano da chapa. A quantidade de 6,0% de resina foi a que resultou em melhores propriedades físico-mecânicas das chapas "OSB". A produção de chapas "OSB" de Eucalyptus grandis, com 4,5 e 6,0% de resina fenol-formaldeído, superou as exigências mínimas de propriedades mecânicas das chapas "OSB" referendadas pela norma canadense CSA 0437-0 (1993.

Comments on "Infrared Photometry of V1057 Cyg" by Mendoza (1971)

Science.gov (United States)

Cruz-González, I.

2011-04-01

Mexican astronomy contributions in the seventies in well represented by the observational work on V1057 Cyg of E.. Mendoza V. in the Boletín de los Observatorios de Tonantzintla y Tacubaya 1971, 6, 37, 135. Mendoza presents evidence of one of the most important properties of the now called FUors: their infrared excess.

Osteoporosis practice patterns in 2006 among primary care physicians participating in the NORA study.

Science.gov (United States)

Weiss, T W; Siris, E S; Barrett-Connor, E; Miller, P D; McHorney, C A

2007-11-01

This study investigated osteoporosis management trends from 1998 to 2006 among 808 primary care physicians involved in the US-based NORA (National Osteoporosis Risk Assessment) study. These results suggest some significant improvements in osteoporosis management over the past eight years. The purpose of this study was to investigate osteoporosis management trends among a large cohort of primary care physicians (PCPs) involved in the US-based NORA (National Osteoporosis Risk Assessment) study. In 2006, we undertook a resurvey of the 2,836 NORA PCPs who completed a baseline survey in 1998. Of the 2,199 PCPs for whom we had current contact information and who were still practicing, we collected usable surveys from 808 (37% response rate). From 1998 to 2006, more than double the percentage of NORA PCPs reported using BMDs "often" (35% vs. 87%). There was a doubling of the percentage of NORA PCPs who reported that a T-score of NORA PCPs who reported using bone turnover markers to screen, diagnosis, or monitor osteoporosis almost tripled (19% vs. 55%). The percentage of patients prescribed or recommended hormone therapy dropped sixfold (67% to 11%), and the percentage of patients prescribed bisphosphonates increased fourfold from 15% to 59%. These results suggest some significant improvements in osteoporosis management over the past eight years.

Nora ehk elu võimalikkusest naisena perekonnas, teatris ja kapitalismis / Anneli Saro

Index Scriptorium Estoniae

Saro, Anneli, 1968-

2008-01-01

Naistegelasest teatrist järgnevate lavastuste põhjal: Helen Rekkori lavastusest "Nora/Maja" Henrik Ibseni "Nukumaja" järgi Ugala teatris ja Elfriede Jelineki "Mis juhtus pärast seda, kui Nora oma mehe maha oli jätnud ehk Ühiskondade toed" Von Krahli Teatris, lavastaja Rainer Sarnet

Posttranslational modification influences the effects of MgrA on norA expression in Staphylococcus aureus.

Science.gov (United States)

Truong-Bolduc, Que Chi; Ding, Yanpeng; Hooper, David C

2008-11-01

MgrA is a global regulator in Staphylococcus aureus. Differences in the effects of MgrA on norA expression have been reported for different strains, which varied in rsbU, a gene that affects the expression of sigB, which encodes an alternative sigma factor involved in stress responses. We hypothesized that MgrA was modified by sigB-dependent factors that affected its ability to control the expression of the norA efflux pump. Heterologously expressed MgrA purified from Escherichia coli was incubated with crude extracts (CE) from strains RN6390 (rsbU) and SH1000 (rsbU(+)) and tested for binding to the norA promoter. Purified MgrA exhibited greater binding to norA promoter DNA after being incubated with SH1000 CE than MgrA incubated with the RN6390 CE. Phosphorylation of MgrA occurring in cell extracts caused it to lose the ability to bind norA promoter DNA. Overexpression of pknB, encoding a candidate serine/threonine kinase, produced increased phospho-MgrA and led to a fivefold increase in the transcript level of norA for both RN6390 and SH1000, as well as a fourfold increase in the MICs of norfloxacin and ciprofloxacin for these two strains. The levels of expression of pknB in RN6390 and SH1000, however, indicated that additional factors related to rsbU or sigB contribute to the differential regulatory effects of MgrA on norA expression.

VP3 is crucial for the stability of Nora virus virions.

Science.gov (United States)

Sadanandan, Sajna Anand; Ekström, Jens-Ola; Jonna, Venkateswara Rao; Hofer, Anders; Hultmark, Dan

2016-09-02

Nora virus is an enteric virus that causes persistent, non-pathological infection in Drosophila melanogaster. It replicates in the fly gut and is transmitted via the fecal-oral route. Nora virus has a single-stranded positive-sense RNA genome, which is translated in four open reading frames. Reading frame three encodes the VP3 protein, the structure and function of which we have investigated in this work. We have shown that VP3 is a trimer that has an α-helical secondary structure, with a functionally important coiled-coil domain. In order to identify the role of VP3 in the Nora virus life cycle, we constructed VP3-mutants using the cDNA clone of the virus. Our results show that VP3 does not have a role in the actual assembly of the virus particles, but virions that lack VP3 or harbor VP3 with a disrupted coiled coil domain are incapable of transmission via the fecal-oral route. Removing the region downstream of the putative coiled coil appears to have an effect on the fitness of the virus but does not hamper its replication or transmission. We also found that the VP3 protein and particularly the coiled coil domain are crucial for the stability of Nora virus virions when exposed to heat or proteases. Hence, we propose that VP3 is imperative to Nora virus virions as it confers stability to the viral capsid. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.

Nora Särak: kõige suurem katsumus on iseenda usaldamine / intervjueerinud Katariina Rebane

Index Scriptorium Estoniae

Särak, Nora

2016-01-01

Kevadel Balti filmi- ja meediakooli magistriõppe lõpetanud Nora Säraku lõputööna valminud lühidokumentaalfilm "Valguseks/Valguseni/Valgusena" Petseris elavatest eestlastest pälvis Eesti Kultuurkapitali Audiovisuaalse kunsti sihtkapitali aastapreemia ning film valiti aasta dokumentaalfilmiks. Intervjuu Nora Särakuga

Second toe swelling: Nora's lesion or glomus tumour, case report and literature review.

LENUS (Irish Health Repository)

Mohammad, A

2012-09-01

We report a rare case of bizarre parosteal osteochondromatous proliferation (BPOP, Nora\\'s lesion) of the right second toe in a 60-year-old man who presented with painful, bluish and bulbous swelling of the right second toe without any break in the skin.

A short history of nuclear activities in Mendoza province

International Nuclear Information System (INIS)

Lardone, Leo E.

2005-01-01

Uranium was found in Mendoza in 1946 in 'Soberania' and 'Independencia' mines. After its creation in 1950 CNEA, together with Cuyo National University (UNC), developed the mining industry starting with the 'Papagayos' mine. It can be considered the beginning of the systematic exploitation of uranium in the country. In course of time the province of Mendoza passed to get one of the most uraniferous reserve of Argentina and it has accumulated the major production till now. However, in the last years there has been opposition to resume the production in the Sierra Pintada Uranium Manufacturing Complex. There was also a powerful land continuous progress in the field of no energetic applications of nuclear techniques in the province. The most outstanding example is the 'School of Nuclear Medicine Foundation', with installations in Mendoza city and in San Rafael. Besides, there is a research and development group in Cuyo National University devoted to the Nuclear Safety. Finally, we can not fail to mention the Auger Pierre Project, which is building in Malargue an observatory for the study of the cosmic rays. (author) [es

Ligand Promiscuity between the Efflux Pumps Human P-Glycoprotein and S. aureus NorA.

Science.gov (United States)

Brincat, Jean Pierre; Broccatelli, Fabio; Sabatini, Stefano; Frosini, Maria; Neri, Annalisa; Kaatz, Glenn W; Cruciani, Gabriele; Carosati, Emanuele

2012-03-08

Thirty-two diverse compounds were evaluated for their ability to inhibit both Pgp-mediated efflux in mouse T-lymphoma L5178 MDR1 and NorA-mediated efflux in S. aureus SA-1199B. Only four compounds were strong inhibitors of both efflux pumps. Three compounds were found to inhibit Pgp exclusively and strongly, while seven compounds inhibited only NorA. These results demonstrate that Pgp and NorA inhibitors do not necessarily overlap, opening the way to safer therapeutic use of effective NorA inhibitors.

Payenia volcanic province, southern Mendoza, Argentina

DEFF Research Database (Denmark)

Søager, Nina; Holm, Paul Martin; Llambias, Eduardo Jorge

2013-01-01

The Pleistocene to Holocene Payenia volcanic province is a backarc region of 60,000 km2 in Mendoza, Argentina, which is dominated by transitional to alkaline basalts and trachybasalts. We present major and trace element compositions of 139 rocks from this area of which the majority are basaltic...

Capsaicin, a novel inhibitor of the NorA efflux pump, reduces the intracellular invasion of Staphylococcus aureus.

Science.gov (United States)

Kalia, Nitin Pal; Mahajan, Priya; Mehra, Rukmankesh; Nargotra, Amit; Sharma, Jai Parkash; Koul, Surrinder; Khan, Inshad Ali

2012-10-01

To delineate the role of capsaicin (8-methyl-N-vanillyl-6-nonenamide) as an inhibitor of the NorA efflux pump and its impact on invasion of macrophages by Staphylococcus aureus. Capsaicin in combination with ciprofloxacin was tested for activity against S. aureus SA-1199B (NorA overproducing), SA-1199 (wild-type) and SA-K1758 (norA knockout). The role of NorA in the intracellular invasion of S. aureus and the ability of capsaicin to inhibit this invasion was established in J774 macrophage cell lines. The three-dimensional structure of NorA was predicted using an in silico approach and docking studies of capsaicin were performed. Capsaicin significantly reduced the MIC of ciprofloxacin for S. aureus SA-1199 and SA-1199B. Furthermore, capsaicin also extended the post-antibiotic effect of ciprofloxacin by 1.1 h at MIC concentration. There was a decrease in mutation prevention concentration of ciprofloxacin when combined with capsaicin. Inhibition of ethidium bromide efflux by NorA-overproducing S. aureus SA-1199B confirmed the role of capsaicin as a NorA efflux pump inhibitor (EPI). The most significant finding of this study was the ability of capsaicin to reduce the intracellular invasion of S. aureus SA-1199B (NorA overproducing) in J774 macrophage cell lines by 2 log(10). This study, for the first time, has shown that capsaicin, a novel EPI, not only inhibits the NorA efflux pump of S. aureus but also reduces the invasiveness of S. aureus, thereby reducing its virulence.

Homology modeling, molecular dynamics, and virtual screening of NorA efflux pump inhibitors of Staphylococcus aureus.

Science.gov (United States)

Bhaskar, Baki Vijaya; Babu, Tirumalasetty Muni Chandra; Reddy, Netala Vasudeva; Rajendra, Wudayagiri

2016-01-01

Emerging drug resistance in clinical isolates of Staphylococcus aureus might be implicated to the overexpression of NorA efflux pump which is capable of extruding numerous structurally diverse compounds. However, NorA efflux pump is considered as a potential drug target for the development of efflux pump inhibitors. In the present study, NorA model was constructed based on the crystal structure of glycerol-3-phosphate transporter (PDBID: 1PW4). Molecular dynamics (MD) simulation was performed using NAMD2.7 for NorA which is embedded in the hydrated lipid bilayer. Structural design of NorA unveils amino (N)- and carboxyl (C)-terminal domains which are connected by long cytoplasmic loop. N and C domains are composed of six transmembrane α-helices (TM) which exhibits pseudo-twofold symmetry and possess voluminous substrate binding cavity between TM helices. Molecular docking of reserpine, totarol, ferruginol, salvin, thioxanthene, phenothiazine, omeprazole, verapamil, nalidixic acid, ciprofloxacin, levofloxacin, and acridine to NorA found that all the molecules were bound at the large hydrophobic cleft and indicated significant interactions with the key residues. In addition, structure-based virtual screening was employed which indicates that 14 potent novel lead molecules such as CID58685302, CID58685367, CID5799283, CID5578487, CID60028372, ZINC12196383, ZINC72140751, ZINC72137843, ZINC39227983, ZINC43742707, ZINC12196375, ZINC66166948, ZINC39228014, and ZINC14616160 have highest binding affinity for NorA. These lead molecules displayed considerable pharmacological properties as evidenced by Lipinski rule of five and prophecy of toxicity risk assessment. Thus, the present study will be helpful in designing and synthesis of a novel class of NorA efflux pump inhibitors that restore the susceptibilities of drug compounds.

The Extended Northern ROSAT Galaxy Cluster Survey (NORAS II). I. Survey Construction and First Results

International Nuclear Information System (INIS)

Böhringer, Hans; Chon, Gayoung; Trümper, Joachim; Retzlaff, Jörg; Meisenheimer, Klaus; Schartel, Norbert

2017-01-01

As the largest, clearly defined building blocks of our universe, galaxy clusters are interesting astrophysical laboratories and important probes for cosmology. X-ray surveys for galaxy clusters provide one of the best ways to characterize the population of galaxy clusters. We provide a description of the construction of the NORAS II galaxy cluster survey based on X-ray data from the northern part of the ROSAT All-Sky Survey. NORAS II extends the NORAS survey down to a flux limit of 1.8 × 10 −12 erg s −1 cm −2 (0.1–2.4 keV), increasing the sample size by about a factor of two. The NORAS II cluster survey now reaches the same quality and depth as its counterpart, the southern REFLEX II survey, allowing us to combine the two complementary surveys. The paper provides information on the determination of the cluster X-ray parameters, the identification process of the X-ray sources, the statistics of the survey, and the construction of the survey selection function, which we provide in numerical format. Currently NORAS II contains 860 clusters with a median redshift of z  = 0.102. We provide a number of statistical functions, including the log N –log S and the X-ray luminosity function and compare these to the results from the complementary REFLEX II survey. Using the NORAS II sample to constrain the cosmological parameters, σ 8 and Ω m , yields results perfectly consistent with those of REFLEX II. Overall, the results show that the two hemisphere samples, NORAS II and REFLEX II, can be combined without problems into an all-sky sample, just excluding the zone of avoidance.

The Extended Northern ROSAT Galaxy Cluster Survey (NORAS II). I. Survey Construction and First Results

Energy Technology Data Exchange (ETDEWEB)

Böhringer, Hans; Chon, Gayoung; Trümper, Joachim [Max-Planck-Institut für Extraterrestrische Physik, D-85748 Garching (Germany); Retzlaff, Jörg [ESO, D-85748 Garching (Germany); Meisenheimer, Klaus [Max-Planck-Institut für Astronomy, Königstuhl 17, D-69117 Heidelberg (Germany); Schartel, Norbert [ESAC, Camino Bajo del Castillo, Villanueva de la Cañada, E-28692 Madrid (Spain)

2017-05-01

As the largest, clearly defined building blocks of our universe, galaxy clusters are interesting astrophysical laboratories and important probes for cosmology. X-ray surveys for galaxy clusters provide one of the best ways to characterize the population of galaxy clusters. We provide a description of the construction of the NORAS II galaxy cluster survey based on X-ray data from the northern part of the ROSAT All-Sky Survey. NORAS II extends the NORAS survey down to a flux limit of 1.8 × 10{sup −12} erg s{sup −1} cm{sup −2} (0.1–2.4 keV), increasing the sample size by about a factor of two. The NORAS II cluster survey now reaches the same quality and depth as its counterpart, the southern REFLEX II survey, allowing us to combine the two complementary surveys. The paper provides information on the determination of the cluster X-ray parameters, the identification process of the X-ray sources, the statistics of the survey, and the construction of the survey selection function, which we provide in numerical format. Currently NORAS II contains 860 clusters with a median redshift of z  = 0.102. We provide a number of statistical functions, including the log N –log S and the X-ray luminosity function and compare these to the results from the complementary REFLEX II survey. Using the NORAS II sample to constrain the cosmological parameters, σ {sub 8} and Ω{sub m}, yields results perfectly consistent with those of REFLEX II. Overall, the results show that the two hemisphere samples, NORAS II and REFLEX II, can be combined without problems into an all-sky sample, just excluding the zone of avoidance.

76 FR 80870 - Notice of Determination of Pest-Free Areas in Mendoza Province, Argentina

Science.gov (United States)

2011-12-27

... ;D=APHIS-2010-0032. The first commenter acknowledged Argentina's history of successful Medfly control...] Notice of Determination of Pest-Free Areas in Mendoza Province, Argentina AGENCY: Animal and Plant Health... Southern and Central Oases in the southern half of Mendoza Province in Argentina as pest-free areas for...

Piperine analogs as potent Staphylococcus aureus NorA efflux pump inhibitors

DEFF Research Database (Denmark)

Sangwan, Payare L; Koul, Jawahir L; Koul, Surrinder

2008-01-01

Based on our recent findings that piperine is a potent Staphylococcus aureus NorA efflux pump inhibitor (EPI), 38 piperine analogs were synthesized and bioevaluated for their EPI activity. Twenty-five of them were found active with potentiating activity equivalent or more than known EPIs like...... reserpine, carsonic acid and verapamil. The inhibitory mechanism of the compounds was confirmed by efflux inhibition assay using ethidium bromide as NorA substrate. The present communication describes the synthesis, bioevaluation and structure related activity of these efflux pump inhibitors....

Formation of a dinitrosyl iron complex by NorA, a nitric oxide-binding di-iron protein from Ralstonia eutropha H16.

Science.gov (United States)

Strube, Katja; de Vries, Simon; Cramm, Rainer

2007-07-13

In Ralstonia eutropha H16, two genes, norA and norB, form a dicistronic operon that is controlled by the NO-responsive transcriptional regulator NorR. NorB has been identified as a membrane-bound NO reductase, but the physiological function of NorA is unknown. We found that, in a NorA deletion mutant, the promoter activity of the norAB operon was increased 3-fold, indicating that NorA attenuates activation of NorR. NorA shows limited sequence similarity to the oxygen carrier hemerythrin, which contains a di-iron center. Indeed, optical and EPR spectroscopy of purified NorA revealed the presence of a di-iron center, which binds oxygen in a similar way as hemerythrin. Diferrous NorA binds two molecules of NO maximally. Unexpectedly, binding of NO to the diferrous NorA required an external reductant. Two different NorA-NO species could be resolved. A minor species (up to 20%) showed an S = (1/2) EPR signal with g( perpendicular) = 2.041, and g( parallel) = 2.018, typical of a paramagnetic dinitrosyl iron complex. The major species was EPR-silent, showing characteristic signals at 420 nm and 750 nm in the optical spectrum. This species is proposed to represent a novel dinitrosyl iron complex of the form Fe(2+)-[NO](2)(2-), i.e. NO is bound as NO(-). The NO binding capacity of NorA in conjunction with its high cytoplasmic concentration (20 mum) suggests that NorA regulates transcription by lowering the free cytoplasmic concentration of NO.

Analysis of immune-related genes during Nora virus infection of Drosophila melanogaster using next generation sequencing.

Science.gov (United States)

Lopez, Wilfredo; Page, Alexis M; Carlson, Darby J; Ericson, Brad L; Cserhati, Matyas F; Guda, Chittibabu; Carlson, Kimberly A

2018-01-01

Drosophila melanogaster depends upon the innate immune system to regulate and combat viral infection. This is a complex, yet widely conserved process that involves a number of immune pathways and gene interactions. In addition, expression of genes involved in immunity are differentially regulated as the organism ages. This is particularly true for viruses that demonstrate chronic infection, as is seen with Nora virus. Nora virus is a persistent non-pathogenic virus that replicates in a horizontal manner in D. melanogaster . The genes involved in the regulation of the immune response to Nora virus infection are largely unknown. In addition, the temporal response of immune response genes as a result of infection has not been examined. In this study, D. melanogaster either infected with Nora virus or left uninfected were aged for 2, 10, 20 and 30 days. The RNA from these samples was analyzed by next generation sequencing (NGS) and the resulting immune-related genes evaluated by utilizing both the PANTHER and DAVID databases, as well as comparison to lists of immune related genes and FlyBase. The data demonstrate that Nora virus infected D. melanogaster exhibit an increase in immune related gene expression over time. In addition, at day 30, the data demonstrate that a persistent immune response may occur leading to an upregulation of specific immune response genes. These results demonstrate the utility of NGS in determining the potential immune system genes involved in Nora virus replication, chronic infection and involvement of antiviral pathways.

Mecanismos de fricción en la estampación de chapas electrocincadas para automóviles

Directory of Open Access Journals (Sweden)

Cárcel, A. C.

2004-04-01

Full Text Available This work was carried out on electrolytic zinc coated steel sheets, and was aimed at understanding and justifying the onset of fractures found in some samples during real stamping of automotive parts. For comparison purposes, a set of samples obtained from zinc coated steel sheets that showed lower friction values was also analysed. Samples that failed by fracture show values of coefficient of friction under BL conditions higher and unstable. This behaviour can be justified by differences in the original surface topography and by a different evolution of the real surface ratio Sc, in contact with the tools. Coils with surface topography having lower values of material ratio in the Abbot-Firestone curve, that is, with higher values of Rpk and lower values of Mr1, contribute to maintain low values of Sc under boundary lubrication conditions and to guarantee stable and low friction coefficient values, allowing correct stamping.

El presente trabajo es una contribución al estudio del comportamiento tribológico entre chapas y matriz durante el proceso de estampación. Se ha llevado a cabo sobre chapas electrocincadas seleccionadas de bobinas que fallaron por roturas durante la estampación de piezas de carrocerías. Un numero similar de bobinas que permitieron una estampación correcta ha sido también sometido a estudio como referencia. El comportamiento tribológico en condiciones de lubricación límite y las diferencias entre distintos tipos de chapas puede interpretarse y justificarse por la diferente topografía original y su contribución a la generación de la superficie real de contacto Sc. Las chapas con un una topografía inicial con bajos valores de material portante en la curva de Abbot-Firestone, con altos valores de Rpk y bajos de Mr1, presentan bajo condiciones de lubricación límite menores valores de Sc y coeficientes de fricción estables, permitiendo una embutición correcta.

Viticulture and landscape, values for the society in Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Abraham Laura

2014-01-01

Full Text Available The landscape is a perception of the agroecosystem valued as aesthetic, cultural, recreational and touristic, for conservation, among others. It is considered an environmental service and cultural heritage according to the International UN Conference 1972 (Paris, France. The agroecosystem of Mendoza's Northern Oasis creates a landscape with the presence of vineyards framed by the Andes, which is a scenic resource characterized as an environmental cultural service. The disordered process of urban growth in North of Mendoza, threatens the provision of the mentioned service. In this paper, a qualitative and a quantitative assessment aim to characterize the perceptions of urban residents on the vineyards landscape. Two methodologies were applied: expert opinion through focus groups and survey data collection. By working with focus groups, positive impacts of this kind of landscape were recognized. In the 638 surveys made in the urban area of Mendoza, a six landscape images valuation was requested (with a score of 1 to 10, where 10 is the maximum. The highest average scores were for the view of Aconcagua, secondly the agricultural landscape with vineyards and mountains and thirdly another view of vineyards in the North Oasis.

Significance of normalized residual activity value (Nora) - the new parameter of isotopic renography - for the diagnosis of patients with obstructive uropathy

International Nuclear Information System (INIS)

Juszczyk-Gontaszewska, M.; Gontaszewski, W.; Rogowski, F.

2005-01-01

The aim of this research was to establish NORA values typical of patients with compensated and uncompensated obstructive uropathy. 147 results of renoscintigraphies carried out after the application of Tc-99m DTPA with furosemide diuretic test were analyzed. The patients were divided into three groups: the group with compensated obstructive uropathy, the group with uncompensated obstructive uropathy, and the controlled group. NORA-1 and NORA-2 values were calculated in each patient, for each kidney separately. It was established that the mean NORA-1 values in the three groups (the controlled group, the compensated uropathy group, and the uncompensated uropathy group) were significantly different, thus enabling differentiation between them. Based on the examination described above, the following conclusions wee drawn: 1. NORA is an effective differentiation index for compensated and uncompensated uropathy. 2. NORA values should be routinely calculated in every case of isotopic diuretic renography. (author)

Nora Tully MacAlvay--Her Life in the Theatre.

Science.gov (United States)

Webb, Dorothy

1996-01-01

Recounts the life and times of a pioneer children's theater playwright and fiction author, Nora Tully MacAlvay (1900-86). Points out that her interest in children's theater and children's literature was lifelong and intense. (PA)

Differential gene expression related to Nora virus infection of Drosophila melanogaster.

Science.gov (United States)

Cordes, Ethan J; Licking-Murray, Kellie D; Carlson, Kimberly A

2013-08-01

Nora virus is a recently discovered RNA picorna-like virus that produces a persistent infection in Drosophila melanogaster, but the antiviral pathway or change in gene expression is unknown. We performed cDNA microarray analysis comparing the gene expression profiles of Nora virus infected and uninfected wild-type D. melanogaster. This analysis yielded 58 genes exhibiting a 1.5-fold change or greater and p-value less than 0.01. Of these genes, 46 were up-regulated and 12 down-regulated in response to infection. To validate the microarray results, qRT-PCR was performed with probes for Chorion protein 16 and Troponin C isoform 4, which show good correspondence with cDNA microarray results. Differential regulation of genes associated with Toll and immune-deficient pathways, cytoskeletal development, Janus Kinase-Signal Transducer and Activator of Transcription interactions, and a potential gut-specific innate immune response were found. This genome-wide expression profile of Nora virus infection of D. melanogaster can pinpoint genes of interest for further investigation of antiviral pathways employed, genetic mechanisms, sites of replication, viral persistence, and developmental effects. Copyright © 2013. Published by Elsevier B.V.

Welcoming Nora: A Family Event

OpenAIRE

Walsh, Allison J.; Walsh, Paul R.; Walsh, Jane M.; Walsh, Gavin T.

2011-01-01

In this column, Allison and Paul Walsh share the story of the birth of Nora, their third baby and their second child to be born at home. Allison and Paul share their individual memories of labor and birth. But their story is only part of the story of Nora’s birth. Nora’s birth was a family event, with Allison and Paul’s other children very much part of the experience. Jane and Gavin share their own memories of their baby sister’s birth.

Virtual screening for novel Staphylococcus Aureus NorA efflux pump inhibitors from natural products.

Science.gov (United States)

Thai, Khac-Minh; Ngo, Trieu-Du; Phan, Thien-Vy; Tran, Thanh-Dao; Nguyen, Ngoc-Vinh; Nguyen, Thien-Hai; Le, Minh-Tri

2015-01-01

NorA is a member of the Major Facilitator Superfamily (MFS) drug efflux pumps that have been shown to mediate antibiotic resistance in Staphylococcus aureus (SA). In this study, QSAR analysis, virtual screening and molecular docking were implemented in an effort to discover novel SA NorA efflux pump inhibitors. Originally, a set of 47 structurally diverse compounds compiled from the literature was used to develop linear QSAR models and another set of 15 different compounds were chosen for extra validation. The final model which was estimated by statistical values for the full data set (n = 45, Q(2) = 0.80, RMSE = 0.20) and for the external test set (n = 15, R(2) = 0.60, |res|max = 0.75, |res|min = 0.02) was applied on the collection of 182 flavonoides and the traditional Chinese medicine (TCM) database to screen for novel NorA inhibitors. Finally, 33 lead compounds that met the Lipinski's rules of five/three and had good predicted pIC50 values from in silico screening process were employed to analyze the binding ability by docking studies on NorA homology model in place of its unavailable crystal structures at two active sites, the central channel and the Walker B.

Chapa aglomerada de cimento-madeira de Hevea brasiliensis Müll. Arg. Cement-bonded particleboard of Hevea brasiliensis Müll. Arg.

Directory of Open Access Journals (Sweden)

Esmeralda Yoshico Arakaki Okino

2004-06-01

Full Text Available Chapas de partículas de cimento-madeira foram confeccionadas com a madeira de quatro clones de Hevea brasiliensis Müll. Arg. (seringueira: IAN 717, IAN 873, GT 711 e AVROS 1301. Confeccionaram-se as chapas na proporção de 1:4:1 (madeira:cimento:água por peso e nas dimensões de 450 x 450 x 13 mm e densidade nominal de 1,4 g/cm³, com a adição de 4% de cloreto de cálcio di-hidratado (CaCl2.2H2O como acelerador. Foram testadas partículas fervidas e não-fervidas dos quatro clones, totalizando oito tratamentos, sendo em cada um destes, com quatro repetições, avaliadas as propriedades mecânicas e físicas das chapas, segundo a norma ASTM D 1037 - 96a. De forma geral, os melhores resultados de propriedades físicas e mecânicas foram obtidos nas chapas com partículas do clone AVROS 1301. No teste de hidratação do cimento, a madeira de seringueira in natura foi classificada como de "inibição extrema", porém com a adição de CaCl2 o foi como de "baixa inibição". Essa madeira se mostrou tecnicamente viável à produção de chapas de cimento-madeira, independentemente do clone.Cement-bonded particleboards of rubberwood were manufactured with four clones of Hevea brasiliensis Müll. Arg. (rubberwood: IAN 717, IAN 873, GT 711 and AVROS 1301. Boards of 450 x 450 x 13 mm were manufactured in a ratio of 1:4:1 (wood/cement/water, weight basis, with 1.4 g/cm³ density and 4% calcium chloride dihydrated - CaCl2.2H2O as accelerator. The particles of four clones were tested in treated and untreated conditions, totaling eight treatments. In each treatment with four replicates, the physical and mechanical properties were evaluated according to ASTM D 1037 - 96a standard. Overall, the best mechanical and physical results were obtained with the cement-bonded particleboard made with particles from clone AVROS 1301. Rubberwood has shown to be "highly inhibitory" in the hydration test, however when CaCl2 was added the inhibition index decreased and

ESTUDIO ARQUEOHISTÓRICO DEL REGISTRO VÍTREO EN SITIOS MINEROS (MENDOZA, ARGENTINA (Archaeohistorical Study of the Vitreous Record in Mining Sites (Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Osvaldo Sironi

2017-06-01

Full Text Available Se presentan los resultados de los análisis de los registros vítreos de los sitios Minas Paramillos Sur y Mina La Atala, localizados en la Reserva Natural Villavicencio y Divisadero Largo. A partir del conocimiento de la materialidad cultural vítrea de esta región, se evidencian patrones de consumo vinculados a diversos tipos de bebidas y productos medicinales entre la clase trabajadora minera de la Precordillera de Mendoza (Argentina. ENGLISH: Results of the analysis of the vitreous record from Minas Paramillos Sur and Mina La Atala are presented. These sites are located in the Villavicencio and Divisadero Largo natural reserves. Knowledge of the vitreous cultural material of this region allows us to show consumption patterns of various types of beverages and medicines among the mining working class of the Mendoza Precordillera, Argentina.

Novel inhibitory activity of the Staphylococcus aureus NorA efflux pump by a kaempferol rhamnoside isolated from Persea lingue Nees.

Science.gov (United States)

Holler, Jes Gitz; Christensen, S Brøgger; Slotved, Hans-Christian; Rasmussen, Hasse B; Gúzman, Alfonso; Olsen, Carl-Erik; Petersen, Bent; Mølgaard, Per

2012-05-01

To isolate a plant-derived compound with efflux inhibitory activity towards the NorA transporter of Staphylococcus aureus. Bioassay-guided isolation was used, with inhibition of ethidium bromide efflux via NorA as a guide. Characterization of activity was carried out using MIC determination and potentiation studies of a fluoroquinolone antibiotic in combination with the isolated compound. Everted membrane vesicles of Escherichia coli cells enriched with NorA were prepared to study efflux inhibitory activity in an isolated manner. The ethanolic extract of Persea lingue was subjected to bioassay-guided fractionation and led to the isolation of the known compound kaempferol-3-O-α-L-(2,4-bis-E-p-coumaroyl)rhamnoside (compound 1). Evaluation of the dose-response relationship of compound 1 showed that ethidium bromide efflux was inhibited, with an IC(50) value of 2 μM. The positive control, reserpine, was found to have an IC(50) value of 9 μM. Compound 1 also inhibited NorA in enriched everted membrane vesicles of E. coli. Potentiation studies revealed that compound 1 at 1.56 mg/L synergistically increased the antimicrobial activity of ciprofloxacin 8-fold against a NorA overexpresser, and the synergistic activity was exerted at a fourth of the concentration necessary for reserpine. Compound 1 was not found to exert a synergistic effect on ciprofloxacin against a norA deletion mutant. The 2,3-coumaroyl isomer of compound 1 has been shown previously not to cause acute toxicity in mice at 20 mg/kg/day. Our results show that compound 1 acts through inhibition of the NorA efflux pump. Combination of compound 1 with subinhibitory concentrations of ciprofloxacin renders a wild-type more susceptible and a NorA overexpresser S. aureus susceptible.

Pharmacophore-Based Repositioning of Approved Drugs as Novel Staphylococcus aureus NorA Efflux Pump Inhibitors.

Science.gov (United States)

Astolfi, Andrea; Felicetti, Tommaso; Iraci, Nunzio; Manfroni, Giuseppe; Massari, Serena; Pietrella, Donatella; Tabarrini, Oriana; Kaatz, Glenn W; Barreca, Maria L; Sabatini, Stefano; Cecchetti, Violetta

2017-02-23

An intriguing opportunity to address antimicrobial resistance is represented by the inhibition of efflux pumps. Focusing on NorA, the most important efflux pump of Staphylococcus aureus, an efflux pump inhibitors (EPIs) library was used for ligand-based pharmacophore modeling studies. By exploitation of the obtained models, an in silico drug repositioning approach allowed for the identification of novel and potent NorA EPIs.

Inhibition of the NorA multi-drug transporter by oxygenated monoterpenes.

Science.gov (United States)

Coêlho, Mayara Ladeira; Ferreira, Josie Haydée Lima; de Siqueira Júnior, José Pinto; Kaatz, Glenn W; Barreto, Humberto Medeiros; de Carvalho Melo Cavalcante, Ana Amélia

2016-10-01

The aim of this study was to investigate intrinsic antimicrobial activity of three monoterpenes nerol, dimethyl octanol and estragole, against bacteria and yeast strains, as well as, investigate if these compounds are able to inhibit the NorA efflux pump related to fluoroquinolone resistance in Staphylococcus aureus. Minimal inhibitory concentrations (MICs) of the monoterpenes against Staphylococcus aureus, Escherichia coli and Candida albicans strains were determined by micro-dilution assay. MICs of the norfloxacin against a S. aureus strain overexpressing the NorA protein were determined in the absence or in the presence of the monoterpenes at subinhibitory concentrations, aiming to verify the ability of this compounds act as efflux pump inhibitors. The monoterpenes were inactive against S. aureus however the nerol was active against E. coli and C. albicans. The addition of the compounds to growth media at sub-inhibitory concentrations enhanced the activity of norfloxacin against S. aureus SA1199-B. This result shows that bioactives tested, especially the nerol, are able to inhibit NorA efflux pump indicating a potential use as adjuvants of norfloxacin for therapy of infections caused by multi-drug resistant S. aureus strains. Copyright © 2016 Elsevier Ltd. All rights reserved.

Novel structural analogues of piperine as inhibitors of the NorA efflux pump of Staphylococcus aureus

DEFF Research Database (Denmark)

Kumar, Ashwani; Khan, Inshad Ali; Koul, Surrinder

2008-01-01

OBJECTIVES: Evaluation of novel synthetic analogues of piperine as inhibitors of multidrug efflux pump NorA of Staphylococcus aureus. METHODS: A library of piperine-derived compounds was evaluated for their potential to inhibit ethidium bromide efflux in NorA-overexpressing S. aureus SA 1199B...... inhibitors of the NorA efflux pump. These inhibitors acted in a synergistic manner with ciprofloxacin, by substantially increasing its activity against both NorA-overexpressing and wild-type S. aureus isolates. These analogues were 2- to 4-fold more potent than piperine at a significantly lower minimal...... of ciprofloxacin through the inhibition of the NorA efflux pump. These molecules may prove useful in augmenting the antibacterial activities of fluoroquinolones in a clinical setting....

VITICULTURA Y POLÍTICA INTERNACIONAL: EL INTENTO DE REINCORPORAR A MENDOZA Y SAN JUAN A CHILE (1820-1835

Directory of Open Access Journals (Sweden)

PABLO LACOSTE

2006-06-01

Full Text Available Entre 1830 y 1835 algunos dirigentes de Mendoza y San Juan, provincias vitivinícolas, trataron de separarse de la República Argentina y regresar a Chile, tal como en la época colonial. Durante más de dos siglos, Mendoza y San Juan fueron parte del Corregimiento de Cuyo del Reino de Chile. Esta situación cambió desde 1776 con la creación del Virreinato del Río de la Plata. Después de la Revolución de 1810, Mendoza y San Juan formaron parte de la República Argentina. Pero algunos años después de la independencia, un grupo descontento con la acción y decisiones del gobierno de Buenos Aires, inició acciones orientadas a la secesión. Este artículo investiga las razones y motivaciones socioeconómicas de este grupoBetween 1830 and 1835 some leaders of Mendoza and San Juan, wine industry oriented provinces, attempted to withdrawal from Argentina Republic, and come back to Chile such as in colonial times. During more than two centuries, Mendoza and San Juan were members of Cuyo Province in Chile's Kingdom. This situation changed since 1776 because the creation of the River Plate Viceroyalty. After Revolution of 1810, Mendoza and San Juan took part of Argentina Republic. But some years after the independence, a group discontented with de action and decision of Buenos Aires government begun the action oriented to secession. This paper explores the socioeconomic reasons and motivation of this group

Optimización de la distribución y corte de piezas irregulares en chapas para la industria minera

Directory of Open Access Journals (Sweden)

José Arzola-Ruíz

2010-03-01

Full Text Available La organización de los procesos productivos es considerada una problemática altamente compleja en la cual han aplicado técnicas de optimización y empleo de sistemas CAPP (Computer Aided Process Planning. Los altos niveles de producción y consumo de materiales durante el proceso de corte de piezas irregulares en chapas, demandan el empleo de estas técnicas, con el propósito de obtener soluciones que permitan reducir los niveles de consumo energéticos y de materiales, aumentando así la productividad y eficiencia del proceso. En este artículo se muestran los aspectos fundamentales de un procedimiento para la optimización de la distribución y corte de las piezas en chapas, teniendo en cuenta las condiciones tecnológicas del proceso de corte. El aprovechamiento de material y las mínimas trayectorias de corte durante el proceso de fabricación son definidos como indicadores de eficiencia para el proceso de distribución y corte de piezas irregulares en chapas. El procedimiento abarca el empleo de heurísticas y un enfoque sistémico para generar soluciones que aporten el mejor compromiso de los valores de los indicadores de eficiencia. Los resultados obtenidos con el procedimiento propuesto mejoran significativamente los indicadores antes mencionados comparados con métodos y esquemas de solución de trabajos precedentes.

ADIÇÃO DE APARAS DE PAPEL RECICLÁVEL NA FABRICAÇÃO DE CHAPAS DE MADEIRA AGLOMERADA

Directory of Open Access Journals (Sweden)

Everton Hillig

2004-05-01

Full Text Available Neste trabalho, foram analisadas as propriedades físico-mecânicas de chapas aglomeradas produzidas com dois tipos de papel reciclável (papel jornal e offset e partículas de madeira de Pinus elliottii Engelm. As aparas de papel foram usadas no colchão em dois diferentes formatos (tiras ou moídas e em diferentes proporções: 0, 20, 40, 60 e 100% do peso seco das partículas. Utilizoaram-se 10% de adesivo à base de tanino-formaldeído na proporção 100:10. O experimento foi estabelecido segundo modelo fatorial, com três repetições. Os testes físico-mecânicos das chapas foram realizados segundo a norma ASTM D1037 (1995. Chapas aglomeradas produzidas tanto pela inclusão de papel jornal quanto offset no formato de tiras apresentaram tendência ao estouro durante a abertura dos pratos da prensa, causado pelo alto teor de umidade do colchão. A inclusão de aparas de papel prejudicaram a maioria das propriedades analisadas, fazendo com que não atendessem aos valores estabelecidos pelas normas DIN 68761 (1-1961, (3-1971 e ANSI A 208.1 (1987. A absorção d’água após 24 horas de imersão, a ligação interna e a resistência ao arrancamento de parafusos foram as propriedades mais prejudicadas. De modo geral, o uso de papel jornal se mostrou mais promissor do que o papel offset.

Plagas de la agricultura en Mendoza: la langosta en los comienzos de la vitivinicultura moderna (1890-1900

Directory of Open Access Journals (Sweden)

Eduardo Pérez Romagnoli

2011-12-01

Full Text Available El trabajo se refiere a la presencia de la langosta en Mendoza en los comienzos de la especialización vitivinícola, en la década de 1890. Comprende aspectos sobre su biogeografía, antecedentes del insecto en nuestro país, los primeros inventos nacionales para enfrentar sus ataques. Con relación a las invasiones de la Schistocerca americana en Mendoza, se indaga sobre la organización estatal y la participación de la sociedad para combatirla, incluyendo algunos problemas y daños causados en la agricultura.The study refers to the presence of locust in Mendoza at the beginning of wine specialization, in the decade of 1890. It includes aspects on biogeography, precedents of the insect in our country, and first national inventions to face its assaults. In relation to invasions of Schistocercaamericana in Mendoza, the study researches on state organization and social participation to attack the plague, including some problems and damages caused in agriculture.

The 95ΔG mutation in the 5'untranslated region of the norA gene increases efflux activity in Staphylococcus epidermidis isolates.

Science.gov (United States)

García-Gómez, Elizabeth; Jaso-Vera, Marcos E; Juárez-Verdayes, Marco A; Alcántar-Curiel, María D; Zenteno, Juan C; Betanzos-Cabrera, Gabriel; Peralta, Humberto; Rodríguez-Martínez, Sandra; Cancino-Díaz, Mario E; Jan-Roblero, Janet; Cancino-Diaz, Juan C

2017-02-01

In the Staphylococcus aureus ATCC25923 strain, the flqB mutation in the 5'untranslated region (5'UTR) of the norA gene causes increased norA mRNA expression and high efflux activity (HEA). The involvement of the norA gene 5'UTR in HEA has not been explored in S. epidermidis; therefore, we examined the function of this region in S. epidermidis clinical isolates. The selection of isolates with HEA was performed based on ethidium bromide (EtBr) MIC values and efflux efficiency (EF) using the semi-automated fluorometric method. The function of the 5'UTR was studied by quantifying the levels of norA expression (RT-qPCR) and by identifying 5'UTR mutations by sequence analysis. Only 10 isolates from a total of 165 (6.1%) had HEA (EtBr MIC = 300 μg/ml and EF ranged from 48.4 to 97.2%). Eight of 10 isolates with HEA had the 5'UTR 95 Δ G mutation. Isolates carrying the 95 Δ G mutation had higher levels of norA expression compared with those that did not. To corroborate that the 95 Δ G mutation is involved in HEA, a strain adapted to EtBr was obtained in vitro. This strain also presented the 95 Δ G mutation and had a high level of norA expression and EF, indicating that the 95 Δ G mutation is important for the HEA phenotype. The 95 Δ G mutation produces a different structure in the Shine-Dalgarno region, which may promote better translation of norA mRNA. To our knowledge, this is the first report to demonstrate the participation of the 5'UTR 95 Δ G mutation of the norA gene in the HEA phenotype of S. epidermidis isolates. Here, we propose that the efflux of EtBr is caused by an increment in the transcription and/or translation of the norA gene. Copyright © 2016 Elsevier Ltd. All rights reserved.

Determinação das propriedades físicas e mecânicas do gesso reciclado proveniente de chapas de gesso acartonado

Directory of Open Access Journals (Sweden)

A. Erbs

2015-12-01

Full Text Available Resumo A busca pela viabilidade técnica e econômica da reciclagem de resíduos na cadeia produtiva da construção civil vem atender às novas necessidades do setor de promover crescimento econômico integrado às necessidades sociais e ambientais. O crescente aumento do consumo das chapas de gesso acartonado carrega consigo o problema da geração dos resíduos de gesso, onde a falta de pesquisa e o descarte incorreto acaba destinando o resíduo gerado, na maioria das vezes, para aterros ou bota-foras irregulares, sem controle ou estimativa de volume. No presente trabalho, por meio da adoção de um processo de reciclagem composto das etapas de moagem e calcinação do resíduo das chapas de gesso acartonado, determinaram-se as propriedades físicas e mecânicas do gesso reciclado proveniente das chapas de gesso acartonado. A análise dos resultados mostrou a viabilidade da reciclagem, pois após a reidratação foi possível moldar corpos de prova, demonstrando que é possível reciclar um produto que hoje é descartado.

Phosphorylation of MgrA and its effect on expression of the NorA and NorB efflux pumps of Staphylococcus aureus.

Science.gov (United States)

Truong-Bolduc, Que Chi; Hooper, David C

2010-05-01

MgrA is a global regulator in Staphylococcus aureus that controls the expression of diverse genes encoding virulence factors and multidrug resistance (MDR) efflux transporters. We identified pknB, which encodes the (Ser/Thr) kinase PknB, in the S. aureus genome. PknB was able to autophosphorylate as well as phosphorylate purified MgrA. We demonstrated that rsbU, which encodes a Ser/Thr phosphatase and is involved in the activation of the SigB regulon, was able to dephosphorylate MgrA-P but not PknB-P. Serines 110 and 113 of MgrA were found to be phosphorylated, and Ala substitutions at these positions resulted in reductions in the level of phosphorylation of MgrA. DNA gel shift binding assays using norA and norB promoters showed that MgrA-P was able to bind the norB promoter but not the norA promoter, a pattern which was the reverse of that for unphosphorylated MgrA. The double mutant MgrA(S110A-S113A) bound to the norA promoter but not the norB promoter. The double mutant led to a 2-fold decrease in norA transcripts and a 2-fold decrease in the MICs of norfloxacin and ciprofloxacin in strain RN6390. Thus, phosphorylation of MgrA results in loss of binding to the norA promoter, but with a gain of the ability to bind the norB promoter. Loss of the ability to phosphorylate MgrA by Ala substitution resulted in increased repression of norA expression and in reductions in susceptibilities to NorA substrates.

Using Network Oriented Research Assistant (NORA) Technology to Compare Digital Photographic With In-Person Assessment of Acne Vulgaris.

Science.gov (United States)

Singer, Hannah M; Almazan, Timothy; Craft, Noah; David, Consuelo V; Eells, Samantha; Erfe, Crisel; Lazzaro, Cynthia; Nguyen, Kathy; Preciado, Katy; Tan, Belinda; Patel, Vishal A

2018-02-01

Teledermatology has undergone exponential growth in the past 2 decades. Many technological innovations are becoming available without necessarily undergoing validation studies for specific dermatologic applications. To determine whether patient-taken photographs of acne using Network Oriented Research Assistant (NORA) result in similar lesion counts and Investigator's Global Assessment (IGA) findings compared with in-person examination findings. This pilot reliability study enrolled consecutive patients with acne vulgaris from a single general dermatology practice in Los Angeles, California, who were able to use NORA on an iPhone 6 to take self-photographs. Patients were enrolled from January 1 through March 31, 2016. Each individual underwent in-person and digital evaluation of his or her acne by the same dermatologist. A period of at least 1 week separated the in-person and digital assessments of acne. All participants were trained on how to use NORA on the iPhone 6 and take photographs of their face with the rear-facing camera. Reliability of patient-taken photographs with NORA for acne evaluation compared with in-person examination findings. Acne assessment measures included lesion count (total, inflammatory, noninflammatory, and cystic) and IGA for acne severity. A total of 69 patients (37 male [54%] and 32 female [46%]; mean [SD] age, 22.7 [7.7] years) enrolled in the study. The intraclass correlation coefficients of in-person and photograph-based acne evaluations indicated strong agreement. The intraclass correlation coefficient for total lesion count was 0.81; for the IGA, 0.75. Inflammatory lesion count, noninflammatory lesion count, and cyst count had intraclass correlation coefficients of 0.72, 0.72, and 0.82, respectively. This study found agreement between acne evaluations performed in person and from self-photographs with NORA. As a reliable telehealth technology for acne, NORA can be used as a teledermatology platform for dermatology research and can

Effect of Promoter Region Mutations and mgrA Overexpression on Transcription of norA, Which Encodes a Staphylococcus aureus Multidrug Efflux Transporter

OpenAIRE

Kaatz, Glenn W.; Thyagarajan, Rama V.; Seo, Susan M.

2005-01-01

NorA is a Staphylococcus aureus multidrug transporter that confers resistance to structurally distinct compounds. The MgrA global regulatory protein is reported to augment norA expression when mgrA is overexpressed from an undefined plasmid-based promoter. Further details about norA regulatory mechanisms are scant. A chromosomal norA::lacZ transcriptional fusion was constructed in different S. aureus strains, and allele replacement was used to define the relevance of promoter region sequences...

Podredumbre radical bacteriana del alcaucil en Mendoza (Argentina)

OpenAIRE

Soto, José Alfredo; Puglia, María Carolina

2002-01-01

En alcauciles (Cynara scolymus L.) de la variedad Bleek cultivados en Coquimbito (Mendoza, Argentina) se observó marcada detención del crecimiento y atraso en la formación de las inflorescencias. Las plantas sanas tenían aprox. 1 m de altura mientras las enfermas no llegaban a 30 cm. Las hojas más externas manifestaban clorosis y leve marchitez con posterior necrosis. Se realizaron aislamientos en APG de...

Adição de aparas de papel reciclável na fabricação de chapas de madeira aglomerada.

Directory of Open Access Journals (Sweden)

Leandro Calegari

2010-08-01

Full Text Available Neste trabalho, foram analisadas as propriedades físico-mecânicas de chapas aglomeradas produzidas com dois tipos de papel reciclável (papel jornal e offset e partículas de madeira de Pinus elliottii Engelm. As aparas de papel foram usadas no colchão em dois diferentes formatos (tiras ou moídas e em diferentes proporções: 0, 20, 40, 60 e 100% do peso seco das partículas. Utilizoaram-se 10% de adesivo à base de tanino-formaldeído na proporção 100:10. O experimento foi estabelecido segundo modelo fatorial, com três repetições. Os testes físico-mecânicos das chapas foram realizados segundo a norma ASTM D1037 (1995. Chapas aglomeradas produzidas tanto pela inclusão de papel jornal quanto offset no formato de tiras apresentaram tendência ao estouro durante a abertura dos pratos da prensa, causado pelo alto teor de umidade do colchão. A inclusão de aparas de papel prejudicaram a maioria das propriedades analisadas, fazendo com que não atendessem aos valores estabelecidos pelas normas DIN 68761 (1-1961, (3-1971 e ANSI A 208.1 (1987. A absorção d'água após 24 horas de imersão, a ligação interna e a resistência ao arrancamento de parafusos foram as propriedades mais prejudicadas. De modo geral, o uso de papel jornal se mostrou mais promissor do que o papel offset.

ORDEN HÍDRICO: PRÁCTICAS E INSTITUCIONES EN MENDOZA, ARGENTINA

Directory of Open Access Journals (Sweden)

Paula Cecilia Mussetta

2014-06-01

Full Text Available Este artículo aborda el campo del manejo de los recursos hídricos y propone un esquema de análisis para estudiar las relaciones entre las instituciones y las prácticas de los actores afectados por las acciones de tales instituciones. Avanza después, en forma preliminar y descriptiva, sobre la exploración de algunas de las categorías presentadas en el esquema propuesto en un caso concreto (Mendoza, Argentina. Reconocemos una doble dinámica de funcionamiento del régimen hídrico: una entre la autoridad hídrica y los grandes y poderosos actores vitícolas y otra entre un conjunto de entidades satélites no hídricas y pequeños productores. Esto lleva a que desde la política hídrica se reproduzca un modelo de producción que claramente beneficia a un sector a costa de otro.   HYDROLOGIC ORDER: PRACTICES AND INSTITUTIONS IN MENDOZA, ARGENTINA This article addresses the territory of water resource management and proposes an analytical framework to study the inter-institutional relationships and practices of the stakeholders affected by the actions taken by those institutions. It explores in a preliminary and descriptive form some of the categories presented in the framework proposed for the specific case of Mendoza, Argentina. It identifies a double working dynamic in the hydrologic regime: one between the hydrologic authorities and large-scale and powerful stakeholders of the wine industry and another dynamic between a series of non-hydrologic satellite entities and small-scale producers. This leads to a hydrologic policy that reproduces a production model that clearly benefits one sector at the expense of another.

Evaluation of expression of NorA efflux pump in ciprofloxacin resistant Staphylococcus aureus against hexahydroquinoline derivative by real-time PCR.

Science.gov (United States)

Pourmand, Mohammad Reza; Yousefi, Masoud; Salami, Seyed Alireza; Amini, Mohsen

2014-01-01

Staphylococcus aureus causes a wide variety of infections worldwide. Methicillin-resistant S. aureus is one of most common causes of nosocomial and community acquired infections. The fluoroquinolones are an important class of antibiotics that used to treat infections caused by S. aureus. Today, a significant increase in the rate of ciprofloxacin resistance in methicillin-resistant S. aureus strains is concerning. The norA efflux pump is considered as contributors to antibiotic resistance. Here, we aimed to evaluate the expression of norA efflux pump in the presence of hexahydroquinoline derivative in methicillin and ciprofloxacin resistant S. aureus. We were determined minimum inhibitory concentration of ciprofloxacin and hexahydroquinoline derivative and their combination by broth microdilution method against ciprofloxacin resistant S. aureus. The expression of the norA efflux pump gene was evaluated by quantitative Real-time PCR. This study showed that minimum inhibitory concentrations of ciprofloxacin in the presence of hexahydroquinoline derivative in comparison to ciprofloxacin were decreased. Quantitative Real-time PCR identified the increased expression of norA efflux pump gene in methicillin and ciprofloxacin resistant S. aureus strain. The increased expression of norA efflux pump gene may have resulted in the effort of S. aureus to survive. The results showed that the hexahydroquinoline derivative enhanced the antibacterial effect of ciprofloxacin against methicillin and ciprofloxacin resistant S. aureus. Therefore, the derivatives may be used as inhibitors of antibiotic resistance for combination therapy.

Water in the Mendoza, Argentina, food processing industry: water requirements and reuse potential of industrial effluents in agriculture

Directory of Open Access Journals (Sweden)

Alicia Elena Duek

2016-04-01

Full Text Available This paper estimates the volume of water used by the Mendoza food processing industry considering different water efficiency scenarios. The potential for using food processing industry effluents for irrigation is also assessed. The methodology relies upon information collected from interviews with qualified informants from different organizations and food-processing plants in Mendoza selected from a targeted sample. Scenarios were developed using local and international secondary information sources. The results show that food processing plants in Mendoza use 19.65 hm3 of water per year; efficient water management practices would make it possible to reduce water use by 64%, i.e., to 7.11 hm3. At present, 70% of the water is used by the fruit and vegetable processing industry, 16% by wineries, 8% by mineral water bottling plants, and the remaining 6% by olive oil, beer and soft drink plants. The volume of effluents from the food processing plants in Mendoza has been estimated at 16.27 hm3 per year. Despite the seasonal variations of these effluents, and the high sodium concentration and electrical conductivity of some of them, it is possible to use them for irrigation purposes. However, because of these variables and their environmental impact, land treatment is required.

Bodegas sobresuelo y estabilidad térmica interior: análisis de envolventes tradicionales y contemporáneas en Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Carolina Ganem Karlen

2013-06-01

Full Text Available El control en el intercambio de flujos energéticos interior-exterior y la inercia térmica de los materiales constructivos son características claves de la envolvente de los edificios de bodegas. Esta situación es particularmente importante en el caso de los edificios construidos sobresuelo en climas con temperaturas diarias y estacionales muy variables. En el caso de que la arquitectura no provea la respuesta adecuada, indefectiblemente se recurre al consumo de energía auxiliar. La bodega S.A., ubicada en Mendoza, Argentina, consume energía auxiliar equivalente a 2.500 kW por año. Dicha bodega sobresuelo presenta dos tipos de envolvente vertical: una tradicional en adobe (λ = 0.81W/mK y otra contemporánea en chapa galvanizada sin aislación (λ = 45 W/mK. El objetivo de este trabajo es analizar los aspectos de materialidad, inercia térmica e intercambio de flujos energéticos de envolventes tradicionales y contemporáneas y, comparar los resultados obtenidos con un caso teórico de bodega subterránea. Entre los resultados obtenidos se observa que la envolvente tradicional mantiene las temperaturas interiores entre 8,5 ºC y 10 ºC por debajo de las temperaturas exteriores, mientras que los nuevos espacios con envolventes contemporáneas lo hacen solamente 3 ºC a 5 ºC por debajo de las temperaturas exteriores. En el caso de una bodega subterránea, las temperaturas estarían estables durante el año en 16,5 ºC; esto es, en verano, 20 ºC por debajo de las temperaturas exteriores.

Software INCAS (Convective Clouds Indicator to Seeding Activities) to convective clouds class forecast in Mendoza (Argentina).

Science.gov (United States)

Pérez, R. C.

2009-09-01

With the objective of to get to forecast and operative determinations tool to seeding of hailstorm in the damage mitigations job that produces its precipitation in Mendoza (Argentina), we developed to software based in on surface and 500 mb. level atmospherics variable. We had used on surface dates because in this level exist to big amount of information, practically it is possible to get its measures continuously; in addition it is the level that data of damages are registered that the hail precipitation produces. The decision to use the level of 500 mb, it must to that it is the height in which the upset one of the air circulation takes place from the Pacific to Mendoza, who produces important changes and instability in the atmosphere of Mendoza, these data were obtained from the radiosonde of Santo Domingo in Santiago (Chile) and El Plumerillo (Mendoza). In the program is integrated the different indices and models obtained in ours works from investigation on the subject of last the five years. Since the October of 2004 to April of 2009 the values have been taken from the variables mentioned every day, hourly during the fight campaigns antihail (October-April). The results have integrated in the program INCAS, whom it is due to enter the surface variables: Temperature in °C, the dew point in °C, the atmospheric pressure in mb., the index of ultraviolet solar radiation, the direction and wind speed; whereas the variables of the level of 500 are due to introduce mb: height of the level of 500 mb in meters, temperature of the level in °C, the direction and wind speed to that height. From the process of these variables the type of convective process is obtained like exit of the program , that is more probable that it appears in Mendoza for these atmospheric conditions; the thresholds that trigger to the stormy processes and their possible severity. This year software was validated in his first version, obtaining itself very good results.

Pollution trends using bark of morus alba in the cities of buenos aires and mendoza (Argentina Tendências de poluição usando cascas de morus alba nas cidades de buenos aires e mendoza (Argentina

Directory of Open Access Journals (Sweden)

Patricia Perelman

2010-06-01

Full Text Available A comparative study of elements deposited on tree bark was carried out for urban and periurban areas of two of the most important cities in Argentina. The content of Fe, Mg, Al, Mn, Zn, Pb, Ba, Cr, Hg, Cu, Ni, Cd and Sb was determined by inductively coupled plasma atomic emission spectrometry (ICP-OES in Morus alba tree bark collected in the cities of Buenos Aires and Mendoza. The main air pollutants detected in the Buenos Aires urban area were Ba, Cr, Cu and Ni and indicate significative difference from the Mendoza urban and periurban areas. Significantly, higher concentrations of Zn, Ba, Cr and Cu were recorded in the periurban area of the city of Buenos Aires than in Mendoza. Bark samples were strongly influenced by dust and show Al, Fe, Mg and other element accumulations that indicate that soil particles were carried out by wind. Elements like Ba and Zn, commonly linked to traffic emissions, showed the highest concentrations in the Buenos Aires metropolitan area, possibly due to more intensive vehicular traffic. Our results indicated that intensity of vehicular traffic and not city structure is responsible for air pollution.Um estudo comparativo dos elementos depositados nas cascas das árvores foi realizado nas áreas urbanas e na periferia de duas cidades das mais importantes da Argentina. Os índices do Fe, Mg, Al, Mn, Zn, Pb, Ba, Cr, Cu, Ni e do Sb foram determinados pela espectrometria da emissão atômica com plasma acoplado indutivamente (ICP-OES nas cascas da árvore Morus alba, coletados nas cidades de Buenos Aires e Mendoza. Os principais elementos da contaminação do ar detectadas na área urbana de Buenos Aires foram Ba, Cr, Cu e Ni, que indicaram diferenças significativas nas áreas urbanas e na periferia de Mendoza. Uma concentração do Zn, Ba, Cr e do Cu foi achada na periferia da cidade de Buenos Aires, significativamente mais elevada do que em Mendoza. As amostras da casca foram influenciadas fortemente pela poeira e

Assessment of aquifer contamination from on-site sanitation systems and effluent reuse in the North of Mendoza province

OpenAIRE

Álvarez, Amilcar; D'Elía, Mónica; Paris, Marta; Fasciolo, Graciela; Barbazza, Carla

2011-01-01

En la zona norte de la provincia de Mendoza se desarrollan actividades que pueden afectar la calidad natural del agua subterránea: disposición y re-uso de efluentes industriales para riego agrícola, utilización de fertilizantes, saneamiento in-situ, fugas de redes de alcantarillado, etc. En esta región, surcada superficialmente por los ríos Mendoza y Tunuyán, la sedimentación cuaternaria determinó la for...

Citral derived amides as potent bacterial NorA efflux pump inhibitors

DEFF Research Database (Denmark)

Thota, Niranjan; Koul, Surrinder; Reddy, Mallepally V

2008-01-01

Monoterpene citral and citronellal have been used as starting material for the preparation of 5,9-dimethyl-deca-2,4,8-trienoic acid amides and 9-formyl-5-methyl-deca-2,4,8-trienoic acid amides. The amides on bioevaluation as efflux pump inhibitors (EPIs) against Staphylococcus aureus 1199 and NorA...

Amino acid amides of piperic acid (PA) and 4-ethylpiperic acid (EPA) as NorA efflux pump inhibitors of Staphylococcus aureus.

Science.gov (United States)

Wani, Naiem Ahmad; Singh, Samsher; Farooq, Saleem; Shankar, Sudha; Koul, Surrinder; Khan, Inshad Ali; Rai, Rajkishor

2016-09-01

A total of eighteen piperic acid (PA) and 4-ethylpiperic acid (EPA) amides (C1-C18) with α-, β- and γ-amino acids were synthesized, characterized and evaluated for their efflux pump inhibitory activity against ciprofloxacin resistant Staphylococcus aureus. The amides were screened against NorA overexpressing S. aureus SA-1199B and wild type S. aureus SA-1199 using ethidium bromide as NorA efflux pump substrate. EPI C6 was found to be most potent and reduced the MIC of ciprofloxacin by 16 fold followed by C18 which showed 4 fold reduction of MIC. Ethidium bromide efflux inhibition and accumulation assay proved these compounds as NorA inhibitors. Copyright © 2016 Elsevier Ltd. All rights reserved.

Análisis de uniones atornilladas vigas-pilar realizadas con chapa frontal a tope

OpenAIRE

Foces, Antonio; Garrido, José; Moreno, Alicia

2007-01-01

Hoy en día está ampliamente reconocido que las uniones y los elementos de una estructura metálica presentan un comportamiento semirrígido y no lineal teniendo los estudios actuales como objetivo incorporar tales conceptos en los métodos de diseño y análisis . El presente trabajo se centra en el estudio de las uniones atornilladas viga-pilar realizadas con chapa frontal a tope, tipo de unión ampliamente utilizada por ser de fácil fabricación y montaje , con el objetivo de predecir su comportam...

Análisis de uniones atornilladas viga-pilar realizadas con chapa frontal a tope

OpenAIRE

Foces Mediavilla, Antonio; Garrido Hernández, Antonio; Moreno

2007-01-01

Hoy en día está ampliamente reconocido que las uniones y los elementos de una estructura met´alica presentan un comportamiento semirrígido y no lineal, teniendo los estudios actuales como objetivo incorporar tales conceptos en los métodos de diseño y análisis. El presente trabajo se centra en el estudio de las uniones atornilladas viga–pilar realizadas con chapa frontal a tope, tipo de unión ampliamente utilizada por ser de fácil fabricación y montaje, con el objetivo de predecir su comportam...

ESTRATEGIAS ALIMENTARIAS Y DE SUBSISTENCIA PREHISPÁNICA EN EL CENTRO-OESTE DE MENDOZA: CONSUMO Y DESCARTE EN EL SITIO ARQUEOLÓGICO AGUA AMARGA / Food and subsistence strategies in the prehispanic Mendoza Midwest: Consumption and discard at Agua Amarga

Directory of Open Access Journals (Sweden)

María José Ots

2011-12-01

Full Text Available Se presenta el análisis de un depósito de desechos asociados a la alimentación en Agua Amarga (departamento de Tupungato, en el Centro Oeste de la provincia de Mendoza. Agua Amarga es un sitio residencial de actividades múltiples ubicado en el piedemonte del Valle de Uco, a 1000 msnm. Los fechados obtenidos sobre cerámica y restos vegetales del contexto lo ubican en el período tardío y de dominación incaica regional. El propósito del trabajo es estudiar estrategias de procesamiento, consumo y descarte de alimentos que asimismo contribuyan a la discusión sobre las estrategias de subsistencia prehispánicas en el Norte y Centro de Mendoza. Se aplican métodos y técnicas específicos para la identificación y el análisis de los restos, y se proponen hipótesis alternativas sobre dicho contexto. Los materiales recuperados, la mayoría de ellos termoalterados y muy fragmentados, incluyen macrorrestos arqueobotánicos (principalmente Zea mays y Phaseulus vulgaris, restos óseos (algunos elementos identificados como Lama sp., fragmentos de distintos recipientes cerámicos y de artefactos de molienda.  Finalmente, se discuten prácticas asociadas con la alimentación y la subsistencia, con especial referencia a la producción y consumo de maíz en el área.   Palabras clave: alimentación, subsistencia, maíz, Mendoza   Abstract We present the study of a refuse deposit associated with feeding activities in the archaeological site Agua Amarga (Tupungato department, Middle West of Mendoza province. This is a residencial site of multiple activities located in the foothill in Valle de Uco, to 1000 masl. We dated ceramics and vegetal remains that locate the context in the late period and during regional inca domination. Our goal is to study strategies of processing, consumption and discarding of foods that also contribute in the discussion on the prehispanic strategies of subsistence in the North and Center of Mendoza province. In this paper

A new species of Liolaemus (Reptilia: Squamata: Tropiduridae from Mendoza province, Argentina

Directory of Open Access Journals (Sweden)

Etheridge, Richard

2001-05-01

Full Text Available Una nueva especie del complejo Liolaemus darwinii es descrita para el centro de la provincia de Mendoza, Argentina. Se parece más a L. olongasta y L. laurenti en que los machos adultos tienen pigmento negro en el pliegue antehumeral y manchas escapulares que no son agrandadas. Difiere de estas especies en tener un cuerpo adulto menor, un número mayor de escamas en la mitad del cuerpo, una cola más corta y un mayor número de poros precloacales en machos, y un patrón ventral distinto en machos adultos. En el norte de su distribución se encuentra L. darwinii en el norte de la provincia de Mendoza y en la provincia de San Luis, y en el sur en el oeste de la provincia de La Pampa, en el noroeste de la provincia de Neuquén y en la provincia de Río Negro, pero se desconoce si estas poblaciones del norte y del sur de L. darwtnii están separadas por la distribución de la nueva especie. Análisis cladísticos basados en comportamiento, morfología y secuencias de DNA muestran filogenias conflictivas, pero concuerdan en que la nueva especie es un miembro del grupo boulengeri, con afinidades más cercanas a L. darwinii, L. olongasta y L. laurenti. A new species,of the Liolaemus darwinii complex is described from central Mendoza Province, Argentina. It most closely resembles L. olongasta and L. laurenti in that adult males have black pigment in the antehumeral fold and scapular spots that are not enlarged. It differs from these species in having a smaller adult body size, a higher number of midbody scales, a shorter tail, more precloacal pores in males, and a different adult male ventral body pattern. Its range is bordered by L. darwinii on the north in northern Mendoza and San Luis provinces, and on the south in western La Pampa and northwestern Neuquén and Río Negro provinces, but it is unknown whether these northern and southern populations of L. darwinii are separated by the range of the new species. Cladistic analyses based on behaviour

Aminoguanidine hydrazones (AGH's) as modulators of norfloxacin resistance in Staphylococcus aureus that overexpress NorA efflux pump.

Science.gov (United States)

Dantas, Natalina; de Aquino, Thiago Mendonça; de Araújo-Júnior, João Xavier; da Silva-Júnior, Edeildo; Gomes, Ednaldo Almeida; Gomes, Antoniel Augusto Severo; Siqueira-Júnior, José Pinto; Mendonça Junior, Francisco Jaime Bezerra

2018-01-25

One of the promising fields for improving the effectiveness of antimicrobial agents is their combination with efflux pump inhibitors (EPIs), which besides expanding the use of existing antibiotics. The goal of this research was to evaluate a series of aminoguanidine hydrazones (AGH's, 1-19) as antibacterial agents and NorA efflux pump inhibitors in Staphylococcus aureus strain SA-1199B. Molecular modeling and docking studies were also performed in order to explain at the molecular level the interactions of the compounds with the generated NorA efflux pump model. The MICs of the antibiotic and ethidium bromide were determined by microdilution assay in absence or presence of a subinhibitory concentration of aminoguanidine hydrazones and macrophages viability was determined through MTT assay. Bioinformatic software Swiss-Model and AutoDock 4.2 were used to perform modeling and docking studies, respectively. As results, all AGH's were able to potentiate the action for the antibiotic norfloxacin, causing MIC's reduction of 16-fold and 32-fold to ethidium bromide. In the cell viability test, the concentration of 10 μg/mL showed better results than 90% and the concentration of 1000 μg/mL showed the lowest viability, reaching a maximum of 50% for the analyzed aminoguanidine hydrazones. Molecular docking studies showed that both norfloxacin and derivative 13 were recognized by the same binding site of NorA pump, suggesting a competitive mechanism. The present work demonstrated for the first time that AGH derivatives have potential to be putative inhibitors of NorA efflux pump, showing a promising activity as an antibacterial drug development. Copyright © 2017 Elsevier B.V. All rights reserved.

Novel structural analogues of piperine as inhibitors of the NorA efflux pump of Staphylococcus aureus.

Science.gov (United States)

Kumar, Ashwani; Khan, Inshad Ali; Koul, Surrinder; Koul, Jawahir Lal; Taneja, Subhash Chandra; Ali, Intzar; Ali, Furqan; Sharma, Sandeep; Mirza, Zahid Mehmood; Kumar, Manoj; Sangwan, Pyare Lal; Gupta, Pankaj; Thota, Niranjan; Qazi, Ghulam Nabi

2008-06-01

Evaluation of novel synthetic analogues of piperine as inhibitors of multidrug efflux pump NorA of Staphylococcus aureus. A library of piperine-derived compounds was evaluated for their potential to inhibit ethidium bromide efflux in NorA-overexpressing S. aureus SA 1199B. The active compounds were then individually combined with ciprofloxacin to study the potentiation of ciprofloxacin's activity. Based on the efflux inhibition assay, a library of 200 compounds was screened. Three piperine analogues, namely SK-20, SK-56 and SK-29, were found to be the most potent inhibitors of the NorA efflux pump. These inhibitors acted in a synergistic manner with ciprofloxacin, by substantially increasing its activity against both NorA-overexpressing and wild-type S. aureus isolates. These analogues were 2- to 4-fold more potent than piperine at a significantly lower minimal effective concentration. Furthermore, these inhibitors also significantly suppressed the in vitro emergence of ciprofloxacin-resistant S. aureus. A newly identified class of compounds derived from a natural amide, piperine, is more potent than the parent molecule in potentiating the activity of ciprofloxacin through the inhibition of the NorA efflux pump. These molecules may prove useful in augmenting the antibacterial activities of fluoroquinolones in a clinical setting.

From phenothiazine to 3-phenyl-1,4-benzothiazine derivatives as inhibitors of the Staphylococcus aureus NorA multidrug efflux pump.

Science.gov (United States)

Sabatini, Stefano; Kaatz, Glenn W; Rossolini, Gian Maria; Brandini, David; Fravolini, Arnaldo

2008-07-24

Overexpression of efflux pumps is an important mechanism by which bacteria evade effects of substrate antimicrobial agents and inhibition of such pumps is a promising strategy to circumvent this resistance mechanism. NorA is a Staphylococcus aureus multidrug efflux pump, the activity of which confers decreased susceptibility to many structurally unrelated agents, including fluoroquinolones, resulting in a multidrug resistant (MDR) phenotype. In this work, a series of 1,4-benzothiazine derivatives were designed and synthesized as a minimized structural template of phenothiazine MDR efflux pump inhibitors (EPIs) in an effort to identify more potent S. aureus NorA EPIs. Almost all derivatives evaluated showed good activity in combination with ciprofloxacin against S. aureus ATCC 25923; some were capable of completely restoring ciprofloxacin activity in a norA-overexpressing strain (SA-K2378). Compounds 6k and 7j displayed good activity against SA-1199B, a strain that also overexpresses norA, in an ethidium bromide (EtBr) efflux inhibition assay.

Drosophila Nora virus capsid proteins differ from those of other picorna-like viruses.

Science.gov (United States)

Ekström, Jens-Ola; Habayeb, Mazen S; Srivastava, Vaibhav; Kieselbach, Thomas; Wingsle, Gunnar; Hultmark, Dan

2011-09-01

The recently discovered Nora virus from Drosophila melanogaster is a single-stranded RNA virus. Its published genomic sequence encodes a typical picorna-like cassette of replicative enzymes, but no capsid proteins similar to those in other picorna-like viruses. We have now done additional sequencing at the termini of the viral genome, extending it by 455 nucleotides at the 5' end, but no more coding sequence was found. The completeness of the final 12,333-nucleotide sequence was verified by the production of infectious virus from the cloned genome. To identify the capsid proteins, we purified Nora virus particles and analyzed their proteins by mass spectrometry. Our results show that the capsid is built from three major proteins, VP4A, B and C, encoded in the fourth open reading frame of the viral genome. The viral particles also contain traces of a protein from the third open reading frame, VP3. VP4A and B are not closely related to other picorna-like virus capsid proteins in sequence, but may form similar jelly roll folds. VP4C differs from the others and is predicted to have an essentially α-helical conformation. In a related virus, identified from EST database sequences from Nasonia parasitoid wasps, VP4C is encoded in a separate open reading frame, separated from VP4A and B by a frame-shift. This opens a possibility that VP4C is produced in non-equimolar quantities. Altogether, our results suggest that the Nora virus capsid has a different protein organization compared to the order Picornavirales. Copyright © 2011 Elsevier B.V. All rights reserved.

Geología de la región del Cerro Guanaquero, Río Diamante, Mendoza Geology of Cerro Guanaquero region, Diamante River, Mendoza

OpenAIRE

Federico Fuentes; Victor A. Ramos

2008-01-01

El estudio realizado presenta nuevos datos sobre un sector poco conocido de la Cordillera Principal de Mendoza, en la alta cuenca del río Diamante en las adyacencias del cerro Guanaquero, y los primeros datos geocronológicos de sus rocas volcánicas. Las unidades geológicas presentes en el área se dividen en cuatro grupos principales: secuencias sedimentarias mesozoicas marinas y continentales intensamente plegadas y falladas; intrusivos y volcanitas intermedias de edad neógena; rocas volcánic...

NORA project offers unique reactor research and advanced training opportunities

International Nuclear Information System (INIS)

1961-01-01

An international program for reactor research and advanced training for a period of three years has been established in connection with the Norwegian critical assembly NORA. The aim of the project is to determine, through integral experiments, the basic reactor physics data for lattices moderated with light-water, heavy-water or mixtures of heavy and light water, with fuels of different sizes and spacing, three different enrichments and compositions. The objectives, programme, and facilities are described in details

Quantitative structure activity relationship (QSAR) of piperine analogs for bacterial NorA efflux pump inhibitors.

Science.gov (United States)

Nargotra, Amit; Sharma, Sujata; Koul, Jawahir Lal; Sangwan, Pyare Lal; Khan, Inshad Ali; Kumar, Ashwani; Taneja, Subhash Chander; Koul, Surrinder

2009-10-01

Quantitative structure activity relationship (QSAR) analysis of piperine analogs as inhibitors of efflux pump NorA from Staphylococcus aureus has been performed in order to obtain a highly accurate model enabling prediction of inhibition of S. aureus NorA of new chemical entities from natural sources as well as synthetic ones. Algorithm based on genetic function approximation method of variable selection in Cerius2 was used to generate the model. Among several types of descriptors viz., topological, spatial, thermodynamic, information content and E-state indices that were considered in generating the QSAR model, three descriptors such as partial negative surface area of the compounds, area of the molecular shadow in the XZ plane and heat of formation of the molecules resulted in a statistically significant model with r(2)=0.962 and cross-validation parameter q(2)=0.917. The validation of the QSAR models was done by cross-validation, leave-25%-out and external test set prediction. The theoretical approach indicates that the increase in the exposed partial negative surface area increases the inhibitory activity of the compound against NorA whereas the area of the molecular shadow in the XZ plane is inversely proportional to the inhibitory activity. This model also explains the relationship of the heat of formation of the compound with the inhibitory activity. The model is not only able to predict the activity of new compounds but also explains the important regions in the molecules in quantitative manner.

1-(1H-indol-3-yl)ethanamine derivatives as potent Staphylococcus aureus NorA efflux pump inhibitors.

Science.gov (United States)

Hequet, Arnaud; Burchak, Olga N; Jeanty, Matthieu; Guinchard, Xavier; Le Pihive, Emmanuelle; Maigre, Laure; Bouhours, Pascale; Schneider, Dominique; Maurin, Max; Paris, Jean-Marc; Denis, Jean-Noël; Jolivalt, Claude

2014-07-01

The synthesis of 37 1-(1H-indol-3-yl)ethanamine derivatives, including 12 new compounds, was achieved through a series of simple and efficient chemical modifications. These indole derivatives displayed modest or no intrinsic anti-staphylococcal activity. By contrast, several of the compounds restored, in a concentration-dependent manner, the antibacterial activity of ciprofloxacin against Staphylococcus aureus strains that were resistant to fluoroquinolones due to overexpression of the NorA efflux pump. Structure-activity relationships studies revealed that the indolic aldonitrones halogenated at position 5 of the indole core were the most efficient inhibitors of the S. aureus NorA efflux pump. Among the compounds, (Z)-N-benzylidene-2-(tert-butoxycarbonylamino)-1-(5-iodo-1H-indol-3-yl)ethanamine oxide led to a fourfold decrease of the ciprofloxacin minimum inhibitory concentration against the SA-1199B strain when used at a concentration of 0.5 mg L(-1) . To the best of our knowledge, this activity is the highest reported to date for an indolic NorA inhibitor. In addition, a new antibacterial compound, tert-butyl (2-(3-hydroxyureido)-2-(1H-indol-3-yl)ethyl)carbamate, which is not toxic for human cells, was also found. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Detecting the Presence of Nora Virus in "Drosophila" Utilizing Single Fly RT-PCR

Science.gov (United States)

Munn, Bethany; Ericson, Brad; Carlson, Darby J.; Carlson, Kimberly A.

2015-01-01

A single fly RT-PCR protocol has recently been developed to detect the presence of the persistent, horizontally transmitted Nora virus in "Drosophila." Wild-caught flies from Ohio were tested for the presence of the virus, with nearly one-fifth testing positive. The investigation presented can serve as an ideal project for biology…

Santiago de Chile y Mendoza, Argentina: La red social que apoyó a exiliados chilenos (1973-1976

Directory of Open Access Journals (Sweden)

Paredes, Alejandro

2007-12-01

Full Text Available The present article describes the social networks that helped those exiled Chileans that arrived at the city Argentina of Mendoza after the overthrow of the socialist Chilean President Salvador Allende in 1973. Between 1973 and 1989, the Chilean community exiled in Mendoza was large. This writing stops in period 1973-1976, because in 1976 a military coup in Argentina deeply changed the social situation of the country, which would justify another article. The used sources are, mainly, letters that belong to the file of the Ecumenical Committee of Social Action, institution that supported the Chileans who received status of Political Refugees by High the Commissioners of the Nations United for Refugees (UNHCR.

Is the societal burden of fatal occupational injury different among NORA industry sectors?

Science.gov (United States)

Biddle, Elyce Anne

2013-02-01

Since the implementation of the Occupational Safety and Health Act, safety and health in the work environment has seen marked improvement. Although these improvements are laudable, workplace hazards continue to plague the American worker. Understanding the economic burden of fatalities by industry sector is important to setting broad occupational safety and health research priorities. Cost estimates provide additional information about how fatal injuries affect society and hence can improve injury prevention program planning, policy analysis, evaluation, and advocacy. This study estimated the total, mean, and median societal costs by worker and case characteristic in 2003-2006 for the industry sectors identified in the National Institute for Occupational Safety and Health National Occupational Research Agenda (NORA). Analyses were conducted with restricted access to the Bureau of Labor Statistics Census of Fatal Occupational Injuries data. These data exclude military personnel, decedents with unknown age or sex, and fatalities occurring in New York City. Societal costs were estimated using the cost-of-illness approach, which combines direct and indirect costs to yield an overall cost of an fatal occupational injury. During this period, the cost of the 22,197 fatal occupational injuries exceeded $21 billion. The mean and median costs of these fatalities were $960,000 and $944,000 respectively. Total societal costs by NORA sector ranged from a high of $5.8 billion in Services to a low of $530 million in Healthcare and Social Assistance with mean costs ranging from the nearly $800,000 in Agriculture, Forestry, and Fishing to almost $1.1 million in Mining. The societal costs-total, mean, and median costs-of case and worker characteristics for occupational fatal injuries varied within each NORA sector. To have the greatest societal impact, these costs can be used to target resources for public and private sector research by industry. Published by Elsevier Ltd.

Is the Societal burden of fatal occupational injury different among NORA industry sectors?

Science.gov (United States)

Biddle, Elyce Anne

2015-01-01

Problem Since the implementation of the Occupational Safety and Health Act, safety and health in the work environment has seen marked improvement. Although these improvements are laudable, workplace hazards continue to plague the American worker. Understanding the economic burden of fatalities by industry sector is important to setting broad occupational safety and health research priorities. Cost estimates provide additional information about how fatal injuries affect society and hence can improve injury prevention program planning, policy analysis, evaluation, and advocacy. Method This study estimated the total, mean, and median societal costs by worker and case characteristic in 2003–2006 for the industry sectors identified in the National Institute for Occupational Safety and Health National Occupational Research Agenda (NORA). Analyses were conducted with restricted access to the Bureau of Labor Statistics Census of Fatal Occupational Injuries data. These data exclude military personnel, decedents with unknown age or sex, and fatalities occurring in New York City. Societal costs were estimated using the cost-of-illness approach, which combines direct and indirect costs to yield an overall cost of an fatal occupational injury. Results During this period, the cost of the 22,197 fatal occupational injuries exceeded $21 billion. The mean and median costs of these fatalities were $960,000 and $944,000 respectively. Total societal costs by NORA sector ranged from a high of $5.8 billion in Services to a low of $530 million in Healthcare and Social Assistance with mean costs ranging from the nearly $800,000 in Agriculture, Forestry, and Fishing to almost $1.1 million in Mining. Discussion The societal costs—total, mean, and median costs—of case and worker characteristics for occupational fatal injuries varied within each NORA sector. Impact on Industry To have the greatest societal impact, these costs can be used to target resources for public and private sector

Inhibition of the NorA efflux pump of Staphylococcus aureus by synthetic riparins.

Science.gov (United States)

Costa, L M; de Macedo, E V; Oliveira, F A A; Ferreira, J H L; Gutierrez, S J C; Peláez, W J; Lima, F C A; de Siqueira Júnior, J P; Coutinho, H D M; Kaatz, G W; de Freitas, R M; Barreto, H M

2016-11-01

The goal of this study was to increase knowledge about the antimicrobial activity of some synthetic Riparin-derived compounds, alone or in combination with fluoroquinolone antibiotics, against a strain of Staphylococcus aureus resistant to fluoroquinolone by way of overexpression of the NorA efflux pump. Microdilution tests showed that Riparins A and B did not show any significant antibacterial activity against Staph. aureus strains. On the other hand, the intrinsic antibacterial activity increased with increasing lipophilicity of the compounds, in the following order: Riparin-D (MIC 256 μg ml -1 ; Log P 2·95) NorA-overexpressing test strain. Riparin-B, which has two methoxyl groups at the phenethyl moiety, showed the best modulatory effect. Riparin-E is a good anti-staphylococci agent, while Riparin-B functions as a NorA efflux pump inhibitor. Our data suggest the possibility of using Riparin-B in combination with norfloxacin or ciprofloxacin for therapy of infections caused by multi-drug resistant Staph. aureus. © 2016 The Society for Applied Microbiology.

MONITORAMENTO DA TEMPERATURA NO INTERIOR DE CHAPAS AGLOMERADAS DURANTE O PROCESSO DE PRENSAGEM

Directory of Open Access Journals (Sweden)

Elio José Santini

2005-03-01

Full Text Available O objetivo do presente trabalho foi analisar o comportamento da temperatura nas faces e no miolo de chapas de partículas aglomeradas, coladas com 8% de adesivo (base peso seco das partículas tanino-formaldeído. As chapas foram produzidas com três repetições por tratamento, com massa específica nominal de 0,7 g/cm³ e pressão específica de prensagem de 27 kgf/cm². Os tratamentos basearam-se na utilização de flocos de pinus (Pinus elliottii e partículas de eucalipto (Eucalytus sp, sendo que os flocos de pinus apresentavam três diferentes comprimentos nominais (40, 75 e 110 mm e duas espessuras (0,5 e 1,0 mm. Também foram analisados duas temperaturas de prensagem (140 e 180°C e dois teores de umidade nominal do colchão (17 e 21%. A temperatura no interior dos painéis durante a prensagem foi obtida por meio de fios para termopares tipo K (cromo-alumel. Os gráficos da temperatura em função do tempo de prensagem mostraram uma rápida elevação da temperatura nos primeiros 100 segundos de prensagem, mantendo-se num plateau possivelmente após atingir a temperatura de ebulição da água. A temperatura voltou a aumentar, de forma mais gradual, após a perda de grande parte da umidade do colchão. Observa-se que colchões formados por flocos de maior espessura apresentaram elevação mais rápida de temperatura no miolo. O principal fator que influenciou na velocidade de elevação da temperatura no miolo dos painéis aglomerados foi o teor de umidade do colchão, sendo que quanto maior o teor de umidade, mais rápida foi a elevação da temperatura.

Algunas hazañas de las muchas de don García Hurtado de Mendoza, comedia genealógica de nueve ingenios

Directory of Open Access Journals (Sweden)

Carlos Mata Induráin

2013-12-01

Full Text Available Algunas hazañas de las muchas de don García Hurtado de Mendoza, marqués de Cañete, pieza escrita en colaboración por nueve ingenios encabezados por Luis de Belmonte Bermúdez, se representó y publicó en Madrid en 1622. Se trata de una comedia genealógica de encargo, que formó parte de la campaña de propaganda emprendida por la familia de los Hurtado de Mendoza para prestigiar la figura de don García Hurtado de Mendoza, cuarto marqués de Cañete, quien como gobernador de Chile (1557-1561 había logrado notables avances en la pacificación del rebelde territorio de Arauco, pero cuyos méritos no quedaron reconocidos por Alonso de Ercilla en La Araucana. Se estudia, sobre todo, la imagen que la pieza ofrece del noble personaje en el contexto de su actuación en la guerra de Arauco, la cual generó en el Siglo de Oro un abundante corpus de obras literarias. Algunas hazañas de las muchas de don García Hurtado de Mendoza, marqués de Cañete, collaborated play by nine playwrights headed by Luis Belmonte Bermúdez, was represented and published in Madrid in 1622. It´s a genealogical comedy, which was part of the propaganda campaign launched and paid by Hurtado de Mendoza’s family, in order to give prestige to the figure of don García Hurtado de Mendoza, 4th Marquis of Cañete, who as Governor of Chile (1557-1561 had achieved remarkable progress in pacifying the rebellious territory of Arauco, but whose merits were not recognized by Alonso de Ercilla in La Araucana. The article studies the image of don García in the context of the Arauco War, which generated a rich corpus of literary works in the Spanish Golden Age. Key words: Spanish Drama of the Golden Age, genealogical comedy, theatre and patronage, García Hurtado de Mendoza, Arauco war, Luis de Belmonte Bermúdez, collaborated comedy.

Chalcone inhibitors of the NorA efflux pump in Staphylococcus aureus whole cells and enriched everted membrane vesicles.

Science.gov (United States)

Holler, Jes Gitz; Slotved, Hans-Christian; Mølgaard, Per; Olsen, Carl Erik; Christensen, Søren Brøgger

2012-07-15

A library of 117 chalcones was screened for efflux pump inhibitory (EPI) activity against NorA mediated ethidium bromide efflux. Five of the chalcones (5-7, 9, and 10) were active and two chalcones (9 and 10) were equipotent to reserpine with IC(50)-values of 9.0 and 7.7 μM, respectively. Twenty chalcones were subsequently proved to be inhibitors of the NorA efflux pump in everted membrane vesicles. Compounds 5, 7, and 9 synergistically increased the effect of ciprofloxacin on Staphylococcus aureus. Our results suggest that chalcones might be developed into drugs for overcoming multidrug resistance based on efflux transporters of microorganisms. Copyright © 2012 Elsevier Ltd. All rights reserved.

A New Natural Product Analog of Blasticidin S Reveals Cellular Uptake Facilitated by the NorA Multidrug Transporter.

Science.gov (United States)

Davison, Jack R; Lohith, Katheryn M; Wang, Xiaoning; Bobyk, Kostyantyn; Mandadapu, Sivakoteswara R; Lee, Su-Lin; Cencic, Regina; Nelson, Justin; Simpkins, Scott; Frank, Karen M; Pelletier, Jerry; Myers, Chad L; Piotrowski, Jeff; Smith, Harold E; Bewley, Carole A

2017-06-01

The permeation of antibiotics through bacterial membranes to their target site is a crucial determinant of drug activity but in many cases remains poorly understood. During screening efforts to discover new broad-spectrum antibiotic compounds from marine sponge samples, we identified a new analog of the peptidyl nucleoside antibiotic blasticidin S that exhibited up to 16-fold-improved potency against a range of laboratory and clinical bacterial strains which we named P10. Whole-genome sequencing of laboratory-evolved strains of Staphylococcus aureus resistant to blasticidin S and P10, combined with genome-wide assessment of the fitness of barcoded Escherichia coli knockout strains in the presence of the antibiotics, revealed that restriction of cellular access was a key feature in the development of resistance to this class of drug. In particular, the gene encoding the well-characterized multidrug efflux pump NorA was found to be mutated in 69% of all S. aureus isolates resistant to blasticidin S or P10. Unexpectedly, resistance was associated with inactivation of norA , suggesting that the NorA transporter facilitates cellular entry of peptidyl nucleosides in addition to its known role in the efflux of diverse compounds, including fluoroquinolone antibiotics. Copyright © 2017 American Society for Microbiology.

PRODUÇÃO DE CHAPAS DE PARTÍCULAS DE MADEIRA DE DUAS ESPÉCIES NATIVAS DA MATA ATLÂNTICA E SUAS COMBINAÇÕES

Directory of Open Access Journals (Sweden)

Edvá Oliveira Brito

2004-05-01

Full Text Available O objetivo deste trabalho foi produzir chapas de partículas "Strand" e maravalhas partindo de Schizolobium parahyba e Erytrina verna e suas combinações. Os parâmetros de manufatura foram: densidade nominal de 0,65 g/cm³, temperatura de prensagem de 180ºC, tempo de prensagem de 14 minutos, resina fenol-formaldeído a 8% e umidade das partículas a 5%. Os melhores resultados para o ensaio de flexão estática foram encontrados quando se utilizou guapuruvu puro e/ou na capa, embora a maioria dos tratamentos tenha apresentado valores superiores aos estabelecidos pela norma canadense (CSA O437-0, 1993. Em relação à ligação interna, 50% dos tratamentos apresentaram valores superiores aos estabelecidos pela norma canadense. Os valores de absorção de água e inchamento em espessura foram considerados altos para todos os tratamentos, devendo-se considerar que não foi utilizado parafina para a confecção das chapas.

Measurements of Void Effects in the Zero-Power Critical Facility NORA; Mesures de l'Effet Cavitaire dans l'Ensemble Critique NORA de Puissance Zero; Izmerenie vliyaniya pustot v kriticheskoj ustanovke nulevoj moshchnosti NORA; DeterminaciOn de los Efectos de CavitaciOn en el Conjunto Critico NORA de Potencia Nula

Energy Technology Data Exchange (ETDEWEB)

Bryhn-Ingebrigtsen, K.; Eriksen, V. O.; Schatvet, J.; Ukkestad, A.; Wood, J. I.; Ofjord, K. [Kjeller Research Establishment (Norway)

1964-02-15

Reactivity effects of voids in a reactor core is of particular importance in boiling-water reactors. Non-uniform distributions of voids make it desirable to know and understand the spatial dependence of the void reactivity effect. An experimental study of void effects under physically clean conditions has been undertaken in NORA. Shrouds surrounding each individual fuel stringer define annular regions which are voided by introduction of air under pressure. For single-rod experiments reactivity effects are so small that it is preferable to oscillate the void volume periodically and analyse the corresponding modulation of power to obtain reactivity equivalents. Multiple-rod experiments are done statically. The experimental technique is described together with examples of its use to measure single-rod void effects, voided rod interactions, and full-voided core effects. (author) [French] L'effet cavitaire revet une importance particuliere dans les reacteurs a eau bouillante. Etant donne que les cavites ne sont pas uniformement reparties, il est souhaitable de connaitre et de comprendre les variations de l'effet cavitaire dans l'espace. L'etude experimentale de l'effet cavitaire dans un ensemble non empoisonne a ete entreprise dans l'ensemble critique NORA. Dans les regions tubulaires comprises entre les barres de combustible et leurs enveloppes, on cree des cavites par injection d'air comprime. Dans les experiences portant sur une seule barre, l'effet est si faible qu'il vaut mieux faire varier periodiquement le volume cavitaire et analyser la modulation de puissance correspondante pour mesurer la reactivite equivalente. Les experiences sur plusieurs barres sont faites dans des conditions statiques. Les auteurs decrivent la methode experimentale et donnent des exemples de son emploi pour mesurer l'effet cavitaire pour une seule barre, l'interaction de battes autour desquelles on a cree des cavites et l'effet des cavites creees dans tout le coeur. (author) [Spanish] La

Centralización de la represión, violencia paraestatal y redes internacionales represivas en la Mendoza predictatorial

Directory of Open Access Journals (Sweden)

Laura Rodriguez Aguero

2014-04-01

Full Text Available Durante el tercer gobierno peronista (1973-1976 comenzó a montarse el dispositivo represivo que marcó los prolegómenos del Terrorismo de Estado llevado adelante por la dictadura militar de 1976. En Mendoza, la violencia paraestatal fue llevada a cabo por el CAM (Comando Anticomunista Mendoza, y el Comando Moralizador Pío XII. En este trabajo nos proponemos realizar a partir del uso de fuentes escritas y del testimonio de algunos/as sobrevivientes, una reconstrucción del accionar paraestatal, en vistas a analizar, por un lado, cómo se constituyeron en la dinámica local, las redes de relaciones implicadas en la práctica represiva y la inflexión que implicó noviembre de 1975 en la centralización de la represión; y por otro lado, cómo se manifestó el carácter internacional de la represión y la idea de aniquilación del “enemigo interno” en Mendoza, partiendo de la hipótesis de que la misma adquirió proporciones inusitadas debido a su carácter de provincia de frontera y su cercanía con Chile, en un momento de articulación de redes represivas en el Cono Sur.

Optimized efflux assay for the NorA multidrug efflux pump in Staphylococcus aureus.

Science.gov (United States)

Zimmermann, Saskia; Tuchscherr, Lorena; Rödel, Jürgen; Löffler, Bettina; Bohnert, Jürgen A

2017-11-01

Real-time fluorescent efflux assays are commonly used for measuring the efflux of bacterial pumps. Here we describe an optimized protocol for the NorA efflux pump in S. aureus using DiOC 3 instead of ethidium bromide. Glucose and sodium formate were tested as energy carriers. This novel method is fast and reproducible. Copyright © 2017 Elsevier B.V. All rights reserved.

C2 Arylated Benzo[b]thiophene Derivatives as Staphylococcus aureus NorA Efflux Pump Inhibitors.

Science.gov (United States)

Liger, François; Bouhours, Pascale; Ganem-Elbaz, Carine; Jolivalt, Claude; Pellet-Rostaing, Stéphane; Popowycz, Florence; Paris, Jean-Marc; Lemaire, Marc

2016-02-04

An innovative and straightforward synthesis of second-generation 2-arylbenzo[b]thiophenes as structural analogues of INF55 and the first generation of our laboratory-made molecules was developed. The synthesis of C2-arylated benzo[b]thiophene derivatives was achieved through a method involving direct arylation, followed by simple structural modifications. Among the 34 compounds tested, two of them were potent NorA pump inhibitors, which led to a 16-fold decrease in the ciprofloxacin minimum inhibitory concentration (MIC) against the SA-1199B strain at concentrations of 0.25 and 0.5 μg mL(-1) (1 and 1.5 μm, respectively). This is a promising result relative to that obtained for reserpine (MIC=20 μg mL(-1)), a reference compound amongst NorA pump inhibitors. These molecules thus represent promising candidates to be used in combination with ciprofloxacin against fluoroquinolone-resistant strains. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Desarrollo poblacional de Diaspidiotus perniciosus (Hemiptera: Diaspididae en cultivos de manzano de San Carlos, Mendoza, Argentina Population development of Diaspidiotus perniciosus (Hemiptera: Diaspididae in apple orchards in San Carlos, Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Guillermo P. Lopez Garcia

2011-12-01

Full Text Available Se estudió la bionomía de Diaspidiotus perniciosus Comstock ("escama de San José", en manzanos de la variedad "Red delicious" de San Carlos, Mendoza, Argentina, durante los ciclos productivos 2007-2008 y 2008-2009. Se determinó el número de generaciones anuales y se estudiaron las fluctuaciones poblacionales asociadas a la integral térmica para la especie en esta región. D. perniciosus presenta dos generaciones superpuestas al ciclo del cultivo, mientras que las ninfas (N1 y N2 de la tercera generación se desarrollan solamente hasta el final de la temporada estival y pasan al estado de quiescencia, en el que permanecen durante el invierno. El desarrollo de D. perniciosus en esta zona coincide con el de esta especie en la zona frutícola del centro de Chile en cuanto al número de generaciones y al periodo de quiescencia invernal. La población quiescente en Chile está integrada predominantemente por ninfas del primer estadio (N1, mientras que en San Carlos, Mendoza, la población quiescente está integrada principalmente por ninfas del segundo estadio (N2. La similitudes entre ambas poblaciones se deben, probablemente, a las coincidencias en latitud, clima y especie hospedera. El impacto económico de D. perniciosus en la zona de estudio tiene mayor relevancia durante los meses de diciembre y enero, cuando se observa una alta incidencia de daños en los frutos y las hojas; este es el momento decisivo para implementar medidas de control fitosanitario. Estas deberán aplicarse en función de los máximos poblacionales de N1 que se producen con 600-650 Grados-Día (ºD en diciembre y con 1.170-1.270ºD en enero. En las temporadas en las que la densidad poblacional de la plaga es especialmente alta, podrían incorporarse medidas adicionales de control con 1.800-2.000ºD durante el mes de abril. Los resultados de estos estudios representan una herramienta predictiva, que permitirá elaborar estrategias para el control de poblaciones de D

Propriedades de chapas de aglomerado confeccionadas com misturas de partículas de Eucalyptus spp e Pinus elliottii Properties of particleboards manufactured with mixed particles from Eucalyptus spp and Pinus elliottii

Directory of Open Access Journals (Sweden)

Carla Priscilla Cabral

2007-10-01

Full Text Available Este trabalho teve como objetivo determinar as propriedades de chapas de madeira aglomerada confeccionadas com partículas geradas de maravalhas e flocos de Eucalyptus grandis, E. urophylla e E. cloeziana. Quando necessário, para manter a massa específica das chapas em 0,70 g/cm³ foram adicionadas partículas de Pinus elliottii. Os eucaliptos foram obtidos nos Municípios de Ponte Alta (Região do Vale do Rio Doce e Três Marias (Região de Cerrado, em Minas Gerais. As densidades básicas das espécies procedentes do Município de Ponte Alta foram iguais a 0,55; 0,61; e 0,70 g/cm³, enquanto aquelas procedentes do Município de Três Marias foram iguais a 0,56; 0,58; e 0,69 g/cm³, respectivamente. A densidade do Pinus elliottii, cultivado no Município de Viçosa, foi de 0,45 g/cm³. As partículas para a confecção das chapas foram obtidas pelo processamento de flocos (0,48 x 20 x 90 mm e maravalhas, em moinho de martelo, e selecionadas com peneiras manuais. Os coeficientes de esbeltez dessas partículas foram iguais a 19,87 e 4,66, respectivamente. Utilizou-se adesivo de uréia-formaldeído na proporção de 8% em relação à massa seca de madeira. As chapas confeccionadas com partículas processadas de flocos e contendo maior quantidade de madeira de eucalipto apresentaram maior adsorção de água, inchamento e expansão linear. Os maiores valores de dureza Janka e compressão paralela foram observados nas chapas confeccionadas com partículas processadas de maravalhas. Os valores médios de tração perpendicular, módulo de ruptura e módulo de elasticidade foram maiores nas chapas confeccionadas com partículas de flocos processados. As chapas confeccionadas com madeiras da Região de Três Marias apresentaram maiores resistências à compressão paralela, tração perpendicular e módulo de ruptura.This work aimed to evaluate properties of particleboards manufactured with particles derived from planner shavings and flakes of

76 FR 51934 - Determination of Pest-Free Areas in Mendoza Province, Argentina; Request for Comments

Science.gov (United States)

2011-08-19

... acknowledged Argentina's history of successful Medfly control efforts, but stated that APHIS should not relax...] Determination of Pest-Free Areas in Mendoza Province, Argentina; Request for Comments AGENCY: Animal and Plant... received a request from the Government of Argentina to recognize additional areas as pest- free areas for...

Re-evolution of the 2-phenylquinolines: ligand-based design, synthesis, and biological evaluation of a potent new class of Staphylococcus aureus NorA efflux pump inhibitors to combat antimicrobial resistance.

Science.gov (United States)

Sabatini, Stefano; Gosetto, Francesca; Iraci, Nunzio; Barreca, Maria Letizia; Massari, Serena; Sancineto, Luca; Manfroni, Giuseppe; Tabarrini, Oriana; Dimovska, Mirjana; Kaatz, Glenn W; Cecchetti, Violetta

2013-06-27

Overexpression of efflux pumps is an important mechanism by which bacteria evade the effects of antimicrobial agents that are substrates. NorA is a Staphylococcus aureus efflux pump that confers reduced susceptibility to many structurally unrelated agents, including fluoroquinolones, biocides, and dyes, resulting in a multidrug resistant (MDR) phenotype. In this work, a series of 2-phenylquinoline derivatives was designed by means of ligand-based pharmacophore modeling in an attempt to identify improved S. aureus NorA efflux pump inhibitors (EPIs). Most of the 2-phenylquinoline derivatives displayed potent EPI activity against the norA overexpressing strain SA-1199B. The antibacterial activity of ciprofloxacin, when used in combination with some of the synthesized compounds, was completely restored in SA-1199B and SA-K2378, a strain overexpressing norA from a multicopy plasmid. Compounds 3m and 3q also showed potent synergistic activity with the ethidium bromide dye in a strain overexpressing the MepA MDR efflux pump.

Tendencias tribológicas actuales en el conformado de la chapa metálica. // Current tribological tendencies in conformed metallic foil.

Directory of Open Access Journals (Sweden)

L. A. Valdivia Pérez

2005-01-01

Full Text Available Muchos de los esfuerzos orientados a mejorar u optimizar los procesos de conformado de chapa metálica en la actualidad,están dirigidos a reducir o eliminar totalmente la lubricación. Esta tendencia se fundamenta en el conocimiento de losfenómenos tribológicos que ocurren en las zonas de contacto herramienta-pieza. También las exigencias ecológicas actualeshan obligado a la industria moderna a estudiar las vías para minimizar los impactos negativos de los lubricantes hacia elmedio y la conformación de la chapa en frío no ha escapado a este análisis. Los residuos de lubricantes provenientes de losdistintos procesos tecnológicos para la fabricación de piezas por esta vía, son potencialmente peligrosos al entorno por sucompleja composición química.El presente estudio analiza el estado del arte relativo a la caracterización de los fenómenos tribológicos en las operacionesde conformado con una visión optimista hacia el futuro donde la lubricación y su impacto ambiental debe y puede serreducido.Palabras claves: Chapa metálica, conformado seco, embutición, lubricación, medio ambiente, rozamiento,fricción, desgaste.___________________________________________________________________________Abstract.Many of the oriented efforts to improve or to optimize the sheet metal forming processes at the present time are directed toreduce or to eliminate totally the lubrication. This tendency is based in the knowledge of the tribologics phenomenas thathappen in the tool-piece contact zones. The current ecological demands have also forced the modern industry to study theprocesses to minimize the negative impacts of lubricants toward the environment and the cold sheet metal formingprocesses has not escaped to this analysis. The residuals of lubricant coming of the different technological processes forthe production of pieces by this way are potentially dangerous to the environment for their complex chemical composition.The present study

75 FR 36347 - Determination of Pest-Free Areas in Mendoza Province, Argentina; Request for Comments

Science.gov (United States)

2010-06-25

...] Determination of Pest-Free Areas in Mendoza Province, Argentina; Request for Comments AGENCY: Animal and Plant... received a request from the Government of Argentina to recognize additional areas as pest- free areas for... determined that these areas meet the criteria in our regulations for recognition as pest-free areas. We are...

Studies on 2-phenylquinoline Staphylococcus aureus NorA efflux pump inhibitors: New insights on the C-6 position.

Science.gov (United States)

Felicetti, Tommaso; Cannalire, Rolando; Nizi, Maria Giulia; Tabarrini, Oriana; Massari, Serena; Barreca, Maria Letizia; Manfroni, Giuseppe; Schindler, Bryan D; Cecchetti, Violetta; Kaatz, Glenn W; Sabatini, Stefano

2018-06-06

The alarming and rapid spread of antimicrobial resistance among bacteria represents a high risk for global health. Targeting factors involved in resistance to restore the activity of failing antibiotics is a promising strategy to overcome this urgent medical need. Efflux pump inhibitors are able to increase antibiotic concentrations in bacteria, thus they can be considered true antimicrobial resistance breakers. In this work, continuing our studies on inhibitors of the Staphylococcus aureus NorA pump, we designed, synthesized and biologically evaluated novel 2-phenylquinoline derivatives starting from our hits 1 and 2. Two of the synthesized compounds (6 and 7) bearing a C-6 benzyloxy group showed the best NorA inhibition activity, thereby providing an excellent starting point to direct future chemical optimizations. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

Evolution from a natural flavones nucleus to obtain 2-(4-Propoxyphenyl)quinoline derivatives as potent inhibitors of the S. aureus NorA efflux pump.

Science.gov (United States)

Sabatini, Stefano; Gosetto, Francesca; Manfroni, Giuseppe; Tabarrini, Oriana; Kaatz, Glenn W; Patel, Diixa; Cecchetti, Violetta

2011-08-25

Overexpression of efflux pumps is an important mechanism by which bacteria evade the effects of substrate antimicrobial agents. Inhibition of such pumps is a promising strategy to circumvent this resistance mechanism. NorA is a Staphylococcus aureus efflux pump that confers reduced susceptibility to many structurally unrelated agents, including fluoroquinolones, resulting in a multidrug resistant phenotype. In this work, a series of 2-phenyl-4(1H)-quinolone and 2-phenyl-4-hydroxyquinoline derivatives, obtained by modifying the flavone nucleus of known efflux pump inhibitors (EPIs), were synthesized in an effort to identify more potent S. aureus NorA EPIs. The 2-phenyl-4-hydroxyquinoline derivatives 28f and 29f display potent EPI activity against SA-1199B, a strain that overexpresses norA, in an ethidium bromide efflux inhibition assay. The same compounds, in combination with ciprofloxacin, were able to completely restore its antibacterial activity against both S. aureus SA-K2378 and SA-1199B, norA-overexpressing strains. © 2011 American Chemical Society

Doña Mencía de Mendoza y su residencia en el Palacio del Real en Valencia

Directory of Open Access Journals (Sweden)

Hidalgo Ogáyar, Juana

2011-03-01

Full Text Available Documents preserved in the Archivo del Palau reveal the furnishings that Mencía de Mendoza had in the Royal Palace at Valencia, particularly luxury beds such as those of the Empress Isabel of Portugal and Queen Mary of France. Painters active at her court, especially Juan de Bolaños, are also discussed.

Con la ayuda de varios documentos conservados en el Archivo del Palau, se dan a conocer diferentes enseres que Doña Mencía de Mendoza tenía en el Palacio del Real en Valencia, destacando camas de lujo como la de la Emperatriz Isabel de Portugal o la de María de Francia. Se dan a conocer algunos pintores activos en su corte como Juan de Bolaños.

Rescatando retazos de la memoria docente: la primera asociación de maestros de Mendoza, 1904-1914. Recovering fragments of teaching memory: first association of teachers in Mendoza, 1904-1914.

Directory of Open Access Journals (Sweden)

Patricia I. Dussel

2014-12-01

Full Text Available (ES El propósito de esta contribución consiste en examinar los orígenes de las primeras organiza-ciones de maestras/os de Mendoza -Argentina, surgidas a fines del siglo XIX y principios del XX. El trabajo comienza con una contextualización política y pedagógica, nacional y provincial para ubicar el escenario en el cual se insertan estas asociaciones, ligadas tanto a corrientes peda-gógicas, como líneas políticas vigentes. Finalmente se analizan las características que las definen y que serán claves en el proceso del desarrollo de las organizaciones docentes de la provincia en la primera mitad del siglo XX. (EN The purpose of this contribution is to examine the origins of the first organizations of teachers in Mendoza Argentina, which emerged in the late nineteenth and early twentieth century. The work begins with a political and pedagogical, national and provincial contextualization to locate the setting in which these associations were inserted, linked both to pedagogical trends and current policies. The author finally analyzed the characteristics that define them and that will be key in the development process of educational organizations in the province in the first half of the twen-tieth century.

Documentos arcebispais no Tombo H da catedral de Santiago: Gómez Manrique e Lopo de Mendoza

Directory of Open Access Journals (Sweden)

Cabana Outeiro, Alexandra

2003-12-01

Full Text Available The cartulary H of Santiago de Compostela's Cathedral -register book compiled by notary Afonso Eanes Jacob-contains documents of the chapter of Compostela dated 1391 to 1409 and includes copies of earlier documents. In this paper, the edition of five documents issued by archbishops Gómez Manrique (1351-1362 and Lope de Mendoza (1399- 1445 and contained in this book is proposed. An introductory note is also included.

[gl] No Tombo H da Catedral de Santiago de Compostela, libro rexistro elaborado polo notario Afonso Eanes Jacob, recógese documentación do cabido compostelán entre os anos 1391 e 1409, incluíndo tamén traslados de documentos anteriores. Neste artigo faise unha edición de cinco documentos emitidos polos arcebispos Gómez Manrique (1351-1362 e Lope de Mendoza (1399-1445, que se insiren neste libro, achegándose tamén unha nota introductoria.

Nora Virus Transmission in "Drosophila Melanogaster": An Investigation to Teach Viral Infection and Prophylaxis to Biology Students

Science.gov (United States)

Weatherred, Wayland; Carlson, Darby J.; Carlson, Kimberly A.

2014-01-01

Proper hand hygiene accompanied with environmental surface disinfection provides a comprehensive approach to control and prevent respiratory and gastrointestinal illness in schools, hospitals, work environments, and the home. The persistent non-pathogenic Nora virus common in "Drosophila melanogaster" provides a horizontally transmitted…

Vida y muerte de doña Melchora Lemos, empresaria vitivinícola y terciaria de la Orden de Predicadores (Mendoza, Reino de Chile, 1691-1741

Directory of Open Access Journals (Sweden)

Lacoste, Pablo

2006-08-01

Full Text Available This paper studies the life and death of doña Melchora Lemos, «pulpera», miller and wine maker in Mendoza, in Chile’s Kingdom. She was the only woman who owned a «pulperia» in the province; she built the only mill of the city; and she leaded one of better winery of Mendoza. Her life and death developed under catholic church influence. The sources of the paper are unpublished documents taken from the historical Archives in Mendoza (Argentine and Santiago (Chile.

El artículo examina la historia de vida y muerte de doña Melchora Lemos, singular empresaria del siglo XVIII. Ella era la única mujer que poseía una pulpería; levantó el entonces único molino harinero de la ciudad; y administró la bodega más moderna de la región desde el punto de vista de la tecnología. Estos hechos se produjeron en el contexto de una intensa vida religiosa como terciaria de la orden de Santo Domingo. El estudio se ha realizado a través de fuentes originales inéditas del Archivo Nacional de Chile y el Archivo Histórico de Mendoza.

Petrografic description of some igneous rocks from the Cordillera of South Mendoza, in the Argentine

NARCIS (Netherlands)

Kuenen, Ph.H.

1926-01-01

Comparatively little is yet known of the intricate igneous history of the Cordillera of South Mendoza. Almost all the knowledge we have is due to the field- and stratigraphical work of Dr. H. Gerth of Leiden (bibl. 1 and 2), and the petrographic studies of Dr. H. G. Backlund (bibl. 3 and 4) on the

Paleozoogeography of the Wine Mouse (Akodon oenos & Late Holocene Paleoenvironments in South-Central Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Fernando Julián Fernández

2011-02-01

Full Text Available Cranial remains of the wine mouse (Akodon oenos are documented from an archaeological site in south-central Mendoza, Argentina (Agua de La Mula, 35º22' S, 68º15' W, which dates to the end of the late Holocene (1610 ± 60; 1260 ± 60; 1000 ± 50 C14 yr B.P.. The taxonomic status of this small rodent is currently being assessed, but these remains represent the first fossil record for the morphotaxon A. oenos. The species’ present distribution is restricted to a few records from Mendoza province. Analysis of the remains supports paleoenvironmental reconstruction using the small mammal assemblage recovered from this site. From the late Holocene into modernity temperature decreased and winter precipitation increased, resulting in advance of Patagonian steppe grading with altitude into Monte desert. Holocene climatic conditions may explain the relatively late human occupation of ecologically marginal environments in this region, which probably favored effective human occupation of the Payunia region at sites such as Agua de La Mula between 1600 and 1000 years B.P.

Phenolic characterisation of red wines from different grape varieties cultivated in Mendoza province (Argentina).

Science.gov (United States)

Fanzone, Martín; Zamora, Fernando; Jofré, Viviana; Assof, Mariela; Gómez-Cordovés, Carmen; Peña-Neira, Álvaro

2012-02-01

Knowledge of the chemical composition of wine and its association with the grape variety/cultivar is of paramount importance in oenology and a necessary tool for marketing. Phenolic compounds are very important quality parameters of wines because of their impact on colour, taste and health properties. The aim of the present work was to study and describe the non-flavonoid and flavonoid composition of wines from the principal red grape varieties cultivated in Mendoza (Argentina). Sixty phenolic compounds, including phenolic acids/derivatives, stilbenes, anthocyanins, flavanols, flavonols and dihydroflavonols, were identified and quantified using high-performance liquid chromatography with diode array detection coupled with electrospray ionisation mass spectrometry (HPLC-DAD/ESI-MS). Marked quantitative differences could be seen in the phenolic profile among varieties, especially in stilbenes, acylated anthocyanins and other flavonoids. The polyphenolic content of Malbec wines was higher compared with the other red varieties. Dihydroflavonols represent a significant finding from the chemotaxonomic point of view, especially for Malbec variety. This is the first report on the individual phenolic composition of red wines from Mendoza (Argentina) and suggests that anthocyanins, flavanols and phenolic acids exert a great influence on cultivar-based differentiation. Copyright © 2011 Society of Chemical Industry.

Searching for Novel Inhibitors of the S. aureus NorA Efflux Pump: Synthesis and Biological Evaluation of the 3-Phenyl-1,4-benzothiazine Analogues.

Science.gov (United States)

Felicetti, Tommaso; Cannalire, Rolando; Burali, Maria Sole; Massari, Serena; Manfroni, Giuseppe; Barreca, Maria Letizia; Tabarrini, Oriana; Schindler, Bryan D; Sabatini, Stefano; Kaatz, Glenn W; Cecchetti, Violetta

2017-08-22

Bacterial resistance to antimicrobial agents has become an increasingly serious health problem in recent years. Among the strategies by which resistance can be achieved, overexpression of efflux pumps such as NorA of Staphylococcus aureus leads to a sub-lethal concentration of the antibacterial agent at the active site that in turn may predispose the organism to the development of high-level target-based resistance. With an aim to improve both the chemical stability and potency of our previously reported 3-phenyl-1,4-benzothiazine NorA inhibitors, we replaced the benzothiazine core with different nuclei. None of the new synthesized compounds showed any appreciable intrinsic antibacterial activity, and, in particular, 2-(3,4-dimethoxyphenyl)quinoline (6 c) was able to decrease, in a concentration-dependent manner, the ciprofloxacin MIC against the norA-overexpressing strains S. aureus SA-K2378 (norA++) and SA-1199B (norA+/A116E GrlA). © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Enriquecimiento en Si mediante PVD de chapas magnéticas convencionales para aplicaciones a altas frecuencias

Directory of Open Access Journals (Sweden)

Molina Aldareguía, J.

2000-06-01

Full Text Available The present work deals with the viability of a method for Si enrichment of conventional Fe-3%Si sheets, by means of physical vapour deposition of Si at its surface and subsequent diffusion heating. The aim is to obtain magnetic sheets with a Si content of 6.5wt%, for they show higher resistivity and null magnetostriction, leading to lower energy losses and solving the noise problems at high frequencies. The PVD deposited films, with ~5 μm thickness, show good adhesion to the substrate. Concerning the heat treatment, there is a critical heating rate between 5 and 15°/min, above which delamination of the film is observed without formation of intermetallics at the interface. At 3°/min the conditions for the formation of intermetallics are given. Direct heating up to 800°C leads to the formation of a Fe3Si(α1 surface layer, which, being brittle, does not delaminate during the heating process. Subsequent heating up to temperatures around 1200°C allows the homogenisation of the sheet composition. There is evidence of Kirkendall effect in the diffusion couple Fe3Si(α1/Fe(α, due to the fact that the diffusion of Fe in Fe3Si(α1 is faster than the diffusion of Si in Fe(α.

El presente trabajo estudia la viabilidad de un método para enriquecer en Si chapas de Fe-3%Si convencionales, depositando Si en su superficie mediante PVD y sometiéndolas a un tratamiento térmico de difusión. Se trata de obtener chapas magnéticas con un contenido en Si de un 6,5% en peso, ya que éstas presentan mayor resistividad y magnetoestricción nula, reduciendo las pérdidas y solucionando los problemas de ruido a altas frecuencias. Las capas depositadas por PVD, de espesores ~5 μm, presentan buena adherencia al substrato. En cuanto al tratamiento térmico, se observa que hay una velocidad de calentamiento crítica entre 5 y 15°/min, por encima de la cual la película se despega sin llegarse a formar intermetálicos en la intercara. A 3°/min se dan las

First identification of boronic species as novel potential inhibitors of the Staphylococcus aureus NorA efflux pump.

Science.gov (United States)

Fontaine, Fanny; Hequet, Arnaud; Voisin-Chiret, Anne-Sophie; Bouillon, Alexandre; Lesnard, Aurélien; Cresteil, Thierry; Jolivalt, Claude; Rault, Sylvain

2014-03-27

Overexpression of efflux pumps is an important mechanism of bacterial resistance that results in the extrusion of antimicrobial agents outside the bacterial cell. Inhibition of such pumps appears to be a promising strategy that could restore the potency of existing antibiotics. The NorA efflux pump of Staphylococcus aureus confers resistance to a wide range of unrelated substrates, such as hydrophilic fluoroquinolones, leading to a multidrug-resistance phenotype. In this work, approximately 150 heterocyclic boronic species were evaluated for their activity against susceptible and resistant strains of S. aureus. Twenty-four hit compounds, although inactive when tested alone, were found to potentiate ciprofloxacin activity by a 4-fold increase at concentrations ranging from 0.5 to 8 μg/mL against S. aureus 1199B, which overexpresses NorA. Boron-free analogues showed no biological activity, thus revealing that the boron atom is crucial for biological activity. This work describes the first reported efflux pump inhibitory activity of boronic acid derivatives.

The Elusive Search for Nora Luca: Tony Gatlif's Adventures in Gypsy Land

OpenAIRE

Sylvie Eve Blum-Reid

2005-01-01

This essay examines Gypsy filmmaker Tony Gatlif and his 1997 film Gadjo Dilo (The Crazy Foreigner). The film ventures on the icy roads of Romania and casts a young French man in search for Nora Luca’s voice, a woman taped by his musicologist father. The young man is adopted by a Romanian Gypsy community and initiated to Gypsy culture. The film reverts stereotypes associated to Gypsies and questions the place of the white traveler in late 20th century Europe. Questions of otherness and exotici...

Evaluation and design of the uranium project “Tigre I – La Terraza”, Sierra Pintada, Mendoza, Argentina

International Nuclear Information System (INIS)

Mansilla, M.; Dieguez, S.

2014-01-01

The Sierra Pintada uranium district in Mendoza Province, Argentina, was discovered by airborne survey. This deposit is associated with a volcanic caldera and occurs in the Lower Permian volcaniclastic sediments of the Cochico Group, in which aeolian and fluvial sandstones, inter-bedded with ignimbrites, were reworked by pyroclastic flows. The origin of the mineralization is interpreted as a product of the leaching of the inter-bedded rhyolitic tuff. The mineralization is lenticular and nearly concordant with the bedding. The deposit has been affected by a complex fault system, which is responsible for mineralization and disposition via spatial displacement. The primary uranium minerals are uraninite, brannerite and coffinite. Uranophane and low liebigite uranium are the products of the oxidative alteration of primary minerals. This study involves the technical and economical evaluation of the open pit uranium mining project Tigre I – La Terraza in Mendoza, Argentina, at prefeasibility level. Its development includes geological modeling through economic evaluation, and the incorporation of different mining-specific software.

Machine learning-, rule- and pharmacophore-based classification on the inhibition of P-glycoprotein and NorA.

Science.gov (United States)

Ngo, T-D; Tran, T-D; Le, M-T; Thai, K-M

2016-09-01

The efflux pumps P-glycoprotein (P-gp) in humans and NorA in Staphylococcus aureus are of great interest for medicinal chemists because of their important roles in multidrug resistance (MDR). The high polyspecificity as well as the unavailability of high-resolution X-ray crystal structures of these transmembrane proteins lead us to combining ligand-based approaches, which in the case of this study were machine learning, perceptual mapping and pharmacophore modelling. For P-gp inhibitory activity, individual models were developed using different machine learning algorithms and subsequently combined into an ensemble model which showed a good discrimination between inhibitors and noninhibitors (acctrain-diverse = 84%; accinternal-test = 92% and accexternal-test = 100%). For ligand promiscuity between P-gp and NorA, perceptual maps and pharmacophore models were generated for the detection of rules and features. Based on these in silico tools, hit compounds for reversing MDR were discovered from the in-house and DrugBank databases through virtual screening in an attempt to restore drug sensitivity in cancer cells and bacteria.

Produção de chapas de partículas de madeira de duas espécies nativas da Mata Atlântica e suas combinações.

Directory of Open Access Journals (Sweden)

Graziela Baptista Vidaurre

2010-08-01

Full Text Available O objetivo deste trabalho foi produzir chapas de partículas "Strand" e maravalhas partindo de Schizolobium parahyba e Erytrina verna e suas combinações. Os parâmetros de manufatura foram: densidade nominal de 0,65 g/cm³, temperatura de prensagem de 180ºC, tempo de prensagem de 14 minutos, resina fenol-formaldeído a 8% e umidade das partículas a 5%. Os melhores resultados para o ensaio de flexão estática foram encontrados quando se utilizou guapuruvu puro e/ou na capa, embora a maioria dos tratamentos tenha apresentado valores superiores aos estabelecidos pela norma canadense (CSA O437-0, 1993. Em relação à ligação interna, 50% dos tratamentos apresentaram valores superiores aos estabelecidos pela norma canadense. Os valores de absorção de água e inchamento em espessura foram considerados altos para todos os tratamentos, devendo-se considerar que não foi utilizado parafina para a confecção das chapas.

The use of massive SIT for the control of the Medfly, Ceratitis capitata (Wied.), strain SEIB 6-96, in Mendoza, Argentina

International Nuclear Information System (INIS)

Longo, Oscar de; Colombo, Anibal; Gomez-Riera, Pablo; Bartolucci, Andrea

2000-01-01

The increasing demand for fresh fruits has led to the development of new techniques in farming and in harvest and postharvest areas. Special care has been taken to ensure that the use of pesticides reconciles pest control with a low impact on the environment and human health. The presence of pests of economic importance, among them, the Medfly (Ceratitis capitata Weid.), led to the search for alternative techniques of control. The Medfly was first recorded in the United States in 1901, and in Argentina in 1934. The use of the sterile insect technique (SIT) began to develop around 1950. Improvement in the technique has produced promising results world-wide, especially in the breeding of sexing strains, which allows the release of sterile males only. The National Service of Agrifood Quality and Protection (SENASA) of Argentina, coordinates the National Program of Control and Eradication of Fruit Flies (PROCEM). PROCEM has divided Argentina into five different regions. This is according to quarantine regulations, and control and eradication activities to be undertaken. Actually, the Mendoza and San Juan provinces, and the Patagonia Region, have adhered to PROCEM. They have ongoing regional programmes in their respective areas. Mendoza and the Central Valleys of San Juan (Tulum, Ullum and Zonda) are included in the New Cuyo Region, Phase I, where the main objectives are: eradication of the Medfly; verification of the quarantine status; creation of a Medfly free area and exports to Medfly free markets. SIT is the main technique used in Mendoza for Medfly eradication. The Institute of Quality and Protection of Mendoza (ISCAMen) is in charge of the programme in the Province of Mendoza. Mendoza policies for Medfly eradication and the use of SIT, are based on: a growing area of 290,000 ha of vegetable and fruits (vineyards, stone, pome and nut orchards) of high quality, with favourable agroecological conditions and geographical isolation, exports of fresh fruits for the

Urban mobility regulation in metropolitan area of Mendoza

Directory of Open Access Journals (Sweden)

Lía Martínez

2016-11-01

Full Text Available Achieving the paradigm of sustainable urban mobility requires institutional capacities, appropriate policies and a regulatory framework that contains them. This work aims to contribute to the knowledge of the regulation of urban mobility in the metropolitan area of Mendoza. To this end, the current mobility regulations are assessed through indicators that are classified into three key areas: institutional and political organization, urban system and financial setup. The purpose is to account for the existence, or not, of regulatory capacities contained in the paradigm of sustainable mobility. Among the results, the absence of a policy of sustainable urban mobility is noteworthy, as well as the lack of sectorial coordination. Also of note is the absence of coordination between the urban planning system and the public transport provision. Lastly, in the financial sector, the results point to a promotion of sustainable transport modes but without such an explicit purpose.

CONCEITOS E ENFOQUES DOMINANTES NA GESTÃO HÍDRICA DO OASIS NORTE DA PROVÍNCIA DE MENDOZA - ARGENTINA

Directory of Open Access Journals (Sweden)

Virgínia Grosso

2012-08-01

Full Text Available Mendoza, província árida do centro-oeste da República Argentina, viveu nos últimos tempos o aprofundamento do debate sobre a problemática da escassez de água. Este trabalho tem por objetivo aproximar-se das respostas às seguintes perguntas: quais fatores construíram e contróem a denominada escassez hídrica na província? Eles se apresentam de maneira homogênea em todo o território de Mendonça? Para abordá-las, inicialmente se analisam e correlacionam os aportes teóricos da nova economia e cultura da água e da teoria população-recursos em torno da noção de escassez. Em segundo lugar, se identificaram as problemáticas hídricas (de apropriação, gestão e uso que se observam ao longo da bacia do rio Mendoza.

Review of Arciaga, Juárez y Mendoza (Coords. (2013. Introducción a la Psicología Social

Directory of Open Access Journals (Sweden)

Ali Lara

2014-11-01

Full Text Available Reseña del libro: Salvador Arciaga Bernal, Juana Juárez Romero y Jorge Mendoza Garcia  (coord. (2013. Introducción a la Psicología Social. México: UAM-MAPorrúa. ISBN 978-607-28-0109-7

The "racemic approach" in the evaluation of the enantiomeric NorA efflux pump inhibition activity of 2-phenylquinoline derivatives.

Science.gov (United States)

Carotti, Andrea; Ianni, Federica; Sabatini, Stefano; Di Michele, Alessandro; Sardella, Roccaldo; Kaatz, Glenn W; Lindner, Wolfgang; Cecchetti, Violetta; Natalini, Benedetto

2016-09-10

Among the mechanisms adopted by bacteria, efflux pumps (EPs) have been recognized as being significantly involved in contributing to resistance to commonly used antibacterial agents. However, little is known about their three-dimensional structures or the steric requirements for their inhibition. Lack of such knowledge includes NorA, one of the most studied Staphylococcus aureus EPs. In the present study, the use of two commercialized Cinchona alkaloid-based zwitterionic chiral stationary phases allowed the enantioseparation of four 2-((2-(4-propoxyphenyl)quinolin-4-yl)oxy)alkylamines 1-4 previously found to be potent S. aureus NorA efflux pump inhibitors when tested as racemates. In the identified optimal polar-ionic conditions (MeOH/THF/H2O-49/49/2 (v/v/v)+25mM formic acid, 12.5mM diethylamine), repeated consecutive injections of 1 allowed the isolation of sufficient amount of its enantiomers (2.6mg and 2.8mg, for (R)-1 and (S)-1, respectively) and then to evaluate their ability to inhibit the S. aureus NorA efflux pump. The biological evaluation highlighted the main contribution of the (R)-1 enantiomer to both the EtBr efflux inhibition and synergistic effect with against SA-1199B (norA+/A116E GrlA) respect to the racemate activity. The comparison between the experimental electronic circular dichroism and the time-dependent density functional theory calculations spectra of the two isolated enantiomeric fractions allowed for all compounds a clear and easy assignment of the enantiomeric elution order. Copyright © 2016 Elsevier B.V. All rights reserved.

Analysis of the potential production and the development of bioenergy in the province of Mendoza - Bio-fuels and biomass - Using geographic information systems

Energy Technology Data Exchange (ETDEWEB)

Flores Marco, Noelia; Hilbert, Jorge Antonio [Instituto de Ingenieria Rural, INTA Las Cabanas y Los Reseros s/n, CP: 1712 Castelar, Buenos Aires (Argentina); Silva Colomer, Jorge [INTA EEA Junin Mendoza, Carril Isidoro Busquets s/n CP: 5572 (Argentina); Anschau, Renee Alicia; Carballo, Stella [Instituto de Clima y Agua, INTA. Las Cabanas y Los Reseros s/n, CP:1712 Castelar, Buenos Aires (Argentina)

2010-06-15

In this work, the partial results of the potential production of energy, starting from the biomass and the development of the crops, directed to the production of bio-fuels (Colza and Topinamur) in the North irrigation oasis of Mendoza, Argentina within the National Program of Bio-energy developed by INTA is presented. For the evaluation of the bio-energetic potential, derived from the biomass, the WISDOM methodology developed by FAO and implemented by INTA in Argentina was applied with the collaboration of national and provincial governmental entities that contribute local information The study of the potential production and the development of the bio-energetic crops have been carried out with the advising and participation of the experts of INTA of the studied crops. The province of Mendoza has semi-deserted agro-climatic characteristics. The type of soil and type of weather allows the production of great quality fruits and vegetables in the irrigated areas. The four great currents of water conform three oasis; Northeast, Center and South, which occupy the 3.67% of the surface of Mendoza. Today, Mendoza has 267,889 irrigated hectares, but the surface that was farmed by irrigation was near to the 400,000 ha. The climate contingencies, froze and hailstorm precipitations, plus the price instability cause great losses in the productive sector, taking it to the forlornness of the exploitations. The crop setting of these forlornness lands with crops directed to the production of bio-fuels and the utilization of the biomass coming from the agriculture activities and the agro industry (pruning of fruit trees, refuses of olive and vine, remnants of the peach industry, etc.) could assist the access to the energy in the rural areas, stimulating the economical improvement and the development in these communities. (author)

Analysis of the potential production and the development of bioenergy in the province of Mendoza - Bio-fuels and biomass - Using geographic information systems

International Nuclear Information System (INIS)

Flores Marco, Noelia; Hilbert, Jorge Antonio; Silva Colomer, Jorge; Anschau, Renee Alicia; Carballo, Stella

2010-01-01

In this work, the partial results of the potential production of energy, starting from the biomass and the development of the crops, directed to the production of bio-fuels (Colza and Topinamur) in the North irrigation oasis of Mendoza, Argentina within the National Program of Bio-energy developed by INTA is presented. For the evaluation of the bio-energetic potential, derived from the biomass, the WISDOM methodology developed by FAO and implemented by INTA in Argentina was applied with the collaboration of national and provincial governmental entities that contribute local information The study of the potential production and the development of the bio-energetic crops have been carried out with the advising and participation of the experts of INTA of the studied crops. The province of Mendoza has semi-deserted agro-climatic characteristics. The type of soil and type of weather allows the production of great quality fruits and vegetables in the irrigated areas. The four great currents of water conform three oasis; Northeast, Center and South, which occupy the 3.67% of the surface of Mendoza. Today, Mendoza has 267,889 irrigated hectares, but the surface that was farmed by irrigation was near to the 400,000 ha. The climate contingencies, froze and hailstorm precipitations, plus the price instability cause great losses in the productive sector, taking it to the forlornness of the exploitations. The crop setting of these forlornness lands with crops directed to the production of bio-fuels and the utilization of the biomass coming from the agriculture activities and the agro industry (pruning of fruit trees, refuses of olive and vine, remnants of the peach industry, etc.) could assist the access to the energy in the rural areas, stimulating the economical improvement and the development in these communities. (author)

Observatorios de Desarrollo Territorial Sustentable Mendoza, Argentina.

Directory of Open Access Journals (Sweden)

María Elina Gudiño

2015-03-01

Full Text Available El observatorio de Desarrollo territorial Sustentable para Mendoza, Argentina surge en el marco de la ley 8051/09 de Ordenamiento Territorial y Usos del Suelo. Se trata de una herramienta de comunicación para la validación y el monitoreo de indicadores, políticas, planes, programas y proyectos de índole territorial. El marco teórico-metodológico se sustenta en los principios del ordenamiento territorial y el enfoque de sistemas complejos adaptativos. La estructura se diseña en una plataforma tecnológica que permite estandarizar datos, sistematizar información, construir indicadores territoriales y publicar cartografía. Una vez logrado el prototipo, se conforma “Red Territorio” como modelo de gestión que permite interactuar entre instituciones del sector público, privado, científico y ONG. Actualmente, se está trabajando en la vinculación con las instituciones que formarán parte de la experiencia piloto de Red territorio y en el ajuste de la plataforma informática que le dará sustento.

Avaliação de três tipos de estrutura de colchão e três níveis de resina fenólica na produção de chapas de partículas orientadas - OSB

Directory of Open Access Journals (Sweden)

Gouveia Fernando Nunes

2003-01-01

Full Text Available O objetivo deste trabalho foi avaliar a influência da estrutura do colchão e de diferentes concentrações de adesivo nas propriedades de chapas de partículas orientadas (strands, contendo 50% de partículas de Eucalyptus grandis e 50% de Pinus elliottii. Foram avaliados três tipos de estruturas. Em uma das estruturas as partículas foram distribuídas em camadas indistintas. Uma segunda estrutura foi constituída de 50% de partículas de eucalipto no miolo do colchão e 25% de pinus em cada face. A terceira estrutura foi formada por 50% de madeira de pinus no miolo e 25% de eucalipto nas faces. Cada uma dessas estruturas foi aglutinada com 4, 6 ou 8% de sólidos resinosos em relação ao peso seco das partículas de um adesivo fenólico com viscosidade de 350 cps, pH 12,15 e 47,63% de sólidos. Para os nove tratamentos foram feitas três repetições, totalizando 27 chapas. As chapas foram submetidas aos testes de flexão estática, ligação interna, arranque de parafuso, inchamento em espessura e absorção de água, obedecendo aos critérios da norma ASTM D 1037 - 91. De modo geral os painéis feitos com 8% de adesivo apresentaram melhores resultados que os demais. Para a maioria das propriedades mecânicas, inclusive para os painéis fabricados com 4% de resina, obtiveram-se resultados superiores àqueles estabelecidos pela Norma CSA O437-93. Contudo, nenhum tratamento produziu chapas com inchamento em espessura inferior ao valor máximo permitido por aquela norma. Não se verificou diferença estatística, ocasionada pela estrutura de colchão, entre todas as propriedades avaliadas.

Avaliação do desempenho de um conector de cisalhamento em chapa dentada para estruturas mistas de aço e concreto

OpenAIRE

Veríssimo, G. S.; Oliveira, Alessandro F. N.; Fakury, R. H.; Rodrigues, F. C.; Paes, J. L. R.; Valente, Isabel; Cruz, Paulo J. S.

2007-01-01

Este trabalho apresenta uma avaliação do comportamento de um conector de cisalhamento em chapa dentada, denominado Crestbond, para sistemas de pisos mistos, a partir dos resultados de 40 ensaios push-out. Avalia-se a capacidade de carga da conexão, sua ductilidade e os modos de colapso observados, considerando-se o efeito de diversas variáveis. Os resultados demonstram que o conector proposto apresenta um comportamento adequado, com alta rigidez para cargas de serviço e boa duc...

Adição de aparas de papel reciclável na fabricação de chapas de madeira aglomerada.

OpenAIRE

Leandro Calegari; Clovis R. Haselein; Marcos V. Barros; Tobias L. Scaravelli; Lourdes Patricia E. Dacosta; Cristiane Pedrazzi; Everton Hillig

2010-01-01

Neste trabalho, foram analisadas as propriedades físico-mecânicas de chapas aglomeradas produzidas com dois tipos de papel reciclável (papel jornal e offset) e partículas de madeira de Pinus elliottii Engelm. As aparas de papel foram usadas no colchão em dois diferentes formatos (tiras ou moídas) e em diferentes proporções: 0, 20, 40, 60 e 100% do peso seco das partículas. Utilizoaram-se 10% de adesivo à base de tanino-formaldeído na proporção 100:10. O experimento foi estabelecido segundo mo...

Lytological characterization and hydrothermal alteration Infiernillo porphyry, provincia Mendoza, Argentina

International Nuclear Information System (INIS)

Gomez, A.; Rubinstein, N.; Kleiman, L.. E.mail: kleiman@cae.cnea.gov.ar

2007-01-01

El Infiernillo porphyry copper and Mo deposit, in southern Mendoza, Argentina is hosted by ignimbrites of the Cochico Group (lower Permian). The alteration zone consists of a small central quartz neck with appreciable hematite surrounded by an intense quartz-injected zone with local pervasive potassic alteration. Outwards, there is a well-developed phyllic halo with intense bleaching which consists of pervasive and vein-type silicification, sericitization and pyritization. In the outer part of the alteration zone, small polymetallic veins with pyrite, arsenopyrite, galena and minor, chalcopyrite, sphalerite and electrum in quartz gangue crop out. New field, petro-mineralogic and geochemical data confirmed that the host rocks are equivalent to the dacitic and rhyodacitic ignimbrites of the Toba Vieja Gorda Member (Yacimiento Los Reyunos Formation, Cochico Group)

The Transformations of the Central Area of Nora: the Reconstruction of the Houses

Directory of Open Access Journals (Sweden)

Elena Belgiovine

2013-11-01

Full Text Available La ricostruzione tridimensionale delle abitazioni presenti nel Quartiere Centrale della città di Nora è stata elaborata mediante l’uso del software Revit Architecture ed è stata concepita per mostrare le trasformazioni avvenute nell’area durante le fasi di II-III secolo d.C. e in età tardo antica. I modelli tridimensionali delle singole abitazioni, che si basano sulla documentazione di scavo, sono confluiti in un progetto di ricostruzione dell’intero isolato, in modo da ricrearne l’aspetto volumetrico e rendere immediatamente percepibili i vari aspetti di questo articolato contesto urbano.

Propriedades de chapas de aglomerado fabricadas com adesivo tânico de angico-vermelho (Anadenanthera peregrina e uréia-formadeído Properties of particleboards glued with adhesives of "angico-vermelho" tannin (Anadenanthera peregrina and urea-formaldehyde

Directory of Open Access Journals (Sweden)

Angélica de Cássia Oliveira Carneiro

2009-06-01

Full Text Available O principal objetivo deste trabalho foi produzir chapas de aglomerado substituindo-se parcial ou totalmente os adesivos à base de uréia-formaldeído por adesivos de taninos extraídos da casca de angico-vermelho (Anadenanthera peregrina e hidrolisados. As chapas de aglomerado foram fabricadas com partículas de Pinus elliottii e dimensões aproximadas de 40 x 40 x 1 cm, contendo 8% de sólidos de adesivo em relação à massa seca de partículas, sendo 100% de adesivo de uréia-formaldeído puro ou contendo 12,5, 25 e 37,5% de adesivo tânico. Foram produzidas, também, chapas com adesivos tânicos puros, constituindo um total de cinco tratamentos, com três repetições. As chapas foram fabricadas com densidade média de 0,7 g/cm³. As propriedades físicas e mecânicas das chapas foram determinadas em conformidade com a norma ASTM D-1037 (1993. Os resultados dos testes mecânicos foram comparados com os valores mínimos estabelecidos na norma ANSI/A 208.1-1993 (Wood Particleboard, enquanto os resultados dos testes de absorção de água e inchamento em espessura, comparados com os valores máximos estabelecidos na norma DIN 68m761 (1-1961. A resistência mecânica das chapas de aglomerado produzidas com adesivos contendo taninos de angico-vermelho, com exceção do módulo de elasticidade, ultrapassou os valores mínimos requeridos na norma ANSI/A1-280/93. A absorção de água e o inchamento em espessura, após 2 e 24 h de imersão, de todas as chapas excederam o valor máximo estabelecido. Conclui-se que os adesivos de taninos de angico-vermelho podem substituir parcial ou totalmente o adesivo comercial de uréia-formaldeído, e as suas misturas são indicadas para uso interior, em que a resistência à umidade não é requerida.The main objective of this work was to produce particleboards with hydrolysed "angico-vermelho" bark (Anadenanthera peregrina tannins as partial or total substitute of urea-formaldehyde. Particleboards with the

El problema de los robos: de los temores de la élite a las prácticas de subsistencia de los sectores subalternos. Mendoza (Río de la Plata, 1820-1831

Directory of Open Access Journals (Sweden)

Molina, Eugenia

2014-04-01

Full Text Available This essay focuses on a specific study of thefts that occurred in the jurisdiction of Mendoza at the time of the formation of the provincial state. To do this, we will analyze judicial cases and government documents preserved in the Historical Archive of Mendoza. The aim of the study is to determine if the fears of the local elite, in the face of what they interpreted as growing post-revolutionary social conflict, were borne out by the information given in the sources; furthermore, we also aim to detect on which offenses against property they prioritized surveillance and punishment.En este trabajo nos centramos en un estudio específico de los robos ocurridos en la jurisdicción de Mendoza en el momento de conformación del estado provincial. Para ello analizaremos expedientes judiciales y documentos gubernamentales conservados en el Archivo Histórico de Mendoza. El objetivo del estudio apunta a determinar si los temores de la élite local, ante lo que ella interpretaba como una creciente conflictividad social pos revolucionaria, se correspondieron con lo planteado en las fuentes; no obstante, también buscamos detectar sobre qué atentados contra la propiedad focalizaron la vigilancia y punición.

Desenvolvimento de um conector de cisalhamento em chapa dentada para estruturas mistas de aço e concreto e estudo do seu comportamento

OpenAIRE

Gustavo de Souza Verissimo

2007-01-01

Este trabalho consiste do desenvolvimento de um conector de cisalhamento em chapa dentada para estruturas mistas de aço e concreto, incluindo o estudo do seu comportamento. O trabalho envolve uma ampla investigação para definição da geometria do conector, um programa experimental, o desenvolvimento de uma equação de resistência e o treinamento de redes neurais para a predição da resposta do conector. O programa experimental, envolvendo 41 ensaios tipo push-out, conforme a EN 1994-1-1:2004, fo...

Determinação das propriedades físicas e mecânicas do gesso reciclado proveniente de chapas de gesso acartonado

OpenAIRE

Erbs,A.; Nagalli,A.; Mymrine,V.; Carvalho,K. Q.

2015-01-01

Resumo A busca pela viabilidade técnica e econômica da reciclagem de resíduos na cadeia produtiva da construção civil vem atender às novas necessidades do setor de promover crescimento econômico integrado às necessidades sociais e ambientais. O crescente aumento do consumo das chapas de gesso acartonado carrega consigo o problema da geração dos resíduos de gesso, onde a falta de pesquisa e o descarte incorreto acaba destinando o resíduo gerado, na maioria das vezes, para aterros ou bota-foras...

Patrones fenológicos de la Provincia de Mendoza, Argentina, mediante serie temporal de imágenes NOAA-AVHRR NDVI GAC Phenological patterns of the province of Mendoza, Argentina, through a temporal series of NOAA-AVHRR NDVI GAC images

Directory of Open Access Journals (Sweden)

M. M González Loyarte

2010-12-01

Full Text Available Se describe la dinámica temporal de la vegetación de Mendoza mediante análisis de la fenología foliar regional con una serie de 108 imágenes mensuales de índice de vegetación NOAA-AVHRR NDVI GAC. La serie se descompone aplicando la Transformada Rápida de Fourier en parámetros dinámicos: NDVI medio, amplitudes (máxima variabilidad del NDVI y fases (tiempo entre inicio del ciclo y máximo NDVI para diferentes períodos. Con los parámetros con mayor información (variablilidad inter e intraanual se hace una clasificación y se obtiene un mapa de 18 áreas de comportamiento fenológico. Éste se vincula con los ecosistemas y con las unidades de vegetación. Se modela el patrón fenológico (curva NDVI mensual para 17 unidades de vegetación. El mapa aporta elementos dinámicos al estudio regional de la vegetación generando una zonificación nueva explicada por variables que determinan la actividad vegetativa. El patrón fenológico describe el funcionamiento de la vegetación y permite comprender sus variaciones geográficas. El conjunto de la vegetación de Mendoza responde a un ciclo anual con matices localizados de ligera bimodalidad. Los patrones de bajo contraste invierno-verano corresponden a condiciones climáticas xéricas expresando su máximo vegetativo al final del verano; la disponibilidad hídrica incrementa este contraste acortando el tiempo de máxima expresión vegetativa.The temporal dynamics of vegetation in Mendoza is described through analysis of regional foliar phenology using a series of 108 monthly NOAA-AVHRR NDVI GAC images. A Fast Fourier Transform was used to decompose the series into dynamic parameters: mean NDVI, amplitudes (maximum NDVI variability and phases (time from start of cycle to maximum NDVI for different time periods. A classification is made based on those parameters with larger information content (inter- and intra-annual variability, achieving a map of 18 areas of phenological behaviour. This

Dithiazole thione derivative as competitive NorA efflux pump inhibitor to curtail multi drug resistant clinical isolate of MRSA in a zebrafish infection model.

Science.gov (United States)

Lowrence, Rene Christena; Raman, Thiagarajan; Makala, Himesh V; Ulaganathan, Venkatasubramanian; Subramaniapillai, Selva Ganesan; Kuppuswamy, Ashok Ayyappa; Mani, Anisha; Chittoor Neelakantan, Sundaresan; Nagarajan, Saisubramanian

2016-11-01

Multi drug resistant (MDR) pathogens pose a serious threat to public health since they can easily render most potent drugs ineffective. Efflux pump inhibitors (EPI) can be used to counter the MDR phenotypes arising due to increased efflux. In the present study, a series of dithiazole thione derivatives were synthesized and checked for its antibacterial and efflux pump inhibitory (EPI) activity. Among 10 dithiazole thione derivatives, real-time efflux studies revealed that seven compounds were potent EPIs relative to CCCP. Zebrafish toxicity studies identified four non-toxic putative EPIs. Both DTT3 and DTT9 perturbed membrane potential and DTT6 was haemolytic. Among DTT6 and DTT10, the latter was less toxic as evidenced by histopathology studies. Since DTT10 was non-haemolytic, did not affect the membrane potential, and was least toxic, it was chosen further for in vivo study, wherein DTT10 potentiated effect of ciprofloxacin against clinical strain of MRSA and reduced bacterial burden in muscle and skin tissue of infected zebrafish by ~ 1.7 and 2.5 log fold respectively. Gene expression profiling of major efflux transport proteins by qPCR revealed that clinical isolate of MRSA, in the absence of antibiotic, upregulated NorA, NorB and MepA pump, whereas it downregulates NorC and MgrA relative to wild-type strain of Staphylococcus aureus. In vitro studies with NorA mutant strains and substrate profiling revealed that at higher concentrations DTT10 is likely to function as a competitive inhibitor of NorA efflux protein in S. aureus, whereas at lower concentrations it might inhibit ciprofloxacin efflux through NorB and MepA as implied by docking studies. A novel non-toxic, non-haemolytic dithiazole thione derivative (DTT10) was identified as a potent competitive inhibitor of NorA efflux pump in S. aureus using in silico, in vitro and in vivo studies. This study also underscores the importance of using zebrafish infection model to screen and evaluate putative EPI for

Measurement of reactor parameters of the 'Nora' reactor by noise analysis method - power spectral density

International Nuclear Information System (INIS)

Jovanovic, S.; Stormark, E.

1966-01-01

Measurements of reactor parameters the Nora reactor by Power Spectral Density (PSD) method are described. In case of critical reactor this method was applied for direct measurement of β/l ratio, β is the effective yield of delayed neutrons and l is the neutron lifetime. In case of subcritical reactor values of α+β-ρ/l were measured, ρ is the negative reactivity. Out coming PSD was measured by a filter or by ISAC. PSD was registered by ISAC as well as the auto-correlation function [sr

Resistencia a la corrosión atmosférica del recubrimiento Zn-10,2% Fe sobre chapa de acero. Comparación con el recubrimiento de zinc

Directory of Open Access Journals (Sweden)

Arnau, G.

1998-05-01

Full Text Available Zn-10.2 % Fe galvanized coating versus hot galvanized coating over carbon steel corrosion performance has been studied. Different periods of atmospheric exposures in various Valencia Community sites, and salt spray accelerated test have been done. Carbon steel test samples have been used simultaneously in order to classify exposure atmosphere corrosivity, and environmental exposure atmosphere characteristics have been analyzed. Corrosion velocity versus environmental parameters has been obtained.

Se estudia el comportamiento a la corrosión atmosférica de un recubrimiento Zn-10,2 % Fe galvanizado en caliente, comparándolo con el comportamiento ofrecido por la chapa galvanizada, habiéndose aplicado ambos recubrimientos sobre chapa de acero de embutición. Se han realizado ensayos de exposición atmosférica en distintas atmósferas de la Comunidad Valenciana y ensayos acelerados de laboratorio en cámara de niebla salina. Se han empleado simultáneamente probetas testigo de acero con el fin de clasificar la corrosividad de las atmósferas, y se han estudiado las características medioambientales de las atmósferas donde se han llevado a cabo los ensayos. Mediante estos estudios se han obtenido las velocidades de corrosión y se han analizado en función de los parámetros ambientales.

Boronic species as promising inhibitors of the Staphylococcus aureus NorA efflux pump: study of 6-substituted pyridine-3-boronic acid derivatives.

Science.gov (United States)

Fontaine, Fanny; Héquet, Arnaud; Voisin-Chiret, Anne-Sophie; Bouillon, Alexandre; Lesnard, Aurélien; Cresteil, Thierry; Jolivalt, Claude; Rault, Sylvain

2015-05-05

In response to the extensive use of antibiotics, bacteria have evolved numerous mechanisms of defense against antimicrobial agents. Among them, extrusion of the antimicrobial agents outside the bacterial cell through efflux pumps is a major cause of concern. At first limited to one or few structurally-related antibiotics, bacterial resistance have then progressed towards cross-resistance between different classes of antibiotics, leading to multidrug-resistant microorganisms. Emergence of these pathogens requires development of novel therapeutic strategies and inhibition of efflux pumps appears to be a promising strategy that could restore the potency of existing antibiotics. NorA is the most studied chromosomal efflux pump of Staphylococcus aureus; it is known to be implied in resistance of Methicillin-resistant S. aureus (MRSA) strains against a wide range of unrelated substrates, including hydrophilic fluoroquinolones. Starting from 6-benzyloxypyridine-3-boronic acid I that we previously identified as a potential inhibitor of the NorA efflux pump against the NorA-overexpressing S. aureus 1199B strain (SA1199B), we describe here the synthesis and biological evaluation of a series of 6-(aryl)alkoxypyridine-3-boronic acids. 6-(3-Phenylpropoxy)pyridine-3-boronic acid 3i and 6-(4-phenylbutoxy)pyridine-3-boronic acid 3j were found to potentiate ciprofloxacin activity by a 4-fold increase compared to the parent compound I. In addition, it has been shown that both compounds promote Ethidium Bromide (EtBr) accumulation in SA1199B, thus corroborating their potential mode of action as NorA inhibitors. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

Geología de la región del Cerro Guanaquero, Río Diamante, Mendoza

OpenAIRE

Federico Fuentes; Victor A. Ramos

2008-01-01

El estudio realizado presenta nuevos datos sobre un sector poco conocido de la Cordillera Principal de Mendoza, en la alta cuenca del río Diamante en las adyacencias del cerro Guanaquero, y los primeros datos geocronológicos de sus rocas volcánicas. Las unidades geológicas presentes en el área se dividen en cuatro grupos principales: secuencias sedimentarias mesozoicas marinas y continentales intensamente plegadas y falladas; intrusivos y volcanitas intermedias de edad neógena; rocas volcánic...

Análise experimental de um conector de cisalhamento em chapa de aço endentada para estruturas mistas de aço e concreto

OpenAIRE

Veríssimo, G. S.; Valente, Isabel; Paes, J. L. R.; Cruz, Paulo J. S.; Fakury, R. H.

2006-01-01

Este trabalho apresenta o projeto e os resultados de ensaios tipo push-out de um novo conector de cisalhamento constituído por uma chapa de aço endentada. O conector proposto possui saliências e reentrâncias trapezoidais que proporcionam resistência ao cisalhamento longitudinal e previnem a separação transversal entre o perfil metálico e a laje de concreto (uplift). Além disso, as aberturas no conector facilitam a disposição das barras de armadura. A capacidade da conexão pode ser varia...

Evaluación del trabajo esencial de fractura en chapa de un acero de alta resistencia de fase dual

Directory of Open Access Journals (Sweden)

Gutiérrez, D.

2013-02-01

Full Text Available Fracture toughness of advanced high strength steels (AHSS, can be used to optimize crash behavior of structural components. However it cannot be readily measured in metal sheet because of the sheet thickness. In this work, the Essential Work of Fracture (EWF methodology is proposed to evaluate the fracture toughness of metal sheets. It has been successfully applied in polymers films and some metal sheets. However, their information about the applicability of this methodology to AHSS is relatively scarce. In the present work the fracture toughness of a Dual Phase (strength of 800 MPa and drawing steel sheets has been measured by means of the EWF. The results show that the test requirements are met and also show the clear influence of notch radii on the measured values, specially for the AHSS grade. Thus, the EWF is postulated as a methodology to evaluate the fracture toughness in AHSS sheets.

La tenacidad de fractura de aceros de alta resistencia (AHSS, es una propiedad interesante para optimizar el comportamiento a impacto, pero su caracterización experimental en chapas metálicas es compleja debido a su espesor. En este trabajo se plantea el método del Trabajo Esencial de Fractura (TEF, como alternativa al cálculo de la tenacidad. Este método ya ha sido utilizado con éxito en polímeros y aceros dúctiles, aunque la información sobre su aplicación en AHSS es escasa. Se ha evaluado la tenacidad en un acero de fase dual de 800 MPa de resistencia y se ha comparado con la de un acero de embutición. Los resultados muestran que se cumplen los requisitos del método y ponen en evidencia la influencia del radio de entalla en el valor obtenido de TEF, especialmente para AHSS. Con todo ello, el método TEF se puede usar para caracterizar la tenacidad de AHSS en formato chapa.

Propriedades de chapas fabricadas com partículas de madeira de Eucalyptus urophylla S. T. Blake e de Schizolobium amazonicum Herb. Properties of foils manufactured with particles of wood of Eucalyptus urophylla S. T. Blake and of Schizolobium amazonicum Herb.

Directory of Open Access Journals (Sweden)

Rafael Baptista Naumann

2008-12-01

Full Text Available Este trabalho teve como objetivo avaliar as propriedades de chapas de madeira aglomerada fabricadas com partículas de Eucalyptus urophylla (massa específica = 0,55 g/cm³ e de Schizolobium amazonicum (Paricá (massa específica = 0,30 g/cm³. Foram confeccionadas chapas com cinco proporções de madeira e dois tipos de partículas (maravalhas e cavacos. As chapas apresentaram dimensões de 60 cm x 60 cm x 1 cm e massa específica média de 0,60 g/cm³. Utilizou-se adesivo à base de uréia-formaldeído, na proporção de 8%. As chapas foram prensadas à temperatura de 170 ºC e 3,2 MPa de pressão, em ciclos de 8 min, e as suas propriedades foram determinadas segundo a norma NBR 14810-3. A massa específica, a dureza Janka e a expansão linear não foram influenciadas pelas variáveis experimentais. De modo geral, o aumento na porcentagem de paricá elevou a resistência à flexão, ao arrancamento de parafuso e à tração perpendicular. O tipo de partícula afetou significativamente apenas a resistência à tração perpendicular e o inchamento em espessura. As chapas produzidas com partículas provenientes de cavacos (coeficiente de esbeltez menor tiveram maior resistência à tração perpendicular. Contudo, apresentaram valores mais elevados de inchamento em espessura.This work aimed to evaluate the properties of particleboards produced with Eucalyptus urophylla (density 0.55 g/cm³ and Schizolobium amazonicum (density 0.30 g/cm³.Five wood proportions and two types of particle (shavings and chips were used to manufacture the boards. Board dimension was 60 cm x 60 cm x 1 cm and average density 0.60g/cm³. Eight percent of urea-formaldehyde adhesive was used. Boards were pressed at 170 ºC and 32 kgf/cm² of pressure in 8 minute cycles. Board properties were determined according to NBR 14810-3 standard. There was no influence of the variables on board density and linear expansion. Generally,increasing the percentage of paricá increased

Non-antibiotic agent ginsenoside 20(S)-Rh2 enhanced the antibacterial effects of ciprofloxacin in vitro and in vivo as a potential NorA inhibitor.

Science.gov (United States)

Zhang, Jingwei; Sun, Yuan; Wang, Yaoyao; Lu, Meng; He, Jichao; Liu, Jiali; Chen, Qianying; Zhang, Xiaoxuan; Zhou, Fang; Wang, Guangji; Sun, Xianqiang

2014-10-05

The aim of this study is to explore the potential enhancing effect of ginsenoside 20(S)-Rh2 (Rh2) towards ciprofloxacin (CIP) against Staphylococcus aureus (S. aureus) infection in vitro and in vivo, and analyze the possible mechanisms through NorA inhibition from a target cellular pharmacokinetic view. In combination with non-toxic dosage of Rh2, the susceptibilities of S. aureus strains to CIP were significantly augmented, and the antibacterial kinetics of CIP in the S. aureus strains were markedly promoted. This enhancing effect of Rh2 towards CIP was also observed in S. aureus infected peritonitis mice, with elevated survival rate and reduced bacteria counts in blood. However, Rh2 did not influence the plasma concentrations of CIP. Further analysis indicated that Rh2 significantly promoted the accumulations of CIP in S. aureus, and inhibited the NorA mediated efflux of pyronin Y. The expressions of NorA gene on S. aureus were positively correlated with the enhancing effect of Rh2 with CIP. This is the first report of the enhancing effect of Rh2 with CIP for S. aureus infection in vitro and in vivo, of which it is probably that Rh2 inhibited NorA-mediated efflux and promoted the accumulation of CIP in the bacteria. Copyright © 2014 Elsevier B.V. All rights reserved.

Conflictos sociales en Mendoza entre dos crisis, 1890-1916: Una larga lucha de los trabajadores por la conquista de sus derechos laborales

Directory of Open Access Journals (Sweden)

Rodolfo Richard-Jorba

2010-06-01

Full Text Available Este artículo contribuye a la reconstrucción de la historia del mundo de los trabajadores en Mendoza. Las fuentes revisadas y la sistematización de información dispersa han permitido profundizar en los conocimientos hasta ahora generados, sacando a luz una parte significativa del desarrollo capitalista centrado en la agroindustria vitivinícola. Las fuentes principales para seguir los conflictos han sido los diarios mendocinos, por lo que nuestro abordaje constituye una aproximación que esperamos poder ampliar en el futuro. En este artículo presentamos los conflictos sociales en el contexto de períodos de crisis y de auge económico. Comenzamos por la crisis de 1890 y concluimos con la crisis provocada por la Primera Guerra Mundial y los cambios políticos que sobrevendrían a partir de 1916-1918This article contributes to reconstructing the history of the world of labour in Mendoza. The revision of sources and the systematization of the scattered information available resulted in a deeper insight on the subject and a better understanding of capitalist development based on vitivicultural agroindustry. Articles from Mendoza newspapers have been the main historical sources used to follow these conflicts, and are expected to be widened in future investigations. Currently, social troubles are presented in a context of a period of economic growth and crisis. We start with the crisis of 1890, to conclude with the World War I crisis and the political changes that would come after 1916-1918

La lacertofauna de Mendoza: lista actualizada, distribución y riqueza

Directory of Open Access Journals (Sweden)

Corbalán, Valeria

2008-04-01

Full Text Available La provincia de Mendoza posee una rica fauna de lagartos pertenecientes a las familias Leiosauridae, Liolaemidae, Teiidae, Scincidae y Gekkonidae. Algunos son propios del Monte, Puna, Payunia o región andina, mientras que otros poseen una amplia distribución, ocupando dos o más ecosistemas. El objetivo de este trabajo fue actualizar la lista lacertofaunística de la provincia y determinar las áreas de mayor riqueza de especies en relación a estos cuatro tipos de ecosistemas. Se utilizaron datos de procedencia de 43 especies de lagartos a partir de colecciones herpetológicas y de bibliografía. Las localidades fueron georreferenciadas y mapeadas. Una primera estimación de las áreas de mayor riqueza fue realizada sobre la base de las distribuciones de acuerdo a los puntos de colecta. En un segundo análisis, se generaron modelos predictivos de distribución utilizan-do 26 variables ambientales. Estas áreas potenciales fueron superpuestas a fin de obtener el número de especies en cuadrículas de 4,6 km x 4,6 km. Los resultados de ambos métodos indican que la mayor riqueza de especies se encuentra en la Payunia, probablemente en relación a la mayor heterogeneidad ambiental de la zona, ya que es considerada un área ecotonal entre la región fitogeográfica de la Patagonia y el Monte. Un análisis de similitud (Índice de Morisita demuestra que la similitud entre ecosistemas en cuanto a la composición de especies es baja, conformándose dos grupos: el Monte y Patagonia por un lado, y el ecosistema Andino y Puneño por otro. Mendoza province has a rich fauna of lizards that belongs to the Leiosauridae, Liolaemidae, Teiidae, Scincidae and Gekkonidae families. Some of them are typical of the Monte, Puna, Payunia or Andean region, whereas some others are widespread, inhabiting two or more ecosystems. The objective of this work is to perform an updating of the Mendoza lizard fauna and to determine the most highly species-rich areas related to

Attaching NorA efflux pump inhibitors to methylene blue enhances antimicrobial photodynamic inactivation of Escherichia coli and Acinetobacter baumannii in vitro and in vivo.

Science.gov (United States)

Rineh, Ardeshir; Bremner, John B; Hamblin, Michael R; Ball, Anthony R; Tegos, George P; Kelso, Michael J

2018-02-24

Resistance of bacteria to antibiotics is a public health concern worldwide due to the increasing failure of standard antibiotic therapies. Antimicrobial photodynamic inactivation (aPDI) is a promising non-antibiotic alternative for treating localized bacterial infections that uses non-toxic photosensitizers and harmless visible light to produce reactive oxygen species and kill microbes. Phenothiazinium photosensitizers like methylene blue (MB) and toluidine blue O are hydrophobic cations that are naturally expelled from bacterial cells by multidrug efflux pumps, which reduces their effectiveness. We recently reported the discovery of a NorA efflux pump inhibitor-methylene blue (EPI-MB) hybrid compound INF55-(Ac)en-MB that shows enhanced photodynamic inactivation of the Gram-positive bacterium methicillin-resistant Staphylococcus aureus (MRSA) relative to MB, both in vitro and in vivo. Here, we report the surprising observation that INF55-(Ac)en-MB and two related hybrids bearing the NorA efflux pump inhibitors INF55 and INF271 also show enhanced aPDI activity in vitro (relative to MB) against the Gram-negative bacteria Escherichia coli and Acinetobacter baumannii, despite neither species expressing the NorA pump. Two of the hybrids showed superior effects to MB in murine aPDI infection models. The findings motivate wider exploration of aPDI with EPI-MB hybrids against Gram-negative pathogens and more detailed studies into the molecular mechanisms underpinning their activity. Copyright © 2018 Elsevier Ltd. All rights reserved.

New meaning from old collections- figurines from the Museo de Jonuta, Chapas Mexico

International Nuclear Information System (INIS)

Sears, Erin L.

2001-01-01

Old collections of archaeological ceramics, often with diverse histories can be a rich source of new information when they are linked with new excavation materials through instrumental neutron activation analysis or other comparable analytical technique. INAA has been applied to study of Maya ceramics from southern Mexico for more than forty years, specially in the modern states of Tabasco, Chapas, Campeche and Yucatan and the Guatemala region of El Peten, More than 1.100 analyzes of fine paste orange and gray pottery provides an extensive compositional background against which to view the chemical variation of a recently analyzed collection of Maya figurines from the Museo de Jonuta, Tabasco Mexico. These figurines constitute an important assemblage of archaeological pottery as they reveal stylistic patterns of continuity in artistic traditions and aspects of stylistics change at and immediately before the time of the so called a Maya Collapse. Since the town of Jonuta is located in hypothesized home of non Maya invaders who are thought to be factors in the Maya collapse. INAA data on the figurines sources of production and related patterns of representational style, provide new data to address the social changes that took place in the lowland Maya regions at the end of the 8 th Century

Improved Potency of Indole-Based NorA Efflux Pump Inhibitors: From Serendipity toward Rational Design and Development.

Science.gov (United States)

Buonerba, Federica; Lepri, Susan; Goracci, Laura; Schindler, Bryan D; Seo, Susan M; Kaatz, Glenn W; Cruciani, Gabriele

2017-01-12

The NorA efflux pump is a potential drug target for reversal of resistance to selected antibacterial agents, and recently we described indole-based inhibitor candidates. Herein we report a second class of inhibitors derived from them but with significant differences in shape and size. In particular, compounds 13 and 14 are very potent inhibitors in that they demonstrated the lowest IC 50 values (2 μM) ever observed among all indole-based compounds we have evaluated.

Scientific development and modern wine industry: the origins and consolidation of Enology Station of Mendoza (Argentina, 1904-1920 Desarrollo científico e industria vitivinícola moderna: orígenes y consolidación de la Estación Enológica de Mendoza (Argentina, 1904- 1920

Directory of Open Access Journals (Sweden)

Florencia Rodríguez Vázquez

2009-01-01

Full Text Available In this article we propose to undertake a reconstruction of the development of the 'Estación Enológica', next to 'Escuela Nacional de Vitivinicultura', between 1904 to 1920 in Mendoza province. This study is of vital importance as we consider this place was a pioneer center in the achievement of scientific and technical studies. These were the basis for the consolidation of quality wine industry , which had many shortcomings by then, and they triggered changes in Mendoza's agroindustry. Besides, Estación Enológica became a meeting place for people who graduated from that school to share experiences and concerns. Apart from carrying out the reconstruction of the development, we will also investigate possibilities of applying these studies to vineyardsEn el presente artículo nos proponemos realizar una reconstrucción de la trayectoria de la Estación Enológica de Mendoza, anexa a la Escuela Nacional de Vitivinicultura, desde 1904 a 1920. El mismo cobra vital importancia en tanto la consideramos un centro pionero en la realización de estudios científicos y técnicos que sirvieron de base a la consolidación de una vitivinicultura de calidad -y que por entonces contaba con múltiples deficiencias- y un impulsor de cambios técnicos en la agroindustria local. A su vez, su importancia radicaría en que fue un espacio aglutinador de las experiencias e inquietudes de los enólogos graduados de la mencionada Escuela. Por último, nos referiremos a las posibilidades de recepción y divulgación de los estudios entre los vitivinicultores

Synergistic effects of baicalein with ciprofloxacin against NorA over-expressed methicillin-resistant Staphylococcus aureus (MRSA) and inhibition of MRSA pyruvate kinase.

Science.gov (United States)

Chan, Ben C L; Ip, Margaret; Lau, Clara B S; Lui, S L; Jolivalt, Claude; Ganem-Elbaz, Carine; Litaudon, Marc; Reiner, Neil E; Gong, Huansheng; See, Raymond H; Fung, K P; Leung, P C

2011-09-01

Baicalein, the active constituent derived from Scutellaria baicalensis Georgi., has previously been shown to significantly restore the effectiveness of β-lactam antibiotics and tetracycline against methicillin-resistant Staphylococcus aureus (MRSA). With multiple therapeutic benefits, the antibacterial actions of baicalein may also be involved in overcoming other bacterial resistance mechanisms. The aim of the present study was to further investigate antibacterial activities of baicalein in association with various antibiotics against selected Staphylococcus aureus strains with known specific drug resistance mechanisms. A panel of clinical MRSA strains was used for further confirmation of the antibacterial activities of baicalein. The effect of baicalein on inhibiting the enzymatic activity of a newly discovered MRSA-specific pyruvate kinase (PK), which is essential for Staphylococcus aureus growth and survival was also examined. In the checkerboard dilution test and time-kill assay, baicalein at 16 μg/ml could synergistically restore the antibacterial actions of ciprofloxacin against the NorA efflux pump overexpressed SA-1199B, but not with the poor NorA substrate, pefloxacin. Moreover, synergistic effects were observed when baicalein was combined with ciprofloxacin against 12 out of 20 clinical ciprofloxacin resistant strains. For MRSA PK studies, baicalein alone could inhibit the enzymatic activity of MRSA PK in a dose-dependent manner. Our results demonstrated that baicalein could significantly reverse the ciprofloxacin resistance of MRSA possibly by inhibiting the NorA efflux pump in vitro. The inhibition of MRSA PK by baicalein could lead to a deficiency of ATP which might further contribute to the antibacterial actions of baicalein against MRSA. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

The Medical Vocabulario terminológico of Manuel Hurtado de Mendoza

Directory of Open Access Journals (Sweden)

Bertha M. Gutiérrez Rodilla

2012-12-01

Full Text Available From the early nineteenth century, Spanish physicians started to sense a «threat» to the language of medicine which they used, due in part to the large number of foreign terms they were forced to import from other languages, particularly French. Many voices emerged to denounce this situation and propose potential solutions such as those which would be derived from the creation of a terminological dictionary which would fix precise meanings for medical terms. It was Manuel Hurtado de Mendoza who eventually dared to take on this task and develop the first modern terminological dictionary of medicine in Spanish. The intention of this paper is to present from a philological viewpoint the process by which a lexicographical work that deserves to be better known and used in studies on historical lexicography came to be constructed.

Les variations récentes (1975-2000 de l’englacement dans le Massif de l’Aconcagua (Mendoza, Argentine

Directory of Open Access Journals (Sweden)

Julie Le Gall

2008-03-01

Full Text Available La région de Mendoza est particulièrement vulnérable au réchauffement climatique. Les glaciers du massif de l’Aconcagua ont amorcé un important retrait depuis la fin du Petit Âge de Glace. Or la disparition de ces glaciers risque d’entraîner une modification des régimes hydrologiques qui, jusqu’à présent, se caractérisaient par de hautes eaux estivales. Ce pic estival pourrait à l’avenir être atténué et remettre en cause les stratégies de gestion de la ressource en eau. Nous faisons ici le point sur les variations récentes de l’englacement et tentons de dessiner un scénario prospectif.Mendoza area is highly vulnerable to the global warming. The glaciers of the Aconcagua massif are currently shrinking, this trend of retreat began at the end of the Little Ice Age. The disappearance of glaciers may modify hydrological regimes. The discharge is currently at maximum during summer (related to glacier melt, but the peak discharge may occur during spring (related to snow melt in the next future. In this paper we synthesize the recent variations of the glaciers and propose a pattern of future variations.

Propriedades de chapas tipo OSB, fabricadas com partículas acetiladas de madeiras de Eucalyptus grandis, Eucalyptus urophylla, Eucalyptus cloeziana e Pinus elliottii Properties of OSB manufactured with wood strands of Eucalyptus grandis, Eucalyptus urophylla, Eucalyptus cloeziana and Pinus elliottii

Directory of Open Access Journals (Sweden)

Carla Priscilla Távora Cabral

2006-08-01

Full Text Available Este trabalho teve como objetivo avaliar as propriedades de chapas de 0riented Strand Board (OSB, fabricadas com flocos de madeira de Eucalyptus grandis, Eucalyptus urophylla e Eucalyptus cloeziana e oriundas dos Municípios de Ponte Alta e Três Marias, no Estado de Minas Gerais. As massas específicas básicas das três espécies de eucaliptos das duas regiões foram, respectivamente: Ponte Alta (0,55; 0,61; e 0,70 g/cm³ e Três Márias (0,56; 0,58; e 0,69 g/cm³. Quando necessário, para manter as massas específicas das chapas próximas de 0,70 g/cm³ foram acrescentadas às partículas de madeira de eucalipto partículas de madeira de Pinus elliottii, oriundo da cidade de Viçosa, com massa específica de 0,45 g/cm³. Os flocos foram gerados nas dimensões médias de 90,00 x 20,00 x 0,46 mm. O adesivo utilizado foi o fenol-formaldeído, na proporção de 8% de sólidos, em relação à massa seca de partículas. Parte dos flocos de eucaliptos foram acetilados. As chapas foram prensadas à temperatura de 170 °C e 32 kgf/cm² de pressão. As propriedades das chapas foram determinadas segundo as normas da ABNT NBR 14810-3 (2002 e ASTM-D 1037 (1991. Os resultados foram comparados utilizando-se as normas ANSI/A - 208.1 (1993 e CSA 0437-93 (1993. As chapas contendo partículas acetiladas foram mais estáveis e adsorveram menos umidade. Na tração perpendicular, observou-se que as chapas contendo 100% de flocos acetilados apresentaram resultados inferiores ao estipulado pela norma CSA O437-0/93 (1993. A resistência ao arrancamento de parafuso, módulo de ruptura (paralelo e perpendicular e compressão longitudinal (perpendicular, foi reduzida pela acetilação nas chapas contendo 100% dos flocos acetilados. As espécies que apresentaram, numericamente, as maiores médias para resistência mecânica foram: Eucalyptus grandis não acetilado (dureza Janka e Eucalyptus cloeziana misturado com Pinus sp (módulo de ruptura. Somente a resistência �

Análisis por elementos finitos de procesos de embutición de chapa mediante un modelo viscoplástico con degradación por huecos

OpenAIRE

Saracibar, Carlos Agelet de; Oñate Ibáñez de Navarra, Eugenio

2009-01-01

En este trabajo se presenta una analogía formal entre las ecuaciones de la teoría de flujo plástico y viscoplástico para metales con huecos y las de la elasticidad no lineal. Se muestra como por simplificación de las ecuaciones generales se obtiene la forma incompresible de las expresiones para metales sin huecos. La formulación general se particulariza para el análisis de problemas de embutición de chapa detallándose las formulaciones de lámina y membrana para tratar del problema de revol...

Análisis por elementos finitos de procesos de embutición de chapa mediante un modelo viscoplástico con degradación por huecos

OpenAIRE

Oñate, E.; Agelet, C.; Dalin, J.

1990-01-01

En este trabajo se presenta una analogía formal entre las ecuaciones de la teoría de flujo plástico y viscoplástico para metales con huecos y las de la elasticidad no lineal. Se muestra como por simplificación de las ecuaciones generales se obtiene la forma incompresible de las expresiones para metales sin huecos. La formulación general se particulariza para el análisis de problemas de embutición de chapa detallándose las formulaciones de lámina y membrana para tratar del problema de revoluci...

Two intercultural performances: Double Nora and Resurrection Day

Directory of Open Access Journals (Sweden)

Mitsuya Mori

2015-02-01

Full Text Available I have so far directed two plays of Ibsen as the intercultural performance, that is, the collaboration of the modern theatre with noh, a traditional Japanese theatre, which was established as an artistic theatre form in the 14th century. The first production was Double Nora, based on A Doll’s House, which premiered at a noh theatre in Tokyo in 2005, and the second was Resurrection Day, based on When We Dead Awaken, performed at the Ibsen Festival in Tokyo in 2010. In both productions, professional noh and modern theatre actors appeared together in their own acting styles. At the Ibsen Conference in Tromsø in June 2012, brief scenes of the two productions were shown. But here in the present article the performances are partly described, and the interactive relationship between different acting styles of noh and modern theatre is examined. A new and difficult experiment of Resurrection Day was to try a conversation between the main noh actor and the modern actress. The experiment was possible because the performance took place not on a noh stage in a unique form but on an ordinary stage in a modern theatre. Thus, some problems involved in the intercultural performance of Ibsen are investigated.

Dynamism of viticultural systems in Mendoza (1988–2008

Directory of Open Access Journals (Sweden)

Van den Bosch M. Eugenia

2014-01-01

Full Text Available Viticulture holdings of Mendoza Argentina, were classified by the allocation and the stratum size according to their total acreage based on the data of the last three National Agricultural Censuses (1988, 2002 and 2008. There are different behaviors in each stratum according to each growing zone. It has been observed that in all “oasis” smaller is the holding, higher is the rate of shrinkage. On the other hand the bigger sizes grow and the acreage concentration of these units has increased significantly. Behaviors were clustered according to their path: taking into account its relationship with both zonal and provincial level stratum averages. Areas like the Oasis Sur have suffered a major a regressive process that has involved almost all the strata. The Uco Valley has shown a significant dynamism in units of more than 25 ha, while the small holdings have moved back, but with lower rates than the average of these strata. The Oasis Norte has also been subject to a bipolar process where a significant loss of small vineyards with the rise of new big holdings. Oasis Este is the only one that remains with lower regression rates.

Historia del Hogar Casa Cuna de la ciudad de Mendoza: La institución que permanece

OpenAIRE

Farias Carracedo, Ana Carolina

2017-01-01

Este trabajo presenta la historia del Hogar Casa Cuna en la ciudad de Mendoza, Argentina,desde sus orígenes, a principios del siglo XX, hasta la actualidad enmarcando dicha historia enel contexto legislativo nacional y provincial.En sus orígenes, la Casa Cuna fue fundada por las Damas de la Caridad. En 1950 el Estado, pormedio de la Dirección Provincial del Menor, se hizo cargo de dicha institución aunque delegó elcuidado de los niños a las Hermanas de Nuestra Señora del Rosario que desempeña...

Mercado de trabajo y condiciones de vida en Mendoza a comienzos del siglo XX

Directory of Open Access Journals (Sweden)

Juan Manuel Cerdá

2006-01-01

Full Text Available El propósito del presente trabajo es analizar los cambios y las continuidades en el proceso de formación del mercado de trabajo en la provincia de Mendoza a comienzos del siglo XX. La incorporación de un número significativo de inmigrantes a finales del siglo XIX junto a un proceso de reorganización productiva asociado al desarrollo de la industria vitivinícola, implicó cambios en las relaciones sociales y en las condiciones de vida de amplios sectores de la población mendocina. Iniciado el siglo XX, la vitivinicultura se convirtió en la principal actividad productiva de la provincia y la más importante en su rubro a nivel nacional. Los viñateros, productores agroindustriales, industriales bodegueros, contratistas de viñas , etc., fueron constituyéndose en parte de una sociedad cada vez más heterogénea y diversa, producto del desarrollo capitalista que experimentó la región desde el último tercio del siglo XIX y que se insertó en el proceso de incorporación de la economía Argentina al mercado mundial. Este período resulta de suma importancia porque se determinó un sistema productivo en torno a la actividad vitivinícola de la provincia que dio forma al mercado de trabajo regional. En este contexto, la inserción de los trabajadores se dio de una manera muy dispar en el proceso productivo, caracterizado por una alta estacionalidad y una escasa especialización de la mano de obra requerida.The aim of this work is to analyze the changes and continuities during the process of formation of the labor market in the province of Mendoza in the early 1900s. Wide sectors of the Mendoza population saw their life conditions and social interactions change as a result of the absorption of a significant amount of immigrants by the end of 19 th century, together with a restructuring of production connected to the development of the wine industry. Shortly after the turn of the century, wine had become the main productive activity of that

Diafragmas horizontais de piso em madeira, confeccionados com chapas de OSB e vigas I, submetido ao carregamento em seu plano - 10.4025/actascitechnol.v32i4.5046

Directory of Open Access Journals (Sweden)

Altevir Castro dos Santos

2010-12-01

Full Text Available Este trabalho aborda nova perspectiva para construções em madeira, sob a ótica construtiva de sistemas com estruturas leves (Lightweight wood-frame construction, pela sua consagrada aplicação internacional e forte viabilidade de utilização no Brasil. Apresenta ensaios realizados pela primeira vez no Brasil, trazendo contribuição inicial sobre o assunto, com subsídios para projeto e execução de diafragmas de piso com emprego de material nacional oriundo do manejo racional de florestas cultivadas. O objetivo geral é avaliar a resistência e a rigidez de diafragmas horizontais, construídos em Sistemas Leves de Madeira, quando submetidos ao carregamento monotônico em seu plano. Para atendimento desse propósito, foram ensaiados protótipos em escala real (2,50 x 5,00 m com diferentes arranjos construtivos e avaliou-se a influência dos seguintes parâmetros: utilização de dispositivos enrijecedores entre vigas, que constituem a ossatura do diafragma horizontal; rigidez das ligações e o efeito do espaçamento entre pregos na rigidez do conjunto, composto de madeira e chapas de OSB – Oriented Strand Board Nacional. Dos ensaios realizados, conclui-se que o emprego de dispositivos enrijecedores permite o aumento do número de pregos de fixação no perímetro das chapas e esse acréscimo é responsável pelo aumento da resistência e rigidez dos diafragmas.

Patterns of practice of regional nodal irradiation in breast cancer: results of the European Organization for Research and Treatment of Cancer (EORTC) NOdal Radiotherapy (NORA) survey

NARCIS (Netherlands)

Belkacemi, Y.; Kaidar-Person, O.; Poortmans, P.; Ozsahin, M.; Valli, M.-C.; Russell, N.; Kunkler, I.; Hermans, J.; Kuten, A.; van Tienhoven, G.; Westenberg, H.

2015-01-01

Predicting outcome of breast cancer (BC) patients based on sentinel lymph node (SLN) status without axillary lymph node dissection (ALND) is an area of uncertainty. It influences the decision-making for regional nodal irradiation (RNI). The aim of the NORA (NOdal RAdiotherapy) survey was to examine

Estimación de la huella energética en agroecosistemas cultivados con vid y ajo en Mendoza, Argentina

OpenAIRE

Santoni, Leonardo; Hidalgo, Verónica P.; Filippini, María Flavia; Gennari, Alejandro J.

2015-01-01

A nivel mundial, los cultivos de mayor importancia como maíz, trigo, soja y girasol presentan una huella energétic aconocida. En Mendoza, Argentina, aún no han sido estudiados los principales cultivos de importancia socio-económica para la región, como la vid (Vitis vinifera L.), especie perenne y el ajo (Allium sativum L.), especie anual, manejados en agroecosistemas convencionales. La presencia de indicadores energéticos como Eficiencia (EE), Balance (BE) y Productividad (PE), permiten obte...

A probability index for surface zonda wind occurrence at Mendoza city through vertical sounding principal components analysis

Science.gov (United States)

Otero, Federico; Norte, Federico; Araneo, Diego

2018-01-01

The aim of this work is to obtain an index for predicting the probability of occurrence of zonda event at surface level from sounding data at Mendoza city, Argentine. To accomplish this goal, surface zonda wind events were previously found with an objective classification method (OCM) only considering the surface station values. Once obtained the dates and the onset time of each event, the prior closest sounding for each event was taken to realize a principal component analysis (PCA) that is used to identify the leading patterns of the vertical structure of the atmosphere previously to a zonda wind event. These components were used to construct the index model. For the PCA an entry matrix of temperature ( T) and dew point temperature (Td) anomalies for the standard levels between 850 and 300 hPa was build. The analysis yielded six significant components with a 94 % of the variance explained and the leading patterns of favorable weather conditions for the development of the phenomenon were obtained. A zonda/non-zonda indicator c can be estimated by a logistic multiple regressions depending on the PCA component loadings, determining a zonda probability index \\widehat{c} calculable from T and Td profiles and it depends on the climatological features of the region. The index showed 74.7 % efficiency. The same analysis was performed by adding surface values of T and Td from Mendoza Aero station increasing the index efficiency to 87.8 %. The results revealed four significantly correlated PCs with a major improvement in differentiating zonda cases and a reducing of the uncertainty interval.

Stable and strontium isotopic records of molluscan shells, lower jurassic, Cuenca Neuquina, southwestern Mendoza, Argentina

International Nuclear Information System (INIS)

Cagnoni, M.C.; Valencio, S.A.; Ramos, A.M; Riccardi, A.C; Panarello, H.O

2001-01-01

The strontium, carbon and oxygen isotopic signal of the past oceans is accurately recorded by authigenic marine minerals such as carbonates, sulfates and phosphates. The variation of these isotope ratios through the geological time is used as a tool in correlating and dating marine sedimentary rocks. Many works have been done concerning to the changes in carbon, oxygen and strontium isotope ratios of different marine successions in the world. These allow the construction of curves of secular variations of the isotope signals with geological time (Jones et al., 1994a, 1994b; Veizer et al., 1999; Jacobsen and Kaufman, 1999). This work presents strontium, carbon and oxygen isotope ratios of Early Jurassic biogenic marine carbonates of Cuenca Neuquina in southwestern Mendoza (au)

Eco-technocratic Device: the Case of the Agro-industrial Water Management in Mendoza – Argentina

Directory of Open Access Journals (Sweden)

Jorge Daniel Ivars

2017-01-01

Full Text Available This paper aims to unravel the formation of an eco-technocratic device behind the "techno-ecological practices" of some integrated agro-food producers. These practices are based on technologies that operate articulating power relations of these actors in connection to world agro-foods markets. The article has an interpretive emphasis and is based on analysis of information generated from in-depth interviews to businessmen of the wine, canning, oil and livestock industries with international commercial links and located in the oasis of the Mendoza river in Argentina. Throughout the paper we analyze certain "techno-ecological practices" and how they are embedded into a specific device that locates and differentiates these entrepreneurs not only in international markets, but also before State and society.

Tomographic and analog 3-D simulations using NORA. [Non-Overlapping Redundant Image Array formed by multiple pinholes

Science.gov (United States)

Yin, L. I.; Trombka, J. I.; Bielefeld, M. J.; Seltzer, S. M.

1984-01-01

The results of two computer simulations demonstrate the feasibility of using the nonoverlapping redundant array (NORA) to form three-dimensional images of objects with X-rays. Pinholes admit the X-rays to nonoverlapping points on a detector. The object is reconstructed in the analog mode by optical correlation and in the digital mode by tomographic computations. Trials were run with a stick-figure pyramid and extended objects with out-of-focus backgrounds. Substitution of spherical optical lenses for the pinholes increased the light transmission sufficiently that objects could be easily viewed in a dark room. Out-of-focus aberrations in tomographic reconstruction could be eliminated using Chang's (1976) algorithm.

Boeravinone B, A Novel Dual Inhibitor of NorA Bacterial Efflux Pump of Staphylococcus aureus and Human P-Glycoprotein, Reduces the Biofilm Formation and Intracellular Invasion of Bacteria.

Science.gov (United States)

Singh, Samsher; Kalia, Nitin P; Joshi, Prashant; Kumar, Ajay; Sharma, Parduman R; Kumar, Ashok; Bharate, Sandip B; Khan, Inshad A

2017-01-01

This study elucidated the role of boeravinone B, a NorA multidrug efflux pump inhibitor, in biofilm inhibition. The effects of boeravinone B plus ciprofloxacin, a NorA substrate, were evaluated in NorA-overexpressing, wild-type, and knocked-out Staphylococcus aureus (SA-1199B, SA-1199, and SA-K1758, respectively). The mechanism of action was confirmed using the ethidium bromide accumulation and efflux assay. The role of boeravinone B as a human P -glycoprotein ( P -gp) inhibitor was examined in the LS-180 (colon cancer) cell line. Moreover, its role in the inhibition of biofilm formation and intracellular invasion of S. aureus in macrophages was studied. Boeravinone B reduced the minimum inhibitory concentration (MIC) of ciprofloxacin against S. aureus and its methicillin-resistant strains; the effect was stronger in SA-1199B. Furthermore, time-kill kinetics revealed that boeravinone B plus ciprofloxacin, at subinhibitory concentration (0.25 × MIC), is as equipotent as that at the MIC level. This combination also had a reduced mutation prevention concentration. Boeravinone B reduced the efflux of ethidium bromide and increased the accumulation, thus strengthening the role as a NorA inhibitor. Biofilm formation was reduced by four-eightfold of the minimal biofilm inhibitory concentration of ciprofloxacin, effectively preventing bacterial entry into macrophages. Boeravinone B effectively inhibited P -gp with half maximal inhibitory concentration (IC 50 ) of 64.85 μM. The study concluded that boeravinone B not only inhibits the NorA-mediated efflux of fluoroquinolones but also considerably inhibits the biofilm formation of S. aureus. Its P -gp inhibition activity demonstrates its potential as a bioavailability and bioefficacy enhancer.

Arvo Pärt: Kui kannatab üks inimene, siis kannatab kogu maailm! / Arvo Pärt, Nora Pärt ; intervjueerinud Yana Toom, Maarja-Liis Arujärv, Aleksandr Zukerman ; kommenteerinud Edgar Savisaar

Index Scriptorium Estoniae

Pärt, Arvo, 1935-

2010-01-01

Arvo Pärt ja tema abikaasa Nora Pärt andsid Türgis enne Pärdi uudisteose "Aadama itk" esiettekannet intervjuu, kus rääkisid nii nende raskustest Läände elama asumisel kui uudisteose sügavamast mõttest

Simulação computacional, projeto, construção e análise do desempenho de uma matriz para extrusão em canal angular dedicada ao processamento de chapas

OpenAIRE

Phillip Springer

2012-01-01

O presente trabalho descreve o projeto, construção e testes de uma matriz de Extrusão em Canal Angular (ECA) dedicada ao processamento de amostras em forma de chapa. O parâmetro construtivo fundamental de uma matriz deste tipo é a geometria dos canais, especialmente o ângulo de encontro dos mesmos e os raios de curvatura nesse ponto. O material de trabalho empregado é o Al comercial AA1050. A motivação deste projeto é prover o ferramental necessário para produção de amostras que serão utiliza...

Nueva ruralidad en territorios periféricos: los productores caprinos del noreste de Mendoza (Argentina

Directory of Open Access Journals (Sweden)

Laura María Torres

2008-07-01

Full Text Available Lately, several authors have been analyzing the changes in rural areas triggered by globalization. The concepts of new rurality and pluriactivity have allowed progress along these lines, highlighting the new difficulties facing the most vulnerable sectors. This study explores the transformation of peripheral rural territories in Mendoza (Argentina, particularly those that have been thought of as isolated and traditional. This research develops from a case study, combines quantitative and qualitative methods, and takes the production undertakings happening in those lands as units of analysis. Production and economic situations of the past are compared to those in the present. The tendency toward pluriactivity is here considered as a response to the new conditions, and also as an expression of the process of articulation with the capitalist system.

The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'

Energy Technology Data Exchange (ETDEWEB)

NONE

1961-06-22

The text of the Supply Agreement between the Agency and the Governments of Norway and of the United States of America, and the text of the related Project Agreement between the Agency and the Government of Norway concerning an Agency project for cooperation in carrying out a joint program of research in reactor physics with the zero power reactor 'NORA', are reproduced in this document for the information of all Members of the Agency.

The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'

International Nuclear Information System (INIS)

1961-01-01

The text of the Supply Agreement between the Agency and the Governments of Norway and of the United States of America, and the text of the related Project Agreement between the Agency and the Government of Norway concerning an Agency project for cooperation in carrying out a joint program of research in reactor physics with the zero power reactor 'NORA', are reproduced in this document for the information of all Members of the Agency

Evaluation report of the Nordic emergency exercise Nora - January 14, 1993

International Nuclear Information System (INIS)

Salo, A.; Singer, K.; Aakesson, T.; Valfells, A.; Backe, S.; Kallhagen, B.

1993-01-01

Nordic countries are signatories to the Convention on Early Notification of a Nuclear Accident and to the Convention on Assistance in Case of a Nuclear Accident or Radiological Emergency. In addition to these international conventions the states, except Iceland, have bilateral agreements on early notification and exchange of information with each other and with neighbouring countries. The bilateral agreements also require notification if levels of radionuclide contamination are observed which prompt information to the public or activation of the emergency organization or part of it. The main objective of the exercise NORA was to test and harmonize the overall decision making in the responsible Nordic approach to the emergency response, to improve co-operation in assessing rumour-, threat- and accident-situations, to improve co-operation in making decisions on intervention levels and on interventions in a Nordic perspective, to enhance harmony in information policy concerning information to the public in order to avoid ''double messages'', to improve information exchange between the Nordic countries and internationally. The objectives of the exercise were considered to have been met satisfactorily and the exercise made a valuable contribution to further develop the Nordic co-operation. (EG)

Flood risk assessment. Case of study: Motozintla de Mendoza, Chiapas, Mexico

Directory of Open Access Journals (Sweden)

David A. Novelo-Casanova

2016-09-01

Full Text Available Due to its geographical location, the community of Motozintla de Mendoza (Motozintla in the State of Chiapas, Mexico, is continuously exposed to the impact of natural hazards. In this work, we assessed the flood risk of Motozintla considering the structural, socioeconomic, organizational, and global (structural, socioeconomic, and organizational vulnerabilities. In addition, we also measured the local risk perception. Spatial maps were generated to determine the most vulnerable and risk areas of this community. Our results indicate that the population has a high level of risk to flooding mainly because (1 the majority of the local houses has high structural vulnerability; (2 a high percentage of the families has a daily income less than the official Mexican minimum wage and lacks of basic public services as well as of proper social security services; (3 most of the community does not know any existing Civil Protection Plan; and (4 the community organization for disaster mitigation and response is practically non-existent. For these reasons, we believe that it is necessary for local authorities to establish in the short-term, preparedness, mitigation and response plans as well as land-use measures to reduce the risk to floods in Motozintla.

The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Program of Research with the Zero Power Reactor 'NORA'. Modification of the Supply Agreement

International Nuclear Information System (INIS)

1961-01-01

Pursuant to Section 15 of the 'Contract for the Lease of Enriched Uranium' for the NORA reactor, the United States Atomic Energy Commission has reduced, with effect from 1 January 1962, the rates of the Use Charge specified in Section II(a) and of the Consumption Charge specified in Section II(b)

The Texts of the Instruments relating to a Project for a Joint Agency-Norwegian Programme of Research with the Zero Power Reactor 'NORA'. Text of a Supplementary Agreement

International Nuclear Information System (INIS)

1962-01-01

The text of a Supplementary Agreement to amend the Supply Agreement concerning the NORA project, which Supplementary Agreement was approved by the Board of Governors on 18 June 1962 and which entered into force on 3 September 1962, is reproduced in this document for the information of all Members of the Agency

Espectro trófico de Chelonoidis chilensis (Chelonii: Testudinidae en la provincia fitogeográfica del monte (Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Richard, Enrique

1994-01-01

Full Text Available Between 1983 and 1991, 83 field trips were made to the biogeographical province of Monte, in Mendoza province, Argentina, in order to study the trophic spectrum of Chelonoidis chilensis, among other ecoethological aspects. The trophic period extends from September to April. Adults are herbivorous in strict sense, but this may change according to the available resourees. Trophic spectrum is composed by 14 items (Families of vegetables. Some items have toxic or potentially toxit substances. Finally, the diet of Ch. chilensis is compared with the one of Ch. donosobarrosi and with other desert tortoises.

Evaluación de la fuerza de doblado y de fricción en el conformado de chapa de acero inoxidable AISI 304 DDQ mediante ensayos de doblado en condiciones multiaxiales de embutición

Directory of Open Access Journals (Sweden)

Coello, J.

2012-08-01

Full Text Available Die radius is a critical area from the viewpoint of friction in forming processes. Moreover the sheet, that has been previously deformed in flange area, suffers bending and unbending stresses. Then, die-sheet contact in die radius must be especially considered in order to guarantee the suitable lubrication conditions. In the present work, a test method is carried out for evaluating an AISI 304 DDQ steel under similar conditions to those existing in the die radius area and that, usually, are not really reproduced in traditional bending under tensions tests. Deformation under pure shear condition, the bending and the radius angle have been established as variables of the tests. Results allow to obtain the apparent pressure sheet-bending tool, that increases with bending angle and decreases with tool radius. This last variable is the most significant while the bending angle has lesser influence. Although experimental results present some concordances with values obtained by analytical methods, some corrections must be considered in them in order to improve the theoretical values.

El radio de entrada a la matriz se considera una de las zonas críticas en los procesos de conformado de chapa mediante embutición profunda. El análisis de la fuerza de fricción y de doblado existentes resulta importante para predecir el comportamiento de la chapa en dicha zona, así como para garantizar una lubricación adecuada a las condiciones de procesado. En el presente trabajo, se aplica un método de ensayo que evalúa las acciones en el proceso de doblado del acero AISI 304 DDQ bajo condiciones similares a las que sufre el material en los procesos de embutición y que no son reproducidas por los clásicos ensayos de doblado bajo tensión. Se establecen como variables la deformación experimentada previamente por el material en condiciones típicas de cortante puro, “pure shear”, el ángulo de doblado y el radio de doblado. Los resultados obtenidos

Comercio y producción en el proceso de desarrollo capitalista en la provincia de Mendoza, Argentina, 1850-1915, De fábrica de carne y grasa a fábrica de vinos

Directory of Open Access Journals (Sweden)

Rodolfo Richard-Jorba

2010-06-01

Full Text Available El trabajo estudia los dos modelos económicos y sociales que tuvieron vigencia en Mendoza entre 1870 y 1915. El primero, de ganadería comercial con agricultura subordinada, estaba centrado en el negocio de compra de ganado en el este del país, su engorde en los oasis mendocinos y su exportación a Chile. La modernización capitalista impuso el modelo agroindustrial vitivinícola orientado al mercado interno formando una de las primeras economías regionales de Argentina. El análisis de los modelos muestra las características centrales de cada uno y el proceso de grandes transformaciones económicas, sociales, políticas y territoriales que experimentó la provincia.This paper studies the two economical and social models that were in vogue in Mendoza between 1870 and 1915 which was oudined by the author's research. The commercial livestock with subordinate agriculture was centered on the buying of cattle in the eastern part of the country, its fattening in the oasis of Mendoza and its export to Chile. The capitalist modernization imposed the viticulture agro industrial model directed to the internal market. This model developed one of the regional economy of Argentine. The analysis of these two models shows the principal characteristics of each and the process of great economical, social, politics and territorial transformations of the province.

Utilização de fibras (epicarpo de babaçu como matéria-prima alternativa na produção de chapas de madeira aglomerada Use of babaçu staple fiber as alternative raw material for panel production

Directory of Open Access Journals (Sweden)

Ademi Moraes Lima

2006-08-01

Full Text Available O objetivo deste trabalho foi avaliar a utilização de fibras (epicarpo de babaçu (Orbignya spp em combinação com partículas de Pinus elliottii em diferentes proporções na confecção de chapas de madeira aglomerada, bem como avaliar o efeito de dois teores de adesivo à base de uréia-formaldeído. As chapas foram prensadas a 160 ºC, utilizando-se dois níveis de resinas (6 e 8%, base peso seco de partículas e tempo de prensagem de 10 min, obtendo-se oito tratamentos. Para cada tratamento foram feitas três repetições, totalizando 24 chapas, com densidade nominal de 0,70 g/cm³. As propriedades avaliadas foram: flexão estática - módulo de ruptura (MOR e módulo de elasticidade (MOE; tração perpendicular-ligação interna (LI; estabilidade dimensional - inchamento em espessura (IE 2 e 24 horas e absorção de água (AA 2 e 24 horas, de acordo com a norma ASTM D 1037-91. O aumento do teor de fibras de babaçu associado ao aumento no teor de adesivo contribuiu para a redução nos valores de inchamento em espessura e absorção de água. O aumento do teor de adesivo de 6 para 8% foi fundamental para a melhoria das propriedades inchamento em espessura, absorção em água, módulo de ruptura e módulo de elasticidade. Utilizando até 30% de fibras de babaçu na composição das chapas, os valores de MOR foram superiores aos estabelecidos pela CS 236-66.The objective of this work was to evaluate the use of babaçu (Orbignya spp fiber (epicarp in combination with particles of Pinus elliottii at different ratios in particleboard manufacturing, as well as evaluating the effect of different adhesive contents. The boards were pressed at 160 ºC, using two resin levels - 6% and 8% (particle dry weight basis and 10 min pressing time, totaling eight treatments, tree repetitions per treatment, totaling twenty four boards, with 0.70 g/cm³ nominal density. The evaluated properties were as follows: Static bending - modulus of rupture (MOR and

Diversity of Saccharomyces strains on grapes and winery surfaces: analysis of their contribution to fermentative flora of Malbec wine from Mendoza (Argentina) during two consecutive years.

Science.gov (United States)

Mercado, L; Dalcero, A; Masuelli, R; Combina, M

2007-06-01

Spontaneous fermentations are still conducted by several wineries in different regions of Argentina as a common practice. Native Saccharomyces strains associated with winery equipment, grape and spontaneous fermentations of Malbec musts from "Zona Alta del Río Mendoza" region (Argentina) were investigated during 2001 and 2002 in the same cellar. Low occurrence of Saccharomyces on grapes and their limited participation during fermentation were confirmed. Strain sequential substitution during fermentation was observed. Between 30% and 60% of yeast population at the end of fermentation was coming from yeasts already present in the winery. A stable and resident Saccharomyces micro-flora in the winery was confirmed. It exhibited a dynamic behaviour during season and between years. Commercial strains were found during fermentation in different percentages, but their presence on winery equipment was low. The present work represents a first approach to winery yeast and spontaneous fermentation Saccharomyces population dynamics in an important viticultural region from Argentina that has never been characterized before. The results obtained have an important significance for the local industry, showing for the first time the real situation of the microbial ecology of alcoholic fermentation in an industrial winery from Mendoza, Argentina.

Testing of a De Nora polymer electrolyte fuel cell stack of 1 kW for naval applications

Science.gov (United States)

Schmal, D.; Kluiters, C. E.; Barendregt, I. P.

In a previous study calculations were carried out for a navy frigate with respect to the energy consumption of a propulsion/electricity generation system based on fuel cells. The fuel consumption for the 'all-fuel cell' ship was compared with the consumption of the current propulsion/electricity generation system based on gas turbines and diesel engines; it showed potential energy savings of a fuel cell based system amounting from 25 to 30%. On the basis of these results and taking into account various military aspects it was decided to start tests with a polymer electrolyte fuel cell (PEFC) stack. For this purpose a De Nora 1 kW PEFC was chosen. Results of the first tests after installation are satisfying.

Panamericanismo femenino y protestantismo en México a través de la vida de la profesora Adelia Palacios Mendoza

OpenAIRE

Lau Jaiven, Ana; Rodríguez, Roxana

2014-01-01

El siguiente artículo explora el panamericanismo y el protestantismo desde la actuación femenina de una mujer metodista, maestra y científica: Adelia Palacios Mendoza. La importancia de estudiar la participación de esta mujer en el ámbito público, educativo y político radica en que Palacios transgredió el deber ser femenino de su época. A finales del siglo XIX y principios del XX, periodo en que Adelia sobresalió, el orden de género imperante recluía a las mujeres al espacio do...

Constitución y actividades de la Mesa Provincial de Educación Ambiental en la provincia de Mendoza, Argentina.

OpenAIRE

Gabriela Diaz Isenrath; T Bilbao; Cristian Barbosa; Susana Lagos Silnik; Nora Marlia; Silvia Musso; Oscar Ongay Ugarteche; Mirta Zarate; Elba Alicia Pescetti de Cristaldo; Mauricio Bucheri; Flora Bertolotti

2015-01-01

La Educación Ambiental como actividad interdisciplinaria e interinstitucional, requiere de la planificación estratégica participativa, que permita la concreción de esfuerzos que suelen realizarse de manera aislada. Se expone el proceso llevado a cabo para la constitución de la Mesa de Educación Ambiental en la provincia de Mendoza, Argentina. A partir de la discusión sobre la problemática local del Cambio Climático y los requerimientos de  medidas de adaptación, se propone el espacio en el añ...

NorA efflux pump inhibitory activity of coumarins from Mesua ferrea.

Science.gov (United States)

Roy, Somendu K; Kumari, Neela; Pahwa, Sonika; Agrahari, Udai C; Bhutani, Kamlesh K; Jachak, Sanjay M; Nandanwar, Hemraj

2013-10-01

The purpose of this investigation was to study the modulator and efflux pump inhibitor activity of coumarins isolated from Mesua ferrea against clinical strains as well as NorA-over expressed strain of Staphylococcus aureus 1199B. Seven coumarins were tested for modulator activity using ethidium bromide (EtBr) as a substrate. Compounds 1, 4-7 modulated the MIC of EtBr by ≥ 2 fold against wild type clinical strains of S. aureus 1199 and S. aureus 1199B, whereas compounds 4-7 modulated the MIC of EtBr by ≥ 16 fold against MRSA 831. Compounds 1, 4-7 also reduced the MIC of norfloxacin by ≥ 8 fold against S. aureus 1199B, and 4-6 reduced the MIC of norfloxacin by ≥ 8 fold against MRSA 831 at half of their MICs. Inhibition of EtBr efflux by NorA-overproducing S. aureus 1199B and MRSA 831 confirmed the role of compounds 4-6 as NorA efflux pump inhibitors (EPI). Dose-dependent activity at sub-inhibitory concentration (6.25 μg/mL) suggested that compounds 4 and 5 are promising EPI compared to verapamil against 1199B and MRSA 831 strains. © 2013.

Resistencias al orden formalizado por la Constitución de Mendoza de 1854 en el ámbito de la campaña

Directory of Open Access Journals (Sweden)

Inés Sanjurjo de Driollet

2004-01-01

Full Text Available The work analyzes the effective application of the principles of the modern constitutionalism in Mendoza after it was formalized the liberal order by means of the Constitution of 1854. The investigation tries to quarrel if in the period of this constitution life (1854-1895, nevertheless the bigger complexity of the state mechanisms and the politics of strengthening the legal authority on the territory, there were spaces that escaped to this power, or practices resistant to the principles in vogue. The work has put on particular attention to the rural localities, which for the distances or small accessibility, is estimated they were less inclined to the changes and less exposed to the state control.El trabajo analiza la efectiva aplicación de los principios del moderno constitucionalismo en Mendoza luego de formalizado el orden liberal mediante la carta magna provincial de 1854. Trata de averiguar, si en el período de su vigencia (1854-1895, no obstante el proceso de complejización del aparato estatal y la política de afianzamiento de su potestad sobre el territorio, quedaron espacios que escaparon a ese poder, o se dieron prácticas resistentes a los principios en boga. Se ha puesto particular atención a las localidades de la campaña, que por las distancias o la poca accesibilidad, se estima eran poco proclives a los cambios y estaban menos expuestas al control estatal.

Arquitectura moderna: autores y producción en Mendoza - Argentina (1930-1970

Directory of Open Access Journals (Sweden)

Cecilia Raffa

2013-06-01

Full Text Available Este trabajo propone trazar un panorama general del desarrollo de la Arquitectura Moderna en Mendoza entre 1930 y 1970, a través de los autores y obras más significativos. La producción arquitectónica lograda en el período, en el presente de valor patrimonial, no cuenta con acciones gubernamentales ni legislación de protección. Esto se debe a dos razones concurrentes: La primera, desde el imaginario social el recorte temporal de lo patrimonial finaliza con la arquitectura de los años ’20 del siglo pasado. La segunda razón, la estética y la vigencia funcional de estas obras impiden poner la distancia crítica que requiere toda mirada histórica, aún más desde lo cultural. Vamos a revisar algunos autores a partir de sus trayectorias y su producción arquitectónica, con el objetivo de descubrir las singularidades de la producción local, haciendo aportes para la valoración de estos bienes y por ende para su patrimonialización.

Attaching the NorA Efflux Pump Inhibitor INF55 to Methylene Blue Enhances Antimicrobial Photodynamic Inactivation of Methicillin-Resistant Staphylococcus aureus in Vitro and in Vivo.

Science.gov (United States)

Rineh, Ardeshir; Dolla, Naveen K; Ball, Anthony R; Magana, Maria; Bremner, John B; Hamblin, Michael R; Tegos, George P; Kelso, Michael J

2017-10-13

Antimicrobial photodynamic inactivation (aPDI) uses photosensitizers (PSs) and harmless visible light to generate reactive oxygen species (ROS) and kill microbes. Multidrug efflux systems can moderate the phototoxic effects of PSs by expelling the compounds from cells. We hypothesized that increasing intracellular concentrations of PSs by inhibiting efflux with a covalently attached efflux pump inhibitor (EPI) would enhance bacterial cell phototoxicity and reduce exposure of neighboring host cells to damaging ROS. In this study, we tested the hypothesis by linking NorA EPIs to methylene blue (MB) and examining the photoantimicrobial activity of the EPI-MB hybrids against the human pathogen methicillin-resistant Staphylococcus aureus (MRSA). Photochemical/photophysical and in vitro microbiological evaluation of 16 hybrids carrying four different NorA EPIs attached to MB via four linker types identified INF55-(Ac)en-MB 12 as a lead. Compound 12 showed increased uptake into S. aureus cells and enhanced aPDI activity and wound healing effects (relative to MB) in a murine model of an abrasion wound infected by MRSA. The study supports a new approach for treating localized multidrug-resistant MRSA infections and paves the way for wider exploration of the EPI-PS hybrid strategy in aPDI.

Facies and carbon/oxygen isotopes of the Calabozo Formation (Middle Jurassic), Arroyo La Vaina, Mendoza, Argentina

International Nuclear Information System (INIS)

Cabaleri, N.G.; Valencio, S.A.; Cagnoni, M.C.; Ramos, A.M.; Armella, C.; Panarello, H.O; Riccardi, A.C

2001-01-01

Facial / microfacial studies and geochemical isotopic analyses on marine jurassic carbonates of the Calabozo Formation (Dessanti, 1973) were carried out to reconstruct the palaeoenvironment and postdepositional history of the unit. This study is part of a project which purpose is the sedimentological and geochemical characterization of the Jurassic carbonate sequences of Cuenca Neuquina, in the southwestern Mendoza, Argentina. A detailed description about this basin can be found in Legarreta and Uliana (1999) and Riccardi et al. (2000). During the Late Bathonian and Early Callovian, the basin showed a reduction of the sedimentation area and a marked marginal facies progradation. West of Malargue, in areas with low detritic contribution, limestones of the Calabozo Formation were deposited. At the end of the Early Callovian, the basin was isolated, prevailing hypersaline conditions which caused the accumulation of the evaporites of the Tabanos Formation (Stipanicic, 1966) (au)

El tropero y el origen de la burguesía en el Cono Sur (Mendoza, siglo XVIII

Directory of Open Access Journals (Sweden)

Lacoste, Pablo

2005-01-01

Full Text Available Este artigo aprofunda a análise sobre a carreta e o tropeiro, para definir em que medida contribuíram para o processo de construção de uma cultura empresarial na América Colonial, levando ao surgimento de uma burguesia. Atenta-se, em especial, para temas como mobilidade social, riscos empresariais, fomento do crédito em confiança ou por hipoteca de carretas, circulação de idéias e configuração de um ethos capitalista. Este trabalho constitui a continuação e a conclusão de um anterior intitulado "Carretas y transporte terrestre bioceánico: la ruta Buenos Aires-Mendoza en el siglo XVIII" (Estudos Ibero-Americanos, vol. XXXI, nº 1, 2005

INFLUÊNCIA DE PARÂMETROS GEOMÉTRICOS NO COMPORTAMENTO DA LIGAÇÃO MISTA VIGA-PILAR PREENCHIDO COM CHAPA PASSANTE

Directory of Open Access Journals (Sweden)

Silvana De Nardin

2016-11-01

Full Text Available RESUMO: Neste artigo é apresentado o desenvolvimento de um modelo numérico de ligação mista viga-pilar preenchido com chapa passante. Além do desenvolvimento do modelo, foram realizadas análises paramétricas com objetivo de avaliar a influência de parâmetros geométricos tais como taxa de armadura da laje, perfis de aço da viga mista e diâmetro dos parafusos. O estudo deu-se por meio das seguintes etapas: desenvolvimento de modelo numérico validado com base em resultados experimentais encontrados na literatura e posterior análise paramétrica. Para a modelagem numérica utilizou-se o pacote computacional Ansys® por meio do método dos elementos finitos. São apresentadas as principais diretrizes adotadas na escolha dos elementos finitos, propriedades dos materiais e relações constitutivas, condições de contorno e vinculações, carregamentos e outros aspectos referentes à modelagem numérica. Os resultados mostraram que dentre os parâmetros analisados, a taxa de armadura resultou no parâmetro mais significativo para a capacidade resistente da ligação mista. As principais contribuições do estudo compreendem, a apresentação da influência de determinados fatores na capacidade resistente da ligação mista viga-pilar com chapa passante, bem como a comprovação da eficácia da metodologia de estudo de ligações por meio de análises numéricas. ABSTRACT: In this paper is presented the development of a numerical model of a composite connection connecting a composite beam to a concrete filled steel tube column using a through steel plate. In addition to the development of the model, parametric analyses were performed in order to evaluate the influence of geometric parameters such as reinforcement ratio of slab, I-steel sections of composite beam and diameter of the bolts. The study came about through the following steps: development of numerical model validated by comparison with experimental results and after parametric

Mineralización de talco asociada a los cuerpos ultramáficos de la Faja del Río de Las Tunas, Cordillera Frontal de Mendoza

Directory of Open Access Journals (Sweden)

Gargiulo, María Florencia

2011-12-01

Full Text Available Talc mineralization related to the ultramafic bodies of the Río de Las Tunas belt, Frontal Cordillera of Mendoza province. This contribution shows the main characteristics of the talc mineralization related to the Río de Las Tunas ultramafic bodies in the Salamanca Mining District, Frontal Cordillera of Mendoza province. According to the parageneses defined on the studied samples, three generations of talc were established: 1º crystallized in metaperidotites and related to the prograde stage of the regional metamorphism; 2º crystallized inreaction zones (mostly in the talc zone developed at the boundary between metaperidotites and their country-rocks.These reaction zones evidence a metasomatic process due to geochemical gradient between the ultramafic body and their country-rocks. This process was developed during the retrogression of the regional metamorphic cycle. 3º Talc present in shear-zones that cut across the ultramafic bodies. The extreme serpentinization of the ultramaficbodies is concentrated in shear-zones where the serpentine is subsequently replaced by talc ± carbonates related with a hydrothermal stage. Aqueous fluids relatively enriched in CO2 flowed through these shear-zones causing the cease of serpentine formation favoring the talc and/or carbonates. Mined talc deposits are those in shear zones and reaction zones. They are mostly industrial-, asbestine- or talcschist-type. The talc related to the hydrothermal stage can locally reach first and extra qualities.

El Trabajo Social en la industrialización sustitutiva venezolana: en el caso de Empresas Mendoza

Directory of Open Access Journals (Sweden)

Edgar Valero Julio

2017-01-01

Full Text Available Este artículo analiza las prácticas de bienestar laboral en Empresas Mendoza (1926-1990 —el grupo industrial más importante en la etapa de industrialización sustitutiva venezolana— y la contribución del Trabajo Social a estructurar y profesionalizar el más avanzado sistema asistencial empresarial desde mediados del siglo XX. La autonomía y dinámica alcanzada por las exponentes de esta profesión, sumadas a la puesta en práctica de acciones determinadas por los valores paternalistas y rentísticos de los directivos y las directivas de esta empresa, permitió conformar en el campo empresarial un espacio idóneo para su actividad e hizo posible que se emprendiera un interesante proceso de autocrítica y replanteamiento del Trabajo Social en Venezuela durante los años setenta.

Projectile motion in Diego Hurtado de Mendoza's Mecánica and new Renaissance dynamics

Directory of Open Access Journals (Sweden)

Iommi Echeverría, Virginia

2011-06-01

Full Text Available This article considers Diego Hurtado de Mendoza’s translation of the Aristotelian Mechanics in relation to the humanistic and scientific Italian environment of the Renaissance. From the analysis of the last problems on dynamics, it demonstrates the affinity with the works of Piccolomini and Cardano. It also shows the originality of the exegesis made by the Spanish author of Problem XXXIV, in which he combines latemedieval physics with the Aristotelian explanation.Este artículo examina la traducción hecha por Diego Hurtado de Mendoza de la Mecánica aristotélica en el contexto del ambiente científico-humanista italiano de mediados del siglo XVI. A partir del análisis de los últimos problemas sobre dinámica, se demuestra su estrecha relación con las obras de Piccolomini y Cardano; sugiriéndose además la originalidad de la interpretación hecha por el autor español del problema XXXIV basada en la combinación de la física tardomedieval y la explicación aristotélica.

Propriedades de chapas de flocos fabricadas com adesivo de uréia-formaldeído e de taninos da casca de Eucalyptus grandis W. Hill ex Maiden ou de Eucalyptus pellita F. Muell. Properties of flakeboards made from urea-formaldehyde and bark tannins adhesives of Eucalyptus grandis or Eucalyptus pellita

Directory of Open Access Journals (Sweden)

Angélica de Cássia Oliveira Carneiro

2004-10-01

Full Text Available Os taninos foram extraídos da casca de Eucalyptus grandis e Eucalyptus pellita, com água quente, à qual se adicionaram 4,5% de sulfito de sódio, durante três horas. As temperaturas da solução foram iguais a 70 e 100 ºC para Eucalyptus grandis e Eucalyptus pellita, respectivamente. Para a produção dos adesivos e com o intuito de reduzir a sua viscosidade, os taninos foram sulfitados com sulfito de sódio e ácido acético. Formulações adesivas foram preparadas adicionando-se 0, 25, 50, 75 ou 100% de adesivos tânicos ao adesivo comercial de uréia-formaldeído. Foram fabricadas chapas de flocos de Pinus elliottii Engelm. e Eucalyptus grandis, utilizando-se 8% da formulação adesiva. As propriedades das chapas foram determinadas segundo a norma ASTM D-1037, de 1993. Observou-se que as propriedades das chapas foram superiores ao mínimo estabelecido pela norma ANSI/A 280.1-93, exceto no caso da resistência à umidade. Verificou-se, ainda, que o emprego de uma formulação adesiva contendo resina à base de uréia-formaldeído e tanino-formaldeído pode melhorar algumas propriedades.Bark tannins of Eucalyptus grandis and Eucalyptus pellita were extracted with 4,5% sodium sulfite in hot water solution for a period of three hours. Solution temperatures were 70 and 100ºC, for Eucalyptus grandis and Eucalyptus pellita bark respectively. Tannins were reacted with acetic acid and sodium sulfite to reduce adhesive viscosity. Adhesive formulations were prepared adding 0, 25, 50, 75 or 100% of tannin adhesives to the commercial urea-formaldehyde adhesive. Flakeboards were fabricated with 8% resin content. Board properties were determined according to ASTM D-1037 standards. Except for humidity, all board properties were superior to the values established by ANSI.A 208.1-93 commercial standard. Addition of tannins to the urea-formaldehyde adhesive improved some properties.

FORMACIÓN, CRISIS Y REORIENTACIONES DE LA VITIVINICULTURA EN MENDOZA Y SAN JUAN, 1970-2000. APORTES PARA EL ESTUDIO DEL SECTOR EN LA ARGENTINA

Directory of Open Access Journals (Sweden)

Rodolfo Richard-Jorba

2006-12-01

Full Text Available Las actuales provincias de Mendoza y San Juan, localizadas en el árido centro-oeste argentino, llevan a cabo sus actividades económicas principales en grandes oasis de regadío, pequeñas porciones del territorio, en las cuales se concentra más del 95% de la población. A lo largo de su historia los productos de sus viñedos fueron dotándolas de una clara identidad hasta conformar lo que hoy conocemos como la gran Región Vitivinícola Argentina.

Distribución espacio-temporal de larvas de Chironomidae (Diptera en un arroyo andino (Uspallata, Mendoza, Argentina Spatial and temporal distribution of larvae of Chironomidae (Diptera in an Andean stream (Uspallata, Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Erica E. Scheibler

2008-12-01

Full Text Available Se realizó un estudio sobre la composición larval de la familia Chironomidae en un arroyo andino en la localidad de Uspallata (Mendoza, Argentina. Se realizaron muestreos estacionales durante un ciclo anual completo (2001/2002 en tres sitios, siguiendo un gradiente altitudinal. Se midieron variables físico-químicas en campo y laboratorio. La relación entre presencia y abundancia de quironómidos y parámetros ambientales se exploró mediante un análisis de Correspondencia Canónica. Se identificaron siete géneros pertenecientes a cuatro subfamilias: Chironominae, Orthocladiinae, Podonominae y Tanypodinae. Orthocladiinae fue la subfamilia que tuvo mayor riqueza genérica (Cricotopus van der Wulp, Onconeura Andersen & Saether y Parametriocnemus Goetghebuer, densidad y frecuencia de aparición a nivel estacional y espacial. Podonominae (Podonomus Philippi y Podonomopsis Brundin se halló únicamente en SA mientras que Chironominae (Polypedilum Kieffer estuvo presente en UD. Tanypodinae (Pentaneura Philippi se encontró en los tres sitios de muestreo aunque con una densidad menor. Se detectó incremento de la conductividad y temperatura del agua, y disminución del tamaño del sustrato desde SA a UD, lo que coincide con la desaparición de Podonomus y Podonomopsis y la aparición de Polypedilum hacia UD. De este estudio se concluye que el sistema presenta baja riqueza genérica comparada con otros sistemas montañosos de Argentina.A study was conducted on the larval composition of the family Chironomidae in an Andean stream in Uspallata locality (Mendoza, Argentina. Seasonal samplings were performed over a full annual cycle (2001/2002 at three sites, along an altitudinal gradient. Physical and chemical variables were measured in both the field and the laboratory. Relationship between presence and abundance of chironomids and environmental parameters was explored using a Canonical Correspondence analysis. Seven genera were identified

Ciclos tectónicos, volcánicos y sedimentarios del Cenozoico del sur de Mendoza-Argentina (35°-37°S y 69°30'W Cenozoic tectonic, volcanic and sedimentary cycles in southern Mendoza Province, Argentina (35°-37°S y 69°30'W

Directory of Open Access Journals (Sweden)

Ana María Combina

2011-01-01

Full Text Available En este trabajo se describe la estratigrafía sedimentaria y volcánica asociada a los procesos de deformación de las unidades con edades del Cretácico Tardío al Plioceno Tardío aflorantes en el sur de Mendoza, Argentina, entre los ríos Atuel y Barrancas en el ámbito de la Cordillera Principal. Se proponen tres ciclos tectovolcano-sedimentarios, limitados por discordancias regionales generadas por la acción de las Fases Incaica, Quechua, Pehuenche y Diaguita. El primer ciclo comprende las unidades volcánicas y sedimentarias del Cretácico Superior hasta el Oligoceno Superior (Formaciones Roca y Pircala-Coihueco y el Ciclo Eruptivo Molle. El segundo abarca desde el Oligoceno Tardío al Mioceno Tardío (Formación Agua de la Piedra y las Andesitas Huincán. Por último, el tercer ciclo comprende desde el Mioceno Tardío al Plioceno (Formaciones Butaló, Pincheiras, Loma Fiera, Río Diamante y las Andesitas La Brea.This article describes the volcanic and sedimentary stratigraphy and their associated proces-ses with the Andean deformation during the Late Cretaceous to Late Pliocene. The studied área is located between the Atuel and Barrancas rivers and the Main Cordillera, in southern Mendoza, Argentina. Three tectovolcano-sedimentary cycles limited by regional discordances (Inca, Quechua, Pehuenche and Diaguita are proposed. The first comprises Upper Oligocene to Upper Miocene volcanic and sedimentary units (Roca and Pircala-Coihueco formations and the Volcanic Cycle Molle. The second extends from the Late Oligocene to Late Miocene (Agua de la Piedra Formation and the Huincán Andesites volcanic cycle. Finally, the third cycle ranges from the Late Miocene to Pliocene (Butaló, Pincheiras, Loma Fiera and Rio Diamante formations and La Brea Andesites.

El proceso de contaminación hídrica en un oasis andino. La vida y la muerte por las acequias de Mendoza, Argentina, 1880-1980

OpenAIRE

María del Rosario PRIETO; Teresita Castrillejo; Patricia Dussel

2006-01-01

El objetivo de este artículo es estudiar, mediante evidencias documentales, el proceso de contaminación hídrica en el oasis norte de la provincia de Mendoza, desde el comienzo del desarrollo industrial (1880) hasta la actualidad, para explicar las causas del deterioro ambiental en el presente y proponer manejos hídricos alternativos. Se ha analizado también la evolución de las representaciones sociales acerca de la contaminación hídrica.

Capitalist modernization and poverty in Mendoza, Argentina. Agroindustrial development and working class life conditions, 1890-1918

Directory of Open Access Journals (Sweden)

Rodolfo Richard-Jorba

2012-08-01

Full Text Available During the last decade of the XIX century and the first two decades of the XX, the argentine province of Mendoza underwent substantial territorial, economical and society changes due to the advance of the capitalism, that formed one of the first regional economy of the country: the viticulture industry. The capitalist development produced an unknown economic expansion in which all the indicators increased in number: extent of the agrarian cultivation, wine vault installment, raise of the capacity of wine elaboration, technological improvement. Pertaining to society land subdivision, enterprise class arising and enlargement of the middle class. However, the majority of the popular sectors, enlarged by the overseas immigration, suffered life conditions characterized by low incomes which were maintained in face values during the studied period, and home and health problems that derived in the propagation of serious contagious disease and high children death rate. This article shows the contrast between a powerful productive forces development and the miserable conditions of population life.

N,N'-disubstituted cinnamamide derivatives potentiate ciprofloxacin activity against overexpressing NorA efflux pump Staphylococcus aureus 1199B strains.

Science.gov (United States)

Radix, Sylvie; Jordheim, Anne Doléans; Rocheblave, Luc; N'Digo, Serge; Prignon, Anne-Laure; Commun, Carine; Michalet, Serge; Dijoux-Franca, Marie-Geneviève; Mularoni, Angélique; Walchshofer, Nadia

2018-04-25

A multi-step procedure has been described which afforded satisfactory yields of N,N'-disubstituted cinnamamides derived from N-Boc-protected amino acids (Boc-Gly, Boc-Val, Boc-Phe). The key step of this synthesis was a regioselective RedAl reduction of an amide function in presence of a carbamate group. Next, these cinnamamides were evaluated in co-admnistration with ciprofloxacin as efflux pump inhibitors against two S. aureus strains, NorA overexpressing SA1199B and wild type SA1199. In parallel, their intrinsic toxicity was appreciated on human lung fibroblast MRC5 cells. Therefore, the cinnamamide combining both carbamate and indol-3-yl groups, was found to be the most active and one of the less toxic EPI and constituted a promising hit. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

Representaciones, turismo y Estado. Imágenes y discursos en torno de los paisajes culturales de Mendoza (Argentina

Directory of Open Access Journals (Sweden)

Cecilia Raffa

2012-01-01

Full Text Available En los últimos años, la provincia de Mendoza ha logrado consolidarse como uno de los principales destinos turísticos de Argentina: su paisaje la ha posicionado como lugar elegido por los turistas tanto nacionales como extranjeros. El trabajo que presentamos se propone refl exionar sobre los procesos dominantes que impulsaron la construcción del paisaje de la capital provincial, a través de la acción pública promovida por el Estado. Se analizan los procesos que los conducen, los actores que los encarnan y las imágenes resultantes que dan origen a la vez que nutren y renuevan las representaciones sociales sobre una ciudad que encuentra la clave de su identidad y gran parte de su desarrollo turístico, en el control y uso del agua.

The metamorphic basement of the Cordillera Frontal of Mendoza: New geochronologic and isotopic data

International Nuclear Information System (INIS)

Basei, Miguel; Ramos, Victor A.; Vujovich, Graciela I.; Poma, Stella

1998-01-01

The metamorphic rocks of the Cordillera Frontal exposed in the Cordon del Portillo, Mendoza were examined by Rb/Sr geochronology and Nd/Sm isotopic analysis. The Rb/Sr data defined a Devonian age for the last metamorphic episode, similar to the previous K/Ar and Ar/Ar ages obtained in this region and western Precordillera. The isotopic analysis identified three sets of model ages: 1.- The oldest corresponds to a set of meta sedimentary rocks with a model age of 1,400 to 1,700 Ma; 2.- A monzogranodiorite with a model age of 1,000 Ma; and 3.- Metabasites with model ages between 577 and 330 Ma. These rocks are interpreted as 1.- A typical Grenvillian derived basement; 2.- Late Paleozoic granitoids derived from a different Proterozoic basement; and 3.- Some Eopaleozoic metabasites tectonically inter fingered with the Grenvillian basement. These new data are coherent with the existence of a Laurentia derived terrane, Chilenia, that was separated by oceanic rocks from the basement of Pre cordillera during Eopaleozoic times. This last basement known as the Cuyania terrane, was also derived from Laurentia. (author)

Desarrollo poblacional de Diaspidiotus perniciosus (Hemiptera: Diaspididae en cultivos de manzano de San Carlos, Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Guillermo P. LOPEZ GARCIA

2011-01-01

Full Text Available Se estudió la bionomía de Diaspidiotus perniciosus Comstock (“escama de San José”, en manzanos de la variedad “Red delicious” de San Carlos, Mendoza, Argentina, durante los ciclos productivos 2007-2008 y 2008-2009. Se determinó el número de generaciones anuales y se estudiaron las fluctuaciones poblacionales asociadas a la integral térmica para la especie en esta región. D. perniciosus presenta dos generaciones superpuestas al ciclo del cultivo, mientras que las ninfas (N1 y N2 de la tercera generación se desarrollan solamente hasta el final de la temporada estival y pasan al estado de quiescencia, en el que permanecen durante el invierno. El desarrollo de D. perniciosus en esta zona coincide con el de esta especie en la zona frutícola del centro de Chile en cuanto al número de generaciones y al periodo de quiescencia invernal. La población quiescente en Chile está integrada predominantemente por ninfas del primer estadio (N1, mientras que en San Carlos, Mendoza, la población quiescente está integrada principalmente por ninfas del segundo estadio (N2. La similitudes entre ambas poblaciones se deben, probablemente, a las coincidencias en latitud, clima y especie hospedera. El impacto económico de D. perniciosus en la zona de estudio tiene mayor relevancia durante los meses de diciembre y enero, cuando se observa una alta incidencia de daños en los frutos y las hojas; este es el momento decisivo para implementar medidas de control fitosanitario. Estas deberán aplicarse en función de los máximos poblacionales de N1 que se producen con 600-650 Grados-Día (oD en diciembre y con 1.170-1.270oD en enero. En las temporadas en las que la densidad poblacional de la plaga es especialmente alta, podrían incorporarse medidas adicionales de control con 1.800-2.000oD durante el mes de abril. Los resultados de estos estudios representan una herramienta predictiva, que permitirá elaborar estrategias para el control de poblaciones de

Patterns of practice of regional nodal irradiation in breast cancer: results of the European Organization for Research and Treatment of Cancer (EORTC) NOdal Radiotherapy (NORA) survey.

Science.gov (United States)

Belkacemi, Y; Kaidar-Person, O; Poortmans, P; Ozsahin, M; Valli, M-C; Russell, N; Kunkler, I; Hermans, J; Kuten, A; van Tienhoven, G; Westenberg, H

2015-03-01

Predicting outcome of breast cancer (BC) patients based on sentinel lymph node (SLN) status without axillary lymph node dissection (ALND) is an area of uncertainty. It influences the decision-making for regional nodal irradiation (RNI). The aim of the NORA (NOdal RAdiotherapy) survey was to examine the patterns of RNI. A web-questionnaire, including several clinical scenarios, was distributed to 88 EORTC-affiliated centers. Responses were received between July 2013 and January 2014. A total of 84 responses were analyzed. While three-dimensional (3D) radiotherapy (RT) planning is carried out in 81 (96%) centers, nodal areas are delineated in only 51 (61%) centers. Only 14 (17%) centers routinely link internal mammary chain (IMC) and supraclavicular node (SCN) RT indications. In patients undergoing total mastectomy (TM) with ALND, SCN-RT is recommend by 5 (6%), 53 (63%) and 51 (61%) centers for patients with pN0(i+), pN(mi) and pN1, respectively. Extra-capsular extension (ECE) is the main factor influencing decision-making RNI after breast conserving surgery (BCS) and TM. After primary systemic therapy (PST), 49 (58%) centers take into account nodal fibrotic changes in ypN0 patients for RNI indications. In ypN0 patients with inner/central tumors, 23 (27%) centers indicate SCN-RT and IMC-RT. In ypN1 patients, SCN-RT is delivered by less than half of the centers in patients with ypN(i+) and ypN(mi). Twenty-one (25%) of the centers recommend ALN-RT in patients with ypN(mi) or 1-2N+ after ALND. Seventy-five (90%) centers state that age is not considered a limiting factor for RNI. The NORA survey is unique in evaluating the impact of SLNB/ALND status on adjuvant RNI decision-making and volumes after BCS/TM with or without PST. ALN-RT is often indicated in pN1 patients, particularly in the case of ECE. Besides the ongoing NSABP-B51/RTOG and ALLIANCE trials, NORA could help to design future specific RNI trials in the SLNB era without ALND in patients receiving or not PST. �

El arriero y el transporte terrestre en el Cono Sur (Mendoza, 1780-1800

Directory of Open Access Journals (Sweden)

Lacoste, Pablo

2008-12-01

Full Text Available This paper explores the muleteer as an economic actor in terrestrial transportation in South Cone, specially in the route across the Andes in order to connect Atlantic and Pacific markets. Since Mendoza’s customs records, this study has processed 120.000 freight-carrying mules to know the origin and destiny places, main routes, volume and kind of charge. The muleteer promoted an intensive activity in terms of transportation, trade and wine industry. As a result, he leaded the rise of a regional proto-bourgeoisie.

El artículo examina al arriero como actor económico en el transporte terrestre del Cono Sur, sobre todo en la ruta a través de la Cordillera de los Andes, para enlazar los mercados del Atlántico y el Pacífico. A partir de los manuales de Cargo y Data de la Aduana de Mendoza, se han procesado 120.000 mulas de carga para determinar los lugares de origen y destino, principales rutas, volumen y tipo de carga transportada. El arriero impulsó una intensa actividad en el transporte, el comercio y en la industria vitivinícola; como resultado, este actor promovió el surgimiento de una protoburguesía regional.

Diafragmas horizontais de piso em madeira, confeccionados com chapas de OSB e vigas I, submetido ao carregamento vertical - DOI: 10.4025/actascitechnol.v29i2.579

Directory of Open Access Journals (Sweden)

Altevir Castro dos Santos

2008-02-01

Full Text Available Este trabalho aborda construções em madeira sob a ótica de sistemas com estruturas leves; apresenta an疝ise computacional por meio de modelagem pelo metodo de elementos finitos de diafragmas de piso e vigas I, submetidas a ensaio de flexão a quatro pontos. O objetivo geral é avaliar a resistência e a rigidez de diafragmas horizontais, construçõos em Sistemas Leves de Madeira, quando submetidos a ações verticais. As análises foram realizadas por meio do programa computacional SAP2000 e foram avaliadas as influencias dos seguintes parametros: espaçamento entre vigas que constituem os elementos de ossatura do diafragma horizontal e o espaçamento entre pregos de fixação do contrapiso, composto por chapas de OSB – Oriented Strand Board. Ao final do trabalho, comparam-se os resultados obtidos a partir das análises numérica e teórica, e são apresentadas algumas conclusões.

Assessment of the risk of African swine fever introduction into Finland using NORA-a rapid tool for semiquantitative assessment of the risk.

Science.gov (United States)

Kyyrö, J; Sahlström, L; Lyytikäinen, T

2017-12-01

The NORA rapid risk assessment tool was developed for situations where there is a change in the disease status of easily transmissible animal diseases in neighbouring countries or in countries with significant interactions with Finland. The goal was to develop a tool that is quick to use and will provide consistent results to support risk management decisions. The model contains 63 questions that define the potential for entry and exposure by nine different pathways. The magnitude of the consequences is defined by 23 statements. The weight of different pathways is defined according to the properties of the assessed disease. The model was built as an Excel spreadsheet and is intended for use by animal health control administrators. As an outcome, the model gives the possible pathways of disease entry into the country, an overall approximation for the probability of entry and the subsequent exposure, an overall estimate for the consequences and a combined overall risk estimate (probability multiplied by magnitude of consequences). Model validity was assessed by expert panels. Outside Africa, African swine fever is currently established in Russia and Sardinia. In addition, there have been cases in both wild boar and domestic pigs in Latvia, Lithuania, Poland and Estonia. Finland has frequent contacts with Russia and Estonia, especially through passengers. The risk of African swine fever (ASF) introduction into Finland was tested with NORA for the situation in December 2015, when ASF was endemic in many parts of Russia, Africa and Sardinia and was present in Baltic countries and in Poland. African swine fever was assessed to have a high probability of entry into Finland, with high consequences and therefore a high overall risk. © 2017 Blackwell Verlag GmbH.

ANÁLISIS DE LA COBERTURA NIVAL DE LA CUENCA SUPERIOR DEL RÍO MENDOZA A PARTIR DE IMÁGENES MODIS

Directory of Open Access Journals (Sweden)

Leandro Cara

2016-06-01

Full Text Available El deshielo de la nieve acumulada durante el invierno en la cuenca alta del río Mendoza constituye el principal suministro de agua para la agricultura, la industria y el consumo humano en los sectores bajos adyacentes. Sin embargo, a pesar de su gran importancia, hay muy pocos estudios que permitan conocer y entender la variabilidad espacial y temporal de la nieve en este sector de los Andes Centrales de Argentina. En este trabajo presentamos una técnica para cuantificar la evolución diaria de la cobertura nival en esta cuenca basada en la integración de imágenes de los sensores MODIS Aqua y Terra para el período 2000 y 2014. La técnica muestra disminución en la pérdida de información por presencia de nubosidad y fue realizada utilizando herramientas y funciones de los lenguajes de programación Libres R y BASH. Las series de cobertura de nieve obtenidas muestran importantes variaciones estacionales con aumentos de la cobertura nival en invierno (58% de cobertura máxima en promedio y reducciones significativas en verano. Asimismo, se observa una importante variabilidad interanual con claras diferencias entre años secos (ej. 2010, con 12% de cobertura promedio y nevadores (ej. 2005, 32% de cobertura anual promedio. Los mapas de cobertura nival muestran además que los sectores con mayor persistencia de nieve coinciden con la ubicación de glaciares, en los sectores más elevados, protegidos y de menor insolación de la cuenca. Los resultados brindan información novedosa y relevante para conocer y entender de forma más completa la distribución y variabilidad de la cobertura nival en este sector de la cordillera. Los mismos pueden servir de base para múltiples aplicaciones incluyendo el modelado hidrológico de la cuenca del río Mendoza contribuyendo al manejo racional de sus recursos hídricos.

Inserciones laborales tempranas: Los jóvenes trabajadores agrícolas en el Valle de Uco, Mendoza, Argentina Early labor markets incorporations: Agricultural young workers in the Uco Valley, Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Gabriel I Bober

2011-06-01

Full Text Available Este artículo presenta las diferentes formas de inserción laboral de trabajadores jóvenes en el Valle de Uco, en la provincia de Mendoza. Durante las últimas décadas, el Valle de Uco basó su patrón de desarrollo agrícola en un modelo intensivo y empresarial de sus tres principales cultivos: los viñedos, los frutales y las hortalizas. En la actualidad, atraviesa un proceso de profunda reconversión productiva, orientada mayoritariamente hacia el mercado externo, que entre otras consecuencias pasó a modificar el funcionamiento del mercado de trabajo local. En este artículo, se contemplan las diferentes situaciones que llevan al ingreso laboral de los jóvenes en este contexto, según el momento etáreo que atraviesen. Se analiza la relación que este proceso guarda con el tamaño y la estructura de las familias y la situación socio-económica del hogar al que pertenecen. También, se examina el vínculo entre las características de los hogares y la forma de inserción de los jóvenes en el mercado de trabajo, de acuerdo al tipo de ocupación en la que se desempeñan y al destino que le dan a sus ingresos. A partir de la realización de entrevistas en profundidad a trabajadores jóvenes y a informantes clave se pudo dar cuenta de las preferencias de los jóvenes con respecto a distintos tipos de trabajos, con particular énfasis en ciertos trabajos agrícolas y, también en relación a su futuro laboral.This article deals with the different ways that young workers in the Uco Valley, at the province of Mendoza, enter to the agrarian local labour market. During the last decadas, the Uco Valley based its pattern of agricultural development in an intensive business model of its three main crops: vineyards, orchards, and vegetables. Currently, it is undergoing a process of profound restructuring of production, mainly oriented towards foreign markets, which among different consequences has modified the functioning of local labour markets. In

The lower Darriwilian (Middle Ordovician) at the northern extreme of the Mendoza Precordillera, Argentina: stratigraphic and biostratigraphic implications; El Darriwiliense inferior (Ordovícico Medio) en el extremo norte de la Precordillera de Mendoza, Argentina: implicaciones estratigráficas y bioestratigráficas

Energy Technology Data Exchange (ETDEWEB)

Beresi, M.S.; Bordonaro, O.L.; Heredia, S.E.; Mestre, A.; Toro, B.A.

2017-09-01

A tectonically affected Middle Ordovician succession crops out at the Los Guanacos quarry in the sierra de Las Higueras, in the Precordillera of Mendoza, western Argentina. This is represented by the San Juan Formation which is transitionally covered by a mixed carbonate-shaly unit of dark colours, 1.5 metres thick (transfacies) which can be interpreted as the base of the Los Azules Formation. A 5-cm thick intra-bioclastic pack/grainstone bed interbedded in the lower part of this unit has been interpreted as a tempestite. It is characterized both by a millimetre-thick erosional boundary, just above the dark mudstone layer and strong mechanical distribution of bioclasts and intraclasts, suggesting sedimentary structures associated with a storm event of high energy possibly occurring in the middle part of the platform. Towards the bottom, a hummocky structure thin interval, under the dark mudstone, is interpreted as the record of another tempestite event. The mudstone represents the post-storm event reflecting the low energy of the marine water environment. The lenticular layer contains predominantly lingulid shells, trilobites and graptolites, all highly fragmented, which suggests they have been reworked and subsequently mixed and quickly redeposited during a storm event that caused the mortality of these faunas. The trilobites Mendolaspis salagastensis and indeterminate species of Matagnostidae, Illaenidae, Leiostegiidae, Encrinuridae, Telephinidae and Trinucleidae have been recorded for the first time at this locality. The conodont fauna allows the identification of the Yangtzeplacognathus crassus Zone, which indicates the lower Darriwilian (Middle Ordovician). Graptolites assignable to evisograptus cf. Levisograptus austrodentatus and Levisograptus sp. are described for the first time in the studied area and biostratigraphic implications validate the early Darriwilian age for the bearing levels. Finally, based on the studied records, correlation with different

Genesis of sandstone-type uranium deposits in the Sierra Pintada district, Mendoza, Argentina: a Moessbauer study

International Nuclear Information System (INIS)

Labenski, F.; Saragovi-Badler, C.

1982-01-01

The genesis of sandstone-type uranium deposits in the Cochico Group (Permo-Triassic) of the Sierra Pintada district, San Rafael, Mendoza, has been studied. This is the most important uranium district in Argentina. Uranium sources, uranium transport and precipitation are discussed. Uraninite and brannerite, the main uranium minerals, occur within the matrix of sandstone. Several phenomena can be deduced regarding the depositional environment. Where oxygen was available, precipitation of hydrated ferric oxides occurred; γFe 2 O 3 .nH 2 O varieties (identified by Moessbauer spectroscopy) precipitated in the upper levels of the aquifer, where CO 2 partial pressure was lower, giving reddish or reddish-brown beds. The CO 2 partial pressure also determines the distribution of biogenic agents such as bacteria. Bacteria thus find a more favourable environment for their development and action in upper levels of an aquifer. In the corresponding horizons local reduction occurred where UO 2 precipitated; therefore the highest uranium concentrations correspond to sandstone levels with reddish or reddish-brown pigment. These pigments have been identified by Moessbauer spectroscopy. (Auth.)

The Elusive Search for Nora Luca: Tony Gatlif's Adventures in Gypsy Land

Directory of Open Access Journals (Sweden)

Sylvie Eve Blum-Reid

2005-08-01

Full Text Available This essay examines Gypsy filmmaker Tony Gatlif and his 1997 film Gadjo Dilo (The Crazy Foreigner. The film ventures on the icy roads of Romania and casts a young French man in search for Nora Luca’s voice, a woman taped by his musicologist father. The young man is adopted by a Romanian Gypsy community and initiated to Gypsy culture. The film reverts stereotypes associated to Gypsies and questions the place of the white traveler in late 20th century Europe. Questions of otherness and exoticism are raised amidst the Western urge to preserve and collect other cultures. The essay is informed by current Gypsies studies on Gypsy law that locate the interaction Rom cultures have had with non-Rom cultures. The film may be seen as a trilingual road movie set in Eastern Europe, yet Gatlif, a man for whom “the road is his country” stretches the limits of the genre, usually situated in the vast open spaces of North America. Gender is important in the analysis of the film as Rom women encountered act as mediators between two different cultures and spaces. Last, the essay reconsiders the place of Tony Gatlif, a now recognized French filmmaker, a spokesperson for Gypsies who delocalised the story and traveled to Eastern Europe. An analysis of the reception of the film adds to the discussion of a filmmaker, born in Algeria, of Berber and Andalusian descent.

SG-SM - Smart Grid San Martin : Red de Distribución y Generación de Energía Inteligente en Ciudad Gral San Martin – Mendoza

OpenAIRE

Mercado, Gustavo; Peña, José Manuel Da; Stasi, Raúl; López, Gabriel; Burlot, Alejandro; Vivone, Gian Carlo; Amstutz, Carolina; Barnabo, Laura; De Paolo, Julieta; Ledda, Marcelo; Cáceres, Roberto; Taffernaberry, Juan Carlos; Pérez, Santiago; Álvarez, Luis; Fernández, Jorge

2015-01-01

Diseño, implementación y análisis de resultados de un proyecto piloto de redes inteligentes y mejoramiento de la eficiencia de la redes de distribución en un área urbano - rural de la zona de concesión de EDESTE SA, en el departamento de Gral. San Martín - Mendoza, que abastece aproximadamente 5000 usuarios de tipo residencial, comercial e industrial, donde se desarrollarán los siguientes aspectos: telemedición y control (Smart Grid) de usuarios finales, telegestión de subestaciones transform...

LAS MUJERES BOLIVIANAS EN LAS CHACRAS, MALARGÜE, MENDOZA, ARGENTINA SU DOBLE CONDICIÓN DE MIGRANTE Y DE MUJER

Directory of Open Access Journals (Sweden)

María Milena Quiroz

2013-10-01

Full Text Available Este estudio socioeducativo fue emprendido en la región de Las Chacras, Malargüe, Mendoza, Argentina. Ha tenido como centro de estudio la mujer de la comunidad con la descripción de sus prácticas, la construcción de sus significados y las formas de participación en su realidad microlocal. La mujer, desde el enfoque de esta investigación es considerada como ser relacional y vinculante con el mundo y los demás actores sociales. Así, se han explorado las características de las tensiones del modelo patriarcal sobre la posición y las relaciones de género. El estigma de ser representada por lo débil, privado, doméstico, pasivo, incompleto y asilado, se le ha excluido de la participación social, cultural y política.Esta complejidad social contemporánea permite dilucidar la demanda y el deseo de la mujer por emprender nuevas identidades como grupo excluido en la sociedad civil y redefinir su reconocimiento de género como aquel que interviene en la cultura y en la educación de su entorno, con modos propios y particulares no impuestos.SummaryThis socioeducational study was undertaken in the region of Las Chacras, Malargüe, Mendoza and Argentina. It is focused on the women of the community and their practices, as well as the construction of its significances and different forms of participation in the micro-local reality. Based on the focus of this research, women are considered as a relational being that binds with the world and other social actors. Thus, we have explored the characteristics of the patriarchal model pressure upon gender relations. The stigma of women being represented as weak, domestic, passive, incomplete and isolated, has contributed to their exclusion from social, cultural and political participation.This contemporary social complexity allows explaining the demand and the desire of women to undertake new identities as excluded group in the civil society and redefine gender’s recognition taking into consideration

Condiciones de sostenibilidad de la ciudad compacta: análisis de superficies expuestas a la radiación y sombras arrojadas en la Ciudad de Mendoza

OpenAIRE

Ganem, Carolina; Balter, Julieta; Coch Roura, Helena

2009-01-01

¿Podemos decir que toda ciudad compacta es una ciudad sostenible? ¿Cuáles son los parámetros que definen a una ciudad compacta sostenible? El objetivo de este trabajo es determinar las características de la ciudad compacta tal y como está creciendo hoy mediante el estudio en profundidad de una ciudad en plena densificación, la ciudad de Mendoza en la República Argentina. Se parte del estudio de los diferentes códigos de edificación vigentes desde su fundación y las restricciones y oportunida...

[Health and working conditions of high school and university teachers in Mendoza: between commitment and emotional distress].

Science.gov (United States)

Collado, Patricia Alejandra; Soria, Cecilia Beatriz; Canafoglia, Eliana; Collado, Sandra Alicia

2016-01-01

With the objective of analyzing aspects related to the perception of working conditions and their impact on health in the teachers and professors who work for the Universidad Nacional de Cuyo (UNCuyo) in Mendoza, Argentina, this work analyzes the results of the Primer Censo de Condiciones y Salud Laboral [First Census on Health and Working Conditions]. The census was conducted in late 2013 in two academic units (one at the high school level and the other at the university level), including 193 educators. The exploration set out to characterize the teaching staff and the conditions affecting their health, primarily with respect to psycho-social health. In order to do, so a self-administered questionnaire was applied, the dimensions of which were discussed in sensitivity workshops with educators who helped to formulate the data collection instrument. Among the primary results emerge the physical and emotional burnout of these highly skilled workers, owing to the combined effect of their committed response to the demands of their work and the deterioration (both material and symbolic) of the conditions in which they carry out that work.

Evaluation of the tannic acid inhibitory effect against the NorA efflux pump of Staphylococcus aureus.

Science.gov (United States)

Tintino, Saulo R; Oliveira-Tintino, Cícera D M; Campina, Fábia F; Silva, Raimundo L P; Costa, Maria do S; Menezes, Irwin R A; Calixto-Júnior, João T; Siqueira-Junior, José P; Coutinho, Henrique D M; Leal-Balbino, Tereza C; Balbino, Valdir Q

2016-08-01

During the early periods of antibiotic usage, bacterial infections were considered tamed. However, widespread antibiotic use has promoted the emergence of antibiotic-resistant pathogens, including multidrug resistant strains. Active efflux is a mechanism for bacterial resistance to inhibitory substances, known simply as drug efflux pumps. The bacterium Staphylococcus aureus is an important pathogenic bacterium responsible for an array of infections. The NorA efflux pump has been shown to be responsible for moderate fluoroquinolone resistance of S. aureus. The inhibition of the efflux pump was assayed using a sub-inhibitory concentration of standard efflux pump inhibitors and tannic acid (MIC/8), where its capacity to decrease the MIC of Ethidium bromide (EtBr) and antibiotics due to the possible inhibitory effect of these substances was observed. The MICs of EtBr and antibiotics were significantly reduced in the presence of tannic acid, indicating the inhibitory effect of this agent against the efflux pumps of both strains causing a three-fold reduction of the MIC when compared with the control. These results indicate the possible usage of tannic acid as an adjuvant in antibiotic therapy against multidrug resistant bacteria (MDR). Copyright © 2016 Elsevier Ltd. All rights reserved.

Manejo de enmiendas para restaurar la materia orgánica del suelo en oasisde regadío de mendoza, argentina

Directory of Open Access Journals (Sweden)

Abril, A.

2014-04-01

Full Text Available La agricultura de regadío en zonas áridas favorece la degradación de la Materia Orgánica del suelo (MO, por lo que suelen aplicarse enmiendas orgánicas con la finalidad de restaurar el contenido de MO y mejorar la disponibilidad de nutrientes para los cultivos, aunque no siempre con resultados concluyentes. En este trabajo se analizan, de manera comparativa, cuatro ensayos con diferentes sistemas de aplicación de enmiendas orgánicas (prácticas agrícolas, tipo de enmienda, dosis, frecuencia y forma de aplicación y combinación con fertilizantes químicos en oasis de regadío de Mendoza (Argentina, con la finalidad de establecer las prácticas de manejo más adecuadas para restaurar las diferentes fracciones de MO del suelo (ácidos húmicos y fúlvicos y sustancias no húmicas. El contenido de MO aumentó en el 40% de los casos analizados (n=92 y no sufrió modificaciones en el resto, mientras que los ácidos fúlvicos también aumentaron en el 40% de los casos, pero disminuyeron en el 30%. Contrariamente, los ácidos húmicos sufrieron más disminuciones que aumentos (39% vs. 26% de los casos. Estas diferencias se explican por las prácticas de manejo agrícola y las técnicas de aplicación de las enmiendas, concluyendo que: a todas las prácticas de aplicación de enmiendas aumentan en el corto plazo la MO; b la fracción humificada aumenta en el corto plazo, con la aplicación superficial sin laboreo; y c el agua de riego con alto contenido de desechos orgánicos disminuye el efecto positivo de las enmiendas sobre la MO. Por tales motivos, las prácticas de manejo recomendadas para lograr la restauración de la MO del suelo en los oasis de regadío de Mendoza son: aumentar la dosis y la frecuencia en la aplicación de enmiendas, y reducir el laboreo y el uso de aguas de reuso.

Evaluación de recubrimientos a base de zinc en la atmosfera industrial de la refineria estatal Esmeraldas

OpenAIRE

Huaman M, M.; Peña E., J.

2009-01-01

El estudio del comportamiento frente a la corrosión atmosférica, de recubrimientos de zinc sobre acero al carbón bajo diferentes condiciones ambientale. En este proyecto se pretende conocer y evaluar el comportamiento del acero galvanizado en caliente (dicontinuo, chapa galvanizada en caliente (continuo senzimir), chapa galvanizada en continuo con aleación de zinc 5% aluminio (galfan), chapa zincada por procedimiento ewlectrolitico (galvanizado en frío) y acero metalizado con zinc en diversas...

Discovery of the Sierra Pintada uranium district, Mendoza Province, Argentina

International Nuclear Information System (INIS)

Rodrigo, F.; Belluco, A.E.

1981-01-01

Since 1956, uranium-bearing minerals have been known to exist in Sierra Pintada, Mendoza Province, Argentina. Based on paragenetic considerations, a first radiometric prospection was carried out, leading to the discovery of two groups of anomalies (Puesto Agua del Toro and Cuesta de los Terneros), such as vein-type deposits, with uraninite and 'yellow minerals' and one sandstone-type deposit (Puesto La Josefa), related to sediments with carbon trash. Some recent geological research and surveys in the area, and a reduced drilling programme carried out on selected anomalies, led to reinterpretation of the potential of the area. Furthermore, and as a result of an airborne radiometric prospection performed in mid-1968, numerous anomalies have been discovered. The main constellation of anomalies, along the flanks of the El Tigre Brachyanticline, occurs in sandstones of Permian age. Explored by 80 000 m of drilling, they have shown the existence of several peneconcordant lens-shaped ore bodies of economic size, with uranophane on the surface and prevailing uraninite and some brannerite, coffinite and davidite below the water table. Reserves exceed 20 000 tonnes of U 3 O 8 . A new regional programme with a 4-km drill-grid initiated in 1978 led to the discovery of new ore bodies which are at present being evaluated. The alternatives and discontinuities during the development of the district, the prospecting and exploration techniques employed, and the results achieved in the different stages of the operation are discussed in detail. This case history attempts to illustrate the developing philosophy which was successfully applied in Sierra Pintada, with emphasis on the following points: (a) the need for adequate geological knowledge of the area; (b) the advantage of a massive survey (in this case, air survey); (c) the necessity for exploration (drilling) in order to define the anomalies and make their evaluation possible; and (d) the convenience of extending exploration

Landsat 5 TM images and DEM in lithologic mapping of Payen Volcanic Field (Mendoza Province, Argentina)

International Nuclear Information System (INIS)

Fornaciai, A.; Bisson, M.; Mazzarini, F.; Del Carlo, P.; Pasquare, G.

2009-01-01

Satellite image such as Landsat 5 TM scene provides excellent representation of Earth and synoptic view of large geographic areas in different band combination. Landsat TM images allow automatic and semi-automatic classification of land cover, nevertheless the software frequently may some difficulties in distinguishing between similar radiometric surfaces. In this case, the use of Digital Elevation Model (DEM) can be an important tool to identify different surface covers. In this study, several False Color Composite (FCC) of Landsat 5 TM Image, DEM and the respective draped image of them, were used to delineate lithological boundaries and tectonic features of regional significance of the Paven Volcanic Field (PVF). PFV is a Quaternary fissural structure belonging to the black-arc extensional areas of the Andes in the Mendoza Province (Argentina) characterized by many composite basaltic lava flow fields. The necessity to identify different lava flows with the same composition, and then with same spectral features, allows to highlight the improvement of synergic use of TM images and shaded DEM in the visual interpretation. Information obtained from Satellite data and DEM have been compared with previous geological maps and transferred into a topographical base map. Based on these data a new lithological map at 1:100.000 scale has been presented [it

Una versión del estado de naturaleza en la España del siglo XVIII: el texto de Joaquín Marín y Mendoza

Directory of Open Access Journals (Sweden)

Salvador RUS RUFINO

2009-11-01

Full Text Available RESUMEN: Joaquín Marín y Mendoza, abogado de la corte en la década de los setenta, historiador de Derecho Natural y académico de la Real Academia de la Historia, escribió la disertación De statu hominum naturali, de la que se ofrece aquí el original latino y la traducción al castellano, bajo el título El estado natural del hombre, cuyo objeto de estudio es el ‘estado de naturaleza’. Se acompaña al texto de una introducción biográfica, así como de un estudio general del presente discurso sobre el Estado Natural, en el que se analizan las fuentes modernas del texto: Hobbes, R. Cumberland, Juan Francisco Finetti o Samuel Pufendorf. J. Marín se adscribió a la tendencia iusnaturalista teonómica moderada, intentó seguir los principios de la filosofía cristiana y enriquecerla con las aportaciones de la filosofía moderna.ABSTRACT: Joaquín Marín y Mendoza, a court attorney in the 1770s, historian of Natural Law and member of the Royal Academy of History, was the author of the dissertation on the «state of nature», De statu hominum naturali, which is offered here in the original Latin and in a Spanish translation entitled El estado natural del hombre. The text is accompanied by a biographical introduction, as well as a general study of the present discourse on the State of Nature, in which the modern sources of the text are analysed: Hobbes, R. Cumberland, Juan Francisco Finetti or Samuel Pufendorf. J. Marín subscribed to the moderate iusnaturalist theonomic trend and tried to follow the principles of Christian phibosophy and to enrich it with the contributions of modern philosophy.

A Study of Nora and Eliza from the Perspective of Feminism%女性主义视角下娜拉与伊莉莎的对比思考

Institute of Scientific and Technical Information of China (English)

卢青青

2012-01-01

易卜生笔下《玩偶之家》中的娜拉和萧伯纳《格梅利翁》中的伊莉莎生活背景迥然不同，但她们有着极其相似的经历，她们都有很强的觉醒意识，是追求独立自主、平等和谐的女性代言人。从女性主义视角走进娜拉和伊莉莎的世界，探索在男权社会中女性的人生和命运，以寻求现代女性在家庭、社会中如何关注个体发展，形成自己的独立人格，实现真正的自强自立。%The protagonists Nora in A Doll ' s House and Eliza in Pygmalion have quite different living background, but they possess similar experience. Both of them, having strong self-awareness, are the spokespersons who pursue self-independent, free and harmony life. From the perspective of feminism, it goes into the world of Nora and Eliza to explore the life and of the females in the situation of patriarchy. From the, modern women may have a better and right judgment of how to pay attention to their individual development and their family and social roles, by which they can develop their own independent personalities and truly achieve self-improvement and self-support and self-reliance in modern society.

Conflictos sociales en Mendoza entre dos crisis, 1890-1916: Una larga lucha de los trabajadores por la conquista de sus derechos laborales

Directory of Open Access Journals (Sweden)

Rodolfo Richard-Jorba

2010-06-01

Full Text Available Este artículo contribuye a la reconstrucción de la historia del mundo de los trabajadores en Mendoza. Las fuentes revisadas y la sistematización de información dispersa han permitido profundizar en los conocimientos hasta ahora generados, sacando a luz una parte significativa del desarrollo capitalista centrado en la agroindustria vitivinícola. Las fuentes principales para seguir los conflictos han sido los diarios mendocinos, por lo que nuestro abordaje constituye una aproximación que esperamos poder ampliar en el futuro. En este artículo presentamos los conflictos sociales en el contexto de períodos de crisis y de auge económico. Comenzamos por la crisis de 1890 y concluimos con la crisis provocada por la Primera Guerra Mundial y los cambios políticos que sobrevendrían a partir de 1916-1918

Recomposición económica de las burguesías regionales: la burguesía vitivinícola en la provincia de Mendoza, Argentina (1990-2011

Directory of Open Access Journals (Sweden)

Adriana Silvina Chazarreta

2014-07-01

Full Text Available Este artículo se propone comprender la recomposición de la burguesíavitivinícola en Mendoza a partir de la reestructuración de la actividadque comienza a principios de los `90. Este trabajo permite mostrar el pesorelevante que en la estructura económica, aún conservan los sectoresligados a capitales locales y/o nacionales, pese al considerable ingreso deempresas transnacionales y extranjeras. El diseño de investigación se basaen una estrategia de triangulación metodológica, combinando técnicas derecolección de datos cuantitativos y cualitativos, y el uso de distintas fuentesde datos secundarias y primarias.

Novel insight into antimicrobial resistance and sensitivity phenotypes associated to qac and norA genotypes in Staphylococcus aureus.

Science.gov (United States)

Marchi, Emmanuela; Furi, Leonardo; Arioli, Stefania; Morrissey, Ian; Di Lorenzo, Valeria; Mora, Diego; Giovannetti, Luciana; Oggioni, Marco Rinaldo; Viti, Carlo

2015-01-01

Staphylococcus aureus strains harboring QacA, QacB, QacC, QacG transporters and norA promoter up-regulating mutations were characterized by phenotype microarray (PM), standard methods for susceptibility testing, and ethidium bromide efflux assays, in order to increase knowledge on phenotypes associated to efflux pumps and their substrates. PM data and standard susceptibility testing lead to the identification of new potential efflux targets, such as guanidine hydrochloride or 8-hydroxyquinoline for QacA and QacC pumps, respectively. The identification of compounds to which the presence of efflux pumps induced increased susceptibility opens new perspectives for potential adjunct anti-resistance treatment (i.e. strains bearing QacB transporters showed increased susceptibility to thioridazine, amitriptyline and orphenadrine). Although the tested isolates were characterized by high degree of heterogeneity, a hallmark of clinical isolates, direct ethidium bromide efflux assays were effective in highlighting differences in efflux efficiency among strains. These data add to characterization of substrate specificity in the different classes of staphylococcal multidrug efflux systems conferring specific substrate profiles and efflux features to each of them. Copyright © 2014 Elsevier GmbH. All rights reserved.

Comportamiento a fatiga de uniones a tope en chapas recubiertas soldadas por proceso láser

Directory of Open Access Journals (Sweden)

Amo, J. M.

1998-05-01

Full Text Available The fatigue strength and the fracture mechanism studies of butt laser welded joints in A155-Zn coated steel sheets, 0.62 and 1.16 mm thick, have been continued. The 2 x 10⁶ cycles fatigue strength for both thicknesses has been finally established in 130 and 175 MPa, respectively, and the big ferritic grain - 300 μm - produced by symmetrical solidification from the fusion zone centre has been confirmed. Initiation and extension fracture zones are analysed by SEM and so are the involved microstructures. The first ones are concerned with high stress concentration zones, mainly undercuts or lack of penetration, from which the fatigue cracks extend in semiellipses, longitudinally and through thickness, along the fusion line or the HAZ. The final fracture is produced by tearing of the residual fatigue crack bound and crack deviation towards the central gross grain line of the welds.

Se continúan los estudios de la resistencia a la fatiga y los mecanismos de rotura en uniones soldadas a tope por proceso láser, de chapas de acero con recubrimiento A155-Zn, en espesores de 0,62 y 1,16 mm. Las resistencias a fatiga a 2 x 10⁶ ciclos para ambos espesores, se establecen finalmente en 130 y 175 MPa, respectivamente, y se confirma el gran tamaño de grano ferrítico - 300 μm - producido por solidificación simétrica desde el centro de la soldadura. Se analizan las zonas de iniciación y propagación de las roturas y las microestructuras implicadas con MEB. Las primeras se corresponden con zonas de concentración de tensión elevada, fundamentalmente mordeduras o faltas de penetración, a partir de las cuales las grietas de fatiga progresan en semielipses, longitudinalmente y en sentido del espesor, por línea de fusión o ZAT. La rotura final se produce por desgarramiento del ligamento residual de la grieta de fatiga y desvío hacia la línea central de grano grueso de las soldaduras.

Subsurface architecture of Las Bombas volcano circular structure (Southern Mendoza, Argentina) from geophysical studies

Science.gov (United States)

Prezzi, Claudia; Risso, Corina; Orgeira, María Julia; Nullo, Francisco; Sigismondi, Mario E.; Margonari, Liliana

2017-08-01

The Plio-Pleistocene Llancanelo volcanic field is located in the south-eastern region of the province of Mendoza, Argentina. This wide back-arc lava plateau, with hundreds of monogenetic pyroclastic cones, covers a large area behind the active Andean volcanic arc. Here we focus on the northern Llancanelo volcanic field, particularly in Las Bombas volcano. Las Bombas volcano is an eroded, but still recognizable, scoria cone located in a circular depression surrounded by a basaltic lava flow, suggesting that Las Bombas volcano was there when the lava flow field formed and, therefore, the lava flow engulfed it completely. While this explanation seems reasonable, the common presence of similar landforms in this part of the field justifies the need to establish correctly the stratigraphic relationship between lava flow fields and these circular depressions. The main purpose of this research is to investigate Las Bombas volcano 3D subsurface architecture by means of geophysical methods. We carried out a paleomagnetic study and detailed topographic, magnetic and gravimetric land surveys. Magnetic anomalies of normal and reverse polarity and paleomagnetic results point to the occurrence of two different volcanic episodes. A circular low Bouguer anomaly was detected beneath Las Bombas scoria cone indicating the existence of a mass deficit. A 3D forward gravity model was constructed, which suggests that the mass deficit would be related to the presence of fracture zones below Las Bombas volcano cone, due to sudden degassing of younger magma beneath it, or to a single phreatomagmatic explosion. Our results provide new and detailed information about Las Bombas volcano subsurface architecture.

Permo-triassic volcanism in the San Rafael Block (Mendoza province) and its uraniferous potential

International Nuclear Information System (INIS)

Kleiman, L.E.

1993-01-01

This paper describes the Permo-triassic volcanism in the San Rafael Block, Mendoza, Argentina, which forms part of the Choiyoi province and it represents by large volumes of intermediate to silicic ignimbrites with minor sub volcanic bodies of rhyolites, andesites and basandesites. Three different suites can be distinguished: the first one (Lower Section) of Early Permian age, is composed of dacites and rhyolites (SiO 2 up to 71 %) with minor andesites, the second one (Upper Section) of Late Permian-Early Triassic age is made up of rhyolites (SiO 2 up to 77 %) with some basandesites and andesites, and the third one, of Triassic age is composed of rhyolites (SiO 2 > 75 %) and basandecites. These suites are easily distinguished by means of trace element data and are believed to represent the transition between a subduction-related magmatic arc and an extensional tectonic regime. This tectonic setting is similar to the prevalent during the Cenozoic in the Sierra Occidental of Mexico and is favourable for the development of long-lived hydrothermal systems which lead to economic U concentrations (i.e. Sierra de Pena Blanca). In the San Rafael Block, the Dr. Baulies-Los Reyunos U deposit, which is hosted in volcanic sediments, is associated to the first suite (Lower Section). Although minor U concentrations are known, up to date, to be related to the second and third suites, these rocks are fertile and seen to be potential source for the formation of uranium deposits within a volcanic caldera environment. (Author)

Solar radiation in forested urban environments with dry climate. Case: Metropolitan Area of Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Mariela Edith Arboit

2014-12-01

Full Text Available The aim of this work is to advance the understanding of the solar potential of urban residential environments which, by their morphology, and the impact of urban trees, present values of irradiance very different from full solar collection. Morphological variables of urban settings and urban trees, a very distinctive feature of the Mendoza Metropolitan Area (MMA, have a fundamental impact on the feasibility of implementing strategies for solar energy utilization in urban environments. The results achieved will contribute to modify and gradually update urban and building legislation to implement higher levels of energy efficiency and minimum environmental impacts.This work proposes to study the potential of solar collection in urban environments, analyzing eleven urban configurations selected according to their building and urban morphological characteristics.Methodologically, we have monitored the global solar irradiance on vertical plane on northern facades, completely sunny and partly sunny, affected by solid masking and arboreal masking. Results obtained so far indicate that solar masking is critical for vertical surfaces, with a reduction of the available solar energy between 2% and 66% in the winter season. However, these drawbacks caused by urban trees are compensated by benefits in the warm season: controlling the intensity of the urban heat island, absorption of pollutants, cooling and humidifying the air through evapotranspiration, reducing thermal loads of buildings, occupancy of public open spaces, and an invaluable contribution to the urban aesthetic.

Biodiversidad de la flora del flanco oriental del Cordón del Plata (Luján de Cuyo, Mendoza, Argentina. Catálogo florístico Biodiversity of the flora of the eastern slope of the Cordón del Plata (Luján de Cuyo, Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Eduardo Méndez

2009-07-01

Full Text Available La biodiversidad de la flora de la vertiente oriental del Cordón del Plata, Luján de Cuyo, Mendoza, Argentina se analizó a lo largo de un gradiente altitudinal, entre los 1200 y 4500 m s.n.m. Para ello se utilizó la lista florística de las especies de 89 comunidades vegetales distribuidas en 14 unidades de vegetación, 5 pisos de vegetación y 3 unidades fitogeográficas. Para cada especie se consideró su distribución en los grupos de comunidades vegetales, ubicación fitogeográfica, formas de vida, origen y registro de colección. La flora examinada contiene 667 especies vegetales que se corresponden con 338 géneros y 82 familias. Las familias están representadas por 8 Pteridophyta, 1 Gymnospermae y 73 Angiospermae, con 12 Monocotyledoneae y 61 Dicotyledoneae. Las familias mejor representadas son Asteraceae y Poaceae que tienen en conjunto 110 géneros y 249 especies. Los géneros Senecio, Baccharis y Adesmia son los más ricos en especies. Aproximadamente el 20 % de las especies son endémicas de Argentina. La flora del área se la compara con la del país, la provincia y la de otras áreas.Floristic catalogue. The floristic biodiversity of the eastern slope of the Cordón del Plata, Luján de Cuyo, Mendoza, Argentina, was studied along an altitudinal gradient, between 1200 and 4500 m a.s.l. For this we used a floristic list of 89 plant communities, distributed in 14 vegetation types, 5 vegetation belts and 3 phytogeographic units. For each of the species, its distribution in the groups of plant communities, phytogeographic position, life form, biogeographical origin, and registration of each collection was considered. The studied flora has 667 species, corresponding to 338 genera and 82 families. There are 8 Pteridophyta, 1 Gymnospermae, and 73 Angiospermae, of which 12 are Monocotyledons and 61 Dicotyledons. The most represented families are Asteraceae and Poaceae, which in total have 110 genera and 249 species. The most species

Investigation of noble metal deposition behaviour in boiling water reactors. The NORA project

International Nuclear Information System (INIS)

Ritter, Stefan; Karastoyanov, Vasil; Abolhassani-Dadras, Sousan; Guenther-Leopold, Ines; Kivel, Niko

2010-01-01

NobleChem trademark is a technology developed by General Electric to reduce stress corrosion cracking (SCC) in reactor internals and recirculation pipes of boiling water reactors (BWRs) while preventing the negative side effects of classic hydrogen water chemistry. Noble metals (Pt, Rh) acting as electrocatalysts for the recombination of O 2 and H 2 O 2 with H 2 to H 2 O and thus reducing the corrosion potential more efficiently are injected into the feedwater during reactor shutdown (classic method) or on-line during power operation. They are claimed to deposit as very fine metallic particles on all water-wetted surfaces, including the most critical regions inside existing cracks, and to stay electrocatalytic over long periods of time. The effectiveness of this technology in plants still remains to be demonstrated. Based on highly credible laboratory experiments down to the sub-μg . kg -1 Pt concentration range, SCC mitigation may be expected, provided that a stoichiometric excess of H 2 and a sufficient surface coverage with very fine Pt particles exist simultaneously at the critical locations [1]. Very little is known about the deposition and (re-)distribution behaviour of the Pt in the reactor. For the validation of this technique the research project NORA (noble metal deposition behaviour in BWRs) has been started at the Paul Scherrer Institute (PSI) with two main objectives: (i) to gain phenomenological insights and a better basic understanding of the Pt distribution and deposition behaviour in BWRs; (ii) to develop and qualify a non-destructive technique to characterise the size and distribution of the Pt particles and the local concentration of Pt on reactor components. This paper presents the objectives of the project, the planned work and a brief description of the status of the project. (orig.)

Efecto de la deformación por tracción sobre la orientación cristalográfica del recubrimiento y la resistencia a la corrosión en CNS de chapas de acero con recubrimientos base cinc

Directory of Open Access Journals (Sweden)

Sacco, E. A.

2002-12-01

Full Text Available Hot dip Zn and 55 % Al - 1.6 % Si - 43.4 % Zn alloy (55Al-Zn coated steel sheets were submitted to uniaxial tension with the aim of evaluating the strain and failure type as well as their corrosion performance in the salt spray cabinet test. As the degree of strain increased, the basal orientation of the Zn coating turned into a prismatic one. Furthermore, the development of many twins, some intergranular cracks and few intragranular ones could also be observed. On the other hand, in 55Al-Zn alloy coatings, the α phase crystallographic orientation changed from {311} towards {100} and {331}, whilst the β phase crystallographic orientation {10.1} did not change. In this material the only failure type observed was the cracking of the interdendritic component. In salt spray cabinet the anticorrosive performance of steel/55Al-Zn sheets was much better than that of the galvanized ones.

Se deformaron, por tracción uniaxial, chapas de acero recubiertas, por inmersión, con cinc o con aleación 55 % Al - 1,6 % Si - 43,4 % Zn (55Al-Zn, con el fin de analizar el modo de deformación y falla de los recubrimientos y su comportamiento en cámara de niebla salina (CNS. A medida que se incrementaba el grado de deformación, el recubrimiento de cinc mostró un cambio de la orientación basal hacia una prismática. Además, pudo apreciarse el desarrollo de numerosas maclas, algunas fisuras intergranulares y escasas fisuras transgranulares. Por otra parte, en las muestras recubiertas con aleación 55Al-Zn, la orientación de la fase α cambió desde {311} hacia {100} y {331}, mientras que la fase β conservó una orientación {10.1}. Para este material, el único modo de falla detectado fue la fisuración del constituyente interdendrítico. En CNS la resistencia a la corrosión de las chapas de acero/55Al-Zn fue, significativamente, mayor que en las de acero galvanizado.

Educación agrícola, enólogos y tecnologías para una vitivinicultura "de calidad", Mendoza, 1890-1930

Directory of Open Access Journals (Sweden)

Florencia Rodriguez Vázquez

2014-08-01

Full Text Available Sobre la base de la relación existente entre enseñanza y economía, el objetivo de este artículo es analizar la repercusión de las políticas públicas de enseñanza agrícola en la economía regional vitivinícola. Para ello, en primer lugar, nos centramos en los principales proyectos educativos sectoriales que hubo en Mendoza en el período de consolidación del modelo productivo, de base capitalista, y la contribución en este período de los técnicos vinculados a estos establecimientos.La reconstrucción operada se basa en datos obtenidos de fuentes primarias, éditas e inéditas, oficiales y no oficiales. Como se resultado, se demuestra que el Estado, nacional y provincial, respondió a las demandas de formación de recursos humanos, y la constitución de un subgrupo que inició discusiones técnicas y realizó importantes aportes sobre enología y vinificación.

Research and transference of the ICES over Malargue, Mendoza, uranium bioremediation

International Nuclear Information System (INIS)

Scotti, A.; Barbero, N.; Castano-Ganan, A.R; Ramires, A.; Ojeda, C.; Meza, Juan C.; Lopez, S.; Salgan, Laura; Diaz Isenrath, G.

2009-01-01

The origin of the International Center for Earth Sciences (ICES) dates back to 2002 when the Acoustic Emission Station on Volcano Peteroa was installed. Up to now, it represents the first of its kind in the entire Andean Cordillera. This scientific activity is jointly coordinated by scientists from Italy and Argentina. At the First Conference on Acoustic Emission held on 2004, a letter of intent for the establishment of ICES was signed. Presently, ICES is composed by 4 departments: Environment and Climate; Anthropology; Environmental and Territorial Environmental Risk; Resources and Exploration Geophysics. One of the primary objectives of ICES is to promoting applied research and development in the broad field of Earth Sciences. The experimental work consists of main 4 steps listed below: The 'Helianthus annus' (sunflower) has proven its ability to raise Uranium (U) in hydroponic systems and was widely used in the model U rizophyiltration extraction of groundwater in Ashtabula, Ohio, USA. Hydroponic trial design consists of 6 treatments and 4 repetitions plants witnesses without minimum level of U, U witnesses plants without and 4 with various levels of U (Stage 1). The Glomus intraradices is a mycorrhizal fungus used in strategies of U phyto-stabilization. Test consists in the cultivation of sunflower with roots inoculated with Glomus intraradices to determine their uptake and translocation of U (Stage 2). The inoculation of 'Glomus intraradices' in 'Helianthus annus' produces an effective symbiosis with the type of strain and its genetic diversity, some genotypes are highly suitable for this. There have been experiences of this kind in the basic research in several countries. In this work, we use the system in 'Helianthus-Glomus' phyto-stabilization or rizophyiltration soil as a strategy for bioremediation of U at the Malargue area, Province of Mendoza (Stage 3). It will launch a pilot test of the transfer plan, which involves creating a garden for the growth of

Biological Characteristics and Medical Treatment of Breast Cancer in Young Women—A Featured Population: Results from the NORA Study

Directory of Open Access Journals (Sweden)

P. Pronzato

2011-01-01

Full Text Available Background. The present paper described the biological characteristics and clinical behavior of young women in the cohort NORA study Patients and Methods. From 2000–2002, patients (>3500 were enrolled at 77 Italian hospitals. Women aged ≤50 years (=1013 were stratified into age groups (≤35, 36–40, 41–45, and 46–50 years. The relationship between age and patient characteristics, cancer presentation, and treatment was analyzed. Results. Younger women more frequently had tumors with ER/PgR-negative(2=7.07; =.008, HER2 amplification (2=5.76; =.01, and high (≥10% Ki67 labelling index (2=9.53; =.002. Positive nodal status, large tumors, and elevated Ki67 all associated with the choice for chemotherapy followed by endocrine therapy in hormone receptor-positive patients (40 versus ≤40, <.0001, resp.. At multivariate analysis, after adjustment for significant clinical and pathological factors, age remains a significant prognostic variable (HR=0.93, =.0021. Conclusion. This cohort study suggests that age per sè is an important prognostic factor. The restricted role of early diagnosis and the aggressive behavior of cancer in this population make necessary the application of targeted medical strategies crucial.

Biological Characteristics and Medical Treatment of Breast Cancer in Young Women-A Featured Population: Results from the Nora Study

International Nuclear Information System (INIS)

Pronzato, P.; Mustacchi, G.; De Matteis, A.; Di Costanzo, F.; Rulli, E.; Floriani, I; Cazzaniga, M.E.

2011-01-01

Background. The present paper described the biological characteristics and clinical behavior of young women in the cohort NORA study Patients and Methods. From 2000-2002, patients (N>3500) were enrolled at 77 Italian hospitals. Women aged =50 years (N=1013) were stratified into age groups (=35, 36-40, 41-45, and 46-50 years). The relationship between age and patient characteristics, cancer presentation, and treatment was analyzed. Results. Younger women more frequently had tumors with ER/PgR-negative(x 2 =7.07; P=.008), HER2 amplification (x 2 =5.76; P=.01), and high (≤10%) Ki67 labelling index (x 2 =9.53; P=.002). Positive nodal status, large tumors, and elevated Ki67 all associated with the choice for chemotherapy followed by endocrine therapy in hormone receptor-positive patients (P 40 versus =40, P<.0001, resp.). At multivariate analysis, after adjustment for significant clinical and pathological factors, age remains a significant prognostic variable (HR=0.93, P=.0021). Conclusion. This cohort study suggests that age per se is an important prognostic factor. The restricted role of early diagnosis and the aggressive behavior of cancer in this population make necessary the application of targeted medical strategies crucial. human epidermal growth factor receptor

Investigation of the noble metal deposition behaviour in boiling water reactors - the NORA project

International Nuclear Information System (INIS)

Ritter, S.; Karastoyanov, V.; Abolhassani-Dadras, S.; Guenther-Leopold, I.; Kivel, N.

2010-01-01

NobleChem™ is a technology developed by General Electric to reduce stress corrosion cracking (SCC) in reactor internals and recirculation pipes of boiling water reactors (BWRs) while preventing the negative side effects of classical hydrogen water chemistry. Noble metals (Pt, Rh) acting as electrocatalysts for the recombination of O 2 and H 2 O 2 with H 2 to H 2 O and thus reducing the corrosion potential more efficiently are injected into the feed water during reactor shut-down (classical method) or on-line during power operation. They are claimed to deposit as very fine metallic particles on all water-wetted surfaces including the most critical regions inside existing cracks and to stay electrocatalytic over long periods of time. The effectiveness of this technology in plants remains still to be demonstrated. Based on highly credible laboratory experiments down to the sub-ppb Pt concentration range, SCC mitigation may be expected, provided that a stoichiometric excess of H 2 and a sufficient surface coverage with very fine Pt particles exist simultaneously at the critical locations. Very little is known about the deposition and (re-)distribution behaviour of the Pt in the reactor. For the validation of this technique the research project NORA (noble metal deposition behaviour in BWRs) has been started at PSI with two main objectives: (i) to gain phenomenological insights and a better basic understanding of the Pt distribution and deposition behaviour in BWRs; (ii) to develop and qualify a non-destructive technique to characterise the size and distribution of the Pt particles and its local concentration on reactor components. This paper presents the objectives of the project, the planned work and a brief description of the status of the project. (author)

Determinación experimental de los factores que controlan el desprendimiento de polvos en el conformado de chapas de acero recubiertas con Zn-Ni

Directory of Open Access Journals (Sweden)

Cárcel, A. C.

1995-04-01

Full Text Available Powder detachment from coatings during press forming of Zn-Ni precoated steel sheets increases die wear and maintenance costs. Experimental design helped to establish that powder detachment rises by increasing coating thickness or bath temperature. Otherwise, the use of high flow rates and the presence of an intermediate layer of nickel help to reduce powdering. Temperature and flow rate affect the alloy composition. In the range 10 to 15 % Ni, powdering increases as the alloy becomes richer in nickel. This behaviour is attributed to changes in structure and ductility of the alloy.

El desprendimiento de polvos del recubrimiento durante la embutición constituye uno de los principales problemas en las líneas de prensas que emplean chapas de acero recubiertas con aleaciones Zn-Ni. El uso de técnicas de diseño de experiencias permitió determinar que la cantidad de polvos aumenta al incrementarse el espesor del depósito y la temperatura del baño, y disminuye al aplicar un flash intermedio de níquel o al aumentar la velocidad relativa cátodo-electrólito. Los efectos de la velocidad y de la temperatura afectan a la composición de la aleación. En el rango comprendido entre el 10-15 % Ni, el desprendimiento aumenta con el contenido en níquel, lo que se atribuye a los cambios de estructura y de ductilidad de la aleación.

La doctrina sobre el poder del príncipe en Alfonso Hojeda de Mendoza

Directory of Open Access Journals (Sweden)

Salustiano de DIOS

2009-12-01

Full Text Available RESUMEN: Alfonso Hojeda fue un notable canonista sevillano que en 1576 publicó en Venecia un libro acerca de los beneficios eclesiásticos. La obra se divide en dos partes: la primera está dedicada a argumentar en contra de la pluralidad de beneficios en una misma persona, de acuerdo con los decretos tridentinos de reforma, mientras la segunda trata en cambio de la compatibilidad de beneficios mediante dispensa papal. Los propios términos en que se manifiestan las dos partes ya están indicando las contradicciones en que ha de moverse el autor, difíciles de salvar. La doctrina de la causa es, además de la distinción entre órdenes normativos, la principal herramienta conciliatoria para Hojeda. El papa está desligado del derecho positivo o humano, pues de otro modo no podría dispensar, o privilegiar, mas sólo puede hacerlo con justa causa.ABSTRACT: Alfonso Hojeda de Mendoza was an outstanding canonist that in 1576 published a book in Venice on the eclesiástica benefits. The book is divided into two parts: the first one is devoted to argue against the plurality of benefits in the same person, according to Trento's decrees, while the second one deals, however, with the compatibility of benefits by the Pope's dispense. The own terms in which both parts are expressed reveal the contradictions, in which the author must move, always difficult to avoid. The doctrine of the cause, as well as the distinction among normative orders, is the main conciliatory tool for Hojeda. The Pope is unlinked to human or positive right, otherwise he could not dispense or privilege, however he can only do it for a just cause.

El costo social del acoso laboral en mujeres : Análisis del costo social originado por demandas judiciales promovidas por maltrato impetradas a empleadas administrativa en la provincia de Mendoza, según el modelo ecológico de Bronfrenbrenner

OpenAIRE

Lamagrande Coria, Mario Manuel Ernesto

2012-01-01

El tratamiento del tema referido al acoso laboral de la mujer en las organizaciones económicas parte de considerar demandas judiciales laborales, en la provincia de Mendoza atendiendo a que se ha convertido en una práctica frecuente sobre la cual la legislación aun no ha precisado en forma satisfactoria su accionar. El caso en examen se articula con una intencionalidad definida consistente en una forma tendiente a lograr por parte del empleador la desvinculación sin causa del trabaj...

Municipio, identidad cultural y comunidades indígenas. El caso huarpe en el noreste de Mendoza

Directory of Open Access Journals (Sweden)

Leticia Saldi

2013-06-01

Full Text Available En el presente artículo analizamos cómo funcionarios de la Municipalidad de Lavalle representan e interpelan a las comunidades indígenas huarpe situadas en el área no irrigada del noreste de Mendoza, área situada en el departamento de Lavalle. Éste se encuentra dividido socioterritorialmente en dos espacios. Uno irrigado, caracterizado como área de progreso, de producción agrícola y de herencia europea y el otro no irrigado, representado como área de atraso, de producción ganadera y de herencia precolonial. A partir de un análisis etnográfico, analizamos cómo el municipio gestiona local y cotidianamente la diversidad étnica, cultural, económica y política. Concluimos que las formas con que los funcionarios interpelan a las comunidades indígenas y a sus integrantes son en base a un doble movimiento, uno de reconocimiento explícito y el otro de individualización, invisibilización y deslegitimación hacia las mismas. Al invisibilizar a las comunidades como sujetos colectivos, funcionarios municipales intentan dar una identidad común que incorpore a los espacios irrigados y no irrigados y a sus poblaciones como pertenecientes a un mismo territorio, el departamental, a la vez que mantenga la jerarquización entre ambos. Al realizar este movimiento, el municipio se erige como el unificador y contenedor de ambos espacios y de los distintos grupos socio-étnicos que los integran.

76 FR 2412 - Notice of Intent To Amend the Grand Junction Resource Management Plan, Prepare an Environmental...

Science.gov (United States)

2011-01-13

... initiates a Notice of Realty Action (NORA) to assist the BLM in determining whether granting the requested..., RMP Amendment, and NORA. DATES: Comments on this project, the NORA, or the proposed transfer of title...

Necesidad de transparencia y legalidad en la gestión y uso de las aguas subterráneas (El reciente caso de la Provincia de Mendoza

Directory of Open Access Journals (Sweden)

María Valentina Erice

2013-12-01

Full Text Available En Mendoza las aguas subterráneas son un recurso natural indispensable para la subsistencia y de gran importancia para el desarrollo provincial, ya que tienen un valor no solo económico y estratégico, sino también social y ambiental. La prevención de la sobreexplotación de los acuíferos y de la contaminación de estas aguas constituye una de las preocupaciones más serias a la que se enfrentan los encargados de gestionar su uso eficiente. Para ello resulta necesario aplicar políticas de ahorro y conservación, contar con un moderno Derecho de aguas preciso, claro, coherente y conservacionista, encaminado a dar soluciones eficaces a los problemas que hoy se nos presentan y que la gestión se realice con rectitud, transparencia y respetando la Constitución y la leyes.

Diafragmas horizontais de piso em madeira, confeccionados com chapas de OSB e vigas I, submetido ao carregamento em seu plano = Wood light-frame floor diaphragms, made with OSB panels and Ijoists, subjected to lateral loads

Directory of Open Access Journals (Sweden)

Altevir Castro dos Santos

2010-10-01

Full Text Available Este trabalho aborda nova perspectiva para construções em madeira, sob a ótica construtiva de sistemas com estruturas leves (Lightweight wood-frame construction, pela sua consagrada aplicação internacional e forte viabilidade de utilização no Brasil. Apresenta ensaios realizados pela primeira vez no Brasil, trazendo contribuição inicial sobre o assunto, com subsídios para projeto e execução de diafragmas de piso com emprego de material nacional oriundo do manejo racional de florestas cultivadas. O objetivo geral é avaliar a resistência e a rigidez de diafragmas horizontais, construídos em Sistemas Leves de Madeira, quando submetidos ao carregamento monotônico em seu plano. Para atendimento desse propósito, foram ensaiados protótipos em escala real (2,50 x 5,00 m com diferentes arranjos construtivos e avaliou-se a influência dos seguintes parâmetros: utilização de dispositivos enrijecedores entre vigas, que constituem a ossatura do diafragma horizontal; rigidez das ligações e o efeito do espaçamento entre pregos na rigidez do conjunto, composto de madeira e chapas de OSB – Oriented Strand Board Nacional. Dos ensaios realizados, concluise que o emprego de dispositivos enrijecedores permite o aumento do número de pregos de fixação no perímetro das chapas e esse acréscimo é responsável pelo aumento da resistência e rigidez dos diafragmas.This work is focused on lightweight wood-frame constructions, which are accepted worldwide and may be considered feasible for use in Brazil as well. It presents the results of experimental tests on floor diaphragms subjected to lateral loads. This is the first time this kind of test is performed in Brazil. Thus, it brings up valuable information about this subject, giving technical information that may contribute to the design and construction of floor diaphragms employing local materials that come from planted forests. The main goal of this research is to evaluate the resistance

Radioactive apparatus for measuring the thickness of hot sheet-metal; Jauge d'epaisseur radioactive pour la mesure a chaud de plaques metalliques; Radioaktivnyj izmeritel' tolshchiny goryachego listovogo prokata; Calibrador radiactivo para la medicion en caliente de chapas

Energy Technology Data Exchange (ETDEWEB)

Vasichev, B N; Latyshev, V K; Pliskin, Yu S; Felinger, A K

1962-01-15

exposent le plan fondamental de l'appareil permettant de controler l'epaisseur des feuilles au cours du laminage et examinent les facteurs dont depend la precision de la mesure a chaud de l'epaisseur des feuilles (temperature, ondulation, humidite superficielle, composition de la feuille et sa position sur le train de laminoirs). Ils decrivent egalement la construction d'un prototype a usage industriel pour me gamme d'epaisseurs allant de 14 a 44 mm. Les essais industriels faits avec l'appareil ont montre que, lors de l'emploi d'une source au {sup 137}Cs d'une activite equivalente a celle de 9,2 g de radium, la precision de la mesure a chaud de l'epaisseur des feuilles dans la gamme susmentionnee est de {+-} 0,1 mm. L'appareil effectue une mesure par seconde. Il fonctionne de facon satisfaisante eu egard aux conditions dans lesquelles il est utilise. (author) [Spanish] Para obtener una elevada exactitud en las condiciones de funcionamiento del tren de laminado se escogio un metodo dinamico en el que el parametro testigo barre todos los valores del intervalo a medir, en tanto que la componente cero indica solamente el momento en que el parametro medido y el parametro testigo son iguales. Este metodo elimina las retroacciones mecanicas y los desplazamientos variables del metodo de compensacion estatica, permite alcanzar la exactitud deseada y funciona con rapidez suficiente en las complejas condiciones del laminado. La memoria describe las caracteristicas fundamentales del aparato para comprobar el espesor de las chapas durante el laminado, y discute los factores que influyen en la exactitud de la medicion del espesor de chapas en caliente (temperatura, ondulacion, humedad superficial y composicion de la chapa, y su posicion en el tren de laminado). Describe tambien la construccion de un aparato experimental para la industria, destinado a medir espesores comprendidos entre 14 y 44 mm. Los ensayos industriales realizados con este aparato indican que con una fuente de {sup 137

Evolución de la natación de competencia en la provincia de Mendoza, Argentina, desde 1950 hasta el año 2000 = Evolution of the swimming competition in the province of Mendoza (Argentina, from 1950 to the year 2000

Directory of Open Access Journals (Sweden)

Adrián Javier Sáez

2013-03-01

Full Text Available La investigación llevada a cabo se sustenta en un estudio exploratorio y descriptivo. El tipo de diseño de la investigación es no experimental retrospectiva porque no se manipulan las variables y se buscan datos del pasado. Fue evaluada una población de N=40 conformada por 28 nadadores, 8 entrenadores y 4 dirigentes de distintas épocas, con una encuesta para recolectar datos de los orígenes y evolución de la natación de competencia en Mendoza. Asimismo se evaluó la evolución de los records de las pruebas de 100 metros en los cuatro estilos, los 400, 800 y 1500 metros libres ambos sexos en pileta de 25 y 50 metros. Se consideró la cantidad de clubes participantes, los nadadores con licencia nacional en los distintos años y las nominaciones para Seleccionados Nacionales en las distintas décadas. No se obtuvo diferencias estadísticamente significativas entre la evolución de los records realizados en pileta de 25 con la de 50 metros. Se comprobó que disminuyó tanto la cantidad de clubes participantes en los torneos desde 1950 hasta el año 2000 como la de nadadores federados. El estudio nos revela que el nivel competitivo de los nadadores se ha elevado por el aumento en las nominaciones a Seleccionados Nacionales. Como conclusión obtuvimos que posiblemente estos valores obtenidos se deban a la evolución en las técnicas de nado y en los métodos de entrenamiento, interrogante que puede servir para próximos estudios y que, en este caso, la cantidad de deportistas no es directamente proporcional a los logros deportivos.------------------------------------------------------------------------------The investigation that we carried out sustains in an exploratory and descriptive study. The type of design of the investigation is non experimental retrospective because the variables are not manipulated and data of the past look for. A population of N=40 conformed by 28 swimmers, 8 trainers and 4 leaders of different times was evaluated

Caracterización de sondeos estivales del norte de Mendoza mediante el análisis de componentes principales y obtención de un índice de convección Characterization Of Summer Soundings From Northern Mendoza By Principal Components Analysis And The Obtaining Of A Convection Index

Directory of Open Access Journals (Sweden)

Diego C Araneo

2011-06-01

Full Text Available Se utilizó el análisis de componentes principales para caracterizar radiosondeos estivales del norte de Mendoza, evaluando su capacidad para identificar patrones asociados a la ocurrencia de convección y definiendo un índice de inestabilidad. Se tomaron 326 casos, construyendo una matriz de anomalías de temperatura (T y temperatura de punto de rocío (Td de los niveles estándar entre 850 y 300 hPa. El análisis arrojó 6 componentes significativas que explican más del 91% de varianza. Así se obtuvieron 12 patrones que representan condiciones atmosféricas diferenciadas. Las mayores correlaciones entre patrones y casos de convección (C y no convección (NC, se obtuvieron para las componentes 6, 2, 4 y 3. La convección se favorecería en entornos relativamente húmedos con un marcado gradiente de T en niveles medios y altos, mientras se inhibiría con capas secas en niveles medios y altos, y débiles gradientes de T en capas bajas. El indicador de C/NC puede estimarse por regresión múltiple logística dependiente de las componentes de carga, con una correlación conjunta de 0,5, determinando un índice de estabilidad/inestabilidad calculable a partir de los perfiles de T y Td y dependiente de las características climatológicas de la región. El índice mostró una efectividad del 72%.The Principal Components Analysis was used to characterize the summery North Mendoza rawinsondes, evaluating their capacity to identify patterns associated to the convection occurrence and defining an instability index. It was selected 326 cases, building an entry matrix with the temperature and dew point temperature anomalies for the standard levels between 850 and 300 hPa. The analysis showed 6 significant components that explain more than 91% of variance. Therefore, 12 patterns were obtained, which represent different atmospheric conditions. The main correlations between the patterns and convection (C and non convection (NC cases were obtained for the

Effects of ‘hoja de malvón’ disease on the composition, sensory properties and preference of Malbec wines from Mendoza, Argentina

Directory of Open Access Journals (Sweden)

F Casassa

2010-08-01

Full Text Available F Casassa1, S Sari1, S Avagnina1, V Longone2, C Césari2, G Escoriaza2, C Catania1, M Gatica21Centro de Estudios de Enología; 2Laboratorio de Fitopatología, EEA Mendoza, Instituto Nacional de Tecnología Agropecuaria (INTA, San Martín 3853 (5507 Luján de Cuyo, Mendoza, ArgentinaAbstract: ‘Hoja de malvón’ is a grapevine wood disease widespread in Argentina that decreases vineyard productivity and longevity. This study was conducted during two consecutive vintages to assess its influence on the general composition, sensory attributes and preference of Vitis vinifera L. cv Malbec wines. Batches of 120 kg of grapes harvested from vines with different degrees of (visual symptoms of the disease were separately vinified. Grapes were grouped in three treatments: T1, grapes from vines with no symptoms; T2, grapes from vines with 10%–50% symptoms; and T3, grapes from vines with 50%–100% symptoms. Basic analyses of the grapes prior to crushing, and basic wine analysis were undertaken, together with spectrophotometric analyses of the wines after three months of bottle aging. The kinetics of alcoholic fermentation (AF was followed daily and additionally the wines were assessed by a sensory panel. T3 grapes were characterized by comparatively lower initial sugar contents and higher titratable acidity. The AF kinetics were unaffected in the wines arising from the diseased grapes. There was no clear-cut effect of the disease on the wines’ pH, volatile acidity, and total acidity; however, the later spectrophotometric analyses showed that the total phenolic index was the highest in T2 wines for both vintages. In 2005, the color index (CI was higher in T3 and showed the lowest value in 2006. The sensory properties of the wines were different in the two vintages. In 2005, T2 and T3 wines were perceived as having higher color intensity, violet hue and spicy notes, T2 being the most preferred wine. In 2006, T1 and T2 showed a much better sensory

La complejidad de la marginalidad y sus derivaciones en el marco de las economías regionales. El caso de la producción caprina en el extremo sur de Mendoza

Directory of Open Access Journals (Sweden)

María Eugenia Cepparo

2014-12-01

Full Text Available Este trabajo analiza la producción caprina en el departamento de Malargüe, sur de Mendoza, sus vinculaciones con el contexto local y en el marco de las transformaciones y perspectivas de los territorios rurales marginales de nuestras economías regionales. Nos referiremos a la situación actual y a la posibilidad de producción y faenamiento de carne caprina en el departamento. El estudio se enriquece, por una parte, con los aportes del marco conceptual de los procesos derivados de la marginalidad, y por la otra con las dinámicas y contextos de las economías regionales, y dentro de ellas, la de los sistemas productivos marginales que acompañan a las producciones extrapampeanas más tradicionales y destacadas.

Virulence profiles of Shiga toxin-producing Escherichia coli and other potentially diarrheagenic E.coli of bovine origin, in Mendoza, Argentina

Directory of Open Access Journals (Sweden)

M.A. Pizarro

2013-12-01

Full Text Available This study described a group of strains obtained from a slaughter house in Mendoza, in terms of their pathogenic factors, serotype, antibiotype and molecular profile. Ninety one rectal swabs and one hundred eight plating samples taken from carcasses of healthy cattle intended for meat consumption were analyzed. Both the swab and the plate samples were processed to analyze the samples for the presence of virulence genes by PCR: stx1, stx2, eae and astA. The Stx positive strains were confirmed by citotoxicity assay in Vero cells. The isolates were subsequently investigated for their O:H serotype, antimicrobial susceptibility and molecular profile by Random Amplification of Polymorphic DNA (RAPD. Twelve E.coli strains were identified by their pathogenicity. Nine were from fecal origin and three from carcasses. Three strains carried the stx1 gene, three the stx2 gene, two carried eae and four the astA gene. The detected serotypes were: O172:H-; O150:H8; O91:H21; O178:H19 and O2:H5. The strains showed a similarity around 70% by RAPD. Some of the E.coli strains belonged to serogroups known for certain life-threatening diseases in humans. Their presence in carcasses indicates the high probability of bacterial spread during slaughter and processing.

Taxonomía y biogeografía de cuatro especies de Psectrascelis (Coleoptera: Tenebrionidae de la Precordillera y Cordillera de los Andes en Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Gustavo E. FLORES

2005-01-01

Full Text Available El género neotropical Psectrascelis Solier (Pimeliinae: Nycteliini comprende 75 especies que se distribuyen desde el sur de Perú hasta el sur de Argentina y Chile. En este aporte se revisan las cuatro especies de Psectrascelis que habitan en el noroeste de la provincia de Mendoza (Argentina, en los cordones montañosos de la Precordillera y Cordillera de los Andes: P. deplanata (Lacordaire, 1830, P. vestita (Lacordaire, 1830, P. mamillonea (Lacordaire, 1830 y P. semistrigosa Fairmaire, 1903. Se proveen redescripciones con nuevos caracteres morfológicos, fotografías de adultos y de los pronotos, e ilustraciones de genitalia masculinos. Se consigna la distribución geográfica y rangos altitudinales para cada especie, estableciendo las provincias biogeográficas que habitan. Se presenta una discusión acerca de los patrones de distribución de las especies de Psectrascelis y de otros artrópodos epigeos que habitan en los cordones montañosos de la Precordillera y Cordillera de los Andes.

US Navy Transfers Research Vessel to Philippine Navy > U.S. Pacific Command

Science.gov (United States)

, 2016 EMAIL PRINT Photos 1 of 1 SAN DIEGO (April 27, 2016) - Vice Adm. Nora Tyson, left, commander of Philippines oceanographic research and study capabilities. SAN DIEGO (April 27, 2016) - Vice Adm. Nora Tyson part in that relationship," said Vice Adm. Nora Tyson, commander, U.S. 3rd Fleet. "Today, we

Tradición y reacción en el Sesquicentenario: La escuela sevillana mendocina Tradition and reaction in the sesquicentennial: The Sevillian school of Mendoza

Directory of Open Access Journals (Sweden)

María Celina Fares

2011-06-01

Full Text Available La indagación sobre el nacionalismo en el posperonismo en Mendoza nos ha permitido recuperar una serie de itinerarios intelectuales que dan cuenta de la complejidad de un período, en el que la circulación y tránsito de ideas evidencian no sólo fuertes procesos de mutación de identidades, sino también la cristalización de posiciones ciertamente anacrónicas. En este trabajo pretendemos relevar a propósito de la celebración del sesquicentenario de Mayo la producción historiográfica mendocina que circuló en espacios de divulgación, constituyéndose en una fuerte tradición que perduró en los espacios académicos locales. Más allá de explicar la incidencia que tuvieron en la refracción de otras corrientes de pensamiento, las tesis interpretativas que ven a Mayo como un momento de reafirmación de la hispanidad y que niegan su sentido emancipatorio, así como los recorridos biográficos de sus autores, revelan redes de sociabilidad intelectual que bajo la nominación de nacionalismo encubrían no pocas especificidades, al mismo tiempo que revelaban las vinculaciones existentes con la escuela historiográfica sevillana, por entonces usina intelectual del franquismo y nutriente del pensamiento nacionalista conservador y autoritario de los años sesenta.Research on the nationalism present in post- Peronism in Mendoza has allowed us to retrieve a number of intellectual itineraries that exemplify the complexity of a period in which the circulation and traffi c of ideas show not only strong identity mutation processes, but also the crystallization of undoubtedly anachronistic positions. In this article we aim to survey -in the context of the sesquicentennial of the May Revolution celebrations-, the important historical production that circulated in zones of wide diffusion, and which contributed to implant a powerful tradition that lasted for a considerable time in the local academic scene. Rather than explaining the impact that they had

Building and Maintaining Organizational Infrastructure to Attain Clinical Excellence.

Science.gov (United States)

Lebak, Kelly; Lane, Jason; Taus, Richard; Kim, Hansol; Stecker, Michael S; Hall, Michael; Lane-Fall, Meghan B; Weiss, Mark S

2017-12-01

Active maintenance of highly functional teams is critical to ensuring safe, efficient patient care in the non-operating room anesthesia (NORA) suite. In addition to developing collaborative relationships and patient care protocols, individual and team training is needed. For anesthesiologists, this training must begin during residency. The training should be supplemented with continuing education in this field for providers who find themselves working in the NORA space. As NORA continues to grow, robust NORA-specific quality assurance and improvement programs will empower anesthesiologists with the tools they need to best care for these patients. Copyright © 2017 Elsevier Inc. All rights reserved.

Redefining U.S. Arctic Strategy

Science.gov (United States)

2015-05-15

responsibility shifts 21 Barno, David and Nora Bensahel. The Anti-Access Challenge you’re not thinking...International Affairs 85, no. 6 (2009). 38 Barno, David and Nora Bensahel. THE ANTI-ACCESS CHALLENGE YOU’RE NOT THINKING ABOUT, 05 May 2015...and Rescue in the Arctic, 22 June 2011. Arctic Council Secretariat. About the Arctic Council, Arctic Council, 2011. Barno, David and Nora

Los Mares Interiores. (Libro de Poemas del Académico Juan Mendoza Vega

Directory of Open Access Journals (Sweden)

Efraim Otero Ruiz

2001-12-01

Full Text Available

(Presentación del libro en la Fundación Santillana para Iberoamérica, Bogotá, Noviembre 23, 2001.

Ha querido la deferencia del señor  exPresidente Belisario Betancur, Presidente de la Fundación Santillana para lberoamérica, que sea yo quien les presente el libro "Los mares interiores" del médico, periodista y poeta Juan Mendoza Vega. Tarea que acometo con singular afecto, nacido de una amistad que supera ya los 40 años y de una admiración continua por las dotes intelectuales y artísticas que lo colocan en un sitial especial entre los médicos de Colombia.

Nacido en Chinácota y bachiller en Pamplona, su infancia y adolescencia transcurrieron en esos paisajes idílicos que se extienden entre el río Pamplonita y las colinas de Iscalá, donde ha trasegado la vida de muchos hijos ilustres del Norte de Santander. Después cursó sus estudios de Medicina en la Universidad
Nacional, en Bogotá, entre 1952 y 1957, habiéndose graduado de médico en 1960 a los dos años de haber iniciado su especialización en neurología y neurocirugía, temas que constituirían la mayor dedicación de su vida. Pues de ahí saltó a la cátedra de la especialidad en la Facultad de Medicina del Rosario entre 1969 y 1985, siendo además iniciador de la cátedra y profesor de Historia de la Medicina en la misma Universidad desde 1980 hasta el presente; al tiempo, ha sido profesor de Etica Médica allí mismo desde 1983. A estas actividades de planta ha unido su participación como catedrático invitado en numerosas instituciones y universidades de dentro y fuera del país. Y la autoría de 55 publicaciones científicas en revistas nacionales e internacionales sobre temas de neurología y neurocirugía, ética médica e historia de la medicina...

Caracterización de daños producidos por Meloidogyne Spp. (Nemata: Tylenchida en la vid en Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Carla Vanina Dagatti

2014-12-01

Full Text Available El objetivo de esta investigación fue comparar y establecer relaciones entre los diferentes indicadores de crecimiento entre plantas de vid con dos niveles de infestación (alto y leve de Meloidogyne spp. El estudio se realizó en un viñedo cv Merlot, situado en Agrelo, Mendoza, donde se escogieron 2 parcelas, con y sin nematodos, con diferentes niveles de crecimiento vegetativo. Los indicadores a evaluar fueron: peso y número de racimos por planta, peso de poda, cantidad de entrenudos y área foliar de hojas y feminelas. El grado de infestación de nematodos de cada parcela se determinó mediante la técnica flotación - centrifugación. Para el análisis estadístico se utilizó la prueba de wilcoxon (Mann Whitney U y el test de student. Además, mediante un análisis de regresión lineal, se comprobó si existía relación entre los indicadores evaluados y la densidad de población de Meloidogyne spp. expresado en número de estados juveniles (J2 presentes en el suelo. Los resultados indicaron que la parcela con menor densidad poblacional de juveniles de Meloidogyne spp., presentó mayor peso promedio de madera de poda, así como también un área foliar de hojas y feminelas superior. Con respecto al peso promedio de racimos por planta, dicha parcela también superó a aquella con alta concentración de nematodos.

Subduction controls on Miocene back-arc lavas from Sierra de Huantraico and La Matancilla, Argentina and new 40Ar/39Ar dating from the Mendoza Region, Argentina

DEFF Research Database (Denmark)

Dyhr, Charlotte Thorup; Holm, Paul Martin; Llambias, Eduardo J.

2013-01-01

Back-arc volcanism in the western Argentinian provinces of Mendoza and Neuquén has been widespread from the Miocene to historic times. We present a detailed investigation of profiles through two of the major Miocene volcanic areas of the region, the neighboring Huantraico and LaMatancilla plateaus......, including new 40Ar/39Ar age results of major and trace elements as well as Nd, Sr and Pb isotopic data. Four million years of eruptions from 24.4 ± 0.3 Ma (2σ) of alkali olivine basalts with OIB-type incompatible trace element enrichments at La Matancilla (~36.50°S) provide evidence for the presence of back......-arc mantle devoid of subduction-related components. In contrast, the lower Huantraico lavas (~37.30°S) require an atypical back-arc mantle, almost devoid of arc-like components (e.g. low La/Ta = 15–18 and Ba/La = 12–18), but with a more depleted isotopic signature (e.g. 87Sr/86Sr, 0.7033–0.7037) than...

Tipos de apoyo y la digitalización de las redes personales. El uso de Facebook de adolescentes rururbanos de Mendoza (Argentina

Directory of Open Access Journals (Sweden)

Alejandro Paredes

2015-06-01

Full Text Available El objetivo de este trabajo es analizar la red social virtual (en este caso Facebook de adolescentes que asisten a un colegio rururbano marginal de Mendoza (Argentina, y estudiar las percepciones que ellos manifiestan sobre los tipos de apoyo que les brinda. Se tomó a un curso del último año de una escuela secundaria compuesto por 23 alumnos de una edad promedio de 17 años (el 67% eran mujeres. En su mayoría provienen de familias cuyos padres no poseen ingresos estables. La metodología utilizada es la propia del análisis de redes sociales (realización de grafos con el software TouchGraph, análisis de centralidad, subgrupos y nodos de la red, aplicación de métodos estadísticos y metodología cualitativa (entrevistas individuales y Focus group. Con respecto al estudio de las redes personales a través del uso de Facebook, se apreció una masividad en el uso de esta red (solo dos casos no lo utilizan, no existiendo diferencias significativas según el género, en el número de amigos. Finalmente desde la percepción de los estudiantes, Facebook sirve para reforzar el apoyo informacional, tangible y afectivo, pero no tanto el apoyo axiológico.

Malnutrition and body composition in urban and rural schoolchildren: A cross-sectional study in San Rafael, Mendoza (Argentina).

Science.gov (United States)

Garraza, Mariela; Cesani, María F; Navone, Graciela T; Oyhenart, Evelia E

2016-11-01

The aim of the present study was to analyze the nutritional status and body composition of children from San Rafael, Mendoza, avoiding urban and rural categorization by generating subpopulations as a function of their socio-environmental characteristics. A cross-sectional study was performed in 3,596 schoolchildren from 4.0 to 13.9 years of age. Body weight, height, upper arm circumference, and triceps skinfold were measured. Body mass index, total muscle, and fat areas of the arm were calculated. To estimate nutritional status and body composition, the NHANES III reference was used. The socio-environmental variables were surveyed using a structured questionnaire. These variables were processed by categorical principal-component analysis (catPCA). The catPCA allowed the differentiation of four groups, three with urban characteristics (high urban, medium urban, impoverished urban), and a rural group. Stunting occurred at a higher rate in the impoverished urban group, and the occurrence of underweight children was higher in the rural group. The prevalence of excess weight varied in the range of 20-26%. The latter value corresponded to children of the high urban group, who also did not show reduced muscle mass. Children from San Rafael presented differences in nutritional condition and body composition associated with pronounced socio-environmental heterogeneity. Thus, we could observe a gradient from the "high urban" group, with better social, economic, and sanitation conditions and at the same time a more obesogenic environment to the "impoverished urban" and "rural" groups, whose vulnerability reflected a higher prevalence of child undernutrition and the association with excess weight and reduced muscle mass. Am. J. Hum. Biol. 28:796-803, 2016. © 2016Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Estructura y estado de conservación de los bosques de Prosopis flexuosa D.C. (Fabaceae, subfamilia: Mimosoideae en el noreste de Mendoza (Argentina Structure and conservative condition of the Prosopis flexuosa D.C. (Fabaceae, subfamily: Mimosoideae woodlands in northeast Mendoza (Argentina

Directory of Open Access Journals (Sweden)

JUAN AGUSTÍN ALVAREZ

2006-03-01

Full Text Available La recomendación de normas de manejo que regulen el uso de los recursos forestales debe estar basada en el conocimiento de la estructura y dinámica de los mismos. El objetivo de este trabajo fue conocer la estructura poblacional de las principales unidades boscosas del bosque de Prosopis flexuosa del noreste de Mendoza, sus condiciones sanitarias y su potencial productivo. Se muestrearon un total de 1.471 algarrobos en las cuatro unidades boscosas más representativas. La densidad total de algarrobos fue la siguiente: bosque semicerrado de P. flexuosa con Atriplex lampa y Lycium tenuispinosum en valles intermédanos (Bosque 1: 181 árboles ha-1, bosque abierto de P. flexuosa con Trichomaria usillo y Suaeda divaricata en ondulaciones (Bosque 2: 155 árboles ha-1, bosque abierto de P. flexuosa con T. usillo (Bosque 3: 233 árboles ha-1 y bosque abierto de P. flexuosa con A. lampa en ondulaciones suaves (Bosque 4: 215 árboles ha-1. El análisis de componentes principales de la estructura diamétrica agrupó los sitios relevados en las distintas unidades boscosas según la proporción de árboles de diámetro basal mayor a 25 cm. Los sitios del Bosque 1 (mayor proporción de árboles grandes, se separaron de los sitios con mayor proporción árboles pequeños (bosques 2 y 4. Debido al hábito de crecimiento de los algarrobos, la cantidad de productos maderables de estos bosques es baja. Además, P. flexuosa presenta en el área un porcentaje alto de individuos con más de dos fustes, la forma en muchos casos es decumbente y la altura de los fustes es menor a un metro. Por lo tanto, el potencial forestal del bosque es bajo y el posible aprovechamiento debería realizarse a escala local, considerando la inclusión de otras actividades complementarias en zonas establecidas para tal finThe recommendation of management rules that regulate the use of forest resources must be based on the knowledge of the structure and dynamics of forests. This work

Fungal population in soils producing quinoa (Chenopodium quinoa Willd, under different management systems in the community Kerecaya Municipality of Salinas de Garci Mendoza

Directory of Open Access Journals (Sweden)

Paco-Pérez Victor

2017-08-01

Full Text Available The Kerecaya community (3700-4000 msnm of the municipality of Salinas of Garci Mendoza of the south altiplano of Bolivia, in spite of your climatics risks. The plots of quinoa present lower organic matter to 0.93%, humidity of the smaller earth to 12.9%, temperature of the earth for under 8.5 oC and pH lower to 8.0. The population of funguses in three types it has studied of earths that went: without farm (without entropic intervention, traditional and mechanized. The humid samples of the earth were gathered to a depth of 6 to 25 cm at random in zig-zag, these to be prosecuted by means of the method of seriate dilution and inoculated in plates with 0.5 mL and it is evaluated the colonies for UFC´s/g of earth, the genre of Penicilli-um spp., with major population of 65.1%, followed for Aspergillus spp., with 24,1% and Trichoderma spp., with minor great quality of 13,8% and the population average in UFC´s/g of earth it went of 1035.4 in with-out farm (without entropic intervention, 959.7 in traditional and 868.2 in the mechanized and the major population was presented in the month of February 1572.8 UFC/g of earth.

76 FR 9814 - Proposed Collection, Comment Request

Science.gov (United States)

2011-02-22

... 25, 2011. ADDRESSES: Send comments to Nora Kincaid, BLS Clearance Officer, Division of Management... INFORMATION CONTACT: Nora Kincaid, BLS Clearance Officer, at 202-691-7628 (this is not a toll free number...

78 FR 50449 - Proposed Collection, Comment Request

Science.gov (United States)

2013-08-19

... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS...

77 FR 36296 - Proposed Collection, Comment Request

Science.gov (United States)

2012-06-18

... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS...

75 FR 55612 - Proposed Collection, Comment Request

Science.gov (United States)

2010-09-13

... Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics, Room... fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid...

78 FR 29383 - Proposed Collection, Comment Request

Science.gov (United States)

2013-05-20

... comments to Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics... by fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora...

76 FR 2149 - Proposed Collection, Comment Request

Science.gov (United States)

2011-01-12

... comments to Nora Kincaid, BLS Clearance Officer, Division of Management Systems, Bureau of Labor Statistics... by fax to 202-691-5111 (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora...

Aplicação do processo laser CO2 de soldagem em aço ARBL na fabricação de rotores para máquinas elétricas

OpenAIRE

Conz, Roberto [UNESP

2004-01-01

O objetivo deste trabalho foi substituir um bloco de grandes dimensões em aço forjado, por chapas finas de aço, laminadas a quente, soldadas pelo processo LASER CO2, destinadas à fabricação de rotores para máquinas elétricas com até 40 MW de potência, para tanto foram utilizadas chapas com 3 mm de espessura, empilhadas, compactadas e fixadas por tirantes. Considerando que a largura das bobinas e blanks disponíveis no mercado nacional não atendem às necessidades dimensionais do produto fez-se ...

Lights and shadows of sustainable development and combat against desertification: economic rationalities in the eye of the storm. Case study involving goat producers in drylands (Mendoza, Argentina Claroscuros del desarrollo sustentable y la lucha contra la desertificación: las racionalidades económicas en el ojo de la tormenta: Estudio de caso con productores caprinos de tierras secas [Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Laura Torres

2010-01-01

Full Text Available This work analyses the conflict situation present in the province's drylands between goat producers and programmes to combat desertification regarding production practices and the use producers make of natural resources. The case study tackled comprises the north-eastern extreme of Mendoza province. The , which is the hyperarid spot of the region, severely affected by desertification processes, covering an extent of 10,007 km2, and with 3015 inhabitants, where small goat breeding farms predominate. Previous studies indicate that the major causes of desertification in the area are logging of the native woodland and overgrazing which have led to improper livestock production practices. In response to this, the actions to combat desertification commonly point out the need to "raise awareness" and "build capacities" of the producers by initiating processes of change in the production systems. The proposals insist that, if the current level of pressure on resources is maintained, the already serious poverty conditions will grow worse in the future. Nevertheless, despite the efforts and funds invested, the producers seem to stubbornly persist in their present production strategies and in the dynamics of natural resource use derived from them. How to explain their refusal to consider other production options likely to result in higher profit and better environmental balance? How to explain that they act, at least apparently, against their own benefits? Against the explanations that place the producers' "culture" is the most important problem, the present work seeks to cooperate in clarifying these questions through an analysis of the different rationalities that, held by different actors, converge in the area. By using a mixed methodology, the paper analyse three dimensions: 1- The environmental resource supply, which is the basis of production activities, 2- The income attained by goat production units, and 3- The expenditures they face in terms of

77 FR 11593 - Proposed Collection, Comment Request

Science.gov (United States)

2012-02-27

... in the Addresses section of this notice on or before April 27, 2012. ADDRESSES: Send comments to Nora... (this is not a toll free number). FOR FURTHER INFORMATION CONTACT: Nora Kincaid, BLS Clearance Officer...

Living with Hearing Loss

Science.gov (United States)

... version of this page please turn Javascript on. Nora Woodruff and her family, including dad Bob, have ... hearing, balance, smell, taste, voice, speech, and language. Nora Woodruff, daughter of ABC newsman Bob Woodruff and ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Process Funding Priorities Research Training News & Events News Nora's Blog NIDA in the News NIDA Notes Podcasts ... of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director The Link ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects Contact the ... News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects National Drug & ...

Publications - GMC 234 | Alaska Division of Geological & Geophysical

Science.gov (United States)

following North Slope wells: Itkillik River Unit #1, Nora Fed #1, Toolik Fed #1, Kemik Unit #1, Lupine Unit following North Slope wells: Itkillik River Unit #1, Nora Fed #1, Toolik Fed #1, Kemik Unit #1, Lupine Unit

Notes on the Analysis of Political Profiles and Careers. The study of Ruling Groups in a Hinterland Province of Argentina. (Mendoza, 1852-1900

Directory of Open Access Journals (Sweden)

Eliana Valeria Fucili

2018-01-01

Full Text Available This paper provides some theses to enrich studies on the conformation and characterization of nineteenth century Argentinean ruling groups. For this purpose, the article takes as its object of study the political teams of the Mendoza province that emerged during the second half of the 19th century, and presents solid empirical evidence to identify a set of 725 political actors responsible of embodying and activating the dynamics of the provincial state. This information has been analyzed with quantitative methods and qualitative tools such as prosopography, sociological interpretations and sociability analyses, allowing us to distinguish several features of the local leadership. A wide variety of documents—official records, departmental dispatches, press of the time— was used to investigate these questions, in order to explore the variables related to the unfolding of these actors’ political careers: their socio-professional profile, their continuity or permanence in public service positions, and the projection of their itineraries. As a whole, the article constitutes a contribution to current historiographical debates about the relative complexity of the nineteenth century political system and the role of provincial and local political groups in the process of shaping the Argentine national state. This study also represents a substantive advance in regard to literature about elites and ruling teams, which has been based on meager and unsystematic data, producing hasty generalizations that have nevertheless been taken as valid indicators to define a broad political spectrum.

Ajuste de modelo fenológico para predecir el comportamiento de Lobesia botrana (Lepidoptera: Tortricidae en un viñedo de Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Carla Vanina DAGATTI

2015-01-01

Full Text Available La temperatura es la variable que más incide en el desarrollo de Lobesia botrana (Den & Schiff, cuya relación ha sido estudiada mediante modelos matemáticos, como el de Touzeau. En Mendoza, en 2010 se registró la aparición de L. botrana. El objetivo de este trabajo es ajustar el modelo de Touzeau para predecir el comportamiento de la polilla. El estudio se realizó en un viñedo cv. Malbec desde 2012. Se emplearon trampas de feromonas. La temperatura se registró con un sensor datalogger. Se calculó la integral térmica con la fórmula de Touzeau con un umbral de 10ºC desde el 1 de julio de cada año. Los resultados indicaron que el primer vuelo se desarrolló el 18 y el 20 de octubre con 204,05 ± 10,73 grados día, el segundo en la primera decena de diciembre con 728,34 ± 41,95 grados día, el tercero durante la última quincena de enero con 1329,08 ± 151,35 grados día y el cuarto a mediados de febrero de 2012 y 2013, respectivamente con 1721,84 ± 116,63 grados día. Estos resultados son útiles para predecir la aparición de la plaga y como herramienta para establecer un sistema de alarma para los productores.

Antibacterial activity of berberine-NorA pump inhibitor hybrids with a methylene ether linking group.

Science.gov (United States)

Samosorn, Siritron; Tanwirat, Bongkot; Muhamad, Nussara; Casadei, Gabriele; Tomkiewicz, Danuta; Lewis, Kim; Suksamrarn, Apichart; Prammananan, Therdsak; Gornall, Karina C; Beck, Jennifer L; Bremner, John B

2009-06-01

Conjugation of the NorA substrate berberine and the NorA inhibitor 5-nitro-2-phenyl-1H-indole via a methylene ether linking group gave the 13-substituted berberine-NorA inhibitor hybrid, 3. A series of simpler arylmethyl ether hybrid structures were also synthesized. The hybrid 3 showed excellent antibacterial activity (MIC Staphylococcus aureus, 1.7 microM), which was over 382-fold more active than the parent antibacterial berberine, against this bacterium. This compound was also shown to block the NorA efflux pump in S. aureus.

Midlatitude Cirrus Clouds Derived from Hurricane Nora: A Case Study with Implications for Ice Crystal Nucleation and Shape.

Science.gov (United States)

Sassen, Kenneth; Arnott, W. Patrick; O'C. Starr, David; Mace, Gerald G.; Wang, Zhien; Poellot, Michael R.

2003-04-01

Hurricane Nora traveled up the Baja Peninsula coast in the unusually warm El Niño waters of September 1997 until rapidly decaying as it approached southern California on 24 September. The anvil cirrus blowoff from the final surge of tropical convection became embedded in subtropical flow that advected the cirrus across the western United States, where it was studied from the Facility for Atmospheric Remote Sensing (FARS) in Salt Lake City, Utah, on 25 September. A day later, the cirrus shield remnants were redirected southward by midlatitude circulations into the southern Great Plains, providing a case study opportunity for the research aircraft and ground-based remote sensors assembled at the Clouds and Radiation Testbed (CART) site in northern Oklahoma. Using these comprehensive resources and new remote sensing cloud retrieval algorithms, the microphysical and radiative cloud properties of this unusual cirrus event are uniquely characterized.Importantly, at both the FARS and CART sites the cirrus generated spectacular halos and arcs, which acted as a tracer for the hurricane cirrus, despite the limited lifetimes of individual ice crystals. Lidar depolarization data indicate widespread regions of uniform ice plate orientations, and in situ particle replicator data show a preponderance of pristine, solid hexagonal plates and columns. It is suggested that these unusual aspects are the result of the mode of cirrus particle nucleation, presumably involving the lofting of sea salt nuclei in strong thunderstorm updrafts into the upper troposphere. This created a reservoir of haze particles that continued to produce halide-salt-contaminated ice crystals during the extended period of cirrus cloud maintenance. The inference that marine microbiota are embedded in the replicas of some ice crystals collected over the CART site points to the longevity of marine effects. Various nucleation scenarios proposed for cirrus clouds based on this and other studies, and the

El conventillo y la vivienda masiva. Medio siglo de historia sobre los espacios domésticos para sectores populares, en el área metropolitana de Mendoza (Argentina, 1900-1955

Directory of Open Access Journals (Sweden)

Cecilia Raffa

2014-10-01

Full Text Available Dónde y cómo se habitaba fueron simultáneamente temas del ámbito privado y problemáticas de injerencia estatal, como efecto de los cambios sociales, políticos y culturales producidos en las primeras décadas del siglo XX en varios países, incluida Argentina. En esos años, la habitación, la educación y la salud empezaron paulatinamente a ser incorporados a las agendas gubernamentales primero para regularlos, luego para abrirlos a los sectores de menores recursos tras el objetivo de la democratización del bienestar. Paralelamente, la renta de habitaciones y la autoconstrucción se mantuvieron como estrategias de larga duración para acceder a la vivienda, a través de variadas tipologías. El trabajo propone, sobre la base del método histórico, trazar una historia de los espacios domésticos en el Área Metropolitana de Mendoza, analizando las condicionantes de su producción y poniendo en relación la acción privada y la estatal.

Assessing the solar potential of low-density urban environments in Andean cities with desert climates: The case of the city of Mendoza, in Argentina. 2nd. Part

Energy Technology Data Exchange (ETDEWEB)

Arboit, M.; Mesa, A.; Fernandez Llano, J.C.; de Rosa, C. [Instituto de Ciencias Humanas, Sociales y Ambientales. (INCIHUSA - CONICET), R+D Unit: Laboratorio de Ambiente Humano y Vivienda, Adrian Ruiz Leal s/n. Parque General San Martin. (5500) Mendoza (Argentina); Diblasi, A. [Facultad de Ciencias Economicas, UNCuyo. Area Ciencias Exactas,(CRICYT - CONICET), Adrian Ruiz Leal s/n. Parque General San Martin. (5500) Mendoza (Argentina)

2010-07-15

Energy use in the built environment is globally recognized as a key issue for sustainable urban development. In temperate-cold arid regions with a generous solar resource, such as those of western Argentina, adequate design and technology can substantially reduce the energy demand for space and water heating in urban buildings. The solar potential of low-density residential urban areas in the city of Mendoza's Metropolitan Area (MMA), has been studied earlier in this research. Several indicators of the solar potential were elaborated. They provide necessary information when planning and designing new urban structures or refurbishing existing ones. However, a more direct indicator, relating the available solar radiation during a heating season to the space volume to be heated, the Volumetric Insolation Factor (VIF), seems to be of most practical use as far as contributing a helpful evaluation indicator, to the above mentioned design processes. The present study follows the methodological steps used in the former research, evaluating comparatively the results of a Graphic-Computational Model and a Multiple Linear Regression Statistical Model. As in the earlier study, the good fit of both models' results clearly point at the reliability of the statistical procedure and its valuable contribution of a simplified calculation tool as its by-product. (author)

Publications - GMC 183 | Alaska Division of Geological & Geophysical

Science.gov (United States)

materials: AK State C #1, Bush Federal #1, Echooka Unit #1, Fin Creek Unit #1, E. De K. Leffingwell #1, Nora materials: AK State C #1, Bush Federal #1, Echooka Unit #1, Fin Creek Unit #1, E. De K. Leffingwell #1, Nora

Análisis de los hábitos de la población como herramienta para la planificación de los espacios verdes públicos. Caso Área Metropolitana de Mendoza.

Directory of Open Access Journals (Sweden)

Dra. Arq. Jimena Gómez Piovano

2017-12-01

Full Text Available En las ciudades actuales la presencia o no de espacios públicos de recreación (parques, plazas, espacios verdes y ramblas influye en la calidad de vida de los habitantes y en consecuencia, en los niveles de sostenibilidad de la misma. Existen numerosos estudios que describen los beneficios que los mismos producen a nivel social, económico y ambiental, a la vez que refieren lo favorable que es su uso, en la salud de los habitantes. A pesar de lo extenso de la bibliografía existente no se halla unanimidad en relación a los radios de influencia de los distintos tipos de espacios públicos de recreación. Por ello, este estudio tiene como objetivo analizar y comprender los hábitos de la población de Área Metropolitana de Mendoza y así determinar si la ciudad posee la suficiente cantidad de superficie verde y si su disposición en la trama satisface a las necesidades de todos sus habitantes.

Publications - GMC 155 | Alaska Division of Geological & Geophysical

Science.gov (United States)

: Brontosaur U.S. #1, Northstar #1, Nora Fed #1, OCS Y-0180-1 (Seal Island A-4), OCS Y-0338-1, Beli Unit #1 following seven North Slope wells: Brontosaur U.S. #1, Northstar #1, Nora Fed #1, OCS Y-0180-1 (Seal Island

Assessing the solar potential of low-density urban environments in Andean cities with desert climates: The case of the city of Mendoza, in Argentina

Energy Technology Data Exchange (ETDEWEB)

Arboit, M.; Fernandez Llano, J.C.; Rosa, C. de [Instituto de Ciencias Humanas, Sociales y Ambientales (INCIHUSA - CONICET), R and D Unit, Laboratorio de Ambiente Humano y Vivienda (LAHV), Adrian Ruiz Leal s/n, Parque General San Martin 5500, Mendoza (Argentina); Diblasi, A. [Facultad de Ciencias Economicas, UNCuyo, Centro Universitario (5500) Mendoza (Argentina)

2008-08-15

Energy use in the built environment is globally recognized as a key issue for sustainable urban development. In tempered-cold arid regions with a generous solar resource, adequate design and technology can substantially reduce the energy demand for space and water heating in urban buildings. This study assessed the solar potential of low-density urban environments in the city of Mendoza, Argentina. The results of the study will be used to develop technical guidelines for urban and energy planning agencies and professionals involved in the production of habitat. The study included the following successive steps: (i) selection of a representative sample of analysis units (city blocks); (ii) selection of a series of urban and building variables; (iii) definition of indicators accounting for solar masking, building's potential use of the solar radiation on the whole urban area, and availability of adequate collecting areas to satisfy high percentages of the energy demand in low-density urban environments; and (iv) insolation of potential collectors simulated by a graphic-computational model developed in the R and D unit. Only the results for solar space heating are presented in this paper. The results, direct and statistical, indicate that it is technically feasible to meet the target solar fractions. At the same time, by means of the solar recycling of existing building stocks, it is possible to considerably reduce the environmental impacts due to the extraction of materials from, and the disposal of solid wastes into, the ecosystem. (author)

La dinámica de la sustentabilidad fiscal en los municipios urbanos de la Provincia de Mendoza

Directory of Open Access Journals (Sweden)

Raúl Molina

2016-11-01

Full Text Available La finalidad del trabajo es revisar el comportamiento fiscal comparado de los departamentos urbanos que forman parte del “Gran Mendoza” (Capital, Guaymallén, Godoy Cruz y Las Heras, así como analizar distintos indicadores de sustentabilidad fiscal y su aplicación a la situación actual y futura de los mismos. A partir del análisis de la deuda pública consolidada y su relación con los resultados financieros de los respectivos municipios, se analizan las perspectivas de solvencia de cada uno de ellos, para determinar, en su caso, los esfuerzos fiscales necesarios para retomar la senda de la sustentabilidad. Sin duda, la efectividad de la política presupuestaria y tributaria, y el nivel del gasto público, repercuten claramente en los resultados de la gestión, pero hay también otros aspectos, como la selección de formas alternativas para financiar el gasto público y el manejo del endeudamiento, que impactan en los resultados financieros de los municipios. Clasificación JEL: H7.Palabras clave: Finanzas Públicas Intergubernamentales; Estados sub-nacionales; Solvencia fiscal; Sustentabilidad; Déficits. The dynamics of fiscal sustainability in the urban municipalities of the Province of MendozaAbstractThe purpose of this paper is to review the fiscal performance compared to urban municipalities of “Gran Mendoza” (Capital, Guaymallén, Godoy Cruz and Las Heras and to analyze different indicators of fiscal sustainability and its application to the current and future situation of them. From the analysis of the consolidated public debt and its relationship to the financial performance of the respective municipalities, the prospects solvency of each of them are analyzed to determine the necessary fiscal efforts to resume the path of sustainability. Certainly the effectiveness of budgetaryl and tax policy, and the level of public spending clearly affect the results of management, but there are also other aspects such as the selection

Convergent evolution of argonaute-2 slicer antagonism in two distinct insect RNA viruses.

NARCIS (Netherlands)

Mierlo, J.T. van; Bronkhorst, A.W.; Overheul, G.J.; Sadanandan, S.A.; Ekstrom, J.O.; Heestermans, M.; Hultmark, D.; Antoniewski, C.; Rij, R.P. van

2012-01-01

RNA interference (RNAi) is a major antiviral pathway that shapes evolution of RNA viruses. We show here that Nora virus, a natural Drosophila pathogen, is both a target and suppressor of RNAi. We detected viral small RNAs with a signature of Dicer-2 dependent small interfering RNAs in Nora virus

Publications - GMC 164 | Alaska Division of Geological & Geophysical

Science.gov (United States)

Staines St. 10-09-23, Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 , Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 (Orion #1), OCS Y-0334

Determinación de densidades urbanas sostenibles en base a metodología relativa al acceso solar: caso área metropolitana de Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Jimena Gómez Piovano

2017-06-01

Full Text Available Uno de los retos actuales a nivel de diseño y planificación urbana consiste en la trasformación de las urbes actuales en modelos de ciudades que contemplen el cuidado del medio ambiente y la mejora de la calidad de vida de los habitantes. Los estudios realizados denotan que los conglomerados de baja densidad poblacional son los más contaminantes (Cepeda y Mardaras, 2004; Norman, Maclean, Asce & Kennedy, 2006 en consecuencia una de las mejoras urbanas a fomentar es la densificación de las ciudades. No obstante, los niveles poblacionales no son únicos y estándares, sino que deben encontrarse en relación con las características propias de cada sector. Este trabajo tiene como objetivo principal desarrollar una metodología de cálculo que permita determinar niveles poblacionales máximos contemplando los requerimientos bioclimáticos de la ciudad y garantizando el acceso al sol más igualitario para todos los habitantes de la urbe. La misma es aplicada en el Área Metropolita de Mendoza y denota que las dimensiones de las manzanas y el ancho de las calles limitan la capacidad constructiva del sector y, en consecuencia, la cantidad de personas albergable. Los resultados obtenidos dan cuenta de las densidades poblaciones máximas para los distintos sectores, las que varían entre los 49 y 400 habitantes por hectárea, siendo las manzanas angostas con calles estrechas las de menor capacidad.

Habitar en Tierras Secas: La Tierra Cruda como vehículo de habitabilidad en el territorio no irrigado del norte de la Provincia de Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Virginia Miranda Gassull

2015-12-01

Full Text Available El territorio no irrigado del norte de la provincia de Mendoza es un vasto espacio sin acceso al bien hídrico, donde habita dispersa una población campesina de identidad originaria Huarpe. Habitar en este territorio ha sido desde hace siglos un desafío tanto al clima/ambiente como a condiciones sociopolíticas. Por lo tanto, el hábitat en tierras secas presenta particulares características respecto a su forma de gestión (autónoma, a su adaptación al ambiente y al uso de la técnica constructiva con tierra cruda: adobe. El objetivo a desarrollar aquí se sustenta en el uso actual del adobe, concebido como un vehículo que facilita la autoconstrucción y autoproducción de soluciones habitacionales en poblaciones desposeídas, ajustando su vivienda a las implicancias de un territorio árido y a un largo proceso de vulnerabilidad de derechos. Este artículo aproxima los primeros resultados de los relevamientos realizados sobre la técnica constructiva del adobe (a través de técnicas cuantitativas: encuesta y muestras in situ y las características propias del hábitat social de la población originaria Huarpe, a partir de la técnica de la observación participante.

Within plate seismicity analysis in the segment between the high Cordillera and the Precordillera of northern Mendoza (Southern Central Andes

Directory of Open Access Journals (Sweden)

Julián Olivar

2018-01-01

Full Text Available Crustal seismicity in northwestern Mendoza Province in Argentina, corresponding to the transition zone between the Chilean-Pampean flat subduction zone (26.5–33.5°S and the Southern Central Andes normal subduction zone to the south, is studied in order to i identify its relationship with the mapped structure, ii determine deformational mechanisms and iii constrain the geometry of the fold and thrust belt in the lower crust. Through this, we aim to determine which are the structures that contribute to Andean construction, east of the Frontal Cordillera in Argentina and at the western Principal Cordillera in Chile. Data from a temporary local seismic network are reprocessed in order to achieve a precise location of hypocenters and, whenever possible, to build focal mechanisms. Results are interpreted and compared with previous seismic studies and structural models. Analyzed seismicity is grouped around the eastern front of Frontal Cordillera, with hypocenters mainly at depths of 25–40 km. Contrastingly, earthquakes in the Principal Cordillera to the west are located at the axial Andean sector and Chilean slope, with depths shallower than 15 km. Obtained focal mechanisms indicate mainly strike-slip displacements, left lateral at Frontal Cordillera and right lateral at Principal Cordillera. Based on these observations, new possible structural models are proposed, where seismogenic sources could be either associated with inherited basement structures from the Cuyania-Chilenia suture; or correspond to deep-blind thrusts linked with a deeper-than-previously-assumed decollement that could be shared between Frontal Cordillera and western Precordillera. This deeper decollement would coincide in turn with the one determined from receiver function analysis for the eastern Sierras Pampeanas in previous works, potentially implying a common decollement all through the fold and thrust belt configuration. Apart from this, a new interpretation of

Sobrepeso y obesidad en relación a condiciones socio-ambientales de Niños residentes en San Rafael, Mendoza

Directory of Open Access Journals (Sweden)

Oyhenart, Evelia Edith

2011-01-01

Full Text Available El exceso de peso representa un problema emergente en salud pública, su prevalencia varía según zona de residencia, nivel socio-económico, edad y sexo. El objetivo del trabajo fue analizar las prevalencias de sobrepeso y obesidad en niños urbanos y rurales del Departamento de San Rafael, Mendoza, en relación a las condiciones socio-ambientales. Se realizó un estudio antropométrico transversal en 1176 individuos de 6 a 12 años. Se relevaron peso corporal, talla y pliegues subcutáneos tricipital y subescapular. El sobrepeso y la obesidad fueron determinados utilizando los criterios del International Obesity Task Force. El patrón de distribución adiposa se analizó mediante el índice Subescapular/Tricipital (IST. Un valor de IST>1 indicó centralización adiposa. El relevamiento socio-ambiental se realizó mediante encuesta autoadministrada. Los datos fueron procesados por análisis de componentes principales categórico (catACP. El catACP discriminó cuatro grupos según su condición socio-ambiental: Urbano: (Alto, Medio y Empobrecido y Rural. Las prevalencias para sobrepeso fueron de 14,4% y para obesidad de 7,6%, siendo las diferencias sexuales no significativas. La población con sobrepeso presentó en ambos sexos, valores de IST<1. En los varones obesos el IST fue >1 a partir de los 9 años y en las mujeres a los 9 y 12 años. El sobrepeso se distribuyó homogéneamente en los cuatro grupos, en tanto que la obesidad fue mayor en el grupo con características rurales. Los resultados dan cuenta del creciente aumento del sobrepeso con distribución homogénea e independiente de la condición socioeconómica. La obesidad en cambio, se concentra principalmente en la zona rural.

Alkaline lavas from southern Mendoza, Argentina, extend the Patagonian DUPAL mantle field to the north

Science.gov (United States)

Soager, N.; Holm, P. M.; Llambias, E.

2010-12-01

The lavas sampled around Río Colorado ~37°S at the border of Mendoza and Neuquén provinces, Argentina, define an OIB-like end-member composition for the Pleistocene and Holocene activity in the Payún Matrú volcanic field. Although positioned in the far back-arc of the Andes, only a few lavas show signs of involvement of slab fluids or crustal contamination such as relatively high LILEs relative to Nb. The very low La/Nb (~0.66) and Zr/Nb (~5) and high U/Pb (0.3-0.4) of the end-member composition clearly distinguish the source from normal MORB mantle, while high Ba/Nb (~10) and K/Nb (370-400) compared to FOZO and HIMU type OIBs suggest an EM type of mantle. Overall, the trace element patterns of the Río Colorado lavas are similar to the central and north Patagonian intraplate basalts and to South Atlantic E-MORB affected by the Discovery plume and the LOMU component (le Roux et al., 2002, EPSL 203). The isotopic composition of the Río Colorado component has a 206Pb/204Pb = 18.4, 207Pb/204Pb = 15.58, 208Pb/204Pb = 38.3, 87Sr/86Sr = 0.70353 and 143Nd/144Nd = 0.51285. This composition overlaps the central and north Patagonian intraplate basalts in Pb-isotopic space but is slightly less enriched in Sr and Nd-isotopes. It is distinctly different from the FOZO like composition of the south Patagonian intraplate basalts and the nearby Juan Fernandéz plume but similar to the South Atlantic N-MORB and MORB from the southern Chile Ridge segment 4 (Sturm et al., 1999, JGR 104) described as DUPAL type. The DUPAL-MORB type isotopic composition and the plume-like trace element patterns of the Río Colorado lavas suggest the presence of a weak plume beneath the area. The eruption of the large Payún Matrú volcano and the gigantic Pleistocene flood basalts also calls for a thermal anomaly to produce these melts during a weakly compressive tectonic regime with no significant addition of slab fluids. This was supported by Burd et al. (2008, Abstr., 7th Int. Sym. And. Geo

Diafragmas horizontais de piso em madeira, confeccionados com chapas de OSB e vigas I, submetido ao carregamento vertical = Wood light-frame floor diaphragms, made with OSB panels and Ijoists, subjected to vertical loads

Directory of Open Access Journals (Sweden)

Altevir Castro dos Santos

2007-07-01

Full Text Available Este trabalho aborda construções em madeira sob a ótica de sistemas com estruturas leves; apresenta análise computacional por meio de modelagem pelo método de elementos finitos de diafragmas de piso e vigas I, submetidas a ensaio de flexão a quatro pontos. O objetivo geral é avaliar a resistência e a rigidez de diafragmas horizontais,construídos em Sistemas Leves de Madeira, quando submetidos a ações verticais. As análises foram realizadas por meio do programa computacional SAP2000 e foram avaliadas as influências dos seguintes parâmetros: espaçamento entre vigas que constituem os elementosde ossatura do diafragma horizontal e o espaçamento entre pregos de fixação do contrapiso, composto por chapas de OSB – Oriented Strand Board. Ao final do trabalho, comparam-se os resultados obtidos a partir das análises numérica e teórica, e são apresentadas algumasconclusões.Wood light-frame floor diaphragms, made with OSB panels and I-joists, subjected to vertical loads. This work is focused on lightweight woodframe constructions, and presents a finite element modeling of floor diaphragms and wood I-joists subjected to four-point bending. It presents the results of experimental tests on wood I-joists subjected to vertical loads. The main goal of this research is to evaluate the resistance and rigidity of wood light-frame floor diaphragms, when subjected to monotonic vertical forces acting in the plane of the floor. The analyses were performed using the SAP2000 computer program and tested with diferent constructive arrangements, and the influence of the following variables were examined: distance between wood I-joists, and distance between nails around the perimeter of the OSB boards. Finally, a comparison between analytical and numerical results is performed.

Rib fracture as a predictor of future fractures in young and older postmenopausal women: National Osteoporosis Risk Assessment (NORA)

Science.gov (United States)

Sajjan, S. G.; Barrett-Connor, E.; McHorney, C. A.; Miller, P. D.; Sen, S. S.; Siris, E.

2013-01-01

Summary A rib fracture history after age 45 was associated with a 5.4-fold increase in new rib fracture risk and a 2.4-fold increase in risk of any new clinical fracture in 155,031 postmenopausal women. A rib fracture history suggests osteoporosis and should be considered when evaluating patients for interventions to prevent fractures. Introduction Until recently, little attention was paid to rib fracture as an osteoporosis marker. Emerging evidence suggests rib fracture may be an osteoporotic fracture in men and women. We report the 5-year independent association between baseline rib fracture histories and self-reported future fractures by age (decade) in the NORA cohort (155,031 postmenopausal women, 50–99 years). Methods Participants reported fracture history and responded to follow-up surveys at years 1, 3, or 6. Women with a baseline rib fracture history without other fractures were compared with women with no fracture. Results At baseline, 4,758 (3.07%) women reported a rib fracture history without other fractures; 6,300 women reported 6,830 new clinical fractures, including wrist (2,271), rib (1,891), spine (1,136), hip (941), and forearm (591). Adjusted relative risk (ARR) values (95% confidence interval [CI]) for future fractures in women with rib fracture history versus women with no fracture history were 5.4 (4.8–6.1) at the rib, 2.1 (1.7–2.6) at the spine, and 1.4 (1.1–1.7) at the wrist, and not significant for forearm or hip fractures. Future fracture risk was at least doubled in women with a rib fracture history in all ages: ARR (95% CI) 3.4 (2.8–4.0) for ages 50–59, 2.5 (2.1–3.0) for ages 60–69, 2.0 (1.7–2.3) for ages 70–79, and 2.0 (1.6–2.6) for ages >80. Conclusions Rib fracture, the second most common clinical fracture in women (after wrist fracture), predicted future fractures of the rib, wrist, and spine at all ages. Women presenting with rib fractures should be evaluated for appropriate management to prevent future

Thin-sheet zinc-coated and carbon steels laser welding

Directory of Open Access Journals (Sweden)

Peças, P.

1998-04-01

Full Text Available This paper describes the results of a research on CO₂ laser welding of thin-sheet carbon steels (zinccoated and uncoated, at several thicknesses combinations. Laser welding has an high potential to be applied on sub-assemblies welding before forming to the automotive industry-tailored blanks. The welding process is studied through the analysis of parameters optimization, metallurgical quality and induced distortions by the welding process. The clamping system and the gas protection system developed are fully described. These systems allow the minimization of common thin-sheet laser welding defects like misalignement, and zinc-coated laser welding defects like porous and zinc volatilization. The laser welding quality is accessed by DIN 8563 standard, and by tensile, microhardness and corrosion tests.

Este artigo descreve os resultados da investigação da soldadura laser de CO₂ de chapa fina de acó carbono (simples e galvanizado, em diferentes combinações de espessura. A soldadura laser é um processo de elevado potencial no fabrico de tailored-blanks (sub-conjuntos para posterior enformação, constituidos por varias partes de diferentes materiais e espessuras para a indústria automóvel. São analisados os aspectos de optimização paramétrica, de qualidade metalúrgica da junta soldada e das deformações resultantes da soldadura. São descritos os mecanismos desenvolvidos de fixação das chapas e protecção gasosa, por forma a minimizar os defeitos típicos na soldadura laser de chapa fina como o desalinhamento e da soldadura laser de chapa galvanizada como os poros e a volatilização do zinco. Por fim apresentam-se resultados da avaliação da qualidade da soldadura do ponto de vista qualitativo através da norma DIN 8563, e do pontos de vista quantitativo através de ensaios de tracção, dureza e corrosão.

Distribución y corte de piezas irregulares con anidamiento bidimensional en la industria minera

Directory of Open Access Journals (Sweden)

José Arzola-Ruíz

2010-03-01

Full Text Available La necesidad del ahorro de material durante el corte de piezas en chapas ha provocado el desarrollo de procedimientos y técnicas de optimización, con la ayuda de las nuevas tecnologías de la informática y las comunicaciones. A pesar de la existencia de diversas plataformas automatizadas para la generación de distribuciones y rutas de corte, el ahorro de material constituye un indicador de permanente atención en la industria minera. En el presente trabajo se ilustra el estado actual del desarrollo de las técnicas de distribución y corte de piezas en chapas y se define la concepción de un procedimiento para la distribución de piezas irregulares con anidamiento bidimensional.

Constitución y actividades de la Mesa Provincial de Educación Ambiental en la provincia de Mendoza, Argentina.

Directory of Open Access Journals (Sweden)

Gabriela Diaz Isenrath

2015-12-01

Full Text Available La Educación Ambiental como actividad interdisciplinaria e interinstitucional, requiere de la planificación estratégica participativa, que permita la concreción de esfuerzos que suelen realizarse de manera aislada. Se expone el proceso llevado a cabo para la constitución de la Mesa de Educación Ambiental en la provincia de Mendoza, Argentina. A partir de la discusión sobre la problemática local del Cambio Climático y los requerimientos de  medidas de adaptación, se propone el espacio en el año 2013 mediante la firma de una declaración de interés entre 4 instituciones. En el año 2014 toma fuerza la iniciativa mediante la definición de objetivos y metas concretas, con la participación activa más de 10 instituciones de diversos ámbitos: educativas, científicas, técnicas, órganos de gobierno, organizaciones no gubernamentales, municipios y privados.  En el año 2015 se consolida mediante la firma de un Acta Constitutiva. Su objetivo principal es articular acciones que permitan a la comunidad tener mejores herramientas para enfrentar la complejidad de la problemática y el cuidado de nuestro ecosistema.  Se considera un espacio proactivo y participativo, abierto a la incorporación de nuevos actores. Procura establecer lineamientos de políticas públicas sobre Educación Ambiental, orientadas a la promoción de comunidades sustentables. Asimismo, aspira a ser un  órgano de articulación reconocido por ley. En su corto recorrido, ha avanzado en su organización interna, capacitaciones a docentes, sugerencias al Proyecto de Ley de Educación de la Provincia como la inclusión de la obligatoriedad de la enseñanza de la Educación Ambiental y la creación de la figura de referente ambiental en los establecimientos educativos, como así también organiza jornadas, concursos y eventos educativos a nivel provincial.

A System-Wide Approach to Physician Efficiency and Utilization Rates for Non-Operating Room Anesthesia Sites.

Science.gov (United States)

Tsai, Mitchell H; Huynh, Tinh T; Breidenstein, Max W; O'Donnell, Stephen E; Ehrenfeld, Jesse M; Urman, Richard D

2017-07-01

There has been little in the development or application of operating room (OR) management metrics to non-operating room anesthesia (NORA) sites. This is in contrast to the well-developed management framework for the OR management. We hypothesized that by adopting the concept of physician efficiency, we could determine the applicability of this clinical productivity benchmark for physicians providing services for NORA cases at a tertiary care center. We conducted a retrospective data analysis of NORA sites at an academic, rural hospital, including both adult and pediatric patients. Using the time stamps from WiseOR® (Palo Alto, CA), we calculated site utilization and physician efficiency for each day. We defined scheduling efficiency (SE) as the number of staffed anesthesiologists divided by the number of staffed sites and stratified the data into three categories (SE 1). The mean physician efficiency was 0.293 (95% CI, [0.281, 0.305]), and the mean site utilization was 0.328 (95% CI, [0.314, 0.343]). When days were stratified by scheduling efficiency (SE 1), we found differences between physician efficiency and site utilization. On days where scheduling efficiency was less than 1, that is, there are more sites than physicians, mean physician efficiency (95% CI, [0.326, 0.402]) was higher than mean site utilization (95% CI, [0.250, 0.296]). We demonstrate that scheduling efficiency vis-à-vis physician efficiency as an OR management metric diverge when anesthesiologists travel between NORA sites. When the opportunity to scale operational efficiencies is limited, increasing scheduling efficiency by incorporating different NORA sites into a "block" allocation on any given day may be the only suitable tactical alternative.

Medical applications of the nuclear energy

International Nuclear Information System (INIS)

Ugarte, Valentin E.

2001-01-01

The Nuclear Medicine School Foundation, in Mendoza (Argentina) was created in 1986 by the National Atomic Energy Commission (CNEA) and is supported by the Government of the Mendoza Province, the CNEA, and the National University of Cuyo. The main activities of the school are medical diagnosis using nuclear techniques and the training of physicians and technicians in nuclear medicine. Teletherapy and brachytherapy are also performed. The use of the PET is described in some detail

Lesnoi tsvetok : [luuletused] / Anna Haava ; lühibiograafia: O. K. [Oskar Kruus

Index Scriptorium Estoniae

Haava, Anna, pseud., 1864-1957

1999-01-01

Sisu: Lesnoi tsvetok 1-2 / tlk. Bronislav Kezhun ; Net, stih ne vetrõ navevajut / tlk. Nora Javorskaja ; Odin lish raz ljubov bõvajet / tlk. B. Kezhun ; "Zabotõ svoi shoronila..." / tlk. Marina Tervonen ; Sodom i Gomorra / tlk. V. Sokolov ; Oh, rodina ; Vetra, tshto mansardu moju produvali / tlk. Nora Javorskaja. Orig.: Nõmmelill 1-2 ; Ei tule luule tuulest ; Üks ainus kord ; Mu mured kõik matsin ma maha ; Sina, Soodom ja Gomorra ; Oh kodumaa ; Kui puhus mu katusekambri tuul

GARGANTA SECA Y ARENA EN LAS BOTAS: PROSPECTANDO ANTECEDENTES ARQUEOLÓGICOS DE LAS TIERRAS ÁRIDAS DEL NORESTE MENDOCINO (CENTRO OESTE ARGENTINO (Dry throat and sand in the boots: Prospecting archaeological backgrounds of the Mendoza Northeastern drylands, Argentinian Center South

Directory of Open Access Journals (Sweden)

Horacio Chiavazza

2009-03-01

Full Text Available Aquí se presenta un detallado estado de las investigaciones arqueológicas desarrolladas en el noreste de la provincia argentina de Mendoza. Esta zona es objeto de estudios desde principios del siglo XX. Sin embargo los pulsos de la investigación han registrado etapas de abandono total y de intervenciones selectivas. Los investigadores han partido de los trabajos precedentes para explicar por extensión las modalidades de asentamiento en la totalidad del territorio norte y, sobre todo, del occidente montañoso, que era donde concentraban sus campañas. Esto acabó generando un cuadro de antecedentes desequilibrado y superficial en el conocimiento de dicha área, con implicaciones en el cuadro interpretativo general de la prehistoria local. En este caso, indagamos las posibles causas que dieron lugar a tal proceso, sus vínculos con los enfoques teóricos y metodologías dominantes a lo largo del siglo XX y su relación con la selección de zonas para llevar a cabo estudios de campo en el norte de la provincia. Reflexionamos críticamente sobre los alcances, límites y posibilidades que ofrece la región para profundizar los análisis arqueológicos del poblamiento prehispánico en relación con las condiciones del ambiente y los procesos históricos documentados, proponiendo discutir los enfoques que basan sus explicaciones en hechos dados por sentados y que merecerían antes una discusión en base a la evidencia disponible. ENGLISH: Here is a detailed state of archaeological research developed in the northeastern Argentine province of Mendoza. This area is the subject of studies since the early twentieth century. However, the pulses of the investigation have been stages of total abandonment and selective interventions. This ended up creating an unbalanced picture of history and superficial knowledge of that area, with implications for the general picture of prehistory interpreted locally. In this case, we investigate the possible causes

To Leave, or not to Leave: That Is the Problem in A Doll’s House and Candida

Directory of Open Access Journals (Sweden)

Naghmeh Varghaiyan

2015-06-01

Full Text Available This paper explores representation of Woman Question in Henrik Ibsen’s A Doll’s House and George Bernard Shaw’s Candida. The paper argues that unlike many studies that have read Candida and Nora as two disparate characters, they can be considered as the same New Woman represented only from different perspectives. In the previous studies, Candida is usually labelled a philistine who chooses to stay at home in order to defend blindly the convention of marriage bond while Nora is commonly called a rebel who chooses to abandon the conventional matrimonial life in order to find her true identity. This study, nonetheless, holds that both female characters’ ensuing decisions, although in different forms, similarly make their husbands reflect deeply on their situation in a way that in general the relation between them changes considerably afterwards. The female characters’ socio-familial states, nevertheless, may not change considerably in the near future. Thus, the textual analysis in the present study reveals that there is no basis for establishing a dualism when discussing Candida and Nora, the former standing for conspiracy against her own gender while the latter being a symbol of female redemption. Instead, it could be argued that their seemingly different final decisions are different solutions to one problem without implying a certificate of authenticity at the end.  Keywords: Problem Play, Woman Question, New Woman, Nora, Candida

Burn Rehabilitation and Research: Proceedings of a Consensus Summit

Science.gov (United States)

2009-08-01

projectsperceivedasneeding investigation.Multicenter re- search initiatives are highly encouraged. ACKNOWLEDGMENTS We thank Carol Raymond, Maria Chapa, Travis...Engrav LH, Nakamura DY, Dutcher KA, Heimbach DM, Vedder NB. Treatment of fourth-degree hand burns. J Burn Care Rehabil 1995;16:36–42. 42. Mendez

Risk assessment on an Argentinean road with a dynamic traffic simulator

Science.gov (United States)

Voumard, Jérémie; Baumann, Valérie; Jaboyedoff, Michel; Derron, Marc-Henri; Penna, Ivanna

2014-05-01

The National Route 7 in Argentina is one of the most important corridors crossing the Andean Cordillera. It concentrates most of the traffic related to the Southern Common Market (MERCOSUR), it also connects Mendoza city (the fourth most populated in Argentina) with Santiago de Chile (the Chile capital city), and is used by tourists to access to the Aconcagua National park, Puente del Inca natural monument, skiing resorts, and to local displacements for the villages along the Mendoza valley. The road crosses the Andes through the Mendoza river valley at an elevation between 2'000 and 3'000 m. The traffic (2500 vehicles/day) is composed of motorcycles, cars and pickup trucks, trucks without trailer, buses, and semi-trailer trucks. Debris flows developed along tributaries of the Mendoza River, and due to remobilization of talus materials, impact frequently the road, causing traffic disruptions, bridges damages, etc. Rock falls detached from highly fractured outcrops also impact frequently the road, causing sometimes casualties. The aim of this study is to evaluate risk along sections of the National Road 7 develop along the Mendoza river, using a dynamic traffic simulator based on MATLAB© routine. The dynamic traffic simulator developed for natural hazards events on roads consider different scenarios based on traffic speeds, vehicle types, interactions types, road properties and natural processes. Here we show that vehicle types and traffic variations may influence the risk estimation. The analyzed risk on several critical sections of the National Route 7 demonstrates that risk may significantly increase: 1) on sinuous sections, steep sections and because of road conditions changes (exit of tunnel, bridges, road width, etc.) because of decreasing vehicle speed, particularly with semi-trailer trucks; 2) when an event, such a debris flow, occurs and generates a vehicle tailback increasing their duration presence in the risk area.

Influencia del uso y gestión de la envolvente en el comportamiento térmico de verano de una vivienda en la ciudad de Mendoza, Argentina

Directory of Open Access Journals (Sweden)

Soledad Elisa Andreoni Trentacoste

2017-12-01

Full Text Available En la ciudad de Mendoza, Argentina, las viviendas presentan mayoritariamente una baja calidad constructiva en relación con la falta de aislamiento de sus envolventes. Se estima que el 95% de las viviendas existentes no están aisladas en su envolvente vertical y presentan aislamiento insuficiente en techos. En un clima templado continental, con grandes amplitudes térmicas diarias y estacionales, las viviendas presentan inercia térmica como única estrategia bioclimática. En estas circunstancias, las posibilidades de gestión que ofrezca la envolvente -a través de elementos practicables y/o móviles-, son claves para la aproximación al logro del confort interior. El presente trabajo analiza la influencia del uso y gestión de las aberturas en la envolvente a cargo del usuario en una vivienda tradicional, mediante monitoreo higrotérmico, durante 59 días en verano. Para ello, se midieron dos períodos con distintas condiciones climáticas (extremas y moderadas en los que se aplicó la estrategia de ventilación natural nocturna, gracias a la cual se obtuvo 82% de horas en confort. Asimismo, se midió un período sin gestión de las aberturas en la envolvente, es decir, manteniéndolas cerradas; de lo que resultó solo un 6% de horas en confort. Se concluye, en suma, que la intervención comprometida y consciente del usuario mediante el aprovechamiento de la ventilación nocturna, en combinación con la inercia térmica del envolvente, desempeña un papel importante en el logro de condiciones térmicas en interiores que reducen el sobrecalentamiento durante el verano.

AcEST: BP913708 [AcEST

Lifescience Database Archive (English)

Full Text Available ial protein cyt-4 OS=Neurospora c... 32 1.3 sp|P23975|SC6A2_HUMAN Sodium-dependent nora...drenaline transporter... 30 4.9 sp|O55192|SC6A2_MOUSE Sodium-dependent noradrenaline transporter... 29...+ Sbjct: 237 LLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFV 273 >sp|O55192|SC6A2_MOUSE Sodium-dependent nora...RERHA-------KTLANI 982 Query: 183 N--NKALFQALV 212 + N+ + QALV Sbjct: 983 DGRNELILQALV 994 >sp|P23975|SC6A2_...HUMAN Sodium-dependent noradrenaline transporter OS=Homo sapiens GN=SLC6A2 PE=1 S

Substituted dihydronaphthalenes as efflux pump inhibitors of Staphylococcus aureus

DEFF Research Database (Denmark)

Thota, Niranjan; Reddy, Mallepally V; Kumar, Ashwani

2010-01-01

A new series of 3-(substituted-3,4-dihydronaphthyl)-2-propenoic acid amides has been prepared through convergent synthetic strategies and tested in combination with ciprofloxacin against NorA overexpressing Staphylococcus aureus 1199B as test strain for potentiating of the drug activity. Out of 24...... compounds evaluated, 12 compounds potentiated the activity of ciprofloxacin and resulted in 2-16 fold reduction in the MIC (4-0.5 microg/mL) of the drug. The failure of these efflux pump inhibitors (EPIs) to potentiate the activity of ciprofloxacin when tested against NorA knock out S. aureus SA-K1758...

Mr. Wolfgang Petritsch, Austrian Ambassador

CERN Multimedia

Patrice Loïez

2002-01-01

Dr.Peter Schmid/CERN/EP, Dr.Wolfgang Petritsch, Austrian Ambassador, Permanent representative at UN, Mrs.Nora Petritsch, Dr.Kurt Hubner/CERN/AC, Mrs. Frederike Klaus-Salesin, Adviser, Mrs.Andrea Strohmeier, Secretary of the Ambassador, Mr.Heinz Klaus, Attaché, Dr.Theodor Tortschanoff/CERN/LHC, Mr.Peter Storer, Advisor. Dr.Peter Schmid/CERN/EP, Dr.Wolfgang Petritsch, Austrian Ambassador, Permanent representative at UN, Mrs.Nora Petritsch, Dr.Kurt Hubner/CERN/AC, Mrs. Frederike Klaus-Salesin, Adviser, Mrs.Andrea Strohmeier, Secretary of the Ambassador, Mr.Heinz Klaus, Attaché, Dr.Theodor Tortschanoff/CERN/LHC, Mr.Peter Storer, Advisor.

Laser welding of tailored blanks

Directory of Open Access Journals (Sweden)

Peças, P.

1998-04-01

Full Text Available Laser welding has an incrising role in the automotive industry, namely on the sub-assemblies manufacturing. Several sheet-shape parts are laser welded, on a dissimilar combination of thicknesses and materials, and are afterwards formed (stamped being transformed in a vehicle body component. In this paper low carbon CO₂ laser welding, on the thicknesses of 1,25 and 0,75 mm, formability investigation is described. There will be a description of how the laser welded blanks behave in different forming tests, and the influence of misalignment and undercut on the formibility. The quality is evaluated by measuring the limit strain and limit effective strain for the laser welded sheets and the base material, which will be presented in a forming limit diagram.

A soldadura laser assume um papel cada vez mais importante na indústria automóvel, principalmente para a fabricação de sub-conjuntos constituídos por varias partes de chapa de diferentes espessuras (e diferentes materiais, que depois de estampados constituem um componente para integrar num veículo. Descreve-se neste artigo o trabalho de investigação de enformabilidade de chapa de ac.o de baixo carbono soldada por laser de CO₂, nas espessuras de 1,25 e 0,75 mm. Apresenta-se uma descrição do comportamento das chapas soldadas por laser em diferentes testes de enformação, e a influência dos defeitos das soldaduras (desalinhamento e queda do banho-undercut no comportamento à enformação. A qualidade é avaliada pela medição da extensão limite e da extensão limite efectiva no material base e no material soldado, que serão representadas num diagrama de limite de enformabilidade.

Actinic keratosis associated with squamous and basal cell carcinomas: an evaluation of neoplastic progression by a standardized AgNOR analysis

Directory of Open Access Journals (Sweden)

G Giuffrè

2009-08-01

Full Text Available In an attempt to investigate the neoplastic progression in different stages of actinic keratosis (AK, a standardized AgNOR analysis was performed in 94 cases of AK, 35 of which were associated with squamous cell carcinoma (SCC or basal cell carcinoma (BCC, and in 31 cases of SCC and 22 cases of BCC. The cases were subdivided into low- and high- AgNOR-expressing (AgNOR status AK by using the mean area of AgNORs per cell (NORA value (3.996 ?m2 as the cut-off. In AK samples, a progressive increase of the mean NORA value from Stage I to Stage IV was encountered. In addition, a significantly higher mean NORA value was found in the AK cases associated with SCC, in comparison to those without SCC; by contrast, no significant differences in the mean NORA value were noted between AK cases with or without BCC. A highly significant association between a high AgNOR quantity and the coexistence of SCC was encountered in AK; no association was appreciable between the AgNOR quantity and the co-occurrence of BCC. Moreover, when the co-existence of SCC in AK was considered as the reference point, the AK cases associated with SCC mostly (95.5% presented a high AgNOR quantity (high sensitivity, but only 57.6% of cases without SCC displayed a low AgNOR quantity (low specificity. Additionally, our data document that the standardised AgNOR analysis represents a strong negative predictor for the association between SCC and AK. Indeed, a low AgNOR quantity mostly is associated with AK cases without SCC.

Incidencia de las plazas urbanas sobre el comportamiento térmico del entorno en alta densidad edilicia. El caso de la ciudad de Mendoza, Argentina.

Directory of Open Access Journals (Sweden)

susana Stocco

2018-05-01

Full Text Available Las plazas concebidas bajo el concepto de “plaza jardín” -modelo dominante en las ciudades de Latinoamérica- generan efectos microclimáticos a escala urbana y edilicia dado que actúan como fuente de enfriamiento nocturno. En contextos de baja y media densidad, dicho efecto está asociado fundamentalmente al diseño de la plaza: núcleo central predominantemente semi-sellado alrededor del cual se distribuyen áreas verdes a modo de bosques y prados. Sin embargo, en el caso de la ciudad de Mendoza-Argentina, la tendencia a la redensificación del tejido urbano, como estrategia de control del crecimiento urbano, limita los beneficios que proporcionan las configuraciones actuales de plazas. Es por ello que este trabajo evalúa el impacto de incrementar la dimensión de la plaza en el comportamiento térmico de la misma y su influencia sobre el microclima del entorno mediato, como alternativa para potenciar sus beneficios en áreas urbanas de alta densidad. Con tal fin, se seleccionaron tres casos de estudio, dos de ellos de una superficie equivalente a una manzana urbana –10000m2–, emplazados en entornos de media y alta densidad, y un caso de mayor superficie -40000m2-, inserto en un contexto de alta densidad. Tales casos fueron monitoreados térmicamente en la estación verano, durante un periodo de 21 días, mediante el uso de microadquisidores de datos del tipo HOBO H08-003-02. Se caracterizaron las condiciones radiativas a partir de la determinación del factor de visión de cielo (SVF. Los resultados obtenidos muestran que, al incrementar las dimensiones de la “plaza jardín”, sus diferentes estructuras -núcleo central, bosque, prado- presentan menores temperaturas respecto a su entorno durante todo el día. En consecuencia, constituye una estrategia eficiente para mejorar las prestaciones del espacio abierto respecto a sus efectos microclimáticos en entornos urbanos de alta densidad. Si bien dicha

Nuclear magnetic relaxation in picolines solutions in carbon tetrachloride

International Nuclear Information System (INIS)

Jurga, J.; Pajak, Z.; Jurga, K.; Jurga, S.

1973-01-01

Spin-lattice relaxation times of the ring and CH 3 group have been measured in order to establish the temperature dependence of the longitudinal relaxation times for picolins in carbon tetrachloride solutions. The information concerning the intramolecular contribution to the relaxation times have been obtained. The high resolution NPR spectrometer operating at 25 MHz has been used. The measurements have been performed in the temperature range from -60degC to 80degC. The experimental results are compared to the predictions given by the Nora Hill and Debye models and it has been found that the Nora Hill model fits the experimental data better than the Debye model. (S.B.)

Implementation and Use of Anesthesia Information Management Systems for Non-operating Room Locations.

Science.gov (United States)

Bouhenguel, Jason T; Preiss, David A; Urman, Richard D

2017-12-01

Non-operating room anesthesia (NORA) encounters comprise a significant fraction of contemporary anesthesia practice. With the implemention of an aneshtesia information management system (AIMS), anesthesia practitioners can better streamline preoperative assessment, intraoperative automated documentation, real-time decision support, and remote surveillance. Despite the large personal and financial commitments involved in adoption and implementation of AIMS and other electronic health records in these settings, the benefits to safety, efficacy, and efficiency are far too great to be ignored. Continued future innovation of AIMS technology only promises to further improve on our NORA experience and improve care quality and safety. Copyright © 2017 Elsevier Inc. All rights reserved.

Performative Environments

DEFF Research Database (Denmark)

Thomsen, Bo Stjerne

2008-01-01

The paper explores how performative architecture can act as a collective environment localizing urban flows and establishing public domains through the integration of pervasive computing and animation techniques. The NoRA project introduces the concept of ‘performative environments,' focusing on ...... of local interactions and network behaviour, building becomes social infrastructure and prompts an understanding of architectural structures as quasiobjects, which can retain both variation and recognisability in changing social constellations.......The paper explores how performative architecture can act as a collective environment localizing urban flows and establishing public domains through the integration of pervasive computing and animation techniques. The NoRA project introduces the concept of ‘performative environments,' focusing...

Estructura y textura de la fase Al₃CaZn en una chapa laminada de la aleación superplástica Al-5 % Ca-5 % Zn

Directory of Open Access Journals (Sweden)

Pérez-Pardo, M. T.

1998-05-01

Full Text Available The structure of the intermetallic phase Al₃CaZn present in the superplastic sheet alloy Al-5 % Ca-5 % Zn has been determined by means of x-ray diffraction (XRD and electrón diffraction (TEM. Also, the texture of this phase has been studied by means of pole figures and the orientation distribution function (ODF. The Al-5 % Ca-5 % Zn alloy is formed by a fine grained aluminum matrix (d ≈ 2-3 μm and 20 % vol. of Al₃CaZn in the form of round-shaped particles with 0.2-0.5 μm diameter. This alloy undergoes superplastic behavior in a wide range of strain rates and temperatures. It has been found in this work that the structure of the second phase is body-centered tetragonal, with lattice parameters a = b = 0.422 nm and c = 1.131 nm. The texture of the alloy is formed by the fiber <001>, i.e., the crystallites are oriented preferentially with the c-axis perpendicular to the rolling plane. The texture sharpens after severe annealings.

En este trabajo se ha determinado la estructura de la fase Al₃CaZn, presente en una chapa laminada de la aleación Al-5 % Ca-5 % Zn, mediante técnicas de difracción de rayos X (DRX y difracción de electrones (MET. Además, se ha estudiado su textura mediante figuras de polos y la función de distribución de orientaciones (FDO. La aleación Al-5 % Ca-5 % Zn objeto de este estudio consta de una matriz de aluminio de grano fino (d ≈ 2-3 μm y un 20 % vol. de la fase Al₃CaZn. Esta segunda fase está presente en el material de partida en forma de partículas esferoidales de 0,2 - 0,5 μm de diámetro. La aleación presenta un comportamiento superplástico en un amplio intervalo tanto de velocidades de deformación como de temperaturas. Se ha encontrado que la fase Al₃CaZn posee una estructura tetragonal centrada, con parámetros de red a = b= 0,422 nm y c = 1,131 nm. Presenta, además, una textura de fibra <001>, en la

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Funding Opportunities Clinical Research Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Opportunities Clinical Research Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog ...

A los hijos hay que reconocerlos. Notas sobre el montaje de La sociedad del semáforo

OpenAIRE

Ospina, Luis

2014-01-01

Luis Ospina describe su relación de trabajo con Rubén Mendoza, responsable del montaje de sus últimas películas La desazón suprema (2003) y Un tigre de papel (2007), y la proposición de Rubén a Ospina de realizar el montaje de su primera película La sociedad del semáforo (2010). Le cinéaste colombien Luis Ospina décrit sa relation de travail avec Rubén Mendoza, le monteur de ses derniers films La desazón suprema (2003) et Un tigre de papel (2007), et la proposition de Rubén à Ospina de mon...

Il faut reconnaître ses enfants. Notes sur le montage de La sociedad del semáforo (La Société du feu rouge)

OpenAIRE

Ospina, Luis

2014-01-01

Le cinéaste colombien Luis Ospina décrit sa relation de travail avec Rubén Mendoza, le monteur de ses derniers films La desazón suprema (2003) et Un tigre de papel (2007), et la proposition de Rubén à Ospina de monter son premier long-métrage La sociedad del semáforo (2010). Luis Ospina describe su relación de trabajo con Rubén Mendoza, responsable del montaje de sus últimas películas La desazón suprema (2003) y Un tigre de papel (2007), y la proposición de Rubén a Ospina de realizar el mo...

Contribution to the knowledge of jumping spiders (Araneae: Salticidae from vicinity of Jagodina, Central Serbia

Directory of Open Access Journals (Sweden)

Stanković, B.

2012-09-01

Full Text Available During last 10 years, based on personal collectings, 21 species from 14 genera of Salticidae (Araneae are recorded from vicinity of Jagodina: Ballus chalybeius, Carrhotus xanthogramma, Evarcha arcuata, Evarcha falcata, Heliophanus auratus, Heliophanus cupreus, Heliophanus flavipes, Heliophanus kochii, Icius hamatus, Icius subinermis, Leptorchestes berolinensis, Macaroeris nidicolens, Marpissa muscosa, Marpissa nivoyi, Mendoza canestrinii, Pellenes tripunctatus, Phintella castriesiana, Phlegra fasciata, Pseudeuophrys erratica, Pseudeuophrys lanigera, Salticus scenicus. All those species are provided with habitat notes and global distribution. New records for the spider fauna of Serbia are Heliophanus kochii (Simon 1868, Icius subinermis (Simon, 1937, Marpissa nivoyi (Lucas, 1846 and Mendoza canestrinii (Ninni, 1868.

Corrosividade Causada por Soluções Salinas Empregadas na Estabilização Dimensional da Madeira

Directory of Open Access Journals (Sweden)

Juarez Benigno Paes

2017-08-01

Full Text Available RESUMO Objetivou-se avaliar a corrosividade de soluções salinas antes e depois de sua impregnação na madeira. Soluções com 5% de concentração de cloreto de lítio, carbonato de sódio, sulfato de magnésio, sulfato de zinco e sulfato de cobre II foram mantidas durante 6 horas, a 25 °C, 45 °C e 100 °C em contato com amostras de 1,25 cm × 0,1 cm × 7,5 cm (largura × espessura × comprimento produzidas com chapas de aço carbono antes e depois de seu contato com amostras de madeira de Corymbia torelliana e Eucalyptus cloeziana. Não se observou efeito da temperatura na corrosão das soluções puras. Depois do contato com a madeira houve incremento da corrosividade para as soluções de sulfato de zinco e de cobre II. O sulfato de cobre II ocasionou a maior perda de massa nas chapas, não sendo recomendado seu contato com superfícies metálicas, como usinas de tratamento e câmaras de secagem de madeira.

78 FR 65302 - Notice of Public Meetings for the Draft Environmental Impact Statement/Overseas Environmental...

Science.gov (United States)

2013-10-31

... FURTHER INFORMATION CONTACT: Ms. Nora Macariola-See, Naval Facilities Engineering Command, Pacific. Attention: MITT EIS/OEIS, 258 Makalapa Drive, Suite 100, Building 258, Floor 3, Pearl Harbor, Hawaii 96860...

Hooaeg, mis kadus pildilt / Krista Kaldvee

Index Scriptorium Estoniae

Kaldvee, Krista

2008-01-01

Ugala teatri hooajast 2007/2008. Peatutakse etendustel "Nora/Maja", "Runar ja Kyllikki", "Põhjas", "Kolm meest paadis", "Kunst", "Ühes Eesti teises linnas", "Kolm õde", "Linnapea" ja nende kajastamisel eesti meedias

Effect of single and combined treatment with gamma rays and some chemical mutagens in rice

International Nuclear Information System (INIS)

Lyong Van Hin; Mekhandzhiev, A.; Murzova, P.; Chilikov, I.

1991-01-01

Dry rice seeds of 3 cvs and 2 lines have been irradiated (Co 60 , 10 krad) and treated with 0.0012% sodium azide (NaN 3 ) and 0.2% ethylmethanesulfonate (EMS) in definite combinations. It is found that chlorophyll mutations are less frequent after single gamma irradiation. Sodium azide produces a higher percentage of mutations than EMS. Highest mutation frequency has been observed following combined treatment with gamma rays and chemical mutagens. The combined treatment has resulted in a considerably higher mutation effect than the theoretically expected one in the lines Nora and Mega, and in cv. Krasnodarski 424. Highest mutation spectrum has been found in cv. Krasnodarski 424 and in Nora line following combined treatment. 1 tab., 5 figs., 20 refs

Evaluación del desempeño ambiental de dos bodegas en Mendoza (Argentina. Propuesta de reacondicionamiento térmico y energético

Directory of Open Access Journals (Sweden)

Carolina Ganem Karlen

2015-06-01

Full Text Available Este trabajo presenta la evaluación del desempeño térmico y energético de dos bodegas en la provincia de Mendoza, Argentina (32º40’ Latitud Sur, 68º51’ Longitud Oeste, 750 metros sobre el nivel del mar. Se ha escogido la vendimia (febrero-marzo como período a analizar debido a que la demanda de refrigeración es entonces mayor: toneladas de materia prima (a alrededor de 26-30ºC deben ser procesadas a 8ºC, mientras que las temperaturas exteriores se encuentran alrededor de los 38ºC. Las bodegas seleccionadas tienen la misma cantidad y calidad de producción y similar tamaño edilicio, pero diferente manejo y materialidad en la envolvente. La bodega “P” fue construida con paredes de ladrillos tradicionales, con techo metálico con aislamiento térmico y simple vidrio en ventanas; mientras que la bodega “H” se construyó parcialmente con paneles de hormigón armado con aislamiento térmico, techos metálicos con aislamiento y doble vidrio hermético en sus aberturas. Se tomaron mediciones in situ de temperatura del aire, temperatura superficial en la envolvente, humedad relativa y radiación solar, y se estudiaron en relación a los registros de consumos energéticos de cada bodega. Luego, con los datos obtenidos se ajustó un modelo generado con el software Energy Plus, el cual se utilizó para simular alternativas de mejora de la envolvente. Como resultado, ambas bodegas presentaron mejoras. Las temperaturas medidas en bodega P fueron igualadas en un promedio de 18.89°C sin el uso de energía auxiliar. En el caso de la bodega H las temperaturas medidas se optimizaron, logrando un promedio de 21.77°C, otra vez, sin el uso de energía auxiliar. Existe la posibilidad de agregar estrategias de ventilación nocturna usando las temperaturas exteriores las cuales disminuyen en 9,78°C en el período analizado. La propuesta de reacondicionamiento térmico y energético que incorpora mejoras edilicias y el manejo de la envolvente

Lahkumata hüvasti jättes / Urmas Petti

Index Scriptorium Estoniae

Petti, Urmas, 1965-2016

2013-01-01

Baltisaksa Kultuuri Seltsi kultuuripäevadest Mare Balticum Helsingis 2012. a. ; autor kommenteerib Baltisaksa Kultuuri Selts esimeest Frank von Auerit ja Läti Baltisaksa Keskuse Domus Rigensis juhatajat Nora Rutke't

Effect of time in the evaluation of F+20 and F0 diuretic renography

International Nuclear Information System (INIS)

Donoso, G.; Piepsz, A.; Ham, H.

2002-01-01

F0 diuretic renography starts gaining popularity especially because of the practical convenient of avoiding one intravenous injection. Using F0 however, the most adequate parameters for evaluating renal output are still to be determined. Aim: to evaluate which parameter of F0 and F+20 procedures gives rise to the best possible renal drainage. Methods: In this retrospective study we compared F0 and F20 quantitative parameters obtained in 36 clinically stable children, aged 10 days to 17 years, with unilateral (25) or bilateral (11)hydronephrosis, in whom both tests were performed. The mean time interval between the two tests was 17 months. F0 and F+20 Tc-99m MAG3 diuretic renography were carried out using the usual procedure. In all cases, a late image (PM) was acquired after micturition and after changing the position of the patient. The mean time at which this image was acquired was 80 min(SD : 33) for the F+20 test and 48 min(SD : 30) for the F0 test. Following parameters were calculated : Time to the maximum of the basic renogram (Tmax); normalized residual activity (NORA) and output efficiency (OE) at the end of the 20- min renogram, at the end of furosemide test (35 min) and on the post micturition image (NORA 20, NORA 35, NORA PM, OE 20, OE35 and OE PM). On the basis of all available parameters, each of the 47 hydronephrotic kidneys were classified either as 'good drainage' or as 'partial or bad drainage'. All parameters were then evaluated according to this reference. Conclusions: For both the F+20 and the F0 tests, the PM image had obviously a higher performance rate than all the other parameters, underlying the mandatory character of this acquisition. The higher performance of the PM image on F+20 is clearly related to the significantly different time at which the PM image was acquired, underlying the need of standardization of the acquisition time

Berberine-INF55 (5-Nitro-2-Phenylindole) Hybrid Antimicrobials: Effects of Varying the Relative Orientation of the Berberine and INF55 Components ▿

Science.gov (United States)

Tomkiewicz, Danuta; Casadei, Gabriele; Larkins-Ford, Jonah; Moy, Terence I.; Garner, James; Bremner, John B.; Ausubel, Frederick M.; Lewis, Kim; Kelso, Michael J.

2010-01-01

Hybrid antimicrobials containing an antibacterial linked to a multidrug resistance (MDR) pump inhibitor make up a promising new class of agents for countering efflux-mediated bacterial drug resistance. This study explores the effects of varying the relative orientation of the antibacterial and efflux pump inhibitor components in three isomeric hybrids (SS14, SS14-M, and SS14-P) which link the antibacterial alkaloid and known substrate for the NorA MDR pump berberine to different positions on INF55 (5-nitro-2-phenylindole), an inhibitor of NorA. The MICs for all three hybrids against wild-type, NorA-knockout, and NorA-overexpressing Staphylococcus aureus cells were found to be similar (9.4 to 40.2 μM), indicating that these compounds are not effectively effluxed by NorA. The three hybrids were also found to have similar curing effects in a Caenorhabditis elegans live infection model. Each hybrid was shown to accumulate in S. aureus cells to a greater extent than either berberine or berberine in the presence of INF55, and the uptake kinetics of SS14 were found to differ from those of SS14-M and SS14-P. The effects on the uptake and efflux of the NorA substrate ethidium bromide into S. aureus cells in the presence or absence of the hybrids were used to confirm MDR inhibition by the hybrids. MDR-inhibitory activity was confirmed for SS14-M and SS14-P but not for SS14. Molecular dynamics simulations revealed that SS14 prefers to adopt a conformation that is not prevalent in either SS14-M or SS14-P, which may explain why some properties of SS14 diverge from those of its two isomers. In summary, subtle repositioning of the pump-blocking INF55 moiety in berberine-INF55 hybrids was found to have a minimal effect on their antibacterial activities but to significantly alter their effects on MDR pumps. PMID:20498327

The Sam and Nora Stories.

Science.gov (United States)

Nijim, Basheer; Nijim, Germana

1992-01-01

Presents a series of five short stories for children that incorporate geographic concepts. Includes the concepts of region, boundaries, and grids. Suggests that the stories will help children master challenging concepts and vocabulary that in turn will increase their knowledge and self-esteem. (DK)

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Research Reports Mind Over Matter Science of Addiction Funding Funding Opportunities Clinical Research Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog ...

Uuslavastused Ugalas / Helle Leppik

Index Scriptorium Estoniae

Leppik, Helle

2007-01-01

Ugalas käib töö nelja uuslavastusega : Ott Aardam lavastab "Börs ja Börsitar", Helen Rekkor toob lavale "Nora/Maja", Peeter Tammearu suvelavastus on "Sirelikassid" ja Margus Vaher lavastab suvelavastuse "Naabri Mari"

Calidad de aguas y análisis de la contaminación en el Río Tunuyán Superior (Mendoza, Argentina en el periodo 2007-2014

Directory of Open Access Journals (Sweden)

Santa Esmeralda Salatino

2017-05-01

Full Text Available Desde agosto de 2007 a la fecha, se ha venido conformando una base de datos de calidad físico-química-microbiológica del agua de riego del río Tunuyán superior, uno de los más importantes de Mendoza. Se seleccionaron seis sitios de muestreo, de lectura mensual, estratégicamente ubicados. Tres sitios pertenecientes al río: Valle de Uco (VU, Costa Anzorena (CA y Dique Tiburcio Benegas (TB y otros tres a sus afluentes principales: río Las Tunas (LT y arroyos Aguanda (A y Yaucha (Y. Son objetivos del trabajo: (1 poner a disposición de los interesados la base de datos de registros mensuales de parámetros medidos; (2 caracterizar al agua de la cuenca; (3 identificar las fuentes de contaminación de mayor impacto; (4 comparar la evolución temporal y espacial de la contaminación y (5 aportar a la elaboración de pautas de gestión transferibles a la administración del recurso hídrico. El trabajo presenta la variación espacial y temporal de los diferentes parámetros analizados los que fueron sometidos a un análisis estadístico no paramétrico (Kruskal Wallis. Se observa que la salinidad del agua expresada como conductividad eléctrica arrojó valores bajos en los sitios: LT, A y Y y bastante más altos en: VU, CA y TB, pudiendo comprobarse además una tendencia creciente en dichos sitios. Los valores de salinidad más elevados se encuentran en TB (1.414 µS.cm-1, seguidos por CA (1.368 µS.cm-1 y VU (1.238 µS.cm-1. En estos tres sitios, los valores de la Relación Adsorción de Sodio (RAS fueron también los más altos.  Con respecto al contenido de Coliformes fecales los sitios CA y TB superaron los valores máximos establecidos porla Resolución 778/96 del Departamento General de Irrigación. Respecto a la evolución temporal los únicos parámetros que han presentado diferencias significativas (α<0,05 son la Demanda Química de Oxigeno, el Oxígeno Disuelto y Coliformes fecales.

Potencial de propagação de cultivares de marmeleiro por estaquia Potencial of propagation of cultivars of quince for cuttings

Directory of Open Access Journals (Sweden)

Rafael Pio

2004-08-01

Full Text Available Devido à escassez de trabalhos com o enraizamento de estacas de marmeleiro, realizou-se o presente trabalho com o objetivo de verificar o potencial de enraizamento de estacas de cultivares de marmeleiro. Utilizaram-se estacas lenhosas e lisas coletadas de plantas de marmeleiro 'Radiolo', 'Mendoza Inta-37', 'Much Prolife', 'Pineapple', 'Smyrna', 'De Patras', 'Provencia', 'Van Deman', 'Provance', 'Meliforme', 'Portugal' (Cydonia oblonga e 'Japonês' (Chaenomelis sinensis L., sendo estas padronizadas com 20 cm de comprimento. As estacas foram enterradas até a metade do comprimento em canteiro de terra e coberto por tela sombrite 50%, sendo umedecidas diariamente através de regas manuais. Após 75 dias, coletaram-se os seguintes dados biométricos: porcentagem de estacas enraizadas e brotadas, número de folhas e brotos, comprimento da maior raiz, comprimento médio das brotações e número de raízes emitidas por estaca. As cultivares Pineapple, De Patras, Provencia e Mendoza Inta-37 apresentaram maior potencialidade de propagação via estaquia.Due to the shortage of works with the quince cutting, the present work was developed with the objective to verify the rooting potential of quince cultivars cutting. Hardwoody cuttings of quince were collected from 'Radiolo', 'Mendoza Inta-37', 'Much Prolife', 'Pineapple', 'Smyrna', 'De Patras', 'Provencia', 'Van Deman', 'Provance', 'Meliforme', 'Portugal' (Cydonia oblonga and 'Japonês' (Chaenomelis sinensis L., being these samples standardized with 20 cm of length. Soon after, half of the length of the cutting was put in a substrate constituted by soil and covered by sombrite 50%, being daily humidified by water. After 75 days, were evaluated the percentage of rooting and sprouting, number of leaves and sprouts, length of the largest root and sprouting and number of roots emitted by cutting. The cultivars Pineapple, De Patras, Provencia and Mendoza Inta-37 presented larger potentiality of propagation

Environmental risk factors for oesophageal cancer in Malawi: A case ...

African Journals Online (AJOL)

Firewood cooking, cigarette smoking, and use of white maize flour all had ... Environmental exposures may be important risk factors ... Correspondence to: Nora E. Rosenberg ..... including in southern Africa.29 To our knowledge, this is the ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects Contact the Press Office Meetings & Events Media ...

First record of the genus Typhlocybella (Hemiptera: Auchenorrhyncha: Typhlocybinae: Dikraneurini from Argentina Primer registro del género Typhlocybella (Hemiptera: Auchenorrhyncha: Typhlocybinae: Dikraneurini para Argentina

Directory of Open Access Journals (Sweden)

María I. Catalano

2008-12-01

Full Text Available The genus Typhlocybella Baker is quoted for first time for Argentina from specimens collected on maize crops in Buenos Aires, Mendoza, Córdoba and Tucumán provinces. This contribution adds taxonomic and bioecologic knowledge about the genus as well as observations about the leaf damage produced on this crop.El género Typhlocybella Baker se cita por primera vez para la Argentina a partir de ejemplares recogidos sobre cultivos de maíz en las provincias de Buenos Aires, Mendoza, Córdoba y Tucumán. En esta contribución se reúne información relevante acerca de los aspectos taxonómicos y bioecológicos del género, y se adicionan observaciones acerca de los daños foliares que provocan sobre el mencionado cultivo.

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Post-Award Concerns General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's ... syndrome). AIDS is a disease of the immune system for which there is treatment, but no cure, ...

Why Are Drugs So Hard to Quit?

Medline Plus

Full Text Available ... Autoplay When autoplay is enabled, a suggested video will automatically play next. Up next Drugs: Shatter The ... Nora Volkow on Addiction: A Disease of Free Will - Duration: 21:12. National Institute on Drug Abuse ( ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Director of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director The ... their peers to prevent the spread of this disease. NIDA's public service announcements depict the devastating consequences ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... General Information Grant & Contract Application Process Funding Priorities Research Training News & Events News Nora's Blog NIDA in the News NIDA Notes Podcasts E-Newsletters Public Education Projects Contact the Press Office Meetings & Events Media ...

Why Are Drugs So Hard to Quit?

Medline Plus

Full Text Available ... views 10:34 Dr. Nora Volkow on NIDA's Neuroscience Research - Duration: 4:05. National Institute on Drug ... Language: English Location: United States Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators ...

Desarrollo de un modelo matemático de diferencias finitas para el análisis del campo de temperaturas en la soldadura por arco de chapas finas de acero inoxidable

Directory of Open Access Journals (Sweden)

Miguel, V.

2010-12-01

Full Text Available This work develops a finite difference method to evaluate the temperature field in the heat affected zone in butt welding applied to AISI 304 stainless steel thin sheet by GTAWprocess. A computer program has been developed and implemented by Visual Basic for Applications (VBA in MS-Excel spreadsheet. The results that are obtained using the numerical application foresee the thermal behaviour of arc welding processes. An experimental methodology has been developed to validate the mathematical model that allows to measure the temperature in several points close to the weld bead. The methodology is applied to a stainless steel sheet with a thickness lower than 3 mm, although may be used for other steels and welding processes as MIG/MAG and SMAW. The data which has been obtained from the experimental procedure have been used to validate the results that have been calculated by the finite differences numerical method. The mathematical model adjustment has been carried out taking into account the experimental results. The differences found between the experimental and theoretical approaches are due to the convection and radiation heat losses, which have not been considered in the simulation model.With this simple model, the designer will be able to calculate the thermal cycles that take place in the process as well as to predict the temperature field in the proximity of the weld bead.

En este trabajo se desarrolla un método de diferencias finitas para calcular el campo de temperaturas en la zona afectada por el calor en la soldadura de dos chapas de acero inoxidable AISI 304, soldadas mediante el procedimiento GTAW. Se ha desarrollado un programa informático implementado en libros de cálculo MS-Excel con Visual Basic para Aplicaciones (VBA. Los experimentos modelizados a través de la aplicación numérica predicen el comportamiento térmico de un procedimiento de soldadura. Para la validación del modelo matemático se ha desarrollado un

Nordic nuclear emergency exercises. Final report

International Nuclear Information System (INIS)

Bennerstedt, T.; Stranden, E.; Salo, A.

1995-01-01

In all Nordic countries, nuclear emergency provisions have been revised following the Chernobyl accident. Local and national exercises are carried out regularly in each country. Several actions have been taken to harmonize the emergency approaches of the Nordic countries. In order to further promote consistent decisions in an emergency situation, two Nordic exercises were conducted in 1993. It was important to see if all five countries (Denmark, Finland, Iceland, Norway and Sweden) responded in a similar way to a given situation, as far as risk assessment and protective measures were concerned. The exercises were mainly aimed at decision makers and advisers of the five national emergency organizations. Thus, the exercises did not include comparison of underlying calculations on, e.g., atmospheric trajectories or transfer of radioactive material from air to ground. Such functions were tested separately in drills that also formed part of the Nordic emergency preparedness program. The exercises included an acute-phase situation (NORA), and a late-phase situation (ODIN). The Nordic exercises aroused international interest, and hence observers from IAEA, OECD/NEA and the European Union were invited to the exercises. NORA was observed by representatives from IAEA (in Finland) and OECD/NEA (in Sweden). ODIN was attended by IAEA (in Sweden) and the European Union (in Norway). Generally speaking, regional exercises such as NORA and ODIN help improve national emergency preparedness planning, organization and operations as well as international coordination. (EG)

Why Are Drugs So Hard to Quit?

Medline Plus

Full Text Available ... Get YouTube Red. Working... Not now Try it free Find out why Close Why Are Drugs So ... Dr. Nora Volkow on Addiction: A Disease of Free Will - Duration: 21:12. National Institute on Drug ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... their lives , but now their night out always will be associated with HIV/AIDS. The “d’cisions” ... for breaking the harmful links between them, we will continue to update this Web site. Sincerely, Nora ...

Ser mujer no es suficiente

Directory of Open Access Journals (Sweden)

Fernando González Cajíao

1991-09-01

Full Text Available Voces en escena, antologías de dramaturgas latinoamericanas. Nora Eidelberg y María Mercedes Jaramillo (antologistas. Universidad de Antioquía, Medellín, 1991, 506 págs, 8 láminas.

Viljandi kultuuriakadeemia tudengid lajatasid kolme tükiga / Andres Keil

Index Scriptorium Estoniae

Keil, Andres, 1974-

2007-01-01

Janusz Glowacki "Fortinbras jõi end täis" Viljandi Kultuuriakadeemia teatrikunsti eriala 6. lennu esituses, lavastaja Kalju Komissarov ja Sven Heiberg ; Ott Aardami "Börs ja börsitar" ja Henrik Ibseni "Nora/Maja", lavastaja Helen Rekkor

Viljandi paugutab kolme esietendusega / Andres Keil

Index Scriptorium Estoniae

Keil, Andres, 1974-

2007-01-01

Janusz Glowacki "Fortinbras jõi end täis" Viljandi Kultuuriakadeemia teatrikunsti eriala 6. lennu esituses, lavastaja Kalju Komissarov ja Sven Heiberg ; Ott Aardami "Börs ja börsitar" ja Henrik Ibseni "Nora/Maja", lavastaja Helen Rekkor

Touch the sky with your hands: a special Planetarium for blind, deaf, and motor disabled

Science.gov (United States)

García, Beatriz; Maya, Javier; Mancilla, Alexis; Álvarez, Silvina Pérez; Videla, Mariela; Yelós, Diana; Cancio, Angel

2015-03-01

The Planetarium for the blind, deaf, and motor disabled is part of the program on Astronomy and Inclusion of the Argentina Pierre Auger Foundation (FOPAA) and the Institute in Technologies and Detection of Astroparticles-Mendoza (ITeDAM).

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Educators Children & Teens Search Connect with NIDA : Facebook LinkedIn Twitter YouTube Flickr RSS Menu Home Drugs of ... Director of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director The ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... from the Director of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director ... D. Volkow, M.D. Director National Institute on Drug Abuse Collaborators Thanks to Those Who Have Helped Raise ...

The Case for Quality Book Selection.

Science.gov (United States)

Bob, Murray C.

1982-01-01

This essay on library book selection critiques Nora Rawlinson's article on practices at the Baltimore County Public Library which appeared in Library Journal, November 15, 1981, p. 2188, and discusses library circulation statistics in relation to book selection. (EJS)

Dactylogyrids (Platyhelminthes, Monogenoidea) from the gills of Hoplias malabaricus (Characiformes: Erythrinidae) from coastal rivers of the Oriental Amazon Basin: species of Urocleidoides and Constrictoanchoratus n. gen.

Science.gov (United States)

Ferreira, K D C; Rodrigues, A R O; Cunha, J-M; Domingues, M V

2018-05-01

Five species of Urocleidoides (one new) and two new species of Constrictoanchoratus n. gen. are described in this study. All were collected from the gills of Hoplias malabaricus (Characiformes: Erythrinidae) captured in six localities of coastal rivers of the north-eastern sector the State of Pará (Oriental Amazon): Urocleidoides brasiliensis Rosim, Mendoza-Franco & Luque, 2011; Urocleidoides bulbophallus n. sp.; Urocleidoides cuiabai Rosim, Mendoza-Franco & Luque, 2011; Urocleidoides eremitus Kritsky, Thatcher & Boeger, 1986; Urocleidoides malabaricusi Rosim, Mendoza-Franco & Luque, 2011; Constrictoanchoratus lemmyi n. gen. n. sp.; and Constrictoanchoratus ptilonophallus n. gen. n. sp. This is the first reported occurrence of the four previously described species of Urocleidoides parasitizing H. malabaricus from streams in the Oriental Amazon Basin. The analysis of voucher specimens of U. eremitus parasitizing the gills of H. malabaricus from the Upper Paraná River floodplain in the limits of States of Paraná and Mato Grosso do Sul, Brazil, indicates that these specimens are members of a new species of Urocleidoides, described here as Urocleidoides paranae n. sp. Constrictoanchoratus n. gen. is proposed for the species with a male copulatory organ sclerotized, coiled, clockwise; ventral anchor with elongate superficial root, inconspicuous deep root; dorsal anchor with inconspicuous roots, and a constriction at the intersection between the shaft and the point. The host-parasite diversity scenario and host specificity of the species of Constrictoanchoratus n. gen. and Urocleidoides from the gills of H. malabaricus are also discussed in this study.

First evidence of tumor-like anomaly infestation in Copepods from the central Indian Ridge

Digital Repository Service at National Institute of Oceanography (India)

Bhandare, C.; Ingole, B.S.

manuscript. This is the contribution No. 4338 of NTO, Goa. References 1 Peralta P & Claps M. Plankton of a high mountain shallow lake (Los Horcones, High Los Andes Cordillera, Mendoza, Argentina). Verhandlungen der Int. Vereinigung fuer Theoretische und...

IMTU Medical Journal - Vol 6, No 1 (2015)

African Journals Online (AJOL)

Child sexual abuse and possible health consequences among secondary school students in urban Tanzania · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Felix Kisanga, David Urassa, Nora Hogan, Jessie Mbwambo, 46-53 ...

Prostě Červíček

Czech Academy of Sciences Publication Activity Database

Martínek, Jiří

2013-01-01

Roč. 4, č. 12 (2013), s. 54-56 ISSN 1804-2260 Institutional support: RVO:67985963 Keywords : Czech travellers * 19th-20th century * A. V. Frič * Čerwuiš Piošád Mendoza Subject RIV: AB - History

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Twitter YouTube Flickr RSS Menu Home Drugs of Abuse Commonly Abused Drugs Charts Emerging Trends and Alerts Alcohol Club Drugs ... from the Director of the National Institute on Drug Abuse, Dr. Nora D. Volkow. Message from the Director ...

Drugs + HIV, Learn the Link

Medline Plus

Full Text Available ... Learn the Link campaign uses TV, print, and Web public service announcements (PSAs), as well as posters, e-cards, ... to misuse drugs. The Learn the Link public service campaign is just one ... site. Sincerely, Nora D. Volkow, M.D. Director ...

Plasma cortisol and noradrenalin concentrations in pigs: automated sampling of freely moving pigs housed in PigTurn versus manually sampled and restrained pigs

Science.gov (United States)

Minimizing the effects of restraint and human interaction on the endocrine physiology of animals is essential for collection of accurate physiological measurements. Our objective was to compare stress-induced cortisol (CORT) and noradrenalin (NorA) responses in automated versus manual blood sampling...

The Siege / Lauri Saaber

Index Scriptorium Estoniae

Saaber, Lauri

1999-01-01

Mängufilm "Sõjaseisukord" ("The Siege") : režissöör Edward Zwick : Ameerika Ühendriigid 1998 : Mängufilm "Sulle on sõnum" ("Youþve Got Mail") : Stsenarist ja režissöör Nora Ephron : Ameerika Ühendriigid 1998

On aeg, mil vajame enam leiba kui lilli / Ants Juske

Index Scriptorium Estoniae

Juske, Ants, 1956-2016

2009-01-01

Marge Monko isikunäitus "Leib ja lilled" Tallinnas Draakoni Galeriis 21. märtsini. Eksponeeritud fotod ja video "Nora õed". Kunstnik on majanduses ja tööhõives asetleidvaid muutusi uurides aluseks võtnud Narva Kreenholmi Manufaktuuri näited

Impact of the water symmetry factor on humidification and cooling strategies for PEM fuel cell stacks

Energy Technology Data Exchange (ETDEWEB)

Picot, D; Metkemeijer, R; Bezian, J J; Rouveyre, L [Centre d` Energetique, Ecole des Mines de Paris, 06 - Sophia Antipolis (France)

1998-10-01

In this paper, experimental water and thermal balances with three proton exchange membrane fuel cells (PEMFC) are proposed. On the test facility of Ecole des Mines de Paris, three De Nora SPA fuel cell stacks have been successfully studied: An 1 kW{sub e} prototype using Nafion {sup trademark} 117, a 5 and 10 kW{sub e} module using Nafion {sup trademark} 115. The averaged water symmetry factor determines strategies to avoid drying membrane. So, we propose analytical solutions to find compromises between humidification and cooling conditions, which determines outlet temperatures of gases. For transport applications, the space occupied by the power module must be reduced. One of the main efforts consists in decreasing the operative pressure. Thus, if adequate cooling power is applied, we show experimentally and theoretically the possibility to use De Nora PEM fuel cells with low pressure, without specific external humidification. (orig.)

¿Cómo fue que el viñedo adquirió importancia? Significados de las vides, calidades de las uvas, y cambio socio-técnico en la producción vinícola de Mendoza

Directory of Open Access Journals (Sweden)

Hernán Thomas

2009-08-01

over the past few decades. Limiting itself to the Mendoza region, this paper wants to analyze some of the changes observed in vineyards from a socio-technical perspective. Following the way that the definition of quality is (reconstructed, a relationship is sought between vines and wine and the use of certain technologies. The paper shows how the dynamics between social groups and artifacts create different conceptions of quality, which in turn lead to a different role of grapes in the wine making process. It also shows that the changes observed do not necessarily imply a ‘new way’ has taken over an ‘old way’. It rather seems that different social groups are relevant in different technological frames, displacing others.

Muscle Weakness Is Associated With an Increase of Left Ventricular Mass Through Excessive Blood Pressure Elevation During Exercise in Patients With Hypertension.

Science.gov (United States)

Kamada, Yumi; Masuda, Takashi; Tanaka, Shinya; Akiyama, Ayako; Nakamura, Takeshi; Hamazaki, Nobuaki; Okubo, Michihito; Kobayashi, Naoyuki; Ako, Junya

2017-08-03

Autonomic imbalance in hypertension induces excessive blood pressure (BP) elevation during exercise, thereby increasing left ventricular mass (LVM). Although muscle weakness enhances autonomic imbalance by stimulating muscle sympathetic activity during exercise, it is unclear whether muscle weakness is associated with an increase of LVM in patients with hypertension. This study aimed to investigate the relationships between muscle weakness, BP elevation during exercise, and LVM in these patients. Eighty-six hypertensive patients aged 69 ± 8 years with controlled resting BP (ie, exercise test performed at moderate intensity (ΔNORA and ΔPWV, respectively). A difference between baseline and peak systolic BP during the exercise test was defined as BP elevation during exercise (ΔSBP). Relationships between muscle strength, ΔNORA, ΔPWV, ΔSBP, BNP, and LVMI were analyzed, and significant factors increasing LVM were identified using univariate and multivariate regression analyses. Muscle strength was negatively correlated with ΔNORA (r = -0.202, P = 0.048), ΔPWV (r = -0.328, P = 0.002), ΔSBP (r = -0.230, P = 0.033), BNP (r = -0.265, P = 0.014), and LVMI (r = -0.233, P = 0.031). LVMI was positively correlated with ΔPWV (r = 0.246, P = 0.023) and ΔSBP (r = 0.307, P = 0.004). Muscle strength was a significant independent factor associated with LVMI (β = -0.331, P = 0.010). Our findings suggest that muscle weakness is associated with an increase of LVM through excessive BP elevation during exercise in patients with hypertension.

Proposta de roteiro para a determinação das variáveis de soldagem do Processo TIG pulsado aplicado à soldagem de chapas finas Proposal of roadmap for determining the variables of pulsed TIG welding process applied to welding of thin plates

Directory of Open Access Journals (Sweden)

Tiago Vieira da Cunha

2013-03-01

Full Text Available Na soldagem TIG pulsada a corrente varia entre dois níveis bem definidos de energia numa determinada frequência, sendo, portanto, necessário a regulagem de um conjunto de variáveis composto pela corrente de pulso, tempo de pulso, corrente de base, tempo de base, além da velocidade de soldagem. Entretanto, apesar de ser uma técnica tão amplamente difundida, na prática estas variáveis de soldagem muitas vezes são reguladas de forma arbitrária. Isto pode conduzir ao uso ineficiente da pulsação da corrente quando considerado o resultado final da solda, bem como nos aspectos de produtividade. Diante desta carência, este trabalho tem por objetivo apresentar um roteiro desenvolvido com o intuito de suprir a necessidade prática de se estabelecer critérios para auxiliar a determinação das variáveis da soldagem TIG pulsada, tomando como premissa a largura desejada para o cordão de solda final, a sobreposição entre os pontos de solda que compõem o cordão e a velocidade de soldagem. Por fim, é apresentada uma aplicação deste roteiro na soldagem "bead on plate" de chapas de aço inox com 1,2 mm de espessura.In pulsed TIG welding the current varies between two well-defined energy levels in a given frequency being, therefore, necessary to the adjustment of a set of variables consisting of the peak current, peak time, background current, background time and the welding speed. However, despite being a technique so widespread, in practice these welding variables are often regulated arbitrarily. This can lead to inefficient use of the pulsed current regarding the end result of the weld as well as in the aspects of productivity. Given this shortage, this paper aims to present a roadmap developed in order to meet the practical need to establish criteria to assist in the determination of pulsed TIG welding variables, taking as its premise the desired width of the weld bead, overlap between the weld points comprising the weld bead and the

Land Tenure, Gender and Globalisation

International Development Research Centre (IDRC) Digital Library (Canada)

The paper argues that these policies have had implications for the ...... For locals, mining was a dry season supplement to farming activities in the wet season. ...... Brown, I.F., S.H.C. Brilhante, E. Mendoza, and I.R. Oliveira, 2002, Estrada de ...

A user-oriented and quantifiable approach to irrigation design.

NARCIS (Netherlands)

Baars, E.; Bastiaansen, A.P.M.; Menenti, M.

1995-01-01

A new user-oriented approach is presented to apply marketing research techniques to quantify perceptions, preferences and utility values of farmers. This approach was applied to design an improved water distribution method for an irrigation scheme in Mendoza, Argentina. The approach comprises two

Efecto del flujo turbulento, la condición superficial, la presencia de ácido acético y un compuesto orgánico usado como inhibidor de corrosión sobre la cinética electroquímica del acero api 5l x52 en soluciones con co2 disuelto /

OpenAIRE

Olvera Martínez, María Elena

2012-01-01

 tesis que para obtener el grado de Doctorado en Ingeniería, presenta Maria Elena Olvera Martinez ; asesor Juan Mendoza Flores310 páginas : ilustracionesDoctorado en Ingeniería UNAM, Facultad de Química, 2012

PRAMU. Contamination sources

International Nuclear Information System (INIS)

Asenjo, Armando R.

2000-01-01

Mining and milling activities have been carried out in Argentina during the last 40 years, and nowadays National Atomic Energy Commission (CNEA) of Argentina is undertaking the Uranium Mining Environmental Restoration Project (PRAMU). The aim of this project is to achieve that in all the places where uranium mining activities were developed, to restore the environment as much as it is possible, according to the legislation in force. The sites which are studied are: Malargue (Mendoza province), Cordoba (Cordoba province), Los Gigantes (Cordoba province), Huemul (Mendoza province), Pichinan (Chubut province), Tonco (Salta province), La Estela (San Luis province), Los Colorados (La Rioja province). In order to develop the restoration project in each site, one of the first task to be performed is to know quantities and the chemical, physicals and radiological characteristics of the contamination sources. In the present paper the activities of PRAMU in this field, are informed. (author)

The relationship between nutritionally-related blood metabolites and ...

African Journals Online (AJOL)

user

goat is reputable mainly for its adaptability and resistance to diseases and parasites (Barry & Godke, 2001). It is, however ... the various nutritional and metabolic disorders (Daramola et al., 2005) in goats. The discovered .... Biochemical and haematological measurements in beef cattle in Mendoza plain rangelands ...

Muerte, pues, a la guerra...

Directory of Open Access Journals (Sweden)

Alonso Valencia Llano

2011-01-01

Full Text Available ¿Estado irresponsable o responsable? La responsabilidad patrimonial del Estado colombiano, luego de la guerra civil de 1876-1877. Hugo Andrés Arenas Mendoza. Editorial Universidad del Rosario, Colección Textos de jurisprudencia, Bogotá, 2009, 384 págs.

Mesa redonda: Argentina en proyectos globales de investigaciones espaciales y astronómicas. Uso científico de la Antena de Espacio Profundo DSA 3

Science.gov (United States)

Colazo, M.

2016-08-01

Argentine has 10 percent of the operative time available for the DSA 3 Antenna of the European Space Agency, installed in Malargüe, Mendoza. Here we present the history of the project and the current activities for the scientific use of the antenna.

Encuesta sobre Brucelosis en Colombia

Directory of Open Access Journals (Sweden)

Luis Patiño Camargo

1952-09-01

Full Text Available Informe al Comite Interamericano de la Brucelosis,  presentado por Luis Patiño Camargo, M. D., Andrés Soriano Lleras, M. D.  en el Segundo Congreso interamericano de la Brucelosis, Buenos Aires, Mendoza, 17-26 de noviembre de 1948.

Is there any relationship between decreased AgNOR protein synthesis and human hair loss?

Science.gov (United States)

Eroz, R; Tasdemir, S; Dogan, H

2012-11-01

Argyrophilic nucleolar organizing region associated proteins (AgNORs) play roles in cell proliferation and a variety of diseases. We attempted to determine whether decreased NOR protein synthesis causes human hair loss. We studied 21 healthy males who suffered hair loss on the frontal/vertex portion of the head. Hair root cells from normal and hair loss sites were stained for AgNOR. One hundred nuclei per site were evaluated and the AgNOR number and NORa/TNa proportions of individual cells were determined using a computer program. The cells from normal sites had significantly higher AgNOR counts than those from hair loss sites. Also, the cells from the normal sites had significantly higher NORa/TNa than cells from the hair loss sites. In the normal sites, the cells demonstrated more NOR protein synthesis than cells in hair loss sites. Therefore, decreased NOR protein synthesis appears to be related to hair loss in humans.

Post-test calculations of out-of-pile single rod burst experiments with Argentine ZRY-4 tubes using SSYST codes system

International Nuclear Information System (INIS)

Nassini, H.; Meyder, R.

1988-11-01

The calculations were performed with SSYST-3 code system. The experiments have been carried out with shortened REBEKA simulators. The main goal was to verify whether the model for describing the Zircaloy cladding deformation and rupture at high temperatures (NORA2 model) is able to predict the Argentine cladding material behaviour under such conditions. A good agreement between experimental results and model predictions was found in the range of temperatures from 700 to 850 0 C (in α phase and first half of α+β transition phase). There were some discrepances at higher temperatures, probably due to the strong influence of heating rate on material properties. According to the results of these post-test calculations, it can be concluded that NORA2 model is able to well describe the Argentine Zircaloy cladding deformation and rupture under LOCA conditions, because there was a good agreement in the range of burst (ballooning) temperatures which are expected in this type of accident. (orig./HP) [de

Descripción del diseño y construcción de un deposito de hormigón pretensado para 80.000 m² de capacidad de gas natural licuado. España

Directory of Open Access Journals (Sweden)

Fernández de la Reguera, Ramón

1981-08-01

Full Text Available La construcción de un nuevo depósito de 80.000 m^{3>/sup> de capacidad para almacenamiento de gas natural licuado en la Planta que la Empresa Nacional del Gas, S A. (ENAGAS tiene en Barcelona, ha sido realizada por la Empresa Auxiliar de la Industria, S/A. (AUXINI en Agrupación Temporal con PRELOAD SISTEMAS. Esta obra, una de las últimas realizaciones mundiales en el sector, consistente en doble pared de hormigón pretensado, ha permitido a AUXINI constituirse en una de las empresas líderes de la joven y dinámica tecnología criogénica, aportando soluciones constructivas adecuadas para este tipo de depósitos. En el trabajo que sigue se hace hincapié en la descripción del depósito indicando los pormenores constructivos del mismo, tales como la construcción y montaje de la chapa del muro interno, así como el pretensado horizontal tipo Preload utilizado, además de otros procedimientos constructivos como la elevación de la cúpula, la soldadura de la chapa 9% Ni, etc. Este depósito incorpora los últimos requisitos de seguridad que se exigen en el Proyecto de ese tipo de almacenamiento y, por las numerosas innovaciones que se han introducido durante su construcción, ha constituido una obra pionera en su género y de carácter mundial.}

Õpetajate päeva eel autasustatakse õpetajaid : aasta õpetajad 2008

Index Scriptorium Estoniae

2008-01-01

Vabariigi presidendi kultuurirahastu hariduspreemiad said tänavu Tallinna reaalkooli vene keele õpetaja Nora Mals, Tartu Ülikooli õppejõud, geograafiaõpikute autor ja metoodika arendaja, Eesti võistkonna juhendaja rahvusvahelistel geograafiaolümpiaadidel Ülle Liiber ja Pärnu Kuninga tänava põhikooli direktor Urve Krause

Small arcs of larger circles framing through other patterns​​

CERN Document Server

Bateson, Nora

2016-01-01

This is an important first collection of essays, reflections and poems by Nora Bateson, the noted research designer, film-maker, writer and lecturer. She is the daughter of Gregory Bateson, president of the International Bateson Institute (IBI) and an adviser to numerous bodies at international and governmental level.

Vetsherneje : [luuletused] / Johannes Semper ; lühibiograafia: T. L. [Toomas Liiv

Index Scriptorium Estoniae

Semper, Johannes, 1892-1970

1999-01-01

Sisu: Vetshernjeje ; Golod / tlk. Nora Javorskaja ; Pod ekvatorom / tlk. S. Olender ; Pribrezhnõje sosnõ / tlk. Z. Mirkina ; Kak bõ smog tõ zhit? / tlk. Leon Toom ; Kakoje eto tshudo / tlk. J. Gordijenko. Orig.: Õhtune ; Nälg ; Ekvaatori all ; Rannamännid ; Kuidas elaksid? ; On liigutavalt tore

Investigating Students' Attitudes towards Private Sector Work during Study in Saudi Arabia

Science.gov (United States)

Al-asqah, Amnah

2018-01-01

Purpose: The purpose of this paper is to identify the students' attitudes towards private sector work during study. Design/methodology/approach: This study used a comprehensive social survey (including questionnaire and interviewing) distributed to experts in departments and colleges in King Saud University and Princess Nora University. Findings:…

Heritage management and sustainable development in perspective: theory, law, and practice

NARCIS (Netherlands)

Veldpaus, L.

2015-01-01

Books reviewed: Heritage Planning: Principles and Process by Harold Kalman, Routledge, 2014, 344 pp., £36.99, ISBN 978-1-13-801792-4; Conserving Cultural Landscapes: Challenges and New Directions by Ken Taylor, Archer St. Clair, Nora J. Mitchell (eds.), Routledge, 2015, 394 pp., £90.00, ISBN

To Leave, or Not to Leave: That Is the Problem in "A Doll's House" and "Candida"

Science.gov (United States)

Varghaiyan, Naghmeh

2015-01-01

This paper explores representation of "Woman Question" in Henrik Ibsen's "A Doll's House" and George Bernard Shaw's "Candida." The paper argues that unlike many studies that have read Candida and Nora as two disparate characters, they can be considered as the same "New Woman" represented only from different…

Avgang 2017: Sommerkonsert i Aulaen

OpenAIRE

2017-01-01

Avgangsstudenter fra MA2 opera og studenter fra MA1 holder konsert med sang fra operaer, lieder og fra operetter. MA2 sangere: Hanne Korsbrekke Askeland, Dagfinn Andersen, Sara Aasen. MA1 sangere: Eilert Egil Taugbøl Hasseldal, Marcela Randem, Nora Oleanne Sårheim, Tina Therese Tuven

Ilves andis üle tänavused hariduspreemiad

Index Scriptorium Estoniae

2008-01-01

President Toomas Hendrik Ilves andis 3. oktoobril 2008 üle Vabariigi Presidendi Kultuurirahastu hariduspreemiad. Premeeritud pedagoog Nora Mals on Tallinna Reaalkooli vene keele õpetaja, Ülle Liiber koolitab Tartu Ülikoolis geograafiaõpetajaid ja Urve Krause töötab Pärnu Kuninga tänava põhikooli direktorina

The adaptive capacity of institutions in Canada, Argentina, and Chile to droughts and floods

NARCIS (Netherlands)

Hurlbert, M.; Gupta, J.

The increasing evidence of global warming calls on all states to enhance their adaptive capacity to deal with climate change. This paper compares the adaptive capacity of two Canadian provinces, the province of Mendoza, Argentina and the administrative region of Coquimbo, Chile in relation to the

War of the Masses: a Component of Guerrilla Warfare.

Science.gov (United States)

2016-05-10

Bogotá: Universidad Nacional de Colombia, Facultad de Derecho, Ciencias Politicas y Sociales, 2009), 72. 59 Carlos Medina Gallego, “FARC-EP: El Partido...de Derecho, Ciencias Politicas y Sociales, 2009. 53 Mendoza, Plinio Apuleyo. “La Segunda Independencia.” El Tiempo. September 13, 2013. Accessed

76 FR 72164 - Circular Welded Carbon-Quality Steel Pipe From India, the Sultanate of Oman, the United Arab...

Science.gov (United States)

2011-11-22

...-811] Circular Welded Carbon-Quality Steel Pipe From India, the Sultanate of Oman, the United Arab... Emirates, and Vietnam), or Angelica Mendoza (Oman), AD/CVD Operations, Office 7, Import Administration... Sultanate of Oman (Oman), the United Arab Emirates (UAE), and the Socialist Republic of Vietnam (Vietnam...

Sr, Nd, Pb and Hf isotopic constraints on mantle sources and crustal contaminants in the Payenia volcanic province, Argentina

DEFF Research Database (Denmark)

Søager, Nina; Holm, Paul Martin; Thirlwall, Matthew F.

2015-01-01

The presented Sr, Nd, Hf and double-spike Pb-isotopic analyses of Quaternary basalts from the Payenia volcanic province in southern Mendoza, Argentina, confirm the presence of two distinct mantle types feeding the Payenia volcanism. The southern Payenia mantle source feeding the intraplate-type Río...

Uranium mining in Sierra Pintada: knowledge, epistemic communities and development

International Nuclear Information System (INIS)

Martinez Demarco, S. R.

2011-01-01

This paper analyses the conflict triggered by the National Atomic Energy Commission of Argentina (CNEA) proposing to re-open the Mining Complex of Sierra Pintada, in San Rafael, Province of Mendoza. Since 2004 when the Commission submitted the first report to the Ministry of Public Works and Environment of Mendoza to obtain the necessary permission to restart the works in the mine, several protests have taken place and many legal measures were taken in order to stop any resuming attempts. This study argues that, although CNEA has been an epistemic community capable of applying their policy proposals in the nuclear field, their technical knowledge is currently not sufficient to design a policy, and moreover, to hold that they are working for local and sustainable development. Only 'puzzling' 'with actors' paradigms and knowledge is possible to fit together their demands and achieve a public policy, or solution, for this problem. (author) [es

Looking for periodicities in the hail intensity in the Andes region

Energy Technology Data Exchange (ETDEWEB)

Prieto, R; Herrera, R; Doussel, P [Inaiglia, Mendoza (Argentina); Gimeno, L; Ribera, P [Univerisdad de Vigo, Orense (Spain); Garcia, R; Hernandez, E [Universidad Complutense de Madrid, Madrid (Spain)

2001-04-01

Documental sources and categorization techniques were used to construct a series of the annual hail intensity in Mendoza area (Argentina). When the temporal series by means of Singular Spectrum Analysis (SSA) and the Maximum Entropy Method (MEM) was analyzed, we found interdecadal oscillations of periods of about 20 years and interannual oscillations of about 4 and 9 years. In addition when detrented-data were used a low frequency oscillation of about 72 years also appears. [Spanish] Para construir una serie de intensidades de granizo en el area de Mendoza (Argentina), se emplearon fuentes documentales y tecnicas de caracterizacion. Cuando se analizaron las series temporales, mediante el Analisis Singular del Expectro (SSA), y el Metodo de Maxima Entropia, encontramos oscilaciones decadales con periodos de aproximadamente 20 anos y oscilaciones interanuales de alrededor de 4 a 9 anos. Ademas cuando la variacion por tendencia de los datos se elimino, se puso de manifiesto una oscilacion de frecuencia de cerca de 72 anos.

O uso de bambu e metal clay no design de jóias de arte

OpenAIRE

Takamitsu, Helen Tatiana [UNESP

2011-01-01

Esta dissertação teve como objetivo desenvolver processos de confecção de Jóias de Arte ecologicamente corretas em bambu e metal clay. Para tanto foram projetados e confeccionados alguns protótipos de jóias com estes materiais, aliando o material renovável bambu e o metal clay, que é proveniente da reciclagem de chapas fotográficas e outros resíduos industriais. Foram confeccionados um anel, uma pulseira e um pingente, com partes de colmos de bambu devidamente secos, da espécie Dendrocalamus ...

Estudo de impactos ambientais em solos: o caso da reciclagem de baterias automotivas usadas, tipo chumbo-ácido

OpenAIRE

Fernandes, Josely Dantas; Dantas, Edilma Rodrigues Bento; Barbosa, Juliana Nóbrega; Barbosa, Edimar Alves

2011-01-01

A ocorrência de solos contaminados com o elemento chumbo está se tornando cada vez mais comum. Ele é, essencialmente, um contaminante ambiental e suas concentrações no meio ambiente vem aumentando de acordo com a aplicação sempre crescente em diversos produtos industriais necessários à sociedade moderna. Hoje, usa-se o chumbo, por exemplo, na fabricação de canos, em revestimentos de cabos elétricos, de chapas para pias, cisternas e telhados e, principalmente, na indústria de baterias automoti...

Tecendo a manhã : Historia do Diretorio Central dos Estudantes da Unicamp (1974/1982)

OpenAIRE

Mateus Camargo Pereira

2006-01-01

Resumo: O objeto de estudo desta pesquisa é o de apresentar uma reflexão inicial sobre a história do Diretório Central dos Estudantes (DCE) da Unicamp, compreendendo o movimento estudantil desde sua formação e destacando o embate entre as principais bandeiras de luta - das chapas vencedoras e perdedoras - nos processos eleitorais que configuraram as quatro primeiras gestões da entidade, no período de 1974 a 1982. Março de 1974 é demarcado pela primeira movimentação de massa do movimento estud...

78 FR 76854 - Notice of Realty Action: Non-Competitive (Direct) Sale of Public Land in Sheridan County, WY

Science.gov (United States)

2013-12-19

... Department of the Interior and the BLM. The Maintenance Plan Change updated the land disposal map and... publication of this NORA, and until completion of the sale, the BLM is no longer accepting land use... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLWYP070000; L14300000.EU0000; WYW-168342...

Sophiatown as lieu de mémoire

NARCIS (Netherlands)

Knevel, P.

2015-01-01

Sophiatown has often been presented as a symbol of a vibrant interracial urban culture that was destroyed by the racial segregationist policy of the apartheid regime. In reality, however, there are many ‘Sophiatowns’. By using Pierre Nora's well-known concept of lieux de mémoire and the related

United States Air Force Academy: A Bibliography 2011-2015

Science.gov (United States)

2016-11-23

21 VI. ATHLETIC DEPARTMENT AND SPORTS - - - - - - - - - - - - - - - - - - - - 23 VII. BASIC CADET...Mendoza, Monica. "Mayor Bach Unveils Plan to Help Attract Tourism ." The Gazette 2 July 2013: A1, A6. Print. 183. ---. " Colorado Springs to Seek...22 PART VI ATHLETIC DEPARTMENT AND SPORTS BOOKS, DOCUMENTS AND REPORT

Geoid Model and Altitude at Mount Aconcagua Region (Argentina) from Airborne Gravity Survey

DEFF Research Database (Denmark)

Cristina Pacino, M.; Jaeger, Eric; Forsberg, René

2014-01-01

Aconcagua is part of the Southern Andes in the Argentine Province of Mendoza and it is the highest mountain in the Americas. The Aconcagua region is mostly inaccessible for land surveys. The existing gravity data are sparsely distributed, and mainly along the route currently used to climb the mou...

Cooperation on Water management issues, Argentina : Project in the framework of Bilateral Cooperation between Argentina and the Netherlands : Case studies on water management issues in Argentina

NARCIS (Netherlands)

Querner, E.P.; Morabito, J.A.; Rebori, G.

2007-01-01

In Argentina parts of the country have problems encountered from too much water or suffer serious water shortages. The Humid Pampas encounter an increased rainfall since the 1970’s. In Mendoza Province water resources are limited and all the water from the rivers is used for agriculture, drinking

Extractive sector politics in Latin America and their impact on poverty alleviation

DEFF Research Database (Denmark)

Pacheco Cueva, Vladimir

and experiences of Mexico, Chile and Peru in regards to the nexus between non-renewable resource management and poverty alleviation. With that contextual background, the paper will present the most common developmental debates taking place in El Salvador, the province of Mendoza (Argentina) and the state of Baja...

Translations on Narcotics and Dangerous Drugs, Number 283

Science.gov (United States)

1977-02-03

Quiroz Carrillo, 20; Virginia Mora Alejo; Elida Alcorta de Torres, wife of Torres Solis, alias "El Pajaro;" Virginia Mora; Alicia and Dora Mora...INMATES-Raul Mendoza Diaz and the director of Federal Health, Dr Fernando Herrera Negrete, will engage in a campaign to detect drug addiction among

Comparison of mating performance of medfly (Diptera: Tephritidae) genetic sexing and wild type strains: field cage and video recording experiments

International Nuclear Information System (INIS)

Calcagno, G.E.; Vilardi, J.C.; Manso, F.

2002-01-01

To improve the efficiency of the sterile insect technique (SIT) efforts are being devoted to obtain genetic sexing strains (GSS). The present work was carried out in order to compare the mating efficiency of flies from the GSS [(Ty34228 y + /X)sw x ] and from a wild type strain (Mendoza). Females of the GSS (T228) exhibit longer embryonic development, while males develop in a normal time period. In a field-cage experiment, mating competitiveness was compared between the T228 and the Mendoza, Argentina mass reared strain. The number and duration of matings and the location of copula in the tree were recorded. The analysis was repeated using irradiated males of T228. The results showed that mating efficiency of the GSS is good in comparison with that of the Mendoza strain. Although copulatory success in T228 is reduced by the radiation treatment, the high numbers of sterilized males released would compensate this effect in the control programs. In a second experiment, under laboratory conditions, video recording techniques were applied. In this case two virgin males, one of the GSS and one emerged from wild collected fruits, competed during 30 min for a virgin wild female. The proportion of successful males did not differ between strains, but some differences were observed between strains in the time spent in different stages of the courtship. Males of the T228 were more aggressive, and they attempted to copulate with the other male more frequently than did wild males. These differences may be due to selection for more aggressive individuals under the overcrowded laboratory breeding conditions for this strain. (author)

Macro- and microclimate conditions may alter grapevine deacclimation: variation in thermal amplitude in two contrasting wine regions from North and South America

Science.gov (United States)

Antivilo, Francisco Gonzalez; Paz, Rosalía Cristina; Keller, Markus; Borgo, Roberto; Tognetti, Jorge; Juñent, Fidel Roig

2017-12-01

Low temperature is a limiting factor that affects vineyard distribution globally. The level of cold hardiness acquired during the dormant season by Vitis sp. is crucial for winter survival. Most research published on this topic has been generated beyond 40° N latitude, where daily mean temperatures may attain injurious levels during the dormant season resulting in significant damage to vines and buds. Symptoms of cold injury have been identified in Mendoza (32-35° S latitude), a Southern Hemisphere wine region characterized by a high thermal amplitude, and warm winds during the dormant season. These symptoms have usually been attributed to drought and/or pathogens, but not to rapid deacclimation followed by injurious low temperatures. Because local information on meteorological events as probable causes is scarce, this research was designed to test and study this assumption by comparing macro-, meso-, and microclimatic data from Mendoza, Argentina, and eastern Washington, USA. The goal was to unveil why freezing damage has occurred in both regions, despite the existence of large climatic differences. Because environmental parameters under field conditions may not correspond to data recorded by conventional weather stations, sensors were installed in vineyards for comparison. Microclimatic conditions on grapevines were also evaluated to assess the most vulnerable portions of field-grown grapevines. In order to better understand if it may be possible to modify cold hardiness status in a short period with high thermal amplitude conditions, deacclimation was induced using a thermal treatment. Hence, despite the fact that Mendoza is warmer, and temperatures are not as extreme as in Washington, high daily thermal amplitude might be partially involved in plant deacclimation, leading to a differential cold hardiness response.

Obstacles to Scientific Research in Light of a Number of Variables

Science.gov (United States)

Algadheeb, Nourah A.; Almeqren, Monira A.

2014-01-01

The present study aimed to identify the scientific research obstacles facing faculty members in the College of Education at Princess Nora bint Abdul Rahman University (PNU) and to determine the differences in the obstacles according to age, academic rank, scientific specialty, marital status, number of completed studies, and time since the last…

Development of a deformation and failure model for Zircaloy at high temperatures for light water reactor loss-of-coolant-accident investigations

International Nuclear Information System (INIS)

Raff, S.

1982-11-01

To describe Zircaloy-4 deformation and failure behaviour at high temperatures (600 to 1400 0 C), the phenomenological model NORA was developed and verified against numerous experimental results. The model can be applied to the calculation of fuel rod cladding deformation during small and large break loss-of-coolant-accidents. (orig./RW) [de

Presidendi teenetemärgi pälvis viis spordiinimest

Index Scriptorium Estoniae

2008-01-01

Vt. ka Linnaleht : Tartu 7. veebr., lk. 7. Eesti riigile osutatud teenete eest pälvisid president Toomas Hendrik Ilveselt teenetemärgi viis spordieluga seotud inimest: jalgpallikoondise ekstreenerid Jelle Goes ja Arno Pijpers, kergejõustikutreener Vésteinn Hafsteinsson, sõudetreener Tatjana Jaanson ning spordielu edendaja Nora Kutti. Juuresoleval fotol Jelle Goes

76 FR 31010 - Iowa Northern Railway Company-Trackage Rights Exemption-Dakota, Minnesota & Eastern Railroad...

Science.gov (United States)

2011-05-27

..., and milepost 116.70 at the connection with CP's Mason City Subdivision, a distance of approximately 20.80 miles; (2) milepost 116.70 at the connection with CP's Mason City Subdivision and milepost 107.30... and Nora Jct.; and (3) milepost 116.70 at the connection with CP's Mason City Subdivision and milepost...

The Politics of Drug Trafficking in Mexican and Mexico-Related Narconovelas

Science.gov (United States)

Palaversich, Diana

2006-01-01

This essay traces the emergence of the Mexican and Mexico-related narconovela. It examines perspectives on drug trafficking and traffickers expressed in novels by Elmer Mendoza, Leonides Alfaro, Gerardo Cornejo, Homero Aridjis, Arturo Perez-Reverte, and Paul Flores. The variety of positions taken refutes the tendency of the Mexican mainstream…

Integrating Social Entrepreneurship with Service and Experiential Learning: A Case Study at the University of Notre Dame

Science.gov (United States)

Paulsen, Melissa A.

2012-01-01

The Gigot Center for Entrepreneurship, supported by the Mendoza College of Business at the University of Notre Dame, launched a Microventuring Certificate Program in the fall of 2006, designed to engage upper-level undergraduate business and nonbusiness students in the provision of technical assistance and other consulting services to low-income…

Experimental and numerical study of flows in PEM fuel cell stacks for traction applications; Etude numerique et experimentale des ecoulements dans une pile a combustible de type PEM adaptable aux applications embarquees

Energy Technology Data Exchange (ETDEWEB)

Picot, D

1998-07-01

The problems with the optimization and design of proton exchange membrane fuel cells (PEMFC) are mainly based on the mastery of water and heat transfers inside the active cells. A theoretical and experimental discussion about this topic is proposed. The average sharing coefficients of the generated water are measured for 3 Nora fuel cells (1, 5 and 10 kW). The values obtained with nafion 117 are in agreement with the data of the literature, while the 40% generated water recovered inside the anode compartment with nafion 115 are unexpected. The difficulty to obtain a physical formulation of electro-osmosis does not allow to quantify this coefficient and leads to justify the limitations of use of the numerical codes on this topic. However, by separating the intrinsic parameters of the electrodes/membrane system and the global operation parameters of a cell, it is possible to extrapolate realistic humidification strategies. In the framework of the European project 'Fever', a systemic model of a 30 kW module for electric-powered vehicle has been developed. For an optimum energy integration of Nora fuel cells in volume-limited applications, it is necessary to separate the humidification sections of these modules. In the case where air is used as oxidant, the presence of nitrogen inside the anode compartment has been evidenced both in close and recirculation modes. In agreement with the literature data about nafion permeability, the nitrogen migration through the electrolyte is explained by the diffusion theory. A discussion about the interest of using both operational modes to maximize the energy efficiency is proposed. Finally, a simple-phase and double-phase numerical study with interface reconstruction is carried out using the resolution of Navier-Stokes equations in Eulerian formalism in order to consider the problems linked with the internal flows inside the collectors of Nora cells. (J.S.)

Like, Love, Delete: Social Media's Influence on College Choice

Science.gov (United States)

Turner, Marcia Layton

2017-01-01

Ten years ago, NACAC published a report showing that 61 percent of college admission offices were using social media to recruit prospective students. The authors--and many people in college admission--could see the writing on the wall: Social media was becoming indispensable. One of the study's authors, Nora Ganim Barnes, recently observed,…

Report of the AACRAO Professional Competencies and Proficiencies Working Group

Science.gov (United States)

American Association of Collegiate Registrars and Admissions Officers (AACRAO), 2015

2015-01-01

Interest on the part of the American Association of Collegiate Registrars and Admissions Officers (AACRAO) Board of Directors in the development of a set of descriptions of the core competencies for AACRAO professions goes back several years, with more active discussion beginning in 2011 under the leadership of AACRAO President Nora McLaughlin. At…

Counternarcotic Efforts in the Southern Cone: Argentina

Science.gov (United States)

1990-06-15

Corrientes , and in this case* the source is Brazil. Some marijuana is smuggled from Chile through Mendoza and Neuquen provinces. The transportation method...34 3, States in the early 1960’s promoted as part of the Alliance for Progress program the "antifoco" theory which vms eagerly accepted and incorporated

Ampliación de la distribución de Phrynops hilarii (Pleurodira: Chelidae en Argentina

Directory of Open Access Journals (Sweden)

Derocco, Natacha N.

2005-01-01

Full Text Available Phrynops hilarii presenta una amplia distribución en la región noreste de la República Argentina, en las provincias de Buenos Aires, Chaco, Córdoba, Corrientes, Entre Ríos, Formosa, Misiones, Santa Fe, Santiago del Estero (Cabrera, 1998, incluyendo poblaciones establecidas por antropocoria en Mendoza (Richard, 1999.

Reactions of some potato genotypes to late blight in Cameroon ...

African Journals Online (AJOL)

Reactions of some potato genotypes to late blight in Cameroon. D. K. Njualem, P. Demo, H. A. Mendoza, J. T. Koi, S. F. Nana. Abstract. Field experiments were conducted in Cameroon in 1995 and 1996 to evaluate reactions of different potato genotypes to late blight. There were significant differences among genotypes for ...

Special Workshop of Marie Curie Fellows on Research and Training in Physics and Technology

CERN Multimedia

Patrice Loiez

2002-01-01

Photo 0210006_07a: Prof. L. Maiani, Director General of CERN. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Function of Large-scale Facilities and Centres of Excellence". Photo 0210006_14a: Prof. L. Maiani, Director General of CERN. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Function of Large-scale Facilities and Centres of Excellence". Photo 0210006_22: Dr. David Plane (CERN) introducing Dr. Theodore Papazoglou from the European Commission. Addressing the Marie Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Marie Curie Fellowships in the 6th Framework Programme". Photo 0210006_28a: Dr. Nora Brambilla, Vice-President of Marie Curie Fellow Association, INFN and Dept. of Physics, University of Milan. Addressing the Marie-Curie Worshop held at CERN 3-4 October 2002. Title of this talk:"Marie Curie Fellows Association". Photo 0210006_29a: Dr. Nora Brambilla, Vice-President of Marie Curie Fellow Association, INFN a...

THE INFLUENCE OF GRANDMOTHERS ON BREASTFEEDING OF HER GRANDCHILDREN: BELIEFS AND CULTURAL PRACTICES

Directory of Open Access Journals (Sweden)

Leila Rangel da Silva

2013-09-01

Full Text Available Objetivos: Conhecer as crenças e as práticas das avós com relação ao aleitamento materno; descrever a influência das avós no manejo do aleitamento das suas filhas e/ou noras. Métodos: Estudo descritivo com abordagem qualitativa. O cenário foi o Alojamento Conjunto da Maternidade do Hospital Universitário Gaffrée e Guinle no Rio de Janeiro. Os sujeitos foram 20 avós que visitaram seus netos ou netas no período de internação. Coleta de dados entre os meses de março e maio de 2011. O instrumento foi um questionário preenchido pelas pesquisadoras. Resultados: As avós reconhecem a importância do aleitamento e passa esses valores para suas filhas e noras. Conclusão: As avós são peças fundamentais no apoio a mulher, durante o período de amamentação. Descritores: Aleitamento materno, lactação, cultura, enfermagem.

Avaliação tecnológica de painéis MDF de madeira de Eucalyptus grandis confeccionados em laboratório e em linha de produção industrial

Directory of Open Access Journals (Sweden)

Ugo Leandro Belini

2010-09-01

Full Text Available Chapas MDF de fibras da madeira de Eucalyptus grandis foram confeccionadas em laboratório e em linha de produção industrial e determinadas suas propriedades anatômicas, físicas e mecânicas. O desfibramento da madeira provocou o rompimento transversal da parede das fibras. Os painéis MDF obtidos em linha de produção apresentaram menores valores de inchamento e de absorção e melhores propriedades mecânicas para módulo de ruptura, módulo de elasticidade e resistência à tração superficial. Para os painéis MDF confeccionados em laboratório, verificou-se correlação estatisticamente significativa entre módulo de ruptura e de elasticidade, densidade média e resistência à tração perpendicular e inchamento e absorção. Para os painéis MDF confeccionados em linha de produção industrial, verificaram-se as mesmas tendências, sem significância estatística. A avaliação dos parâmetros de qualidade de painéis MDF de eucalipto confeccionados em laboratório e em linha de produção visa a calibrar as variáveis para a obtenção de chapas MDF em pequena escala e melhorar a precisão das análises de rotina de controle de qualidade bem como nas informações apresentadas em publicações científicas.

PROFUNDIZACIÓN DEL TOPE DE PERMAFROST Y TENDENCIAS EN LA DINÁMICA CRIOGÉNICA, A PARTIR DE 1989, EN EL GLACIAR DE ESCOMBROS COMPUESTO DEL VALLE DE MORENAS COLORADAS, MENDOZA, ARGENTINA.

Directory of Open Access Journals (Sweden)

Darío Trombotto Liaudat

2007-12-01

Full Text Available Los glaciares de escombros (rockglaciers son las geoformas periglaciales con permafrost reptante más típicas e importantes, por su volumen en criosedimentos congelados y hielo, de los Andes Centrales. La presente contribución muestra ejemplos de la marcha de las temperaturas y la profundización del tope de permafrost en dos puntos de monitoreo (Balcón I y II del glaciar de escombros compuesto de Morenas Coloradas, Cordillera Frontal, en la provincia de Mendoza, Argentina. El engrosamiento de la capa activa en la lengua terminal, o límite inferior del creeping permafrost en este valle, de 4,9 m a 7,5 / 7,8 m en los últimos años, así como la tendencia de la dinámica criogénica desde 1992, y la geomorfología (termokarst inactivos en los frentes, expresan el fenómeno de calentamiento que se está detectando también en otros lugares del mundo. Estas variaciones térmicas sugieren cambios en la estructura interna de estas mesoformas. Asimismo, como otra situación geofísica paralela, el cálculo de difusividad térmica en Balcon II ( ̃ = 0.14 × 10-6 m2/s; Trombotto y Borzotta, 2007, a 3770 m de altura, permite correlacionar el bajo valor obtenido con una mejor y más larga conservación del hielo por debajo de los criorregolitos que son en este caso, principalmente, de origen volcánico. Los cambios térmicos detectados en esta zona piloto tendrían una consecuencia directa en el ambiente criogénico local y son un ejemplo para la situación regional del permafrost andino de los glaciares de escombros. Las variaciones descriptas se expresan a través de la profundización del tope de permafrost, formación de termokarst y reactivación de los más antiguos a lo largo del valle, y pérdida de movimiento, o de la criodinámica, en los taludes frontales (“narices” en la parte inferior y de menor altura de las geoformas investigadas. El trabajo promueve también a colocar mayor atención en la posible influencia que pueden tener estos

Kes see möllab köögis? / Kaisa Karu

Index Scriptorium Estoniae

Karu, Kaisa

2009-01-01

Nora Ephroni filmist "Julie ja Julia" (USA 2009), mille stsenaariumi kirjutas ta kokku Julia Childi autobiograafia "My Life in France" ja Julie Powelli blogist raamatuks vormunud teose "Julie & Julia: 365 Days, 524 Recipes, 1 Tiny Apartment Kitchen" põhjal. Julia Childi rollis Meryl Streep. Lisaks Kairit Tsäro kommentaarid "Meryli maagia" ja "Süües saledaks"

Cytogenetics and radiosensitivity for quince tree breeding purpose (Cydonia oblonga Mill.)

International Nuclear Information System (INIS)

Dall'Orto, F.A.C.; Barbosa, W.; Cruz, N.D.; Ferraz, E.S.B.; Menten, J.O.M.; Tulmann Neto, A.; Ando, A.

1984-01-01

Quince cytogenetic aspects were studied to determine the level of ploidy and chromosome number, of Cydonia oblonga Mill. The existence or not of first genetic barriers which would hamper the intercross of the eight studied varieties (Acucar, Champion, Cheldow, Manning, Mato Dentro, Mendoza-INTA 37, Portugal and Smyrna) was done. (M.A.C.) [pt

QT Mobile: compilación cruzada para distintos sistemas operativos móviles

OpenAIRE

PICCININNO, ANDRÉS

2015-01-01

[ES] En este proyecto se ha llevado a cabo el diseño y la implementación del tradicional juego de chapas de fútbol para dispositivos móviles. Es un proyecto orientado a más de un sistema operativo, a múltiples plataformas, y es que es ahí donde reside la dificultad e innovación que este supone. Se ha desarrollado un juego que permite a dos usuarios, a través de un único dispositivo móvil, pasar un buen rato y recordar este antiguo pero entretenido juego. Piccininno, A. (2014...

Algoritmos para problemas de corte e empacotamento

OpenAIRE

Thiago Alves de Queiroz

2010-01-01

Resumo: Problemas de Corte e Empacotamento são, em sua maioria, NP-difíceis e não existem algoritmos exatos de tempo polinomial para tais se for considerado P ¿ NP. Aplicações práticas envolvendo estes problemas incluem a alocação de recursos para computadores; o corte de chapas de ferro, de madeira, de vidro, de alumínio, peças em couro, etc.; a estocagem de objetos; e, o carregamento de objetos dentro de contêineres ou caminhões-baú. Nesta tese investigamos problemas de Corte e Empacotament...

Las memorias del Conde de Robres : la nueva planta y la narrativa de la guerra civil

Directory of Open Access Journals (Sweden)

José María Iñurritegui Rodríguez

2002-01-01

Full Text Available Mediante un completo análisis de la narrativa de la guerra civil, este trabajo propone una revisión de la obra de Alberto López de Mendoza, III Conde de Robres. Ante todo, en las ÍVIemorias para la historia de las guerras de España se descubre un observatorio privilegiado que no sólo permite examinar las diferentes variantes de la narrativa de la guerra civil, sino también esbozar la difícil coexistencia entre la política y la historia en el momento inaugural del Setecientos hispano.Trough a complete analysis of the narrative of the civil war, this article postúlales a revisión of the work of Alberto López de Mendoza, III Conde de Robres. First of all, the Memorias para la historia de las guerras civiles de España is a phviledge scene to examine the various faces of the narrative of the civil war and the difficult coexistence between politic and history in the spanish early eighteenth century.

Learning Networks in Innovation Systems at Sector / Regional Level in Argentina: Winery and Dairy Industries

Directory of Open Access Journals (Sweden)

Guillermo Sanchez

2011-11-01

Full Text Available This work studies how the set of relationships that gives place to the learning processes is established in the food industry in Argentina. A theoretical ad hoc approach is adopted, conjugating the concepts of innovation systems at sector / regional level with some context considerations like the innovative behaviour of the global and local food industry and a description of the public and private S&T in Argentina. The study is focused in two cases: the wine industry, at the Mendoza province, and the dairy products industry at the centre of the Santa Fe province, both in Argentina. While the winery industry at the province of Mendoza exports differentiated products the dairy industry, at the central basin of the province of Santa Fe, exports commodities leaving differentiated (functional products for the domestic market. These facts determine different dynamics between them, despite of what the established set of relationships is very complex and knowledge intensive in both cases. Also, in both cases the preponderant contribution of the public institutions of science and technology as knowledge and technology source is flagged.

Detecting Diabetic Blindness in Low-Income Mexican Adults

Centers for Disease Control (CDC) Podcasts

This podcast features Kenny Mendoza-Herrera, a former graduate student at the National Institute of Public Health of Mexico and one of the winners of PCD's 2017 Student Research Paper Contest. Kenny answers questions about his winning research and what impact his study has on the prevention of diabetic blindness and public health, particularly for Mexican adults.

Education and Knowledge in the Use of Financial Products and Services in Bachelor's Degree Students

Science.gov (United States)

García-Santillán, Arturo; Moreno-García, Elena; Molchanova, Violetta S.

2017-01-01

This study seeks to determine a university student's knowledge and culture in relation to money; the way they plan their budget, their economic independence and consumer habits, the level of debt, and the use of financial services and products. The instrument designed by Aravena-Collao and Mendoza-Letelier (2010) was used for the query among the…

Hacia la creacion de una filosofia latinoamericana. Un ensayo nacionalista: El perfil del hombre y la cultura en Mexico (Toward the Creation of a Latin American Philosophy. An Essay on Nationalism: A Profile of the Mexicans and Their Culture).

Science.gov (United States)

Mendoza, Manuel

An analysis of a Mexican essay by Samuel Ramos attempts to resolve the issue of whether or not there is a common philosophy in Latin America today. Manuel Mendoza concludes that no such philosophy exists, because the area has not had time to develop an internal character, and as a result, the intellectual and and philosophical concepts are based…

Teaching in the Restorative Window: Authenticity, Conviction, and Critical-Restorative Pedagogy in the Work of One Teacher-Leader

Science.gov (United States)

Fine, Sarah M.

2018-01-01

In this article, Sarah M. Fine uses portraiture to explore the undertheorized question of what it means to teach in ways that align with the values of the restorative justice framework. The piece centers around the work of Nora, a veteran teacher-leader who explored this question in the context of her own classroom and, as a result, shifted her…

Uued filmitiigrid oriendist üllatavad vaatajat ootamatu modernismiga / Andres Laasik

Index Scriptorium Estoniae

Laasik, Andres, 1960-2016

2005-01-01

IX Pimedate Ööde Filmifestivali filme Aasiast - "Troopikahaigus" : režissöör Apichatpong Weerasethakul : Tai - Prantsusmaa 2004, "Massöör" : režissöör Brillante Mendoza : Filipiinid 2005, "Päevalill" : režissöör Zhang Yang : Hiina 2005. Lisatud "Euroopasse pürib ka Türgi film" Yesim Ustaoglu filmist "Oodates pilvi"

The wind sea and swell waves climate in the Nordic seas

Science.gov (United States)

Semedo, Alvaro; Vettor, Roberto; Breivik, Øyvind; Sterl, Andreas; Reistad, Magnar; Soares, Carlos Guedes; Lima, Daniela

2015-02-01

A detailed climatology of wind sea and swell waves in the Nordic Seas (North Sea, Norwegian Sea, and Barents Sea), based on the high-resolution reanalysis NORA10, developed by the Norwegian Meteorological Institute, is presented. The higher resolution of the wind forcing fields, and the wave model (10 km in both cases), along with the inclusion of the bottom effect, allowed a better description of the wind sea and swell features, compared to previous global studies. The spatial patterns of the swell-dominated regional wave fields are shown to be different from the open ocean, due to coastal geometry, fetch dimensions, and island sheltering. Nevertheless, swell waves are still more prevalent and carry more energy in the Nordic Seas, with the exception of the North Sea. The influence of the North Atlantic Oscillation on the winter regional wind sea and swell patterns is also presented. The analysis of the decadal trends of wind sea and swell heights during the NORA10 period (1958-2001) shows that the long-term trends of the total significant wave height (SWH) in the Nordic Seas are mostly due to swell and to the wave propagation effect.

Anthropometrics applied to the agricultural tractors operators

OpenAIRE

Schlosser, José Fernando; Debiasi, Henrique; Parcianello, Geovano; Rambo, Lisandro

2002-01-01

O objetivo deste trabalho foi determinar o padrão antropométrico dos operadores de tratores agrícolas da Depressão Central do Rio Grande do Sul. Os operadores de tratores agrícolas foram medidos por meio de um painel constituído por duas chapas metálicas, permanecendo durante as medições em pé, eretos, com o mínimo de roupa possível e em contato com o painel. As variáveis medidas foram as seguintes: altura do corpo; altura ao nível dos olhos; altura ao nível dos olhos sentado; altura do cotov...

Efeito do ácido fórmico na eletrodeposição de ligas Zn-Ni em substrato de aço

OpenAIRE

Pedroza, Graziella Aguiar Gomes

2013-01-01

A utilização dos depósitos de Zn-Ni eletrodepositados para melhorar a resistência à corrosão de chapas de aço revestidas tem atraído um interesse crescente porque oferece uma alternativa particularmente promissora para o Zn puro, devido às suas melhores propriedades mecânicas e de resistência à corrosão. Portanto, os estudos sobre os fatores que aumentam a eficiência de deposição e resistência à corrosão de eletrodepósitos das ligas Zn-Ni são altamente relevantes. Este trabalho descreve uma i...

Diagnóstico de la situación actual de la mecánica automotriz en el sector de la chapistería en la ciudad de Azogues y elaboración de una propuesta técnica del pintado de automóviles utilizando nuevas tecnologías con el menor impacto ambiental

OpenAIRE

Cárdenas Sánchez, Andrés Eduardo; Tapia Quinteros, Fausto Daniel

2011-01-01

Observando el servicio de chapa y pintura que se oferta en la ciudad de Azogues se pudo notar la deficiencia técnica que tiene este sector de la Mecánica Automotriz, por lo que la presente tesis se enfoca hacia el diagnóstico de la Mecánica Automotriz en lo referente a chapistería para conocer exacta mente cual es la situación actual de la misma y poder implementar procesos técnicos para el desarrollo de esta actividad. El análisis también se enfoca al cuidado y protección del medio ambien...

Diseño, cálculo y comprobación de unión soldada en viga de puente grúa de alma doble

OpenAIRE

Fraile Griborio, Francisco J.

2011-01-01

El trabajo se basa en el diseño y la comprobación de las uniones soldadas en una viga con alma doble que servirá como Puente Grúa. Partiendo de un ejemplo particular de una viga con alma doble (definido por la longitud, la carga máxima y las características químicas y mecánicas de las chapas metálicas) se ha realizado el pre‐dimensionado de la estructura utilizando un programa de cálculo (SAP2000). Los resultados se han comprobado mediante un modelo teórico de cálculo para vigas con alma dobl...

Emplacement of the La Peña alkaline igneous complex, Mendoza, Argentina (33° S): Implications for the early Miocene tectonic regime in the retroarc of the Andes

Science.gov (United States)

Pagano, D. S.; Galliski, M. A.; Márquez-Zavalía, M. F.

2014-03-01

The La Peña alkaline complex (LPC) of Miocene age (18-19 Ma) lies on the eastern front of the Precordillera (32°41ʹ34ʺS, 68°59ʹ48″W, 1400-2900 m a.s.l.), 30 km northwest of Mendoza city, Argentina. It is a subcircular massif of 19 km2 and 5 km in diameter, intruded in the metasedimentary sequence of the Villavicencio Formation of Silurian-Devonian age. It is the result of integration of multiple pulses derived from one or more deep magma chambers, which form a suite of silicate rocks grouped into: a clinopyroxenite body, a central syenite facies with a large breccia zone at the contact with the clinopyroxenite, bodies of malignite, trachyte and syenite porphyry necks, and a system of radial and annular dikes of different compositions. Its subcircular geometry and dike system distribution are frequent features of intraplate plutons or plutons emplaced in post-orogenic settings. These morphostructural features characterize numerous alkaline complexes worldwide and denote the importance of magmatic pressures that cause doming with radial and annular fracturing, in a brittle country rock. However, in the LPC, the attitude of the internal fabric of plutonic and subvolcanic units and the preferential layout of dikes match the NW-SE extensional fractures widely distributed in the host rock. This feature indicates a strong tectonic control linked to the structure that facilitate space for emplacement, corresponding to the brittle shear zone parallel to the N-S stratigraphy of the country rock. Shearing produced a system of discontinuities, with a K fractal fracture pattern, given by the combination of Riedel (R), anti-Riedel (R‧), (P) and extensional (T) fracture systems, responsible for the control of melt migration by the opening of various fracture branches, but particularly through the NW-SE (T) fractures. Five different pulses would have ascent, (1) an initial one from which cumulate clinopyroxenite was formed, (2) a phase of mafic composition represented by

O Beethoven de DeNora: o contexto está no texto DeNora's Beethoven: the context is in the text

Directory of Open Access Journals (Sweden)

Marcos Câmara de Castro

2012-12-01

Full Text Available Estudo sobre a repercussão do livro de DENORA (1995, e discussão sobre os conceitos que vêm à tona, a partir de uma abordagem sociológica do fenômeno do "gênio criador"; do surgimento do conceito de "música séria"¹ em oposição ao entretenimento; das estratégias de ocupação de um determinado campo cultural e suas aplicações em novos contextos. Todos os fatores que elegeram Beethoven são inoperantes num mundo em que novas regras se impõem na produção artística, tanto quanto na produção de mercadorias em geral: essa a principal contribuição do livro, que passou despercebida pela maioria das resenhas publicadas à época de sua publicação. Os esquissos do projeto da música dita "séria" são facilmente detectáveis na obra de Beethoven, em que sua busca de profundidade, em oposição à música leve, atinge novos patamares pari passu com sua posição social como compositor.Study on the impact of the DENORA's book (1995 and discussion of the concepts that come to light, from a sociological approach to the phenomenon of "creative genius"; the emergence of the concept of "serious music" as opposed to entertainment; strategies of occupation of a particular cultural field and its applications in new contexts. All factors that elected Beethoven are inoperative in a world where new rules are imposed on artistic production, as much as on the production of goods in general: this is the main contribution of this book, which remained unnoticed by most of the reviews published at the time of his publication. The sketches of the music project called "serious" are easily detectable in the work of Beethoven, and in his quest for depth, as opposed to pleasingness as a value, reaches new heights pari passu with his social position as a composer.

Additional considerations to the model of musical empathic engagement: Empathy facets, preferences, and openness. Comment on "Music, empathy, and cultural understanding" by E. Clarke et al.

Science.gov (United States)

Greenberg, David M.

2015-12-01

Recent research has shown that empathy plays an important role in musical experience including perception, preference, and performance [9,11,13,16,17]. Clarke, DeNora, and Vuoskoski's [4] timely review extends this work by establishing a framework for how ;music empathic engagement; can facilitate cultural understanding. In this commentary I raise attention to some additional factors that may be at play in their model.

Detection of Ichthyophonus by chromogenic in situ hybridization

Science.gov (United States)

Conway, Carla M.; Purcell, Maureen K.; Elliott, Diane G.; Hershberger, Paul K.

2015-01-01

Ichthyophonus hoferi (Plehn & Mulsow 1911) is a protistan parasite in the class Mesomycetozoea that infects a large range of marine and freshwater fish (Mendoza, Taylor & Ajello 2002; McVicar 2011). The broad host and geographic range, which includes both fresh and marine waters of the Northern and Southern Hemispheres, combined with a lack of distinguishing morphological characteristics, have prompted speculation that Ichthyophonus-like organisms in multiple species of fish, as well as reptiles, amphibians, birds and invertebrates, may have been incorrectly classified under a single type species I. hoferi (McVicar 2011). At present, only two species,I. hoferi and I. irregularis, are currently recognized within the genus (Rand et al. 2000; Mendoza et al. 2002). Investigations of ribosomal DNA sequence variation have begun to clarify relationships among Ichthyophonus types (Criscione et al. 2002; Rasmussen et al. 2010). Here, we will use the term Ichthyophonus to broadly represent all members of the genus regardless of species/subspecies.

Novelas

OpenAIRE

Lannutti, Fabio J.

2014-01-01

Fabio Lannutti (escritor argentino) obtuvo, con su novela inédita La ropa del muerto, el premio Medellín Negro 2014. El libro fue publicado por Planeta, en Medellín, en agosto de 2014. El jurado estaba integrado por Elmer Mendoza, Amir Valle y Néstor Ponce. En esta nota, Fabio Lanutti nos relata el origen de su novela y la “cocina literaria”.

The elasticity of Substitution in demand for Non tradable Goods in Latin America. Case Study: Argentina

OpenAIRE

Pablo Andres Neumeyer; Martín Gonzalez Rozada

2003-01-01

This objective of this paper is to estimate the elasticity of substitution in the demand for non-tradable goods relative to tradable goods in Argentina. This parameter plays a crucial role in the analysis of the macroeconomic equilibrium of a small open economy (Mendoza, Galindo and Izquierdo (2003)). Using two data sets we found estimates for this elasticity of, approximately, 0.40 and 0.48.

Origanum essential oil : a potential food additive

OpenAIRE

Amadio, Claudia; Medina, Rosa; Dediol, Cora; Zimmermann, Mónica; Miralles, Susana

2011-01-01

Se trabajó con aceite esencial obtenido por arrastre por vapor de Origanum x applii (criollo) y Origanum x majoricum (mendocino), cultivados en La Consulta, Mendoza, Argentina. Para evaluar su poder antioxidante y conservante en alimentos se determinó: rendimiento, polifenoles totales, cuantificación de timol y carvacrol mediante cromatografía en capa fina de alta resolución (HPTLC) y capacidad de secues...

Procesamiento de señales radioastronómicas; implementación para la antena de espacio profundo DSA 3 de la Agencia Espacial Europea.

Science.gov (United States)

Cancio, A.; Colazo, M.; García, B.

2017-10-01

In December 2012, the European Space Agency opened its third Deep Space Station in Malargüe, province of Mendoza, Argentina. Due to the nature of its operations, the antenna has requirements for the stability of reference signals and low phase noise equipment that makes it a candidate for use in radio astronomy applications. The present work evaluates the first experience of observation of astronomical sources.

Les deux journaux de José Santos Vargas (1814-1825. 1: Problèmes d'édition

Directory of Open Access Journals (Sweden)

1995-01-01

Full Text Available La découverte du journal de guerre tenu par le guérillero José Santos Vargas a renouvelé nos connaissances sur l’histoire de la guerre d’indépendance dans le Haut Pérou. Cependant, le fait qu’il existe deux manuscrits différents de ce document, publiés tous deux par les soins de don Gunnar Mendoza, l’un en 1952 en Bolivie, l’autre en 1982 au Mexique, pose aux historiens des problèmes que les choix effectués par l’éditeur ont obscurcis. Cette première livraison d’un article qui devrait en comprendre deux remet en question la valeur scientifique de l’édition de 1982. LOS DOS DIARIOS DE JOSÉ SANTOS VARGAS. 1: PROBLEMAS EDITORIALES. El descubrimiento del diario de guerra redactado por el guerrillero José Santos Vargas ha renovado el conocimiento de la guerra de independencia en el Alto Perú. Pero el hecho de que existen dos manuscritos distintos de este documento, ambos publicados por don Gunnar Mendoza, uno en Bolivia en 1952 y otro en México en 1982, plantea a los historiadores problemas que las decisiones del editor han obscurecido. Esta primera entrega de un artículo que constará de dos, pone en tela de juicio el valor científico de la edición de 1982. THE TWO DIARIES OF JOSÉ SANTOS VARGAS. 1: PROBLEMS OF EDITION. The discovery of the diary of the guerillero leader José Santos Vargas add to our knowledge of the history of the independence war in the Alto Peru. However, the existence of two different manuscripts, both published by don Gunnar Mendoza, the first in Bolivia, 1952, the second in Mexico, 1982, present historians with problems that have been obscured by the editor’s choices. In this first part of the two parts article, we question the scientific value of the edition of 1982.

Description of the immature stages of Sigara (Tropocorixa jensenhaarupi (Hemiptera: Heteroptera: Corixidae: Corixini, with ecological notes Descripción de los estadios larvales de Sigara (Tropocorixa jensenhaarupi (Heteroptera: Corixidae, con notas acerca de su ecología

Directory of Open Access Journals (Sweden)

María Cecilia Melo

2011-03-01

Full Text Available Sigara (Tropocorixa jensenhaarupi Jaczewski is the smallest species of the subgenus ranging from 4.2-4.7 mm, and it is characterized by the absence of a strigil, the small and narrow genital capsule with a short hypandrium in males, and the shape of the abdominal tergite VII in females. This species is endemic to the Patagonian subregion (Andean region in Argentina. A monthly sampling study was performed during a year in northern Mendoza, and additional material was collected in southern Mendoza, more precisely from Bañado Carilauquen in the Llancanelo Lake Reserve (Malargüe Department. Since little is known about the ecological requirements of S. (T. jensenhaarupi, herein we describe its habitat, the environmental conditions and its association with other macroinvertebrates. Also, we provide a morphological description of larval stages, and provide new records of this species.Sigara (Tropocorixa jensenhaarupi Jaczewski es la especie más pequeña del subgénero (4.2-4.7 mm, y se caracteriza por la ausencia de estrigilo, la cápsula genital masculina pequeña y angosta con el hipandro corto, y la forma característica del tergito abdominal VII en las hembras. Esta especie es endémica de la subregión Patagónica (región Andina en Argentina. Se realizaron muestreos mensuales durante un año en el norte de la provincia de Mendoza, material adicional fue recolectado en el sur de la provincia, más precisamente en el Bañado Carilauquen en la Reserva Laguna Llancanelo (Departamento de Malargüe. Poco se conoce acerca de los requerimientos ecológicos de S. (T. jensenhaarupi, por lo que en este trabajo describimos su hábitat, las condiciones ambientales y su asociación con otros macroinvertebrados. Además, describimos los estadios larvales y damos nuevos registros de esta especie.

Nación, Provincia, Indígenas: Poéticas y políticas de la interculturalidad Nation, Province, Indigenous people: intercultural poetics and policies

Directory of Open Access Journals (Sweden)

Leticia Katzer

2010-12-01

Full Text Available A través de una revisión crítica de documentación administrativa, censos, historiografías y monografías etnográficas, el objetivo general de este artículo es indagar y analizar comparativamente las condiciones y parámetros epistemológicos y jurídico-administrativos a través de los cuales la interculturalidad ha sido reconocida y conceptualizada a nivel nacional/provincial según coyunturas críticas: aquella que marcó el proceso de modernización de la "Nación", en la que la identidad y modo de producción histórica de Mendoza, se definieron por oposición y exclusión a la tradición cultural indígena local; y aquella que marca la reforma constitucional de 1994, en la que la filiación cultural es anexada a los sistemas de clasificación social y de gobernabilidad. Se trata de explicitar entonces las categorías, intereses y saberes que guían las políticas interculturales, recuperándolos como componentes constitutivos de un proceso histórico.Through a critical review of administrative documentation, censuses, historiographies and ethnographic monographs, the general objective of this article is to investigate and to analyze comparatively the epistemologicals and juridical - administrative conditions and parameters through which the interculturality has been recognized and conceptualized at national / provincial level according to critical historicals moments: the one that marked the process of modernization of the "Nation", where Mendoza`s identity and historical production, they were defined by opposition and exclusion from local indigenous tradition cultural; and the one that was marked by 1994 constitutional reformation, in which cultural filiation is annexed to the systems of social classification and of gobernability. We aim to make categories, interests and knowledge that guide the intercultural policies explicit, recovering them as constitutive components of a historical process.

Miss Willie and Nora Bonesteel: Teaching in Cyberspace.

Science.gov (United States)

Atwell, Nedra Wheeler

Two of the author's favorite Appalachian women serve as thought mentors to help see the practical and educational opportunities available in cyberspace for meeting the critical shortage of teachers serving the Appalachian women and children of today. In classrooms and homes throughout Appalachia, women and children are logging on to computers to…

Impacts of the MERCOSUR Agreement on the Uruguayan Economy

Science.gov (United States)

1994-06-01

Carlos, Comercio con Argentina y Brasil: Uno o Dos Patrones de Insercion Regional? Sextas Jornadas Anuales de Economia , Banco Central del Uruguay...lornadas Anuales de Economia , BCU, Montevideo. 1990. "Rolds, Jorge, MERCOSUR, Pohtica Comercial Optima?, Boletin Ceres •(), Montevideo. 1991. 4" Also...34 Quintas Jornadas Anuales de Economia , BCU, 1990. Berreta, Nora and Paolino, Carlos, "Comercio con Argentina y Brasil: uno o dos patrones de inserci6n

El paisaje urbano de la Ciudad de León

Directory of Open Access Journals (Sweden)

Eduardo Rodríguez Vásquez

2004-02-01

Full Text Available Cuando se aborda el tema del paisaje, es fácil asociarlo al que nos ofrece la naturaleza de los ríos, lagos, montañas, fauna y nora; sin embargo, actualmente el término paisaje abarca también al medio construido por el hombre, en forma de espacios urbanos de distintos tamaños, llámese pueblo, barrio, reparto, villa, parque, ciudad, etc.

Development of Personalized Cancer Therapy for Men with Advanced Prostate Cancer

Science.gov (United States)

2017-10-01

AWARD NUMBERS: W81XWH-14-1-0554 TITLE: Development of Personalized Cancer Therapy for Men with Advanced Prostate Cancer PRINCIPAL INVESTIGATOR...Dr. Nora M. Navone CONTRACTING ORGANIZATION: The University of Texas MD Anderson Cancer Center 1515 Holcombe Blvd. Houston, TX 77030-4009...COVERED 09/22/2016-09/21/2017 4. TITLE AND SUBTITLE 5a. CONTRACT NUMBER N/A Development of Personalized Cancer Therapy for Men with Advanced

A psychopharmacological aspects of human emotional memory for emotional material.

OpenAIRE

Brignell, C. M.

2004-01-01

It is often assumed that emotional events are remembered in great clarity and detail. This thesis begins with a review of the literature on memory enhancement by emotional material. This enhancement may involve mechanisms that are psychologically and neurobiologically distinct from the mechanisms usually employed in memory for neutral material, such as modulation of consolidation by emotional arousal via noradrenaline action in the amygdala. Theoretically, pharmacological manipulation of nora...

Aproximación matemática al proceso de galvanorrecocido en productos siderúrgicos planos

Directory of Open Access Journals (Sweden)

Pérez, A.

1998-05-01

Full Text Available A short review of the kinetics models for the formation of Fe-Zn alloy phases in the galvannealing process is presented. It will focus on the continuous process which is often used by the automotive industry. A first mathematical approach of the kinetics growth of the δ phase has been done, using a continuous hot-diping process simulator which resembles the conditions of the galvannealing process in production lines. Hold time and the galvannealing temperature as well as the weight of the coating were varied. The preliminary results of the iron content and proportion of δ phase in the coating are in agreement with the results obtained by other authors.

Se revisan brevemente los modelos cinéticos descritos para la formación de las fases de aleación Zn-Fe durante el proceso de galvanorrecocido de chapa, con especial énfasis en el proceso continuo, con destino a la industria del automóvil. Se ha realizado una primera aproximación matemática al crecimiento cinético de la fase delta utilizando un simulador de recubrimiento en continuo por inmersión en caliente produciéndose el galvanorrecocido por calentamiento de la chapa galvanizada exactamente después de su salida del baño de zinc con objeto de aproximarse a las condiciones reales imperantes en las líneas de producción. Los parámetro variables han sido: el tiempo y la temperatura de galvanorrecocido y el peso de recubrimiento. Los resultados iniciales del contenido de hierro del recubrimiento y de contenido de fase delta están de acuerdo con los resultados obtenidos por otros autores.

The first Triassic dipteran (Insecta) from South America, with review of Hennigmatidae.

Science.gov (United States)

Lara, María Belén; Lukashevich, Elena D

2013-01-01

The first Triassic dipteran from South America is described based on an isolated wing from the lower Upper Triassic deposits of Argentina (Mendoza Province, Potrerillos Formation, Quebrada del Durazno locality). Trihennigma zavattierii gen. et sp. nov. is a member of the Mesozoic family Hennigmatidae, previously recorded only from Eurasia. A key for the genera and species of Hennigmatidae is provided and systematic position of the taxa is discussed.

Context Evaluation of Historical Sites in the Prado Basin

Science.gov (United States)

1990-01-29

Mendoza (452) Vega (455) Garcia (458) Morales (459) Padiga (460) Aguilar (461) Montes (461) Morales (462) Aquque [3] (468) Serana (477) Guerrero (479...Maine Lopera, Emilio " Schoolmaster Chile Velardez, Francisco 489 Hatter Mexico Macy, Oben 517 Physician No. Carolina Total number: 13 already well...Jose Innocenta 3 Calif. Rafael 18 -- laborer Calif. Miguel 14 Calif. Pedro 12 Calif. Refugia 9 Calif. Mariano 25 -- laborer Calif. Vittoriano Vega 40

Once Upon a Time There Was an Indian

Directory of Open Access Journals (Sweden)

Arij Ouweneel

2015-04-01

Full Text Available Alas de maguey. La lucha de Eufrosina Cruz Mendoza, by Marta Gómez-Rodulfo, with a preface by Elena Poniatowska, 2012.Embers of the Past. Essays in Times of Decolonization, by Javier Sanjinés C., with a foreword by Walter D. Mignolo; translated by David Frye, 2013.The Village Is Like a Wheel: Rethinking Cargos, Family and Ethnicity in Highland Mexico, by Roger Magazine, 2012.

“I am active”: effects of a program to promote active aging

OpenAIRE

Mendoza-Ruvalcaba NM; Arias-Merino ED

2015-01-01

Neyda Ma Mendoza-Ruvalcaba,1 Elva Dolores Arias-Merino2 1Health Sciences Department, University of Guadalajara, University Center of Tonala Guadalajara, Jalisco, Mexico; 2Public Health Department, University of Guadalajara, University Center of Health Sciences, Guadalajara, Jalisco, Mexico Background: Active aging involves a general lifestyle strategy that allows preservation of both physical and mental health during the aging process. “I am Active” is a program designed...

On the Mechanism of Berberine-INF55 (5-Nitro-2-phenylindole) Hybrid Antibacterials.

Science.gov (United States)

Dolla, Naveen K; Chen, Chao; Larkins-Ford, Jonah; Rajamuthiah, Rajmohan; Jagadeesan, Sakthimala; Conery, Annie L; Ausubel, Frederick M; Mylonakis, Eleftherios; Bremner, John B; Lewis, Kim; Kelso, Michael J

Berberine-INF55 hybrids are a promising class of antibacterials that combine berberine and the NorA multidrug resistance pump inhibitor INF55 (5-nitro-2-phenylindole) together in one molecule via a chemically stable linkage. Previous studies demonstrated the potential of these compounds for countering efflux-mediated antibacterial drug resistance but they didn't establish whether the compounds function as originally intended, i.e. with the berberine moiety providing antibacterial activity and the attached INF55 component independently blocking multidrug resistance pumps, thereby enhancing the activity of berberine by reducing its efflux. We hypothesised that if the proposed mechanism is correct, then hybrids carrying more potent INF55 pump inhibitor structures should show enhanced antibacterial effects relative to those bearing weaker inhibitors. Two INF55 analogues showing graded reductions in NorA inhibitory activity compared with INF55 were identified and their corresponding berberine-INF55 hybrids carrying equivalent INF55 inhibitor structures synthesised. Multiple assays comparing the antibacterial effects of the hybrids and their corresponding berberine-INF55 analogue combinations showed that the three hybrids all show very similar activities, leading us to conclude that the antibacterial mechanism(s) of berberine-INF55 hybrids is different from berberine-INF55 combinations.

Assessment of industrial wastes in mortar layers deposited on stainless steel sheets of sinks Avaliação de resíduos industriais em camadas de argamassas depositadas sobre chapas de aço inoxidável de pias

Directory of Open Access Journals (Sweden)

E. Gemelli

2004-12-01

Full Text Available This work deals with the properties of alternative mortars destined to strengthen metal sheets of sinks. The performance of these mortars was compared to that of a basic mortar made of cement, sand, and water, named standard mortar (SM. One of these mortars, named alternative mortar 2 (AM2, and composed of cement, textile residue, polyurethane, polypropylene fibers and water, was developed recently to replace the current one, named alternative mortar 1 (AM1, composed of cement, sand, polystyrene, polypropylene fibers and water. These mortars were manufactured and aged in a room in atmospheric environment for 7, 14, 28, 60 and 90 days, either with or without initial drying in a furnace. After cure of 90 days the flexion strength stress of the SM, AM1 and AM2 mortars was 5.21, 3.84, and 1.42 MPa, respectively. The SM and AM1 mortars were constituted of C-S-H phases, Ca(OH2, SiO2, AFm and AFt (monossulphate/ettringite phases. The AM2 mortar presented, apart from the compounds mentioned above, CaCO3. This compound is from the textile residue that is composed essentially of CaCO3 and Ca(OH2. The reduction in flexion strength of AM1 mortar, compared to SM mortar, is caused by the polystyrene whereas the lowering mechanical strength of the AM2 is due to both polyurethane and textile residue. Even so, its mechanical strength is acceptable because the flexion strength stress required for the industrial application is 1.0 MPa.O objetivo desse trabalho foi estudar as propriedades de argamassas alternativas usadas para reforço de chapas metálicas de pias de cozinha. O desempenho dessas argamassas foi comparado com aquele de uma argamassa básica feita de cimento, areia e água, denominada argamassa padrão (SM. Uma dessas argamassas, denominada argamassa alternativa 2 (AM2, composta de cimento, resíduo, poliuretano, fibras de polipropileno e água, foi desenvolvida recentemente para substituir a atual, chamada argamassa alternativa 1 (AM1, composta de

Evaluation of fuel rod damage in LWR under accident conditions using SSYST

International Nuclear Information System (INIS)

Meyder, R.

1982-01-01

After a short outline of the recent SSYST-development, the creep rupture model NORA 2 is presented. The effect of temperature and oxygen on Zircaloy 4 creep behaviour is shown. Examples on the effect of azimuthal varying gap width and wall thickness are given. Remarks on the extension of a single rod analysis on a bundle and the stepwise application of SSYST for investigation of fuel rod failure conclude the paper. (orig.) [de

The Role of Angiopoietin-like 4 in Lipid Homeostasis

OpenAIRE

Gray, Nora

2012-01-01

AbstractThe Role of Angiopoietin-like 4 in Lipid HomeostasisbyNora Elizabeth Forbes GrayDoctor of Philosophy in Molecular and Biochemical NutritionUniversity of California, BerkeleyProfessor Jen-Chywan Wang, ChairAlterations in the regulation of lipid homeostasis are major causes of metabolic diseases like obesity, insulin resistance and the metabolic syndrome. These diseases affect millions of people and therefore constitute a pressing public health concern. The mobilization of lipids is a k...

Investigating the Correlation between Food Prices and University Students Awareness of the Effects of Fast Food Consumption on their Health

OpenAIRE

Al-Aklabi, Nouf; Al-Dowsari, Wejdan; Andrioti, Despena

2016-01-01

Background: The price of a given food product is an indicative measure of its nutritious value. Forthis reason, people belonging to low-income groups are specifically vulnerable to malnutrition. Thisstudy aims to identify nutritional patterns among students at the Princess Nora University, Riyadh,Saudi Arabia, quantify students’ level of awareness of health risks associated with fast food consumption,examine how price affects their choice of food, and provide general guidelines for improving ...

Knowledge of Saudi female university students regarding cervical cancer and acceptance of the human papilloma virus vaccine

OpenAIRE

Al-Shaikh, Ghadeer K.; Almussaed, Eman M.; Fayed, Amel A.; Khan, Farida H.; Syed, Sadiqa B.; Al-Tamimi, Tahani N.; Elmorshedy, Hala N.

2014-01-01

Objectives: To assess the level of knowledge regarding cervical cancer and the acceptance of the human papilloma virus (HPV) vaccine among Saudi female students in health colleges. Methods: This cross-sectional study of a convenient sample encompassed 1400 students in Health Colleges at Princess Nora Bint Abdul Rahman University, Riyadh, Saudi Arabia was conducted between December 2013 and February 2014. A self-administrated questionnaire was distributed to all participants. Data collected in...

The Next Supreme Leader: Succession in the Islamic Republic Of Iran

Science.gov (United States)

2011-01-01

E. Thaler, Nora Bensahel, Kim Cragin, Jerrold D. Green, Dalia Dassa Kaye, Nadia Oweidat, and Jennifer Li , Dangerous But Not Omnipotent: Exploring...Janeshin Namayand e Vali e Faghih dar Sepah, ya Sokhanguy e Hezb e Siyasi Neza- mian ? [The Deputy Representative of the Supreme Leader in the Guards...Dassa Kaye, Nadia Oweidat, and Jennifer Li , Dangerous But Not Omnipotent: Exploring the Reach and Limitations of Iranian Power in the Middle East, Santa

Palmse viinaköögi manifest

Index Scriptorium Estoniae

1996-01-01

Manifest. Tõlkijate seminari puhul 17. mail 1996 Palmse viinaköögis Juta Bedia, Eric Dickens, Gyözö Fehérvári, Guntars Godinsh, Maima Grinberga, Irja Grönholm, Leif Hannibal, Cornelius Hasselblatt, Pirkko Huurto, Ivo Iliste, Nora Javorskaja, Gisbert Jänicke, Kaisu Lahikainen, Enel Melberg, Vera Ruber, Arnold Tamm, Leili Tamm, Jonatan Tomesh, Lilia Velic'kova, Marianne Vogel. Inglise k.: Estonian Literary Magazine, autumn 1996, nr. 3

La educación agrícola en la economía regional: El aporte de la Escuela Nacional de Vitivinicultura a la consolidación de la industria vitivinícola argentina (1900-1920

Directory of Open Access Journals (Sweden)

Florencia Rodríguez Vázquez

2011-12-01

Full Text Available La generación y difusión de conocimientos técnicos útiles a las economías regionales de base agroindustrial sólo en los últimos años ha sido abordada por la historiografía argentina. En particular, en el presente artículo ofreceremos un panorama de los proyectos políticos educativos de orientación productiva generados en Mendoza y San Juan a partir de su inserción en una economía vitivinícola moderna, de base capitalista, y los resultados de estos proyectos. Para esto último, nos detendremos en la reconstrucción de las trayectorias profesionales de algunos enólogos y agrónomos graduados de estos establecimientos.The generation and difussion of technical knowledge useful to the agroindustrial regional economies only in recent years has been studied by historiography in Argentina. In particular, this article offers an overview of the political projects, with a productive educational profile, generated in Mendoza and San Juan from its insertion into a modern wine economy of capitalist basis, and the results of these projects. For this, we stop at the reconstruction of the careers of some winemakers and agronomists graduates of these establishments.

Fundamentos y modalidades de la tutoría en educación superior / Fundamentos e modalidades da tutoria em educação superior

Directory of Open Access Journals (Sweden)

Ida Lucía Morchio

2009-01-01

Full Text Available La Tutoría en Educación Superior constituye una vía para contribuir al logro de la calidad educativa en términos de aprendizaje efectivo y promoción del desarrollo personal de los estudiantes. En el presente trabajo se recupera su etimología, se propone una conceptualización, se analizan sus bases teóricas desde la perspectiva de la Orientación Educativa y de la Psicología de la Educación y se describen algunas modalidades de implementación. Como cierre se comparten experiencias realizadas en la Facultad de Filosofía y Letras de la UNCuyo (Mendoza, Argentina.A tutoria em Educação Superior constitui uma via para atingir a qualidade educativa em termos de aprendizado efetivo e promoção do desenvolvimento pessoal dos estudantes. No presente trabalho recupera-se sua etimologia, propõe-se uma conceitualização, analisam-se suas bases teóricas desde a perspectiva da Orientação Educativa e da psicologia da Educação e se descrevem algumas modalidades de implementação. No final, partilham-se experiências realizadas na Faculdade de Filosofia e Letras da Universidade Nacional de Cuyo (UNCuyo, Mendoza, Argentina.

Evidence of Rickettsial and Leptospira Infections in Andean Northern Peru

Science.gov (United States)

2004-01-01

about health in six Latin American countries, 1973- 1992. Rev Panam Salud Publica 1: 23–34. 3. Cowan G, 2000. Rickettsial diseases: the typhus group of...Leonardo Mendoza Instituto Nacional de Salud , Capac Yupanqui No. 1400, Jesús Maria, Lima 11, Peru, Telephone: 51-1-471-9920. Allen L. Richards, Viral and...Colli C, 1997. Leptospira interrogans in a canine population of greater Bue- nos Aires: variables associated with seropositivity. Rev Panam Salud

Revelando el origen de la variedad de vid ‘Bonarda’ cultivada en Argentina a través del empleo de marcadores moleculares microsatélites

OpenAIRE

De Rosas, María Inés; Martínez, Liliana

2009-01-01

‘Bonarda’ es una variedad de vid que en Argentina se cultiva principalmente en las provincias de Mendoza y San Juan, representa el segundo cepaje tinto en superficie nacional cultivada y es considerada con gran potencial para la elaboración de vinos tintos de alta calidad. Existe incertidumbre respecto a su origen en el país. La descripción ampelográfica de la ‘Bonarda’ cultivada en Argentina remarca gra...

Effectiveness of the Vital Aging program to promote active aging in Mexican older adults

OpenAIRE

Mendoza-Ruvalcaba, Neyda Ma; Fern?ndez-Ballesteros, Roc?o

2016-01-01

Neyda Ma Mendoza-Ruvalcaba,1 Rocío Fernández-Ballesteros2 1Health Sciences Department, University of Guadalajara, University Center of Tonalá, Tonalá, Jalisco, Mexico; 2Department of Biological and Health Psychology, Autonomous University of Madrid, Madrid, Spain Introduction: Aging is not only a population phenomenon but also an experience and an individual reality. Vital Aging® is a program that considers active aging as the lifelong ada...

Introducción a la aparatología ortodóncica de autoligado : baja fricción

OpenAIRE

Grynberg, Eduardo; Pastor, Laura; Lopez, Marcela; Villafañe, Deborah; Iranzo, Andrea; Blas, Fernanda; Calatayud, Laura

2015-01-01

Los bracket de autoligado son presentados al ámbito de la ortodoncia, como un sistema de alta eficiencia, al servicio de la baja fricción. 13 casos fueron tratados durante el ciclo de cursos de ortodoncia, dictados por el Dr. Edgardo Grynberg, en la Facultad de Odontología de la Universidad de Cuyo, Mendoza, con aparatologia de autoligado en combinación con arcos superelasticos, en los cuales se aprecio una importante dismi...

Representaciones sociales de la computadora en usuarios semirrurales de México (Social Representations of Semirural Computer Users of Mexico (Les représentations sociales de l′ordinateur chez les usagers semi-ruraux au Méxique (Representações sociais do computador em usuários semirrurais do México

Directory of Open Access Journals (Sweden)

Marco Antoniog González-Pérez

2012-12-01

Full Text Available ResumenEste artículo de investigación se deriva de un estudio de campo realizado para identificar representaciones sociales (RS de la computadora en usuarios de los Centros Comunitarios de Aprendizaje del Instituto Tecnológico y de Estudios Superiores de Monterrey, ITESM. Se aplicaron dos instrumentos: prueba de aso- ciación libre y guion de entrevista a muestras de 217 sujetos, en la primera condición y 31, en la segunda. El estudio se realizó en Chapa de Mota y Villas del Car- bón, Estado de México. Se mostraron representacio- nes sociales, RS, cambiantes entre usuarios con base en edad y tiempo de uso y se observó cómo los miem- bros de la comunidad insertan la computadora en sus actividades cotidianas.AbstractThis research article is derived from a field study conducted to identify social representations (SR of the computer users of Community Learning Centers at ITESM. The instruments used were: free association test and interview script to samples of 217 subjects in the first condition and 31 in the sec- ond one. The study was conducted in Chapa de Mota and Villas del Carbón, Estado de México. SR were chang- ing between users based on age and length of use and showed how com- munity members used the computer in their daily activities.RésuméCet article de recherche découle d'une étude dans le terrain réalisée pour identifier les représentations sociales (RS de l’ordinateur chez les usagers des Centres Communautaires d’ap- prentissage dans le Tecnológico de Monterrey (Technologique de Mon- terrey. On a appliqué deux outils: la preuve d’association libre à 217 per- sonnes et le scenario d’entretien à 31 personnes. Les résultats ont montrés des représentations sociales chan- geantes en fonction de l’âge et le temps d’usage et on a observé com- ment les membres de la communauté utilisent l’ordinateur dans leurs activi- tés au quotidien.ResumoEste artigo se deriva de uma pesqui- sa de campo realizada

Measuring turbidity, and indicator to evaluate drinkability of waters in Southern countries? Approaches from Burkina Faso, Sudan and Argentina case studies

Science.gov (United States)

Lavie, Emilie; Robert, Elodie

2013-04-01

The relationship between proportion of suspended solids, dissolved oxygen and bacteriology has long been proven (Brock, 1966; Lechevallier et al., 1985; Bustina and Levallois, 2003; Chang and Liao, 2012), bacteria need coarse elements to hang on and develop. However, water bacteriology analyses are difficult to implement in southern countries. They are expensive and require sterile equipment, transport in cold conditions and a nearby laboratory, which remains difficult in remote areas under these hot latitudes. Yet, simple measurement devices allow to know in a few minutes the water turbidity. Is turbidity an efficient tool to evaluate the drinkability of water when no bacteriological analyses are possible? The results proposed here are taken from three different studies whose purposes were to measure different physical, chemical and bacteriological parameters of water used for human and/or animal consumption. One of the finalities was to propose a method, at lower cost, to evaluate the drinkability of water for consumption. Four case studies were chosen: the basin of the Doubegue River in Burkina Faso is a rural area of a developing country, where drinking water is taken from the alluvial aquifer close to the surface. Furthermore, the laundry is washed and the children play in running streams. Major expansion of the cultivated lands since 1980s has brought important soils losses, thus a chronicle contamination of surface water with suspended solids (Robert, 2012). The Mendoza and Tunuyán Rivers Basins in Argentina, an emerging country, have snow-glaciar regimes with naturally turbid waters. They supply drinking water to two towns, Mendoza and Tunuyán cities, respectively 1 million and 40,000 inhabitants. However, these two streams -whose watersheds are common- do not present the same managements: the Mendoza River has been equipped with large hydraulic infrastructures, moving the turbid waters into clear and erosive ones (Lavie, 2009), while the Tunuyán River

Desenvolvimento de 31 cultivares de marmeleiro enxertadas no porta-enxerto 'Japonês' Development of 31 cultivars of quince grafted in the japanese rootstock

Directory of Open Access Journals (Sweden)

Rafael Pio

2008-06-01

Full Text Available Os marmeleiros sempre foram propagados comercialmente através de enraizamento de estacas. Devido à falta de vigor das mudas, principalmente nos primeiros anos após o plantio, uma série de trabalhos foram desenvolvidos no Brasil a fim de viabilizar a utilização do marmeleiro 'Japonês' (Chaenomeles sinensis Koehne como porta-enxerto para marmelos. Frente à falta de informações, desenvolveu-se este experimento com o objetivo de verificar o desenvolvimento de diferentes cultivares de marmeleiros enxertadas sobre esse porta-enxerto. Os marmeleiros 'Japonês', 'MC', 'Adams', 'Van Deman', 'Provence', 'Cheldow', 'Smyrna', 'Rea's Mamouth', 'De Patras', 'De Vranja', 'Lajeado', 'Champion', 'Mendoza Inta-37', 'Alongado', 'Meech Prolific', 'Bereckzy', 'Alaranjado', 'Kiakami', 'Du Lot', 'Radaelli', 'CTS 207', 'D'Angers', 'Zuquerinetta', 'BA 29', 'Constantinopla', 'Marmelo Pêra', 'Apple', 'Portugal', 'Füller', 'Meliforme' e 'Pineapple' foram enxertados através de garfagem em mudas de 'Japonês', pelo método em fenda cheia. Foram utilizados garfos com três gemas, coletados de plantas-matrizes. As mudas foram mantidas em viveiro, sendo avaliadas, após 60 dias, a porcentagem de garfos brotados. O comprimento e diâmetro médio do enxerto foram avaliados aos 60; 90; 120 e 150 dias após a realização da enxertia. Concluiu-se que os marmeleiros apresentaram boa afinidade com o porta-enxerto 'Japonês'. As cultivares 'Van Deman', 'Japonês', 'Smyrna', 'De Vranja', 'Lajeado', 'Mendoza Inta-37', 'Alongado', 'Meech Prolific', 'Meliforme', 'Cheldow', 'Champion', 'Bereckzy' e 'De Patras' foram as que tiveram o maior vigor na fase de viveiro.The quinces have always been commercially propagated by means of rooting stem cuttings. Due to the lack vigor of the seedlings, especilly afer the first years whih followed the planting season, a sequency of studies were developed in Brazil aiming to permit the use of 'Japanese' quinces (Chaenomeles sinensis Koehne as

Biografija : [luuletused] / Viivi Luik ; tlk. Svetlan Semenenko, lühibiograafia: T. L. [Toomas Liiv

Index Scriptorium Estoniae

Luik, Viivi, 1946-

1999-01-01

Sisu: Biografija ; "Smeisja, smeisja, davai smejatsja..." ; Rodnoi dom / tlk. Nora Javorskaja ; Molba ; "Ja skazhu: kol ne ja..." ; Starõi gorod ; V dorogu ; "Togo uzh ne naiti, kto zaplutal v meteli..." ; Ona skazala vsjo ; Bolshije doma ; Snova ; "Neprestanno krov vo mne zhurtshit..." / tlk. Svetlan Semenenko. Orig.: Elulugu ; "Naera, naera, naerame võidu..." ; Kodu ; Palve ; "Mõtlen: kui mitte mina...", "Ei jäta jälgi see, kes eksis sadudesse..." ; Ta on kõik öelnud ; Uued suured majad ; Jälle

Avgang 2017: Don Giovanni i Operaen

OpenAIRE

2017-01-01

Opera av W.A. Mozart, med våre MA-studenter og gjester. Medvirkende: Dagfinn Andersen (MA2), Emil Havold Næshagen (MA1), Hanne Korsbrekke Askeland (MA2), Nora Oleanne Sårheim (MA2?), Sara Aasen (MA2), Marcela Randem (MA1), Eilert Hasseldal (MA1). Gjester: Eirik Grøtvedt, Per Lindström, Pavels Trofimiks. Kostymer: Fredrik Straum Floen. Dessuten medvirker kor (NMH), strykere (Ensemble Allegri) og blåsere (Stabsmusikken i Oslo)

Narrative Journalism in the Age of the Internet. New Ways to Create Authenticity in Online Literary Reportages

Directory of Open Access Journals (Sweden)

Nora Berning

2011-11-01

Full Text Available Online literary reportages represent an imperative counterweight to conventional journalism that is essential both for our emotional and intellectual survival. Using Paula Delgado-Kling’s online literary reportage Child Soldiers: Homero and Mark Bowden’s multimedia text The Desert One Debacle as examples, Nora Berning explores issues of multimediality and authenticity in online narrative journalism. Berning’s case studies open up discussions, both theoretical and practical, about the future of digital media literacy.