WorldWideScience

Sample records for nonlinear stationary ac

  1. Nonlinear optics with stationary pulses of light

    OpenAIRE

    Andre, A.; Bajcsy, M.; Zibrov, A. S.; Lukin, M. D.

    2004-01-01

    We show that the recently demonstrated technique for generating stationary pulses of light [Nature {\\bf 426}, 638 (2003)] can be extended to localize optical pulses in all three spatial dimensions in a resonant atomic medium. This method can be used to dramatically enhance the nonlinear interaction between weak optical pulses. In particular, we show that an efficient Kerr-like interaction between two pulses can be implemented as a sequence of several purely linear optical processes. The resul...

  2. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  3. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  4. On global attraction to stationary states for wave equations with concentrated nonlinearities

    OpenAIRE

    Kopylova, E.

    2016-01-01

    The global attraction to stationary states is established for solutions to 3D wave equations with concentrated nonlinearities: each finite energy solution converges as $t\\to\\pm\\infty$ to stationary states. The attraction is caused by nonlinear energy radiation.

  5. Effective nonlinear AC response to composite with spherical particles

    Institute of Scientific and Technical Information of China (English)

    Chen Xiao-Gang; Liang Fang-Chu; Wei En-Bo

    2005-01-01

    An effective nonlinear alternative-current (AC) response to granular nonlinear-composite with spherical inclusions embedded in a host medium under the action of an external AC field is investigated by using a perturbation approach.The local potentials of composite at higher harmonics are derived both in a region of local inclusion particles and in a local host region under the action of a sinusoidal field E1 sinωt + E3sin3ωt. An effective nonlinear-response to composite and the relationship between the effective nonlinear-responses at the fundamental frequency and the third harmonics are also studied for the spherical inclusions in a dilute limit.

  6. ARE THE REAL GDP SERIES IN ASIAN COUNTRIES NONSTATIONARY OR NONLINEAR STATIONARY?

    Directory of Open Access Journals (Sweden)

    Nurun Nahar Jannati

    2013-06-01

    Full Text Available This paper checks whether per capita real gross domestic product (GDP series in 16 Asian countries are nonstationary or nonlinear and globally stationary during the period from 1970 to 2009, by applying the nonlinear unit root tests developed by Kapitanios, Shin and Snell (2003. In five out of the sixteen countries that is approximately one-third of the countries, the series are found to be stationary with asymmetric or nonlinear mean reversion. Analyses depict that nonlinear unit root test are suitable for some cases compare to the commonly used unit root test, Augmented Dickey-Fuller (ADF and Dickey-Fuller Generalized Least Square (DF-GLS tests.

  7. Experimental Investigation of Separation Control on a NACA0024 Airfoil using Stationary and Non-Stationary AC-Dielectric Barrier Discharge Plasma Actuator

    Directory of Open Access Journals (Sweden)

    Hossein Parishani

    2016-01-01

    Full Text Available An experimental study of stationary and non-stationary dielectric barrier discharge (DBD plasma actuator is presented to control the flow around a NACA0024 airfoil. First, an induced air velocity of ~5 m/s is generated on a flat plate in still air using an AC-DBD actuator to find the optimal setup of the actuator (voltage, frequency, electrode width and gap size. Using the same actuator in the optimal position/setup on a NACA0024 airfoil at Reynolds number of 0.48×106, we are able to increase the stall angle of the airfoil to 18º, compared to 16º in no-actuator state. Furthermore, during the plasma actuation, the lift is increased by up to 5%. We show that non-stationary actuation, while yielding a performance similar to stationary actuation, leads to a considerable reduction of ~51% in plasma power consumption.

  8. Testing the Granger noncausality hypothesis in stationary nonlinear models of unknown functional form

    DEFF Research Database (Denmark)

    Péguin-Feissolle, Anne; Strikholm, Birgit; Teräsvirta, Timo

    In this paper we propose a general method for testing the Granger noncausality hypothesis in stationary nonlinear models of unknown functional form. These tests are based on a Taylor expansion of the nonlinear model around a given point in the sample space. We study the performance of our tests...

  9. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    We study the response of a model microelectrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes...... in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  10. Strongly nonlinear dynamics of electrolytes in large ac voltages

    CERN Document Server

    Olesen, Laurits H; Bruus, Henrik

    2009-01-01

    We study the response of a model micro-electrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes, ignoring any transverse instability or fluid flow. We analyze the resulting one-dimensional problem by matched asymptotic expansions in the limit of thin double layers and extend previous work into the strongly nonlinear regime, which is characterized by two novel features - significant salt depletion in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasi-equilibrium structure of the double layers. The former leads to the prediction of "ac capacitive desalination", since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion layers. The latter is associated with transient diffusion limitation, which drives the formation and co...

  11. Exact stationary solutions independent of energy for strongly nonlinear stochastic systems of multiple degrees of freedom

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    A new procedure is proposed to construct strongly nonlinear systems of multiple degrees of freedom subjected to parametric and/or external Gaussian white noises, whose exact stationary solutions are independent of energy. Firstly, the equivalent Fokker-Planck-Kolmogorov (FPK) equations are derived by using exterior differentiation. The main difference between the equivalent FPK equation and the original FPK equation lies in the additional arbitrary antisymmetric diffusion matrix. Then the exact stationary solutions and the structures of the original systems can be obtained by using the coefficients of antisymmetric diffusion matrix. The obtained exact stationary solutions, which are generally independent of energy, are for the most general class of strongly nonlinear stochastic systems multiple degrees of freedom (MDOF) so far, and some classes of the known ones dependent on energy belong to the special cases of them.

  12. Exact stationary solutions independent of energy for strongly nonlinear stochastic systems of multiple degrees of freedom

    Institute of Scientific and Technical Information of China (English)

    HUANG ZhiLong; JIN XiaoLing

    2009-01-01

    A new procedure is proposed to construct strongly nonlinear systems of multiple degrees of freedom subjected to parametric and/or external Gaussian white noises,whose exact stationary solutions are independent of energy.Firstly,the equivalent Fokker-Planck-Kolmogorov(FPK)equations are derived by using exterior differentiation.The main difference between the equivalent FPK equation and the original FPK equation lies in the additional arbitrary antisymmetric diffusion matrix.Then the exact stationary solutions and the structures of the original systems can be obtained by using the coefficients of antisymmetric diffusion matrix.The obtained exact stationary solutions,which are generally independent of energy,are for the most general class of strongly nonlinear stochastic systems multiple degrees of freedom(MDOF)so far,and some classes of the known ones dependent on energy belong to the special cases of them.

  13. Band-phase-randomized Surrogates to assess nonlinearity in non-stationary time series

    CERN Document Server

    Guarin, Diego; Orozco, Alvaro

    2011-01-01

    Testing for nonlinearity is one of the most important preprocessing steps in nonlinear time series analysis. Typically, this is done by means of the linear surrogate data methods. But it is a known fact that the validity of the results heavily depends on the stationarity of the time series. Since most physiological signals are non-stationary, it is easy to falsely detect nonlinearity using the linear surrogate data methods. In this document, we propose a methodology to extend the procedure for generating constrained surrogate time series in order to assess nonlinearity in non-stationary data. The method is based on the band-phase-randomized surrogates, which consists (contrary to the linear surrogate data methods) in randomizing only a portion of the Fourier phases in the high frequency band. Analysis of simulated time series showed that in comparison to the linear surrogate data method, our method is able to discriminate between linear stationarity, linear non-stationary and nonlinear time series. When apply...

  14. Stationary waves on nonlinear quantum graphs. II. Application of canonical perturbation theory in basic graph structures

    Science.gov (United States)

    Gnutzmann, Sven; Waltner, Daniel

    2016-12-01

    We consider exact and asymptotic solutions of the stationary cubic nonlinear Schrödinger equation on metric graphs. We focus on some basic example graphs. The asymptotic solutions are obtained using the canonical perturbation formalism developed in our earlier paper [S. Gnutzmann and D. Waltner, Phys. Rev. E 93, 032204 (2016), 10.1103/PhysRevE.93.032204]. For closed example graphs (interval, ring, star graph, tadpole graph), we calculate spectral curves and show how the description of spectra reduces to known characteristic functions of linear quantum graphs in the low-intensity limit. Analogously for open examples, we show how nonlinear scattering of stationary waves arises and how it reduces to known linear scattering amplitudes at low intensities. In the short-wavelength asymptotics we discuss how genuine nonlinear effects may be described using the leading order of canonical perturbation theory: bifurcation of spectral curves (and the corresponding solutions) in closed graphs and multistability in open graphs.

  15. Moderately nonlinear diffuse-charge dynamics under an ac voltage

    Science.gov (United States)

    Stout, Robert F.; Khair, Aditya S.

    2015-09-01

    The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of Vo/(kBT /e ) , where Vo is the amplitude of the driving voltage and kBT /e is the thermal voltage with kB as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D /λDL , where D is the ion diffusivity, λD is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O (Vo3) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in Vo. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing Vo. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.

  16. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  17. Scaling of ac susceptibility and the nonlinear response function of high-temperature superconductors

    Institute of Scientific and Technical Information of China (English)

    CHEN; Kaixuan; NING; Zhenhua; XU; Hengyi; QI; Zhi; LU; Guo

    2005-01-01

    The amplitude-dependent ac susceptibility of high-temperature superconductors is shown to obey some empirical scaling relations. We try to analyze this behavior by extending a dc nonlinear response function of mixed state to the ac cases. The derived equations for critical current and ac susceptibility x(T) agree with the scaling relations of experimental data.

  18. Stationary solutions and self-trapping in discrete quadratic nonlinear systems

    DEFF Research Database (Denmark)

    Bang, Ole; Christiansen, Peter Leth; Clausen, Carl A. Balslev

    1998-01-01

    the nonintegrable dimer reduce to the discrete nonlinear Schrodinger (DNLS) equation with two degrees of freedom, which is integrable. We show how the stationary solutions to the two systems correspond to each other and how the self-trapped DNLS solutions gradually develop chaotic dynamics in the chi((2)) system......We consider the simplest equations describing coupled quadratic nonlinear (chi((2))) systems, which each consists of a fundamental mode resonantly interacting with its second harmonic. Such discrete equations apply, e.g., to optics, where they can describe arrays of chi((2)) waveguides...

  19. Syntheses of terminal control for nonlinear stationary controlled system under incomplete information

    Science.gov (United States)

    Kvitko, Alexander

    2016-06-01

    By constructing a Luenberger-type asymptotic observer, a method of finding the control function, that ensures the translation of a class of nonlinear stationary control systems of ordinary differential equations from the initial state to a given final state taking into account the actual measured values, was developed. A constructive criterion guaranteeing the existence of solution of this problem was found. An algorithm is proposed for constructing a control function that transfer wide class of nonlinear systems of ordinary differential equations from an initial state to an fixed state. The algorithm is convenient for numerical implementation. A constructive condition is obtained for which this transfer is possible.

  20. The Fourier decomposition method for nonlinear and non-stationary time series analysis.

    Science.gov (United States)

    Singh, Pushpendra; Joshi, Shiv Dutt; Patney, Rakesh Kumar; Saha, Kaushik

    2017-03-01

    for many decades, there has been a general perception in the literature that Fourier methods are not suitable for the analysis of nonlinear and non-stationary data. In this paper, we propose a novel and adaptive Fourier decomposition method (FDM), based on the Fourier theory, and demonstrate its efficacy for the analysis of nonlinear and non-stationary time series. The proposed FDM decomposes any data into a small number of 'Fourier intrinsic band functions' (FIBFs). The FDM presents a generalized Fourier expansion with variable amplitudes and variable frequencies of a time series by the Fourier method itself. We propose an idea of zero-phase filter bank-based multivariate FDM (MFDM), for the analysis of multivariate nonlinear and non-stationary time series, using the FDM. We also present an algorithm to obtain cut-off frequencies for MFDM. The proposed MFDM generates a finite number of band-limited multivariate FIBFs (MFIBFs). The MFDM preserves some intrinsic physical properties of the multivariate data, such as scale alignment, trend and instantaneous frequency. The proposed methods provide a time-frequency-energy (TFE) distribution that reveals the intrinsic structure of a data. Numerical computations and simulations have been carried out and comparison is made with the empirical mode decomposition algorithms.

  1. Non-stationary resonance dynamics of a nonlinear sonic vacuum with grounding supports

    Science.gov (United States)

    Koroleva (Kikot), I. P.; Manevitch, L. I.; Vakakis, Alexander F.

    2015-11-01

    In a recent work [L.I. Manevitch, A.F.Vakakis, Nonlinear oscillatory acoustic vacuum, SIAM Journal of Applied Mathematics 74(6) (2014), 1742-1762] it was shown that a periodic chain of linearly coupled particles performing low-energy in-plane transverse oscillations behaves as a strongly nonlinear sonic vacuum (with corresponding speed of sound equal to zero). In this work we consider the grounded version of this system by coupling each particle to the ground through lateral springs in order to study the effect of the grounding stiffness on the strongly nonlinear dynamics. In that context we consider the simplest possible such system consisting of two coupled particles and present analytical and numerical studies of the non-stationary planar dynamics. The most significant limiting case corresponding to predominant low energy transversal excitations is considered by taking into account leading order geometric nonlinearities. Then we show that the grounded system behaves as a nonlinear sonic vacuum due to the purely cubic stiffness nonlinearities in the governing equations of motion and the complete absence of any linear stiffness terms. Under certain assumptions the nonlinear normal modes (i.e., the time-periodic nonlinear oscillations) in the configuration space of this system coincide with those of the corresponding linear one, so they obey the same orthogonality relations. Moreover, we analytically find that there are two transitions in the dynamics of this system, with the parameter governing these transitions being the relation between the lateral (grounding) and the interchain stiffnesses. The first transition concerns a bifurcation of one of the nonlinear normal modes (NNMs), whereas the second provides conditions for intense energy transfers and mixing between the NNMs. The drastic effects of these bifurcations on the non-stationary resonant dynamics are discussed. Specifically, the second transition relates to strongly non-stationary dynamics, and signifies

  2. Stationary variational estimates for the effective response and field fluctuations in nonlinear composites

    Science.gov (United States)

    Ponte Castañeda, Pedro

    2016-11-01

    This paper presents a variational method for estimating the effective constitutive response of composite materials with nonlinear constitutive behavior. The method is based on a stationary variational principle for the macroscopic potential in terms of the corresponding potential of a linear comparison composite (LCC) whose properties are the trial fields in the variational principle. When used in combination with estimates for the LCC that are exact to second order in the heterogeneity contrast, the resulting estimates for the nonlinear composite are also guaranteed to be exact to second-order in the contrast. In addition, the new method allows full optimization with respect to the properties of the LCC, leading to estimates that are fully stationary and exhibit no duality gaps. As a result, the effective response and field statistics of the nonlinear composite can be estimated directly from the appropriately optimized linear comparison composite. By way of illustration, the method is applied to a porous, isotropic, power-law material, and the results are found to compare favorably with earlier bounds and estimates. However, the basic ideas of the method are expected to work for broad classes of composites materials, whose effective response can be given appropriate variational representations, including more general elasto-plastic and soft hyperelastic composites and polycrystals.

  3. Nonlinear stability of non-stationary cross-flow vortices in compressible boundary layers

    Science.gov (United States)

    Gajjar, J. S. B.

    1995-01-01

    The nonlinear evolution of long wavelength non-stationary cross-flow vortices in a compressible boundary layer is investigated and the work extends that of Gajjar (1994) to flows involving multiple critical layers. The basic flow profile considered in this paper is that appropriate for a fully three-dimensional boundary layer with O(1) Mach number and with wall heating or cooling. The governing equations for the evolution of the cross-flow vortex are obtained and some special cases are discussed. One special case includes linear theory where exact analytic expressions for the growth rate of the vortices are obtained. Another special case is a generalization of the Bassom & Gajjar (1988) results for neutral waves to compressible flows. The viscous correction to the growth rate is derived and it is shown how the unsteady nonlinear critical layer structure merges with that for a Haberman type of viscous critical layer.

  4. Control of parallel-connected bidirectional AC-DC converters in stationary frame for microgrid application

    DEFF Research Database (Denmark)

    Lu, Xiaonan; Guerrero, Josep M.; Teodorescu, Remus

    2011-01-01

    With the penetration of renewable energy in modern power system, microgrid has become a popular application worldwide. In this paper, parallel-connected bidirectional converters for AC and DC hybrid microgrid application are proposed as an efficient interface. To reach the goal of bidirectional...

  5. Nonlinear Excitation of Inviscid Stationary Vortex in a Boundary-Layer Flow

    Science.gov (United States)

    Choudhari, Meelan; Duck, Peter W.

    1996-01-01

    We examine the excitation of inviscid stationary crossflow instabilities near an isolated surface hump (or indentation) underneath a three-dimensional boundary layer. As the hump height (or indentation depth) is increased from zero, the receptivity process becomes nonlinear even before the stability characteristics of the boundary layer are modified to a significant extent. This behavior contrasts sharply with earlier findings on the excitation of the lower branch Tollmien-Schlichting modes and is attributed to the inviscid nature of the crossflow modes, which leads to a decoupling between the regions of receptivity and stability. As a result of this decoupling, similarity transformations exist that allow the nonlinear receptivity of a general three-dimensional boundary layer to be studied with a set of canonical solutions to the viscous sublayer equations. The parametric study suggests that the receptivity is likely to become nonlinear even before the hump height becomes large enough for flow reversal to occur in the canonical solution. We also find that the receptivity to surface humps increases more rapidly as the hump height increases than is predicted by linear theory. On the other hand, receptivity near surface indentations is generally smaller in comparison with the linear approximation. Extension of the work to crossflow receptivity in compressible boundary layers and to Gortler vortex excitation is also discussed.

  6. Stationary distribution and periodic solution for stochastic predator-prey systems with nonlinear predator harvesting

    Science.gov (United States)

    Zuo, Wenjie; Jiang, Daqing

    2016-07-01

    In this paper, we investigate the dynamics of the stochastic autonomous and non-autonomous predator-prey systems with nonlinear predator harvesting respectively. For the autonomous system, we first give the existence of the global positive solution. Then, in the case of persistence, we prove that there exists a unique stationary distribution and it has ergodicity by constructing a suitable Lyapunov function. The result shows that, the relatively weaker white noise will strengthen the stability of the system, but the stronger white noise will result in the extinction of one or two species. Particularly, for the non-autonomous periodic system, we show that there exists at least one nontrivial positive periodic solution according to the theory of Khasminskii. Finally, numerical simulations illustrate our theoretical results.

  7. Approximate Forward Difference Equations for the Lower Order Non-Stationary Statistics of Geometrically Non-Linear Systems subject to Random Excitation

    DEFF Research Database (Denmark)

    Köylüoglu, H. U.; Nielsen, Søren R. K.; Cakmak, A. S.

    Geometrically non-linear multi-degree-of-freedom (MDOF) systems subject to random excitation are considered. New semi-analytical approximate forward difference equations for the lower order non-stationary statistical moments of the response are derived from the stochastic differential equations...... of motion, and, the accuracy of these equations is numerically investigated. For stationary excitations, the proposed method computes the stationary statistical moments of the response from the solution of non-linear algebraic equations....

  8. Nonlinear attitude stability of a spacecraft on a stationary orbit around an asteroid subjected to gravity gradient torque

    CERN Document Server

    Wang, Yue

    2014-01-01

    The classical problem of attitude stability in a central gravity field is generalized to that on a stationary orbit around a uniformly-rotating asteroid. This generalized problem is studied in the framework of geometric mechanics. Based on the natural symplectic structure, the non-canonical Hamiltonian structure of the problem is derived. The Poisson tensor, Casimir functions and equations of motion are obtained in a differential geometric method. The equilibrium of the equations of motion, i.e. the equilibrium attitude of the spacecraft, is determined from a global point of view. Nonlinear stability conditions of the equilibrium attitude are obtained with the energy-Casimir method. The nonlinear attitude stability is then investigated versus three parameters of the asteroid, including the ratio of the mean radius to the stationary orbital radius, the harmonic coefficients C20 and C22. It is found that when the spacecraft is located on the intermediate-moment principal axis of the asteroid, the nonlinear stab...

  9. Seismic response of structures: from non-stationary to non-linear effects

    Science.gov (United States)

    Carlo Ponzo, Felice; Ditommaso, Rocco; Mucciarelli, Marco; Smith, Tobias

    2013-04-01

    cases it is possible to confuse apparent frequencies variations with real ones (related to nonlinear phenomena) which could lead to an incorrect assessment of the structural safety. In this paper a new theoretical approach is proposed to discriminate non-stationary from non-linear effects, it was tested on both numerical and experimental accelerometric recordings respectively retrieved from one degree of freedom oscillator and one timber framed structure monitored during the 2011 Canterbury Seismic Sequence.

  10. Robust Nonlinear Causality Analysis of Non-Stationary Multivariate Physiological Time Series.

    Science.gov (United States)

    Schaeck, Tim; Muma, Michael; Feng, Mengling; Guan, Cuntai; Zoubir, Abdelhak

    2017-05-26

    An important research area in biomedical signal processing is that of quantifying the relationship between simultaneously observed time series and to reveal interactions between the signals. Since biomedical signals are potentially non-stationary and the measurements may contain outliers and artifacts, we introduce a robust time-varying generalized partial directed coherence (rTV-gPDC) function. The proposed method, which is based on a robust estimator of the timevarying autoregressive (TVAR) parameters, is capable of revealing directed interactions between signals. By definition, the rTV-gPDC only displays the linear relationships between the signals. We therefore suggest to approximate the residuals of the TVAR process, which potentially carry information about the nonlinear causality by a piece-wise linear time-varying moving-average (TVMA) model. The performance of the proposed method is assessed via extensive simulations. To illustrate the method's applicability to real-world problems, it is applied to a neurophysiological study that involves intracranial pressure (ICP), arterial blood pressure (ABP), and brain tissue oxygenation level (PtiO2) measurements. The rTV-gPDC reveals causal patterns that are in accordance with expected cardiosudoral meachanisms and potentially provides new insights regarding traumatic brain injuries (TBI). The rTV-gPDC is not restricted to the above problem but can be useful in revealing interactions in a broad range of applications.

  11. Extreme-Point Symmetric Mode Decomposition Method for Nonlinear and Non-Stationary Signal Processing

    CERN Document Server

    Wang, Jin-Liang

    2013-01-01

    To process nonlinear and non-stationary signals, an extreme-point symmetric mode decomposition (ESMD) method is developed. It can be seen as a new alternate of the well-known Hilbert-Huang transform (HHT) method which is widely used nowadays. There are two parts for it. The first part is the decomposition approach which yields a series of intrinsic mode functions (IMFs) together with an optimal adaptive global mean (AGM) curve, the second part is the direct interpolating (DI) approach which yields instantaneous amplitudes and frequencies for the IMFs together with a time-varying energy. Relative to the HHT method it has five characteristics as follows: (1) Different from constructing 2 outer envelopes, its sifting process is implemented by the aid of 1, 2 or 3 inner interpolating curves; (2) It does not decompose the signal to the last trend curve with at most one extreme point, it optimizes the residual component to be an optimal AGM curve which possesses a certain number of extreme points; (3) Its symmetry ...

  12. Nonlinearity exponent of ac conductivity in disordered systems

    Science.gov (United States)

    Nandi, U. N.; Sircar, S.; Karmakar, A.; Giri, S.

    2012-07-01

    We measured the real part of ac conductance Σ(x,f) or Σ(T,f) of iron-doped mixed-valent polycrystalline manganite oxides LaMn1-xFexO3 as a function of frequency f by varying initial conductance Σ0 by quenched disorder x at a fixed temperature T (room) and by temperature T at a fixed quenched disorder x. At a fixed temperature T, Σ(x,f) of a sample with fixed x remains almost constant at its zero-frequency dc value Σ0 at lower frequency. With increase in f, Σ(x,f) increases slowly from Σ0 and finally increases rapidly following a power law with an exponent s at high frequency. Scaled appropriately, the data for Σ(T,f) and Σ(x,f) fall on the same universal curve, indicating the existence of a general scaling formalism for the ac conductivity in disordered systems. The characteristic frequency fc at which Σ(x,f) or Σ(T,f) increases for the first time from Σ0 scales with initial conductance Σ0 as {f}_{{c}}\\sim {\\Sigma }_{0}^{{x}_{f}}, where xf is the onset exponent. The value of xf is nearly equal to one and is found to be independent of x and T. Further, an inverse relationship between xf and s provides a self-consistency check of the systematic description of Σ(x,f) or Σ(T,f). This apparent universal value of xf is discussed within the framework of existing theoretical models and scaling theories. The relevance to other similar disordered systems is also highlighted.

  13. Effective Response of Nonlinear Composite under External AC and DC Electric Field

    Institute of Scientific and Technical Information of China (English)

    LIU Ye; LIANG Fang-Chu; SHEN Hong-Liang

    2005-01-01

    A perturbation method is used to study effective response of nonlinear Kerr composites, which are subject to the constitutive relation of electric displacement and electric field, Dα = εαE + xα|E|2E. Under the external AC and DC electric field Eapp = Eα(1 + sinwt), the effective nonlinear responses and local potentials are induced by the cubic nonlinearity of Kerr materials at all harmonics. As an example in three dimensions, we have investigated this kind of nonlinear composites with spherical inclusions embedded in a host. At all harmonic frequencies, the potentials in inclusion and host regions are derived. Furthermore, the formulae of the effective linear and nonlinear responses are given in the dilute limit.

  14. A Nonlinear Galerkin/Petrov-Least Squares Mixed Element Method for the Stationary Navier-Stokes Equation

    Institute of Scientific and Technical Information of China (English)

    罗振东; 朱江; 王会军

    2002-01-01

    A nonlinear Galerkin/ Petrov- least squares mixed element (NGPLSME) method for the stationary Navier-Stokes equations is presented and analyzed. The scheme is that Petrov-least squares forms of residuals are added to the nonlinear Galerkin mixed element method so that it is stable for any combination of discrete velocity and pressure spaces without requiring the Babuska-Brezzi stability condition. The existence, uniqueness and convergence ( at optimal rate ) of the NGPLSME solution is proved in the case of sufficient viscosity ( or small data).

  15. Identification and frequency domain analysis of non-stationary and nonlinear systems using time-varying NARMAX models

    Science.gov (United States)

    He, Fei; Wei, Hua-Liang; Billings, Stephen A.

    2015-08-01

    This paper introduces a new approach for nonlinear and non-stationary (time-varying) system identification based on time-varying nonlinear autoregressive moving average with exogenous variable (TV-NARMAX) models. The challenging model structure selection and parameter tracking problems are solved by combining a multiwavelet basis function expansion of the time-varying parameters with an orthogonal least squares algorithm. Numerical examples demonstrate that the proposed approach can track rapid time-varying effects in nonlinear systems more accurately than the standard recursive algorithms. Based on the identified time domain model, a new frequency domain analysis approach is introduced based on a time-varying generalised frequency response function (TV-GFRF) concept, which enables the analysis of nonlinear, non-stationary systems in the frequency domain. Features in the TV-GFRFs which depend on the TV-NARMAX model structure and time-varying parameters are investigated. It is shown that the high-dimensional frequency features can be visualised in a low-dimensional time-frequency space.

  16. Broken space-time symmetries and mechanisms of rectification of ac fields by nonlinear (non)adiabatic response

    DEFF Research Database (Denmark)

    Denisov, S.; Flach, S.; Ovchinnikov, A. A.

    2002-01-01

    We consider low-dimensional dynamical systems exposed to a heat bath and to additional ac fields. The presence of these ac fields may lead to a breaking of certain spatial or temporal symmetries, which in turn cause nonzero averages of relevant observables. Nonlinear (non)adiabatic response is em...

  17. A New Method for Non-linear and Non-stationary Time Series Analysis:
    The Hilbert Spectral Analysis

    CERN Document Server

    CERN. Geneva

    2000-01-01

    A new method for analysing non-linear and non-stationary data has been developed. The key part of the method is the Empirical Mode Decomposition method with which any complicated data set can be decomposed into a finite and often small number of Intrinsic Mode Functions (IMF). An IMF is defined as any function having the same numbers of zero crossing and extreme, and also having symmetric envelopes defined by the local maximal and minima respectively. The IMF also admits well-behaved Hilbert transform. This decomposition method is adaptive, and, therefore, highly efficient. Since the decomposition is based on the local characteristic time scale of the data, it is applicable to non-linear and non-stationary processes. With the Hilbert transform, the Intrinsic Mode Functions yield instantaneous frequencies as functions of time that give sharp identifications of imbedded structures. The final presentation of the results is an energy-frequency-time distribution, designated as the Hilbert Spectrum. Classical non-l...

  18. ac electrokinetic micropumps: The effect of geometrical confinement, Faradaic current injection, and nonlinear surface capacitance

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.

    2006-01-01

    Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...... therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects...... indeed affect the pump performance in a way that we can rationalize by physical arguments....

  19. Nonlinear transport in coupled quantum dots:A stationary probability approach

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The stationary tunneling current and differential conductance of the coupled quantum dots system with split-gates are calculated by generalizing the Beenaker’s linear response theory for the description of the Coulomb-blockade oscillations of the conductance in the single quantum dot.The calculation of the charging diagram in parallel through the double dot as function of the two side-gate voltages shows a remarkable agreement with the recent experimental results by Hatano et al.

  20. Nonlinear Dynamics of Magnons observed by AC Spin Pumping in Magnetic Hybrid Structures

    Science.gov (United States)

    Vilela-Leao, L. H.; Cunha, R. O.; Azevedo, A.; Rodriguez-Suarez, R. L.; Rezende, S. M.

    2015-03-01

    The electron spin degree of freedom constitutes the basic means to carry and store information in the field of spintronics. In the spin pumping process, the microwave driven magnetization dynamics in a ferromagnetic film generates a spin current in an attached metallic layer that can be converted into a charge current by means of the inverse spin Hall effect and detected by a voltage signal. While the time independent component (DC) of the spin current has been widely investigated in a variety of material structures, recently it has been recognized that the alternating current (AC) component is much larger, though more difficult to detect, and has many attractive features. We report experiments with microwave driven DC and AC spin pumping in bilayers made of the insulating ferrimagnet yttrium iron garnet (YIG) and platinum that reveal the nonlinear dynamics involving the driven mode and a pair of magnon modes with half frequency. This process occurs when the frequency is lowered below a critical value so that a three-magnon splitting process with energy conservation is made possible. The results are explained by a model with coupled nonlinear equations describing the time evolution of the magnon modes.

  1. Nonlinear control of voltage source converters in AC-DC power system.

    Science.gov (United States)

    Dash, P K; Nayak, N

    2014-07-01

    This paper presents the design of a robust nonlinear controller for a parallel AC-DC power system using a Lyapunov function-based sliding mode control (LYPSMC) strategy. The inputs for the proposed control scheme are the DC voltage and reactive power errors at the converter station and the active and reactive power errors at the inverter station of the voltage-source converter-based high voltage direct current transmission (VSC-HVDC) link. The stability and robust tracking of the system parameters are ensured by applying the Lyapunov direct method. Also the gains of the sliding mode control (SMC) are made adaptive using the stability conditions of the Lyapunov function. The proposed control strategy offers invariant stability to a class of systems having modeling uncertainties due to parameter changes and exogenous inputs. Comprehensive computer simulations are carried out to verify the proposed control scheme under several system disturbances like changes in short-circuit ratio, converter parametric changes, and faults on the converter and inverter buses for single generating system connected to the power grid in a single machine infinite-bus AC-DC network and also for a 3-machine two-area power system. Furthermore, a second order super twisting sliding mode control scheme has been presented in this paper that provides a higher degree of nonlinearity than the LYPSMC and damps faster the converter and inverter voltage and power oscillations.

  2. On the Nonlinear Evolution of a Stationary Cross-Flow Vortex in a Fully Three-Dimensional Boundary Layer Flow

    Science.gov (United States)

    Gajjar, J. S. B.

    1995-01-01

    We consider the nonlinear stability of a fully three-dimensional boundary layer flow in an incompressible fluid and derive an equation governing the nonlinear development of a stationary cross-flow vortex. The amplitude equation is a novel integro-differential equation which has spatial derivatives of the amplitude occurring in the kernal function. It is shown that the evolution of the cross-flow vortex is strongly coupled to the properties of an unsteady wall layer which is in fact driven by an unknown slip velocity, proportional to the amplitude of the cross-flow vortex. The work is extended to obtain the corresponding equation for rotating disk flow. A number of special cases are examined and the numerical solution for one of cases, and further analysis, demonstrates the existence of finite-distance as well as focussing type singularities. The numerical solutions also indicate the presence of a new type of nonlinear wave solution for a certain set of parameter values.

  3. Stationary states of the two-dimensional nonlinear Schrödinger model with disorder

    DEFF Research Database (Denmark)

    Gaididei, Yuri Borisovich; Hendriksen, D.; Christiansen, Peter Leth

    1998-01-01

    Solitonlike excitations in the presence of disorder in the two-dimensional cubic nonlinear Schrodinger equation are analyzed. The continuum as well as the discrete problem are analyzed. In the continuum model, otherwise unstable excitations are stabilized in the presence of disorder. In the discr......Solitonlike excitations in the presence of disorder in the two-dimensional cubic nonlinear Schrodinger equation are analyzed. The continuum as well as the discrete problem are analyzed. In the continuum model, otherwise unstable excitations are stabilized in the presence of disorder...

  4. Non Gaussian and Non stationary characters of ENSO: the role of climate shifts and nonlinearities

    Science.gov (United States)

    Boucharel, J.; Dewitte, B.; Garel, B.; Du Penhoat, Y.

    2009-04-01

    ENSO is the dominant climate mode of variability in the Pacific, having socio-economical impacts on surrounding regions. ENSO exhibits a significant modulation at decadal to multidecadal timescales which is associated to changes of its characteristics (onset, amplitude, frequency, propagation, and predictability). Among these characteristics, some of them are generally ignored in ENSO studies, such as its asymmetry and the deviation of its statistics from those of the Gaussian distribution. These properties could be related to the ability of the current generation of coupled models to predict ENSO and its modulation. Here, the non-Gaussian nature and asymmetry of ENSO is diagnosed from in situ data and a variety of models (from intermediate complexity models to full physics coupled general circulation models) using robust statistical tools. In particular α-stable laws are used as theoretical background material to quantify the non-Gaussian character of ENSO time series. It is shown that the α-stable character of ENSO may result from the presence of climate shifts inducing non stationnarity in the time series. Also, cool (warm) periods are associated with ENSO statistics having a larger (weaker) tendency towards Gaussianity and a weaker (larger) asymmetry. This supports the hypothesis of ENSO being rectified by changes in mean state through non-linear processes. The relationship between change in mean state and non-linearity is investigated both in the Zebiak and Cane model and the IPCC models, which indicate that the propensity of a model to reproduce extreme events is related to its tendency to emphasize the non-linear interaction between mean state and ENSO variability. More particularly, high statistical moments i.e high order nonlinearities seem to be involved in the feedback between extreme events occurrence and mean state shit triggering through energy cascade, emphasizing the ENSO multifractal nature.

  5. Non Stationary And Non Gaussian Character Of ENSO: The Role Of Climate Shifts And Nonlinearities

    Science.gov (United States)

    Boucharel, J.; Dewitte, B.; Garel, B.; Du Penhoat, Y.

    2008-12-01

    ENSO is the dominant climate mode of variability in the Pacific, having socio-economical impacts on surrounding regions. ENSO exhibits a significant modulation at decadal to interdecadal timescales which is associated to changes of its characteristics (onset, amplitude, frequency, propagation, and predictability). Among these characteristics, some of them are generally ignored in ENSO studies, such as its asymmetry and the deviation of its statistics from those of the Gaussian distribution. These properties could be related to the ability of the current generation of coupled models to predict ENSO and its modulation. Here, the non-Gaussian nature and asymmetry of ENSO is diagnosed from in situ data and the outputs of a variety of models (from intermediate complexity models to full physics coupled general circulation models) using robust statistical tools. In particular alpha-stable laws are used as theoretical background material to quantify the non-Gaussian character of ENSO time series. It is shown that the Alpha-stable character of ENSO may result from the presence of climate shifts inducing non stationnarity in the time series. Also, cool (warm) periods are associated with ENSO statistics having a larger (weaker) tendency towards Gaussianity and a weaker (larger) asymmetry. This supports the hypothesis of ENSO being rectified by changes in mean state through non-linear processes. The relationship between change in mean state and non-linearity is investigated both in the Zebiak and Cane model and the IPCC models, which indicate that the propensity of a model to reproduce extreme events is related to its tendency to emphasize the non-linear interaction between mean state and ENSO variability. More particularly, high statistical moments i.e. high order nonlinearities seem to be involved in the feedback between extreme events occurrence and mean state shift triggering through inverse energy cascade, emphasizing the ENSO multifractal nature.

  6. Faster Simulation Methods for the Non-Stationary Random Vibrations of Non-Linear MDOF Systems

    DEFF Research Database (Denmark)

    Askar, A.; Köylüoglu, H. U.; Nielsen, Søren R. K.;

    In this paper semi-analytical forward-difference Monte Carlo simulation procedures are proposed for the determination of the lower order statistics and the Joint Probability Density Function (JPDF) of the stochastic response of geometrically nonlinear multi-degree-of-freedom structural systems....... Such a treatment offers higher rates of convergence, faster speed and higher accuracy. These procedures are compared to the direct Monte Carlo simulation procedure, which uses a fourth order Runge-Kutta scheme with the white noise process approximated by a broad band Ruiz-Penzien broken line process...

  7. Numerical solution of the stationary multicomponent nonlinear Schrödinger equation with a constraint on the angular momentum.

    Science.gov (United States)

    Sandin, Patrik; Ögren, Magnus; Gulliksson, Mårten

    2016-03-01

    We formulate a damped oscillating particle method to solve the stationary nonlinear Schrödinger equation (NLSE). The ground-state solutions are found by a converging damped oscillating evolution equation that can be discretized with symplectic numerical techniques. The method is demonstrated for three different cases: for the single-component NLSE with an attractive self-interaction, for the single-component NLSE with a repulsive self-interaction and a constraint on the angular momentum, and for the two-component NLSE with a constraint on the total angular momentum. We reproduce the so-called yrast curve for the single-component case, described in [A. D. Jackson et al., Europhys. Lett. 95, 30002 (2011)], and produce for the first time an analogous curve for the two-component NLSE. The numerical results are compared with analytic solutions and competing numerical methods. Our method is well suited to handle a large class of equations and can easily be adapted to further constraints and components.

  8. Influence of intrapulse Raman scattering on the stationary pulses in the presence of linear and nonlinear gain as well as spectral filtering

    Science.gov (United States)

    Uzunov, Ivan M.; Georgiev, Zhivko D.; Arabadzhev, Todor N.

    2015-01-01

    In this paper we present numerical investigation of the influence of intrapulse Raman scattering (IRS) on the stable stationary pulses. Our basic equation, namely cubic-quintic Ginzburg-Landau equation describes the propagation of ultra-short optical pulses under the effect of IRS in the presence of linear and nonlinear gain as well as spectral filtering. Our aim is to examine numerically the influence of IRS, on the stable stationary pulses in the presence of constant linear and nonlinear gain as well as spectral filtering. Numerical solution of our basic equation is performed by means of the "fourth-order Runge-Kutta method in the interaction picture method" method. We found that the small change of the value of the parameter which describes IRS leads to qualitatively different behavior of the evolution of pulse amplitudes. In order to study the observed strong dependence on the IRS, the perturbation method of conserved quantities of the nonlinear Schrodinger equation is applied. The numerical analysis of the derived nonlinear system of ordinary differential equations has shown that our numerical findings are related to the existence of the Poincare-Andronov-Hopf bifurcation.

  9. AC and DC Electrical Conductivity Measurements on Glycine Family of Nonlinear Optical (NLO Single Crystals

    Directory of Open Access Journals (Sweden)

    Suresh Sagadevan

    2014-04-01

    Full Text Available In the present work, the AC/DC conductivity studies were carried out on Glycine family of NLO single crystals such as Trisglycine Zinc Chloride (TGZC, Triglycine Acetate (TGAc and Glycine Lithium Sulphate (GLS. The AC conductivity measurements were carried out using HIOKI 3532-50 LCR HITESTER in the frequency range of 50 Hz to 5 MHz for the grown NLO single crystals. The DC electrical conductivity measurements were also carried out for the crystals using the conventional two – probe technique in the temperature range of 313 – 423 K. The present study indicates that both the AC and DC conductivity of the samples increase with the increase in temperature. The activation energies were also calculated from AC/DC conductivity studies.

  10. Controlled merging and annihilation of localised dissipative structures in an AC-driven damped nonlinear Schrödinger system

    Science.gov (United States)

    Jang, Jae K.; Erkintalo, Miro; Luo, Kathy; Oppo, Gian-Luca; Coen, Stéphane; Murdoch, Stuart G.

    2016-03-01

    We report studies of controlled interactions of localised dissipative structures in a system described by the AC-driven damped nonlinear Schrödinger equation (equivalent to the Lugiato-Lefever model). Extensive numerical simulations reveal a variety of interaction scenarios that are governed by the properties of the system driver, notably its gradients. In our experiments, performed with a nonlinear optical fibre (Kerr) resonator, the phase profile of the driver is used to induce interactions of the dissipative structures on demand. We observe both merging and annihilation of localised structures, i.e. interactions governed by the dissipative, out-of-equilibrium nature of the system. These interactions fundamentally differ from those typically found for conventional conservative solitons.

  11. Nonlinear response of metallic acGNR to an elliptically-polarized terahertz excitation field

    CERN Document Server

    Wang, Yichao

    2016-01-01

    We present a theoretical description of the nonlinear response induced by an elliptically-polarized terahertz beam normally-incident on intrinsic and extrinsic metallic armchair graphene nanorib- bons. Our results show that using a straightforward experimental setup, it should be possible to observe novel polarization-dependent nonlinearities at low excitation field strengths of the or- der of 10 4 V/m. At low temperatures the Kerr nonlinearities in extrinsic nanoribbons persist to significantly higher excitation frequencies than they do for linear polarizations, and at room tem- peratures, the third-harmonic nonlinearities are enhanced by 2-3 orders of magnitude. Finally, the Fermi-level and temperature dependence of the nonlinear response is characterized.

  12. Observations of spatiotemporal instabilities in the strong-driving regime of an AC-driven nonlinear Schr\\"odinger system

    CERN Document Server

    Anderson, Miles; Coen, Stéphane; Erkintalo, Miro; Murdoch, Stuart G

    2016-01-01

    Localized dissipative structures (LDS) have been predicted to display a rich array of instabilities, yet systematic experimental studies have remained scarce. We have used a synchronously-driven optical fiber ring resonator to experimentally study LDS instabilities in the strong-driving regime of the AC-driven nonlinear Schr\\"odinger equation (also known as the Lugiato-Lefever model). Through continuous variation of a single control parameter, we have observed a string of theoretically predicted instability modes, including irregular oscillations and chaotic collapses. Beyond a critical point, we observe behaviour reminiscent of a phase transition: LDSs trigger localized domains of spatiotemporal chaos that invade the surrounding homogeneous state. Our findings directly confirm a number of theoretical predictions, and they highlight that complex LDS instabilities can play a role in experimental systems.

  13. Nonlinear oscillations of a sessile drop on a hydrophobic surface induced by ac electrowetting

    Science.gov (United States)

    Lee, Joohee; Park, Jun Kwon; Hong, Jiwoo; Lee, Sang Joon; Kang, Kwan Hyoung; Hwang, Hyung Ju

    2014-09-01

    We examine the nature of ac electrowetting (EW)-driven axisymmetric oscillations of a sessile water drop on a dielectric substrate. In ac EW, small-amplitude oscillations of a drop differ from the Rayleigh linear modes of freely oscillating drops. In this paper, we demonstrate that changes in the time-averaged contact angle of the sessile drop attributed to the presence of an electric field and a solid substrate mainly caused this discrepancy. We combine the domain perturbation method with the Lindsted-Poincaré method to derive an asymptotic formula for resonant frequency. Theoretical analysis shows that the resonant frequency is a function of the time-averaged contact angle. Each mode of the resonance frequency is a linear function of ɛ1, which is the magnitude of the cosine of the time-averaged contact angle. The most dominant mode in this study, that is, the fundamental mode n =2, decreases linearly with ɛ1. The results of the theoretical model are compared with those of both the experiments and numerical simulations. The average resonant frequency deviation between the perturbation solutions and numerical simulations is 4.3%, whereas that between the perturbation solutions and the experiments is 1.8%.

  14. Nonlinear oscillations of a sessile drop on a hydrophobic surface induced by ac electrowetting.

    Science.gov (United States)

    Lee, Joohee; Park, Jun Kwon; Hong, Jiwoo; Lee, Sang Joon; Kang, Kwan Hyoung; Hwang, Hyung Ju

    2014-09-01

    We examine the nature of ac electrowetting (EW)-driven axisymmetric oscillations of a sessile water drop on a dielectric substrate. In ac EW, small-amplitude oscillations of a drop differ from the Rayleigh linear modes of freely oscillating drops. In this paper, we demonstrate that changes in the time-averaged contact angle of the sessile drop attributed to the presence of an electric field and a solid substrate mainly caused this discrepancy. We combine the domain perturbation method with the Lindsted-Poincaré method to derive an asymptotic formula for resonant frequency. Theoretical analysis shows that the resonant frequency is a function of the time-averaged contact angle. Each mode of the resonance frequency is a linear function of ɛ(1), which is the magnitude of the cosine of the time-averaged contact angle. The most dominant mode in this study, that is, the fundamental mode n=2, decreases linearly with ɛ(1). The results of the theoretical model are compared with those of both the experiments and numerical simulations. The average resonant frequency deviation between the perturbation solutions and numerical simulations is 4.3%, whereas that between the perturbation solutions and the experiments is 1.8%.

  15. Dynamic magnetic hysteresis and nonlinear susceptibility of antiferromagnetic nanoparticles

    Science.gov (United States)

    Kalmykov, Yuri P.; Ouari, Bachir; Titov, Serguey V.

    2016-08-01

    The nonlinear ac stationary response of antiferromagnetic nanoparticles subjected to both external ac and dc fields of arbitrary strength and orientation is investigated using Brown's continuous diffusion model. The nonlinear complex susceptibility and dynamic magnetic hysteresis (DMH) loops of an individual antiferromagnetic nanoparticle are evaluated and compared with the linear regime for extensive ranges of the anisotropy, the ac and dc magnetic fields, damping, and the specific antiferromagnetic parameter. It is shown that the shape and area of the DMH loops of antiferromagnetic particles are substantially altered by applying a dc field that permits tuning of the specific magnetic power loss in the nanoparticles.

  16. ENSO influence on the North Atlantic European climate: a non-linear and non-stationary approach

    Science.gov (United States)

    López-Parages, Jorge; Rodríguez-Fonseca, Belén; Dommenget, Dietmar; Frauen, Claudia

    2016-10-01

    El Niño Southern Oscillation (ENSO) impact on the North Atlantic European sector (NAE) is still under discussion. Recent studies have found a non stationary feature of this teleconnection, suggesting an effective modulating role of the ocean mean state. Nevertheless, physical explanations about the underlying mechanisms have been little studied in the available literature. In addition, ENSO events show different SST spatial patterns, phases, and amplitudes, which can also influence on the related remote impacts. In view of all this, in the present study a set of partially coupled experiments have been performed with a global atmospheric general circulation model in which different SST ENSO patterns are superimposed over distinct Pacific and Atlantic SST mean states. These SST background conditions are constructed according to the observational difference between periods with a distinct impact of ENSO on the leading Euro-Mediterranean rainfall mode in late winter-early spring. Our results point to two distinct mechanisms associated with ENSO that can be modulated by the SST mean state: (1) the thermally driven direct circulation (Walker and Hadley cells) connecting the Atlantic and Pacific basins, and (2) the Rossby wave propagation from the tropical Pacific to the North Atlantic. The former elucidates that the positive NAO-like pattern usually related to La Niña events could be only valid for selected decades. The latter explains a reinforced signature of Eastern Pacific Niños on the Euro-Mediterranean rainfall when the tropical Pacific is warmer than usual and the North Atlantic is colder than usual. This feature is consistent with the changing ENSO impact identified in previous studies and demonstrates how the ENSO teleconnection with the NAE climate at interannual timecales could be modulated by multidecadal changes in the SST. According to our results, the assumption of stationarity which is still common to many studies of ENSO teleconnections clearly has to

  17. A hybrid AR-EMD-SVR model for the short-term prediction of nonlinear and non-stationary ship motion

    Institute of Scientific and Technical Information of China (English)

    Wen-yang DUAN; Li-min HUANG; Yang HAN; Ya-hui ZHANG; Shuo HUANG

    2015-01-01

    题目:用于非线性非平稳船舶运动极短期预报的一种复合自回归经验模态分解支持向量机回归模型  目的:基于支持向量机回归(SVR)模型在非线时间序列的预测能力及经验模态分解(EMD)方法在处理非线性非平稳性的优势,提出一种复合自回归经验模态分解支持向量机回归(AR-EMD-SVR)模型,提高非线性非平稳船舶运动极短期预报精度。  创新点:1.研究非线性非平稳船舶运动的极短期预报问题,提出一种复合的预报方法;2.基于不同层次的预报模型和模型试验数据,分析非线性非平稳性对极短期预报精度的影响。  方法:1.在SVR模型中引入基于自回归(AR)预报端点延拓的 EMD 方法,形成复合的 AR-EMD-SVR 预报模型;2.基于集装箱船模水池试验运动数据将 AR-EMD-SVR 模型与 AR、SVR 和EMD-AR 三种模型进行比较,分析非线性非平稳性对极短期预报的影响以及不同模型的预报性能。  结论:1. AR-EMD 方法能够有效的克服非平稳对极短期预报模型(AR和 SVR)在精度上所带来的不良影响;2.基于船模试验数据的预报结果表明:相较于 AR、SVR 和 EMD-AR 三种预报模型,基于 AR-EMD-SVR模型的非线性非平稳船舶运动极短期预报结果具有更高的精度。%Accurate and reliable short-term prediction of ship motions offers improvements in both safety and control quality in ship motion sensitive maritime operations. Inspired by the satisfactory nonlinear learning capability of a support vector re-gression (SVR) model and the strong non-stationary processing ability of empirical mode decomposition (EMD), this paper develops a hybrid autoregressive (AR)-EMD-SVR model for the short-term forecast of nonlinear and non-stationary ship motion. The proposed hybrid model is designed by coupling the SVR model with an AR-EMD technique, which employs an AR model in ends

  18. Assessment of the non-Gaussianity and non-linearity levels of simulated sEMG signals on stationary segments.

    Science.gov (United States)

    Messaoudi, Noureddine; Bekka, Raïs El'hadi; Ravier, Philippe; Harba, Rachid

    2017-02-01

    The purpose of this paper was to evaluate the effects of the longitudinal single differential (LSD), the longitudinal double differential (LDD) and the normal double differential (NDD) spatial filters, the electrode shape, the inter-electrode distance (IED) on non-Gaussianity and non-linearity levels of simulated surface EMG (sEMG) signals when the maximum voluntary contraction (MVC) varied from 10% to 100% by a step of 10%. The effects of recruitment range thresholds (RR), the firing rate (FR) strategy and the peak firing rate (PFR) of motor units were also considered. A cylindrical multilayer model of the volume conductor and a model of motor unit (MU) recruitment and firing rate were used to simulate sEMG signals in a pool of 120 MUs for 5s. Firstly, the stationarity of sEMG signals was tested by the runs, the reverse arrangements (RA) and the modified reverse arrangements (MRA) tests. Then the non-Gaussianity was characterised with bicoherence and kurtosis, and non-linearity levels was evaluated with linearity test. The kurtosis analysis showed that the sEMG signals detected by the LSD filter were the most Gaussian and those detected by the NDD filter were the least Gaussian. In addition, the sEMG signals detected by the LSD filter were the most linear. For a given filter, the sEMG signals detected by using rectangular electrodes were more Gaussian and more linear than that detected with circular electrodes. Moreover, the sEMG signals are less non-Gaussian and more linear with reverse onion-skin firing rate strategy than those with onion-skin strategy. The levels of sEMG signal Gaussianity and linearity increased with the increase of the IED, RR and PFR. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Application of a Nonlinear Model to Transcript Levels of Upregulated Stress Response Gene ibpA in Stationary-Phase Salmonella enterica Subjected to Sublethal Heat Stress.

    Science.gov (United States)

    Carroll, Laura M; Bergholz, Teresa M; Hildebrandt, Ian M; Marks, Bradley P

    2016-07-01

    Sublethal heating, which can occur during slow cooking of meat products, is known to induce increased thermal resistance in Salmonella. However, very few studies have addressed the kinetics of this response. Although several recent studies have reported improved thermal inactivation models that include the effect of prior sublethal history on subsequent thermal resistance, none of these models were based on cellular-level responses to sublethal thermal stress. The goal of this study was to determine whether a nonlinear model could accurately portray the response of Salmonella to heat stress induced by prolonged exposure to sublethal temperatures. To accomplish this, stationary-phase Salmonella Montevideo cultures were subjected to various heating profiles (held at either 40 or 45°C for 0, 5, 10, 15, 30, 60, 90, 180, or 240 min) using a PCR thermal cycler. Differential plating on selective and nonselective media was used to confirm the presence of cellular injury. Reverse transcription quantitative PCR was used to screen the transcript levels of six heat stress-related genes to find candidate genes for nonlinear modeling. Injury was detected in populations of Salmonella held at 45°C for 30, 60, and 90 min and at 40°C for 0, 5, and 90 min (P 0.05). The transcript levels of ibpA, which codes for a small heat shock protein associated with the ClpB and DnaK-DnaJ-GrpE chaperone systems, showed the greatest increase relative to the transcript levels at 0 min, which was significant at 5, 10, 15, 30, 60, 90, and 180 min at 45°C and at 5, 10, 15, 30, 60, and 90 min at 40°C (P < 0.05). Using ibpA transcript levels as an indicator of adaptation to thermal stress, a nonlinear model for sublethal injury is proposed. The use of variables indicating the physiological state of the pathogen during stress has the potential to increase the accuracy of thermal inactivation models that must account for prolonged exposure to sublethal temperatures.

  20. Locally Stationary Processes - A Review

    CERN Document Server

    Dahlhaus, Rainer

    2011-01-01

    The article contains an overview over locally stationary processes. At the beginning time varying autoregressive processes are discussed in detail - both as as a deep example and an important class of locally stationary processes. In the next section a general framework for time series with time varying finite dimensional parameters is discussed with special emphasis on nonlinear locally stationary processes. Then the paper focusses on linear processes where a more general theory is possible. First a general definition for linear processes is given and time varying spectral densities are discussed in detail. Then the Gaussian likelihood theory is presented for locally stationary processes. In the next section the relevance of empirical spectral processes for locally stationary time series is discussed. Empirical spectral processes play a major role in proving theoretical results and provide a deeper understanding of many techniques. The article concludes with an overview of other results for locally stationar...

  1. NON-STATIONARY RANDOM VIBRATION AND OPTIMAL ACTIVE CONTROL OF A HALF-CAR NONLINEAR SUSPENSION%半车非线性悬架的非平稳随机振动及控制

    Institute of Scientific and Technical Information of China (English)

    罗璇; 靳艳飞

    2013-01-01

    This paper studied the non-stationary stochastic response and the optimal control of a half-car dynamical model with nonlinear active suspension under the excitation of random road surface.Using the method of equivalent linearization,the response statistics and stochastic optimal control of the nonlinear suspension were obtained.The comparison and analysis of the non-stationary response of active and passive suspension show that the nonlinear active suspension is better than the passive suspension.Finally,the accuracy of the equivalent linearization technique was verified by Monte Carlo simulation.%研究了1/2车非线性悬架模型在路面随机激励下的非平稳振动响应,并基于随机最优控制理论对其进行主动控制.首先利用等效线性化方法将具有非线性阻尼及迟滞刚度的非线性悬架模型线性化,然后将主动、被动悬架非平稳随机响应进行比较,结果表明非线性主动悬架的性能要优于被动悬架.最后,通过Monte-Carlo数值模拟验证了理论结果.

  2. Superparamagnetic state by linear and non-linear AC magnetic susceptibility in Mn0.5Zn0.5Fe2O4 ferrites nanoparticles.

    Science.gov (United States)

    Suneetha, T; Kundu, S; Kashyap, Subhash C; Gupta, H C; Nath, T K

    2013-01-01

    The Mn0.5Zn0.5Fe2O4 nanoparticles has been synthesized using citrate-gel-precursor method. The direct mixing of nitrates and acetates yields homogeneous nanoparticles. Phase formation and crystal structure of the synthesized powder were examined through the X-ray diffraction (XRD). Fourier transform infrared (FTIR) spectra of the sample confirm the spinel structure. The average particle size was determined by transmission electron microscopy (TEM) and field emission scanning electron microscopy (FESEM). The average particle size is found to be about 13 nm. Superparamagnetic-like nature of the nanoparticles of Mn0.5Zn0.5Fe2O4 has been revealed through various dc and linear and non-linear ac magnetization measurements. However, the nanoparticles do not behave like ideal non-interacting superparamagnets. The magnetic particle size is found to be about 8 nm with saturation magnetization about 18.1 emu/g. The blocking temperature (T(B)) of the nanoparticle assembly is found to be about 150 K as observed from dc and ac magnetization measurements. The frequency dependence of the blocking temperature (T(B)) is found to follow Vogel-Fulcher law. The associated characteristic time tau0 is found to be 10(-5) s. This value is different from that generally found for non-interacting superparamagnetic (SPM) systems (tau0 = 10(-9)-10(-10) s).

  3. Asymptotic analysis of solution to the nonlinear problem of non-stationary heat conductivity of layered anisotropic non-uniform shells at low Biot numbers on the front surfaces

    Science.gov (United States)

    Yankovskii, A. P.

    2017-03-01

    The nonlinear problem of non-stationary heat conductivity of the layered anisotropic heat-sensitive shells was formulated taking into account the linear dependence of thermal-physical characteristics of the materials of phase compositions on the temperature. The initial-boundary-value problem is formulated in the dimensionless form, and four small parameters are identified: thermal-physical, characterizing the degree of heat sensitivity of the layer material; geometric, characterizing the relative thickness of the thin-walled structure, and two small Biot numbers on the front surfaces of shells. A sequential recursion of dimensionless equations is carried out, at first, using the thermalphysical small parameter, then, small Biot numbers and, finally, geometrical small parameter. The first type of recursion allowed us to linearize the problem of heat conductivity, and on the basis of two latter types of recursion, the outer asymptotic expansion of solution to the problem of non-stationary heat conductivity of the layered anisotropic non-uniform shells and plates under boundary conditions of the II and III kind and small Biot numbers on the facial surfaces was built, taking into account heat sensitivity of the layer materials. The resulting two-dimensional boundary problems were analyzed, and asymptotic properties of solutions to the heat conductivity problem were studied. The physical explanation was given to some aspects of asymptotic temperature decomposition.

  4. Non-stationary and non-linear influence of ENSO and Indian Ocean Dipole on the variability of Indian monsoon rainfall and extreme rain events

    Science.gov (United States)

    Krishnaswamy, Jagdish; Vaidyanathan, Srinivas; Rajagopalan, Balaji; Bonell, Mike; Sankaran, Mahesh; Bhalla, R. S.; Badiger, Shrinivas

    2015-07-01

    The El Nino Southern Oscillation (ENSO) and the Indian Ocean Dipole (IOD) are widely recognized as major drivers of inter-annual variability of the Indian monsoon (IM) and extreme rainfall events (EREs). We assess the time-varying strength and non-linearity of these linkages using dynamic linear regression and Generalized Additive Models. Our results suggest that IOD has evolved independently of ENSO, with its influence on IM and EREs strengthening in recent decades when compared to ENSO, whose relationship with IM seems to be weakening and more uncertain. A unit change in IOD currently has a proportionately greater impact on IM. ENSO positively influences EREs only below a threshold of 100 mm day-1. Furthermore, there is a non-linear and positive relationship between IOD and IM totals and the frequency of EREs (>100 mm day-1). Improvements in modeling this complex system can enhance the forecasting accuracy of the IM and EREs.

  5. Self-Organized Stationary States of Tokamaks.

    Science.gov (United States)

    Jardin, S C; Ferraro, N; Krebs, I

    2015-11-20

    We demonstrate that in a 3D resistive magnetohydrodynamic simulation, for some parameters it is possible to form a stationary state in a tokamak where a saturated interchange mode in the center of the discharge drives a near helical flow pattern that acts to nonlinearly sustain the configuration by adjusting the central loop voltage through a dynamo action. This could explain the physical mechanism for maintaining stationary nonsawtoothing "hybrid" discharges, often referred to as "flux pumping."

  6. Stationary Light Pulses in Cold Atomic Media

    CERN Document Server

    Liao, Wen-Te; Peters, Thorsten; Chou, Hung-Chih; Wang, Jian-Siung; Kuan, Pei-Chen; Yu, Ite A

    2008-01-01

    Stationary light pulses (SLPs), i.e., light pulses without motion, are formed via the retrieval of stored probe pulses with two counter-propagating coupling fields. We show that there exist non-negligible hybrid Raman excitations in media of cold atoms that prohibit the SLP formation. We experimentally demonstrate a method to suppress these Raman excitations and realize SLPs in laser-cooled atoms. Our work opens the way to SLP studies in cold as well as in stationary atoms and provides a new avenue to low-light-level nonlinear optics.

  7. Total AC loss of YBCO coated conductor carrying AC transport current in AC transverse magnetic field with various orientations

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, Naoyuki [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Jiang, Zhenan [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Iijima, Yasuhiro [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Kakimoto, Kazuomi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Saitoh, Takashi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan)

    2004-08-01

    Using an electro-magnetic method, we measured the total AC loss of a YBCO coated conductor carrying an AC transport current in an AC transverse magnetic field with various orientations. We measured the magnetization loss (energy flow from the external magnetic field) and the transport loss (energy flow from the transport current circuit) independently during simultaneous application of an AC transverse magnetic field and AC transport current. Their sum gave us the total AC loss. The transport loss increases with increasing AC transverse magnetic field, and the magnetization loss increases with increasing AC transport current. The AC transverse magnetic field and the AC self magnetic field interact with each other at the conductor edges. This nonlinear interaction is a possible cause of the increase in AC loss. Due to the high aspect ratio of YBCO coated conductors, this increase in AC loss due to the interaction between the AC transverse and AC self magnetic fields is observed even when the transverse magnetic field is nearly parallel to the conductor wide-face. When the total AC losses for various transport currents and various field orientations are plotted against a transverse magnetic field component which is perpendicular to the conductor wide-face, the plots with different field angles but identical transport current all agree quite well with each other. The total AC loss is dominated by the self magnetic field and the perpendicular component of the transverse magnetic field, both of which mostly penetrate from the conductor edges.

  8. Delocalization of disturbances and the stability of ac electricity grids

    Science.gov (United States)

    Kettemann, Stefan

    2016-12-01

    In order to study how local disturbances affect the ac grid stability, we start from nonlinear power balance equations and map them to complex linear wave equations. Having obtained stationary solutions with phases φi at generator and consumer nodes i , we next study the dynamics of deviations. Starting with an initially localized perturbation, it is found to spread in a periodic grid diffusively throughout the grid. We find the parametric dependence of diffusion constant D . We apply the same solution strategy to general grid topologies and analyze their stability against local perturbations. The perturbation remains either localized or becomes delocalized, depending on grid topology, power capacity, and distribution of consumers and generator power Pi. Delocalization is found to increase the lifetime of perturbations and thereby their influence on grid stability, whereas localization results in an exponentially fast decay of perturbations at all grid sites. These results may therefore lead to new strategies to control the stability of electricity grids.

  9. Nonlinear PDEs

    OpenAIRE

    2015-01-01

    From the Back Cover: The emphasis throughout the present volume is on the practical application of theoretical mathematical models helping to unravel the underlying mechanisms involved in processes from mathematical physics and biosciences. It has been conceived as a unique collection of abstract methods dealing especially with nonlinear partial differential equations (either stationary or evolutionary) that are applied to understand concrete processes involving some important applications re...

  10. Stationary dynamical systems

    CERN Document Server

    Furstenberg, Hillel

    2009-01-01

    Following works of Furstenberg and Nevo and Zimmer we present an outline of a theory of stationary (or m-stationary) dynamical systems for a general acting group G equipped with a probability measure m. Our purpose is two-fold: First to suggest a more abstract line of development, including a simple structure theory. Second, to point out some interesting applications; one of these is a Szemeredi type theorem for SL(2,R).

  11. Large A.C. machines theory and investigation methods of currents and losses in stator and rotor meshes including operation with nonlinear loads

    CERN Document Server

    Boguslawsky, Iliya; Hayakawa, Masashi

    2017-01-01

    In this monograph the authors solve the modern scientific problems connected with A.C. motors and generators, based first on the detailed consideration of their physical phenomena. The authors describe the theory and investigative methods they developed and applied in practice, which are considered to be of essential interest for specialists in the field of the electrical engineering industry in European countries, the USA, Argentina, and Brazil, as well as in such countries as India, China, and Iran. This book will be of interest to engineers specialized in the field of the manufacture, operation, and repair of A.C. machines (motors and generators) as well as electric drives; to professors, lecturers, and post-graduate students of technical universities, who are specializing in the field of electric machine engineering and electric drives; and to students who are engaged in the field of high current techniques, electric drives, and electric machine engineering.

  12. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  13. Synthesis of novel chiral stationary phases for high-performance liquid chromatography

    Institute of Scientific and Technical Information of China (English)

    Xu Lin Tan; Shi Cong Hou; Qing Hua Bian; Min Wang

    2007-01-01

    Three novel chiral selectors 4a-c were synthesized from (S)-amino acids and (R)- 1-phenyl-2-(4-methylphenyl)ethylamine. 4a-c were connected to 3-aminopropylsilanized silica gel to be used as the chiral stationary phase for HPLC. Five amino acid derivatives and two pyrethroid insecticides were fairly resolved on these three new chiral stationary phases under normal phase condition.

  14. Trapping of light pulses in ensembles of stationary Lambda atoms

    OpenAIRE

    Hansen, Kristian Rymann; Molmer, Klaus

    2007-01-01

    We present a detailed theoretical description of the generation of stationary light pulses by standing wave electromagnetically induced transparency in media comprised of stationary atoms. We show that, contrary to thermal gas media, the achievable storage times are limited only by the ground state dephasing rate of the atoms, making such media ideally suited for nonlinear optical interactions between stored pulses. Furthermore, we find significant quantitative and qualitative differences bet...

  15. Stationary Black Holes: Uniqueness and Beyond

    Directory of Open Access Journals (Sweden)

    Piotr T. Chruściel

    2012-05-01

    Full Text Available The spectrum of known black-hole solutions to the stationary Einstein equations has been steadily increasing, sometimes in unexpected ways. In particular, it has turned out that not all black-hole-equilibrium configurations are characterized by their mass, angular momentum and global charges. Moreover, the high degree of symmetry displayed by vacuum and electro vacuum black-hole spacetimes ceases to exist in self-gravitating non-linear field theories. This text aims to review some developments in the subject and to discuss them in light of the uniqueness theorem for the Einstein-Maxwell system.

  16. Stationary Black Holes: Uniqueness and Beyond

    Directory of Open Access Journals (Sweden)

    Heusler Markus

    1998-01-01

    Full Text Available The spectrum of known black hole solutions to the stationary Einstein equations has increased in an unexpected way during the last decade. In particular, it has turned out that not all black hole equilibrium configurations are characterized by their mass, angular momentum and global charges. Moreover, the high degree of symmetry displayed by vacuum and electro-vacuum black hole space-times ceases to exist in self-gravitating non-linear field theories. This text aims to review some of the recent developments and to discuss them in the light of the uniqueness theorem for the Einstein-Maxwell system.

  17. Large-scale stationary and turbulent flow over topography

    Science.gov (United States)

    Vallis, G. K.; Roads, J. O.

    1984-01-01

    The contributions made to the formation of stationary features of flow over topography by linear and nonlinear dynamics were examined with an integrated quasi-geostrophic model with idealized topographic forcing. The simulation was run out to several months and generated time-averaged values which were compared with those obtained with linear theory. Linear predictions were converted to turbulent features through the addition of stationary, nonlinear thermodynamic and transient vorticity fluxes. The turbulence features matched atmospheric data on energy spectra, the direction and magnitude of energy transfers, and the spatial magnitudes involved. Transient flow transferred the majority of energy absorbed by the upscale flow and, by absorbing energy, reduced the energy of stationary flow while retaining resonance signatures. Instability was a pervasive feature of the topographically forced flow except at high wavenumbers. The results confirm that transient eddies are interactive with both asymmetric and zonal flow and cannot be adequately described by linear theory.

  18. Gyrokinetic modelling of stationary electron and impurity profiles in tokamaks

    CERN Document Server

    Skyman, Andreas; Tegnered, Daniel

    2014-01-01

    Particle transport due to Ion Temperature Gradient/Trapped Electron (ITG/TE) mode turbulence is investigated using the gyrokinetic code GENE. Both a reduced quasilinear (QL) treatment and nonlinear (NL) simulations are performed for typical tokamak parameters corresponding to ITG dominated turbulence. A selfconsistent treatment is used, where the stationary local profiles are calculated corresponding to zero particle flux simultaneously for electrons and trace impurities. The scaling of the stationary profiles with magnetic shear, safety factor, electron-to-ion temperature ratio, collisionality, toroidal sheared rotation, triangularity, and elongation is investigated. In addition, the effect of different main ion mass on the zero flux condition is discussed. The electron density gradient can significantly affect the stationary impurity profile scaling. It is therefore expected, that a selfconsistent treatment will yield results more comparable to experimental results for parameter scans where the stationary b...

  19. STABLE STATIONARY STATES OF NON-LOCAL INTERACTION EQUATIONS

    KAUST Repository

    FELLNER, KLEMENS

    2010-12-01

    In this paper, we are interested in the large-time behaviour of a solution to a non-local interaction equation, where a density of particles/individuals evolves subject to an interaction potential and an external potential. It is known that for regular interaction potentials, stable stationary states of these equations are generically finite sums of Dirac masses. For a finite sum of Dirac masses, we give (i) a condition to be a stationary state, (ii) two necessary conditions of linear stability w.r.t. shifts and reallocations of individual Dirac masses, and (iii) show that these linear stability conditions imply local non-linear stability. Finally, we show that for regular repulsive interaction potential Wε converging to a singular repulsive interaction potential W, the Dirac-type stationary states ρ̄ ε approximate weakly a unique stationary state ρ̄ ∈ L∞. We illustrate our results with numerical examples. © 2010 World Scientific Publishing Company.

  20. Approximating Stationary Statistical Properties

    Institute of Scientific and Technical Information of China (English)

    Xiaoming WANG

    2009-01-01

    It is well-known that physical laws for large chaotic dynamical systems are revealed statistically. Many times these statistical properties of the system must be approximated numerically. The main contribution of this manuscript is to provide simple and natural criterions on numerical methods (temporal and spatial discretization) that are able to capture the stationary statistical properties of the underlying dissipative chaotic dynamical systems asymptotically. The result on temporal approximation is a recent finding of the author, and the result on spatial approximation is a new one. Applications to the infinite Prandtl number model for convection and the barotropic quasi-geostrophic model are also discussed.

  1. Stationary oscillation of an impulsive delayed system and its application to chaotic neural networks.

    Science.gov (United States)

    Sun, Jitao; Lin, Hai

    2008-09-01

    This paper investigates the stationary oscillation for an impulsive delayed system which represents a class of nonlinear hybrid systems. First, a new concept of S-stability is introduced for nonlinear impulsive delayed systems. Based on this new concept and fixed point theorem, the relationship between S-stability and stationary oscillation (i.e., existence, uniqueness and global stability of periodic solutions) for the nonlinear impulsive delayed system is explored. It is shown that the nonlinear impulsive delayed system has a stationary oscillation if the system is S-stable. Second, an easily verifiable sufficient condition is then obtained for stationary oscillations of nonautonomous neural networks with both time delays and impulses by using the new criterion. Finally, an illustrative example is given to demonstrate the effectiveness of the proposed method.

  2. Ceramic stationary gas turbine

    Energy Technology Data Exchange (ETDEWEB)

    Roode, M. van [Solar Turbines Inc., San Diego, CA (United States)

    1995-10-01

    The performance of current industrial gas turbines is limited by the temperature and strength capabilities of the metallic structural materials in the engine hot section. Because of their superior high-temperature strength and durability, ceramics can be used as structural materials for hot section components (blades, nozzles, combustor liners) in innovative designs at increased turbine firing temperatures. The benefits include the ability to increase the turbine inlet temperature (TIT) to about 1200{degrees}C ({approx}2200{degrees}F) or more with uncooled ceramics. It has been projected that fully optimized stationary gas turbines would have a {approx}20 percent gain in thermal efficiency and {approx}40 percent gain in output power in simple cycle compared to all metal-engines with air-cooled components. Annual fuel savings in cogeneration in the U.S. would be on the order of 0.2 Quad by 2010. Emissions reductions to under 10 ppmv NO{sub x} are also forecast. This paper describes the progress on a three-phase, 6-year program sponsored by the U.S. Department of Energy, Office of Industrial Technologies, to achieve significant performance improvements and emissions reductions in stationary gas turbines by replacing metallic hot section components with ceramic parts. Progress is being reported for the period September 1, 1994, through September 30, 1995.

  3. Ceramic stationary gas turbine

    Energy Technology Data Exchange (ETDEWEB)

    Roode, M. van

    1995-12-31

    The performance of current industrial gas turbines is limited by the temperature and strength capabilities of the metallic structural materials in the engine hot section. Because of their superior high-temperature strength and durability, ceramics can be used as structural materials for hot section components (blades, nozzles, combustor liners) in innovative designs at increased turbine firing temperatures. The benefits include the ability to increase the turbine inlet temperature (TIT) to about 1200{degrees}C ({approx}2200{degrees}F) or more with uncooled ceramics. It has been projected that fully optimized stationary gas turbines would have a {approx}20 percent gain in thermal efficiency and {approx}40 percent gain in output power in simple cycle compared to all metal-engines with air-cooled components. Annual fuel savings in cogeneration in the U.S. would be on the order of 0.2 Quad by 2010. Emissions reductions to under 10 ppmv NO{sub x} are also forecast. This paper describes the progress on a three-phase, 6-year program sponsored by the U.S. Department of Energy, Office of Industrial Technologies, to achieve significant performance improvements and emissions reductions in stationary gas turbines by replacing metallic hot section components with ceramic parts. Progress is being reported for the period September 1, 1994, through September 30, 1995.

  4. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  5. Discrete nonlinear Schrodinger equations with arbitrarily high-order nonlinearities

    DEFF Research Database (Denmark)

    Khare, A.; Rasmussen, Kim Ø; Salerno, M.

    2006-01-01

    A class of discrete nonlinear Schrodinger equations with arbitrarily high-order nonlinearities is introduced. These equations are derived from the same Hamiltonian using different Poisson brackets and include as particular cases the saturable discrete nonlinear Schrodinger equation and the Ablowi......-Ladik equation. As a common property, these equations possess three kinds of exact analytical stationary solutions for which the Peierls-Nabarro barrier is zero. Several properties of these solutions, including stability, discrete breathers, and moving solutions, are investigated....

  6. Nonlinear Control Systems

    Science.gov (United States)

    2007-03-01

    IEEE Transactions on Automatic Control , AC- 48, pp. 1712-1723, (2003). [14] C.I. Byrnes, A. Isidori...Nonlinear internal models for output regulation,” IEEE Transactions on Automatic Control , AC-49, pp. 2244-2247, (2004). [15] C.I. Byrnes, F. Celani, A...approach,” IEEE Transactions on Automatic Control , 48 (Dec. 2003), 2172–2190. 2. C. I. Byrnes, “Differential Forms and Dynamical Systems,” to appear

  7. Nonlinear quasimodes near elliptic periodic geodesics

    CERN Document Server

    Albin, Pierre; Marzuola, Jeremy L; Thomann, Laurent

    2011-01-01

    We consider the nonlinear Schr\\"odinger equation on a compact manifold near an elliptic periodic geodesic. Using a geometric optics construction, we construct quasimodes to a nonlinear stationary problem which are highly localized near the periodic geodesic. We show the nonlinear Schr\\"odinger evolution of such a quasimode remains localized near the geodesic, at least for short times.

  8. On Asymptotic Completeness of Scattering in the Nonlinear Lamb System, II

    CERN Document Server

    Komech, A I

    2012-01-01

    We establish the asymptotic completeness in the nonlinear Lamb system for hyperbolic stationary states. For the proof we construct a trajectory of a reduced equation (which is a nonlinear nonautonomous ODE) converging to a hyperbolic stationary point using the Inverse Function Theorem in a Banach space. We give the counterexamples showing nonexistence of such trajectories for nonhyperbolic stationary points.

  9. Stationary and Transient Response Statistics

    DEFF Research Database (Denmark)

    Madsen, Peter Hauge; Krenk, Steen

    1982-01-01

    The covariance functions for the transient response of a linear MDOF-system due to stationary time limited excitation with an arbitrary frequency content are related directly to the covariance functions of the stationary response. For rational spectral density functions closed form expressions...

  10. Dynamics of breathers in discrete nonlinear Schrodinger models

    DEFF Research Database (Denmark)

    Christiansen, Peter Leth; Johansson, Magnus; Aubry, Serge

    1998-01-01

    We review some recent results concerning the existence and stability of spatially localized and temporally quasiperiodic (non-stationary) excitations in discrete nonlinear Schrodinger (DNLS) models. In two dimensions, we show the existence of linearly stable, stationary and non-stationary localized...

  11. A Family of Exact Solutions for the Nonlinear Schrodinger Equation

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    In this paper, the nonlinear Schrodinger (NLS) equation was analytically solved. Firstly, the stationary solutions of NLSequation were explicitly given by the elliptic functions. Then a family of exact solutions of NLS equation were obtained from these sta-tionary solutions by a method for finding new exact solutions from the stationary solutions of integrable evolution equations.

  12. Influence of Stationary Crossflow Modulation on Secondary Instability

    Science.gov (United States)

    Choudhari, Meelan M.; Li, Fei; Paredes, Pedro

    2016-01-01

    A likely scenario for swept wing transition on subsonic aircraft with natural laminar flow involves the breakdown of stationary crossflow vortices via high frequency secondary instability. A majority of the prior research on this secondary instability has focused on crossflow vortices with a single dominant spanwise wavelength. This paper investigates the effects of the spanwise modulation of stationary crossflow vortices at a specified wavelength by a subharmonic stationary mode. Secondary instability of the modulated crossflow pattern is studied using planar, partial-differential-equation based eigenvalue analysis. Computations reveal that weak modulation by the first subharmonic of the input stationary mode leads to mode splitting that is particularly obvious for Y-type secondary modes that are driven by the wall-normal shear of the basic state. Thus, for each Y mode corresponding to the fundamental wavelength of results in unmodulated train of crossflow vortices, the modulated flow supports a pair of secondary modes with somewhat different amplification rates. The mode splitting phenomenon suggests that a more complex stationary modulation such as that induced by natural surface roughness would yield a considerably richer spectrum of secondary instability modes. Even modest levels of subharmonic modulation are shown to have a strong effect on the overall amplification of secondary disturbances, particularly the Z-modes driven by the spanwise shear of the basic state. Preliminary computations related to the nonlinear breakdown of these secondary disturbances provide interesting insights into the process of crossflow transition in the presence of the first subharmonic of the dominant stationary vortex.

  13. Curvature-induced symmetry breaking in nonlinear Schrodinger models

    DEFF Research Database (Denmark)

    Gaididei, Yuri Borisovich; Mingaleev, S. F.; Christiansen, Peter Leth

    2000-01-01

    We consider a curved chain of nonlinear oscillators and show that the interplay of curvature and nonlinearity leads to a symmetry breaking when an asymmetric stationary state becomes energetically more favorable than a symmetric stationary state. We show that the energy of localized states decrea...

  14. Asymptotic Limit of a Singularly Perturbed Stationary Diffusion Equation: The Case of a Limit Cycle

    CERN Document Server

    Ge, Hao

    2010-01-01

    A limit cycle for a nonlinear ordinary differential equation has a sustained, stationary oscillation in time; Any non-trivial stationary stochastic process also exhibits stationary oscillations in time, though with randomness and a stationary probability density. A reconciliation of these two views of oscillatory dynamics has been elusive, although it becomes increasingly important in the biochemical modeling of cellular dynamics, where stochatic models based on the chemical master equation and the deterministic model based on the Law of Mass Action are routinely compared. Using a singularly perturbed stationary diffusion equation as a model for the chemical master equation with sufficiently large volume, $\\epsilon \\leftrightarrow 1/V$, we show that its stationary solution $u(\\vx)$ exhibits a clear separation of the exponentially and algebraic small contributions: $u(\\vx)=C_{\\epsilon}(\\vx) e^{-\\phi(\\vx)/\\epsilon}$, in which $\\phi(x)\\ge 0$ and $=0$ on the entire stable limit cycle. On the limit cycle, $C_0(\\vx...

  15. Filamentation with nonlinear Bessel vortices.

    Science.gov (United States)

    Jukna, V; Milián, C; Xie, C; Itina, T; Dudley, J; Courvoisier, F; Couairon, A

    2014-10-20

    We present a new type of ring-shaped filaments featured by stationary nonlinear high-order Bessel solutions to the laser beam propagation equation. Two different regimes are identified by direct numerical simulations of the nonlinear propagation of axicon focused Gaussian beams carrying helicity in a Kerr medium with multiphoton absorption: the stable nonlinear propagation regime corresponds to a slow beam reshaping into one of the stationary nonlinear high-order Bessel solutions, called nonlinear Bessel vortices. The region of existence of nonlinear Bessel vortices is found semi-analytically. The influence of the Kerr nonlinearity and nonlinear losses on the beam shape is presented. Direct numerical simulations highlight the role of attractors played by nonlinear Bessel vortices in the stable propagation regime. Large input powers or small cone angles lead to the unstable propagation regime where nonlinear Bessel vortices break up into an helical multiple filament pattern or a more irregular structure. Nonlinear Bessel vortices are shown to be sufficiently intense to generate a ring-shaped filamentary ionized channel in the medium which is foreseen as opening the way to novel applications in laser material processing of transparent dielectrics.

  16. A simple stationary semi-analytical wake model

    DEFF Research Database (Denmark)

    Larsen, Gunner Chr.

    -uniform mean wind field, although the modelling of the individual stationary wake flow fields includes non-linear terms. The simulation of the individual wake contributions are based on an analytical solution of the thin shear layer approximation of the NS equations. The wake flow fields are assumed......We present an idealized simple, but fast, semi-analytical algorithm for computation of stationary wind farm wind fields with a possible potential within a multi-fidelity strategy for wind farm topology optimization. Basically, the model considers wakes as linear perturbations on the ambient non...... rotationally symmetric, and the rotor inflow fields are consistently assumed uniform. Expansion of stationary wake fields is believed to be significantly affected by meandering of wake deficits as e.g. described by the Dynamic Wake Meandering model. In the present context, this effect is approximately...

  17. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  18. Stationary Light Pulses without Bragg Gratings

    CERN Document Server

    Lin, Yen-Wei; Peters, Thorsten; Liao, Wen-Te; Cho, Hung-Wen; Guan, Pei-Chen; Yu, Ite A

    2008-01-01

    The underlying mechanism of the stationary light pulse (SLP) was identified as a band gap being created by a Bragg grating formed by two counter-propagating coupling fields of similar wavelength. Here we present a more general view of the formation of SLPs, namely several balanced four-wave mixing processes sharing the same ground-state coherence. Utilizing this new concept we report the first experimental observation of a bichromatic SLP at wavelengths for which no Bragg grating can be established. We also demonstrate the production of a SLP directly from a propagating light pulse without prior storage. Being easily controlled externally makes SLPs a very versatile tool for low-light-level nonlinear optics and quantum information manipulation.

  19. Nonparametric Nonlinear Cotrending Analysis, with an Application to Interest and Inflation in the U.S

    NARCIS (Netherlands)

    Bierens, H.J.

    1996-01-01

    Given the assumption that the components of a vector time series are stationary about nonlinear deterministic time trends, nonlinear co-trending is the phenomenon that one or more linear combinations of the time series are stationary about a linear trend, hence the series have common nonlinear

  20. Current Control of Grid Converters Connected with Series AC Capacitor

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang

    2015-01-01

    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...

  1. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  2. Stability of a stationary solution for the Lugiato-Lefever equation

    OpenAIRE

    MIYAJI, TOMOYUKI; Ohnishi, Isamu; Tsutsumi, Yoshi

    2011-01-01

    We study the stability of a stationary solution for the Lugiato-Lefever equation with the periodic boundary condition in one space dimension, which is a damped and driven nonlinear Schrödinger equation introduced to model the optical cavity. In this paper, we prove the Strichartz estimates for the linear damped Schrödinger equation with potential and external forcing and investigate the stability of certain stationary solutions under the initial perturbation within the framework of $L^2...

  3. Nonequilibrium stationary states and entropy.

    Science.gov (United States)

    Gallavotti, G; Cohen, E G D

    2004-03-01

    In transformations between nonequilibrium stationary states, entropy might not be a well defined concept. It might be analogous to the "heat content" in transformations in equilibrium which is not well defined either, if they are not isochoric (i.e., do involve mechanical work). Hence we conjecture that in a nonequilibrium stationary state the entropy is just a quantity that can be transferred or created, such as heat in equilibrium, but has no physical meaning as "entropy content" as a property of the system.

  4. Condensational theory of stationary tornadoes

    CERN Document Server

    Makarieva, Anastassia M; Nefiodov, Andrei V; 10.1016/j.physleta.2011.04.023

    2012-01-01

    Using the Bernoulli integral for air streamline with condensing water vapor a stationary axisymmetric tornado circulation is described. The obtained profiles of vertical, radial and tangential velocities are in agreement with observations for the Mulhall tornado, world's largest on record and longest-lived among the three tornadoes for which 3D velocity data are available. Maximum possible vortex velocities are estimated.

  5. Stationary Measure in the Multiverse

    OpenAIRE

    Linde, Andrei; Vanchurin, Vitaly; Winitzki, Sergei

    2008-01-01

    We study the recently proposed "stationary measure" in the context of the string landscape scenario. We show that it suffers neither from the "Boltzmann brain" problem nor from the "youngness" paradox that makes some other measures predict a high CMB temperature at present. We also demonstrate a satisfactory performance of this measure in predicting the results of local experiments, such as proton decay.

  6. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  7. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  8. Non-Stationary Random Response of MDOF Duffing Systems

    Directory of Open Access Journals (Sweden)

    J.H. Lin

    2004-01-01

    Full Text Available This paper presents a method to solve non-stationary random responses of nonlinear multi-degrees-of-freedom (MDOF Duffing systems subjected to evolutionary random excitations. Specific phase-lags between the excitations can also be taken into account. The power spectral density (PSD of the input excitations is not confined to simple white noise or filtered white noise, in fact it can also take more complicated forms. The MDOF nonlinear random differential equations are iteratively solved by means of the Equivalent Linearization Method (ELM combined with the Pseudo Excitation Method (PEM. This combined method is easy and efficient. Two examples are given in which this method is well justified by the Monte-Carlo numerical simulations. Although only a Duffing model is dealt with in this paper for computational simplicity, the proposed method is in fact quite general, e.g. it can also deal with nonlinear hysteretic structures that will be dealt with in a separate paper.

  9. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  10. Time scale of stationary decoherence

    Science.gov (United States)

    Polonyi, Janos

    2017-07-01

    The decoherence of a test particle interacting with an ideal gas is studied by the help of the effective Lagrangian, derived in the leading order of the perturbation expansion and in order O (∂t2) . The stationary decoherence time is found to be comparable to or longer than the diffusion time. The decoherence time reaches its minimal value for classical, completely decohered environment, suggesting that physical decoherence is slowed down as compared with diffusion by the quantum coherence of the environment.

  11. Stationary measure in the multiverse

    Energy Technology Data Exchange (ETDEWEB)

    Linde, Andrei [Department of Physics, Stanford University, Stanford, CA 94305 (United States); Vanchurin, Vitaly; Winitzki, Sergei, E-mail: alinde@stanford.edu, E-mail: vitaly@cosmos2.phy.tufts.edu, E-mail: winitzki@physik.uni-muenchen.de [Department of Physics, Ludwig-Maximilians University, Munich (Germany)

    2009-01-15

    We study the recently proposed ''stationary measure'' in the context of the string landscape scenario. We show that it suffers neither from the ''Boltzmann brain'' problem nor from the ''youngness'' paradox that makes some other measures predict a high CMB temperature at present. We also demonstrate a good performance of this measure in predicting the results of local experiments, such as proton decay.

  12. A stationary q-metric

    CERN Document Server

    Toktarbay, Saken

    2015-01-01

    We present a stationary generalization of the static $q-$metric, the simplest generalization of the Schwarzschild solution that contains a quadrupole parameter. It possesses three independent parameters that are related to the mass, quadrupole moment and angular momentum. We investigate the geometric and physical properties of this exact solution of Einstein's vacuum equations, and show that it can be used to describe the exterior gravitational field of rotating, axially symmetric, compact objects.

  13. A stationary q-metric

    Science.gov (United States)

    Toktarbay, S.; Quevedo, H.

    2014-10-01

    We present a stationary generalization of the static $q-$metric, the simplest generalization of the Schwarzschild solution that contains a quadrupole parameter. It possesses three independent parameters that are related to the mass, quadrupole moment and angular momentum. We investigate the geometric and physical properties of this exact solution of Einstein's vacuum equations, and show that it can be used to describe the exterior gravitational field of rotating, axially symmetric, compact objects.

  14. High efficiency stationary hydrogen storage

    Energy Technology Data Exchange (ETDEWEB)

    Hynek, S.; Fuller, W.; Truslow, S. [Arthur D. Little, Inc., Cambridge, MA (United States)

    1995-09-01

    Stationary storage of hydrogen permits one to make hydrogen now and use it later. With stationary hydrogen storage, one can use excess electrical generation capacity to power an electrolyzer, and store the resultant hydrogen for later use or transshipment. One can also use stationary hydrogen as a buffer at fueling stations to accommodate non-steady fueling demand, thus permitting the hydrogen supply system (e.g., methane reformer or electrolyzer) to be sized to meet the average, rather than the peak, demand. We at ADL designed, built, and tested a stationary hydrogen storage device that thermally couples a high-temperature metal hydride to a phase change material (PCM). The PCM captures and stores the heat of the hydriding reaction as its own heat of fusion (that is, it melts), and subsequently returns that heat of fusion (by freezing) to facilitate the dehydriding reaction. A key component of this stationary hydrogen storage device is the metal hydride itself. We used nickel-coated magnesium powder (NCMP) - magnesium particles coated with a thin layer of nickel by means of chemical vapor deposition (CVD). Magnesium hydride can store a higher weight fraction of hydrogen than any other practical metal hydride, and it is less expensive than any other metal hydride. We designed and constructed an experimental NCM/PCM reactor out of 310 stainless steel in the form of a shell-and-tube heat exchanger, with the tube side packed with NCMP and the shell side filled with a eutectic mixture of NaCL, KCl, and MgCl{sub 2}. Our experimental results indicate that with proper attention to limiting thermal losses, our overall efficiency will exceed 90% (DOE goal: >75%) and our overall system cost will be only 33% (DOE goal: <50%) of the value of the delivered hydrogen. It appears that NCMP can be used to purify hydrogen streams and store hydrogen at the same time. These prospects make the NCMP/PCM reactor an attractive component in a reformer-based hydrogen fueling station.

  15. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  16. Quasi-stationary distributions and population processes

    CERN Document Server

    Méléard, Sylvie

    2011-01-01

    This survey concerns the study of quasi-stationary distributions with a specific focus on models derived from ecology and population dynamics. We are concerned with the long time behavior of different stochastic population size processes when 0 is an absorbing point almost surely attained by the process. The hitting time of this point, namely the extinction time, can be large compared to the physical time and the population size can fluctuate for large amount of time before extinction actually occurs. This phenomenon can be understood by the study of quasi-limiting distributions. In this paper, general results on quasi-stationarity are given and examples developed in detail. One shows in particular how this notion is related to the spectral properties of the semi-group of the process killed at 0. Then we study different stochastic population models including nonlinear terms modeling the regulation of the population. These models will take values in countable sets (as birth and death processes) or in continuou...

  17. Handbook of differential equations stationary partial differential equations

    CERN Document Server

    Chipot, Michel

    2006-01-01

    This handbook is volume III in a series devoted to stationary partial differential quations. Similarly as volumes I and II, it is a collection of self contained state-of-the-art surveys written by well known experts in the field. The topics covered by this handbook include singular and higher order equations, problems near critically, problems with anisotropic nonlinearities, dam problem, T-convergence and Schauder-type estimates. These surveys will be useful for both beginners and experts and speed up the progress of corresponding (rapidly developing and fascinating) areas of mathematics. Ke

  18. Scattering in the nonlinear Lamb system

    Energy Technology Data Exchange (ETDEWEB)

    Komech, A.I. [Faculty of Mathematics of Vienna University, Vienna (Austria); Institute for the Information Transmission Problems of RAS, Moscow (Russian Federation)], E-mail: alexander.komech@univie.ac.at; Merzon, A.E. [Institute of Physics and Mathematics, University of Michoacan of San Nicolas de Hidalgo, Morelia, Michoacan (Mexico)], E-mail: anatoli@ifm.imich.mx

    2009-03-09

    We obtain long time asymptotics for the solutions to a string coupled to a nonlinear oscillator: each finite energy solution decays to a sum of a stationary state and a dispersive wave. The asymptotics hold in global energy norm. The dispersive waves are expressed via initial data and solution to an ordinary differential equation. The asymptotics give a mathematical model for the Bohr's transitions between quantum stationary states.

  19. Stationary bubbles: information loss paradox?

    CERN Document Server

    Domènech, Guillem

    2016-01-01

    The main purpose of this work is to build classically stationary bubbles, within the thin-shell formalism, which are unstable under quantum effects; they either collapse into a black hole or expand. Thus, the final state can be thought of a superposition of geometries. We point out that, from a quantum mechanical point of view, there is no issue with a loss of information in such configuration. A classical observer sees a definite geometry and, hence, finds an effective loss of information. Although it does not cover all possible cases, we emphasise the role of semi-classical gravitational effects, mediated by instatons, in alleviating/solving the information loss paradox.

  20. Measuring nonlinear behavior in time series data

    Science.gov (United States)

    Wai, Phoong Seuk; Ismail, Mohd Tahir

    2014-12-01

    Stationary Test is an important test in detect the time series behavior since financial and economic data series always have missing data, structural change as well as jumps or breaks in the data set. Moreover, stationary test is able to transform the nonlinear time series variable to become stationary by taking difference-stationary process or trend-stationary process. Two different types of hypothesis testing of stationary tests that are Augmented Dickey-Fuller (ADF) test and Kwiatkowski-Philips-Schmidt-Shin (KPSS) test are examine in this paper to describe the properties of the time series variables in financial model. Besides, Least Square method is used in Augmented Dickey-Fuller test to detect the changes of the series and Lagrange multiplier is used in Kwiatkowski-Philips-Schmidt-Shin test to examine the properties of oil price, gold price and Malaysia stock market. Moreover, Quandt-Andrews, Bai-Perron and Chow tests are also use to detect the existence of break in the data series. The monthly index data are ranging from December 1989 until May 2012. Result is shown that these three series exhibit nonlinear properties but are able to transform to stationary series after taking first difference process.

  1. Application of the Non—Stationary Oil Film Force Database

    Institute of Scientific and Technical Information of China (English)

    WANGWen; ZHANGZHi-ming; 等

    2001-01-01

    The technique of non-stationary oll film force database for hydrodynamic bearing is introduced and its potential applications in nonlinear rotor-dynamics are demonstrated.Through simulations of the locus of the shaft center aided by the database technique,nonlinear stability analysis can be performed and the natural frequency can be obtained as well.The easiness of “assembling” the individual bush forces from the database to form the bearing force.makes it very convenient to evaluate the stability of various types of journal bearings,Examples are demonstrated to show how the database technique makes it possible to get technically abundant simulation results at the expense of very short calculation time.

  2. Investigation of magnetic spin glass property in La{sub 0.5}Bi{sub 0.5}MnO{sub 3} sample using non-linear AC susceptibility measurements

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Punith V., E-mail: drvldayal@gmail.com; Manju, M. R., E-mail: drvldayal@gmail.com; Dayal, Vijaylakshmi, E-mail: drvldayal@gmail.com [Department of Physics, Maharaja Institute of Technology, Mysore-571438, Karnataka (India)

    2014-04-24

    We present a comprehensive study on origin of Spin Glass (SG) property in polycrystalline La{sub 0.5}Bi{sub 0.5}MnO{sub 3} perovskite oxide using linear and higher order ac susceptibility (χ) measurements. The third order harmonic susceptibility (χ{sub 3}) vs. temperature (K) with varying magnetic fields from 0.95 to 9.45 Oe and the divergence in their χ{sub 3} (max) allows us to infer the SG behavior occurring in the sample possibly due to co-operative freezing of the spins.

  3. Pattern formation and mass transfer under stationary solutal Marangoni instability.

    Science.gov (United States)

    Schwarzenberger, Karin; Köllner, Thomas; Linde, Hartmut; Boeck, Thomas; Odenbach, Stefan; Eckert, Kerstin

    2014-04-01

    According to the seminal theory by Sternling and Scriven, solutal Marangoni convection during mass transfer of surface-active solutes may occur as either oscillatory or stationary instability. With strong support of Manuel G. Velarde, a combined initiative of experimental works, in particular to mention those of Linde, Wierschem and coworkers, and theory has enabled a classification of dominant wave types of the oscillatory mode and their interactions. In this way a rather comprehensive understanding of the nonlinear evolution of the oscillatory instability could be achieved. A comparably advanced state-of-the-art with respect to the stationary counterpart seemed to be out of reach a short time ago. Recent developments on both the numerical and experimental side, in combination with assessing an extensive number of older experiments, now allow one to draw a more unified picture. By reviewing these works, we show that three main building blocks exist during the nonlinear evolution: roll cells, relaxation oscillations and relaxation oscillations waves. What is frequently called interfacial turbulence results from the interaction between these partly coexisting basic patterns which may additionally occur in different hierarchy levels. The second focus of this review lies on the practical importance of such convection patterns concerning their influence on mass transfer characteristics. Particular attention is paid here to the interaction between Marangoni and buoyancy effects which frequently complicates the pattern formation even more. To shed more light on these dependencies, new simulations regarding the limiting case of stabilizing density stratification and vanishing buoyancy are incorporated.

  4. Extracting stationary segments from non-stationary synthetic and cardiac signals

    Science.gov (United States)

    Rodríguez, María. G.; Ledezma, Carlos A.; Perpiñán, Gilberto; Wong, Sara; Altuve, Miguel

    2015-01-01

    Physiological signals are commonly the result of complex interactions between systems and organs, these interactions lead to signals that exhibit a non-stationary behaviour. For cardiac signals, non-stationary heart rate variability (HRV) may produce misinterpretations. A previous work proposed to divide a non-stationary signal into stationary segments by looking for changes in the signal's properties related to changes in the mean of the signal. In this paper, we extract stationary segments from non-stationary synthetic and cardiac signals. For synthetic signals with different signal-to-noise ratio levels, we detect the beginning and end of the stationary segments and the result is compared to the known values of the occurrence of these events. For cardiac signals, RR interval (cardiac cycle length) time series, obtained from electrocardiographic records during stress tests for two populations (diabetic patients with cardiovascular autonomic neuropathy and control subjects), were divided into stationary segments. Results on synthetic signals reveal that the non-stationary sequence is divided into more stationary segments than needed. Additionally, due to HRV reduction and exercise intolerance reported on diabetic cardiovascular autonomic neuropathy patients, non-stationary RR interval sequences from these subjects can be divided into longer stationary segments compared to the control group.

  5. The cost of using stationary inventory policies when demand is non-stationary

    NARCIS (Netherlands)

    Tunc, Huseyin; Kilic, Onur A.; Tarim, S. Armagan; Eksioglu, Burak

    Non-stationary stochastic demands are very common in industrial settings with seasonal patterns, trends, business cycles, and limited-life items. In such cases, the optimal inventory control policies are also non-stationary. However, due to high computational complexity, non-stationary inventory

  6. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  7. Space plasma physics: I - Stationary processes

    Science.gov (United States)

    Hasegawa, Akira; Sato, Tetsuya

    1989-01-01

    The physics of stationary processes in space plasmas is examined theoretically in an introduction intended for graduate students. The approach involves the extensive use of numerical simulations. Chapters are devoted to fundamental principles, small-amplitude waves, and the stationary solar plasma system; typical measurement data and simulation results are presented graphically.

  8. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  9. 基于非线性振荡和混沌分析的单相AC-DC变流电路的摄动解析%Perturbation solution of single-phase AC-DC converter based on nonlinear oscillation and chaotic analysis

    Institute of Scientific and Technical Information of China (English)

    张扬; 查晓明; 刘雅琦; 张鲲; 熊一; 樊友平

    2012-01-01

    This paper deals with the issue of modeling method by perturbation solution to the single-phase AC-DC converter. A continuous circuit that includes a single-phase AC-DC converter is inducted first. And then a differential equation is presented with two parameters, which are controlling parameter and small perturbation parameter. A strict proof indicates that this equation can be solved by the regular perturbation. The compareison between the result and the simulation figures of PSCAD/EMTDC, shows that the result is correct and simple, thus avoiding the requirements for large computation capacity. Finally, the physical significance of the two parameters is analyzed, showing that they may incur the period-doubling chaos. This method not only fits the single-phase AC-DC converter circuit, but also meets the need of two-phase or N-phase circuits.%针对单相交直流全桥变流电路,推导出其在脉宽调制下的连续等效摄动解析模型.首先通过研究非线性振荡过程得到其连续微分方程,该方程含有控制参数和摄动参数.随后通过数学理论证明正则摄动方法能够求出其近似解,求解后对比PSCAD/EMTDC的仿真结果从而验证了解析的正确性.该方法在大规模计算中具有优势.最后分析了控制参数和摄动参数的物理意义,指出这两个参数能够影响变流器的工作状态,甚至引发倍周期混沌.该摄动建模方法不仅适用于单相变流电路,也适用于三相变流电路甚至多相变流电路.

  10. On the Gross–Pitaevskii Equation with Pumping and Decay: Stationary States and Their Stability

    KAUST Repository

    Sierra Nunez, Jesus Alfredo

    2015-02-11

    We investigate the behavior of solutions of the complex Gross–Pitaevskii equation, a model that describes the dynamics of pumped decaying Bose–Einstein condensates. The stationary radially symmetric solutions of the equation are studied, and their linear stability with respect to two-dimensional perturbations is analyzed. Using numerical continuation, we calculate not only the ground state of the system, but also a number of excited states. Accurate numerical integration is employed to study the general nonlinear evolution of the system from the unstable stationary solutions to the formation of stable vortex patterns.

  11. Stationary and non-stationary occurrences of miniature end plate potentials are well described as stationary and non-stationary Poisson processes in the mollusc Navanax inermis.

    Science.gov (United States)

    Cappell, M S; Spray, D C; Bennett, M V

    1988-06-28

    Protractor muscles in the gastropod mollusc Navanax inermis exhibit typical spontaneous miniature end plate potentials with mean amplitude 1.71 +/- 1.19 (standard deviation) mV. The evoked end plate potential is quantized, with a quantum equal to the miniature end plate potential amplitude. When their rate is stationary, occurrence of miniature end plate potentials is a random, Poisson process. When non-stationary, spontaneous miniature end plate potential occurrence is a non-stationary Poisson process, a Poisson process with the mean frequency changing with time. This extends the random Poisson model for miniature end plate potentials to the frequently observed non-stationary occurrence. Reported deviations from a Poisson process can sometimes be accounted for by the non-stationary Poisson process and more complex models, such as clustered release, are not always needed.

  12. Dynamical ensembles in stationary states

    Energy Technology Data Exchange (ETDEWEB)

    Gallavotti, G. [Universita di Roma la Sapienza, Rome (Italy); Cohen, E.G.D. [Rockefeller Univ., New York, NY (United States)

    1995-09-01

    We propose, as a generalization of an idea of Ruelle`s to describe turbulent fluid flow, a chaotic hypothesis for reversible dissipative many-particle systems in nonequilibrium stationary states in general. This implies an extension of the zeroth law of thermodynamics to nonequilibrium states and it leads to the identification of a unique distribution {mu} describing the asymptotic properties of the time evolution of the system for initial data randomly chosen with respect to a uniform distribution on phase space. For conservative systems in thermal equilibrium the chaotic hypothesis implies the ergodic hypothesis. We outline a procedure to obtain the distribution {mu}: it leads to a new unifying point of view for the phase space behavior of dissipative and conservative systems. The chaotic hypothesis is confirmed in a nontrivial, parameter-free, way by a recent computer experiment on the entropy production fluctuations in a shearing fluid far from equilibrium. Similar applications to other models are proposed, in particular to a model for the Kolmogorov-Obuchov theory for turbulent flow.

  13. Three-dimensional modes of a symmetric nonlinear plane waveguide

    Science.gov (United States)

    Akhmediev, N. N.; Nabiev, R. F.; Popov, Yu. M.

    1989-01-01

    The three-dimensional problem of a symmetric nonlinear plane waveguide, which consist of a linear medium layer surrounded by nonlinear media, is investigated. The stationary solution of this problem is a mode whose field is falling to zero at infinity in all directions perpendicular to the propagation direction. The even, odd and assymetrical solutions of the problem are obtained.

  14. Breather compactons in nonlinear Klein-Gordon systems.

    Science.gov (United States)

    Dinda, P T; Remoissenet, M

    1999-11-01

    We demonstrate the existence of a localized breathing mode with a compact support, i.e., a stationary breather compacton, in a nonlinear Klein-Gordon system. This breather compacton results from a delicate balance between the harmonicity of the substrate potential and the total nonlinearity induced by the substrate potential and the coupling forces between adjacent lattice sites.

  15. Rethinking Rectification: AC-DC Power Supply in Package

    DEFF Research Database (Denmark)

    Pejtersen, Jens; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Rectification of AC mains voltage is almost exclusively implemented with passive diode bridge rectifiers for power applications below 100 W. The diode bridge rectifier is reliable, cost effective and easy to use. But it is also lossy, nonlinear and passive. Thus reducing the power conversion...

  16. RHIC AC DIPOLE DESIGN AND CONSTRUCTION.

    Energy Technology Data Exchange (ETDEWEB)

    BAI,M.; METH,M.; PAI,C.; PARKER,B.; PEGGS,S.; ROSER,T.; SANDERS,R.; TRBOJEVIC,D.; ZALTSMAN,A.

    2001-06-18

    Two ac dipoles with vertical and horizontal magnetic field have been proposed at RHIC for applications in linear and non-linear beam dynamics and spin manipulations. A magnetic field amplitude of 380 Gm is required to produce a coherent oscillation of 5 times the rms beam size at the top energy. We take the ac dipole frequency to be 1.0% of the revolution frequency away from the betatron frequency. To achieve the strong magnetic field with minimum power loss, an air-core magnet with two seven turn winding of low loss Litz wire resonating at 64 kHz is designed. The system is also designed to allow one to connect the two magnet winding in series to resonate at 37 kHz for the spin manipulation. Measurements of a half length prototype magnet are also presented.

  17. Metric domains, holomorphic mappings and nonlinear semigroups

    Directory of Open Access Journals (Sweden)

    Simeon Reich

    1998-01-01

    Full Text Available We study nonlinear semigroups of holomorphic mappings on certain domains in complex Banach spaces. We examine, in particular, their differentiability and their representations by exponential and other product formulas. In addition, we also construct holomorphic retractions onto the stationary point sets of such semigroups.

  18. Pulse operation of semiconductor laser with nonlinear optical feedback

    Science.gov (United States)

    Guignard, Celine; Besnard, Pascal; Mihaescu, Adrian; MacDonald, K. F.; Pochon, Sebastien; Zheludev, Nikolay I.

    2004-09-01

    A semiconductor laser coupled to a gallium-made non linear mirror may exhibit pulse regime. In order to better understand this coupled cavity, stationary solutions and dynamics are described following the standard Lang and Kobayashi equations for a semiconductor laser submitted to nonlinear optical feedback. It is shown that the nonlinearity distorts the ellipse on which lied the stationary solutions, with a ``higher'' part corresponding to lower reflectivity and a ``lower'' part to higher reflectivity. Bifurcation diagrams and nonlinear analysis are presented while the conditions for pulsed operation are discussed.

  19. Analyses of non-linear systems and their application to biology: a review.

    Science.gov (United States)

    Sato, S

    1994-01-01

    In this review article, Wiener's analyses of non-linear systems and other topics on non-linear noise and non-stationary signals are introduced. Firstly, application and limitation of linear aspects on a biological system and a background of introduction of the Wiener's theory to non-linear analysis are briefly mentioned. The practical applications, however, were not so successful for several reasons. We shall see how these problems are solved under collaboration between biologists and engineers who have a knowledge of the subject and utilizing computational facility. Several aspects of the methodology involving non-linear systems, non-linear noise and non-stationary signals are also reviewed.

  20. Dynamical response to a stationary tidal field

    CERN Document Server

    Landry, Philippe

    2015-01-01

    We demonstrate that a slowly rotating compact body subjected to a stationary tidal field undergoes a dynamical response, in which the fluid variables and the interior metric vary on the time scale of the rotation period. This dynamical response requires the tidal field to have a gravitomagnetic component generated by external mass currents; the response to a gravitoelectric tidal field is stationary. We confirm that in a calculation carried out to first order in the body's rotation, the exterior geometry bears no trace of this internal dynamics; it remains stationary in spite of the time-dependent interior.

  1. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  2. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  3. Non-stationary Effects In Space-charge Dominated Electron Beams

    CERN Document Server

    Agafonov, A V; Tarakanov, V P

    2004-01-01

    Problems of non-linear dynamics of space charge dominated electron beams in plane and in coaxial electron guns are discussed from the point of view of non-stationary behaviour of beams. The results of computer simulations of beam formation are presented for several simple plane diode geometries and for the gun with large compression of annular beam. Emphasised is non-stationary behaviour combined with edge and hysteresis effects. Non-stationary effects in crossed electron and magnetic field are considered from the point of view a development of schemes of intense electron beam formation for compact accelerators and RF-devices. The results of computer simulation of beam formation inside coaxial guns are described under condition of secondary self-sustaining emission. Possibilities of electron storage and capture due to transient processes are discussed. Work supported by RFBR under grant 03-02-17301.

  4. On the existence of stationary Ricci solitons

    CERN Document Server

    Figueras, Pau

    2016-01-01

    Previously the DeTurck 'trick' has been used to render the stationary Einstein's equation a well posed elliptic system that may be solved numerically by geometric flow or directly. Whilst in the static case for pure gravity with zero or negative cosmological constant there is a simple proof that solving the modified "harmonic" Einstein's equation leads to a solution of the original Einstein system - i.e. not a Ricci soliton - in the stationary case this argument no longer works. Here we provide a new argument that extends the static result to the case of stationary spacetimes that possess a "$t$-$\\phi$" reflection symmetry. Defining a "soliton charge" from the asymptotic behaviour of the solution, we show that this quantity is always non-positive. Provided asymptotic conditions are chosen such that this charge vanishes, then stationary solitons cannot exist.

  5. Trends in non-stationary signal processing techniques applied to vibration analysis of wind turbine drive train - A contemporary survey

    Science.gov (United States)

    Uma Maheswari, R.; Umamaheswari, R.

    2017-02-01

    Condition Monitoring System (CMS) substantiates potential economic benefits and enables prognostic maintenance in wind turbine-generator failure prevention. Vibration Monitoring and Analysis is a powerful tool in drive train CMS, which enables the early detection of impending failure/damage. In variable speed drives such as wind turbine-generator drive trains, the vibration signal acquired is of non-stationary and non-linear. The traditional stationary signal processing techniques are inefficient to diagnose the machine faults in time varying conditions. The current research trend in CMS for drive-train focuses on developing/improving non-linear, non-stationary feature extraction and fault classification algorithms to improve fault detection/prediction sensitivity and selectivity and thereby reducing the misdetection and false alarm rates. In literature, review of stationary signal processing algorithms employed in vibration analysis is done at great extent. In this paper, an attempt is made to review the recent research advances in non-linear non-stationary signal processing algorithms particularly suited for variable speed wind turbines.

  6. Stable Stationary Harmonic Maps to Spheres

    Institute of Scientific and Technical Information of China (English)

    Fang Hua LIN; Chang You WANG

    2006-01-01

    For k ≥ 3, we establish new estimate on Hausdorff dimensions of the singular set of stable-stationary harmonic maps to the sphere Sk. We show that the singular set of stable-stationary harmonic maps from B5 to S3 is the union of finitely many isolated singular points and finitely many Holder continuous curves. We also discuss the minimization problem among continuous maps from Bn to S2.

  7. Stationary infinitely divisible processes

    DEFF Research Database (Denmark)

    Barndorff-Nielsen, Ole E.

    Several recent strands of work has led to the consideration of various types of continuous time stationary and infinitely divisible processes. A review of these types, with some new results, is presented.......Several recent strands of work has led to the consideration of various types of continuous time stationary and infinitely divisible processes. A review of these types, with some new results, is presented....

  8. Stationary phase deposition based on onium salts

    Science.gov (United States)

    Wheeler, David R.; Lewis, Patrick R.; Dirk, Shawn M.; Trudell, Daniel E.

    2008-01-01

    Onium salt chemistry can be used to deposit very uniform thickness stationary phases on the wall of a gas chromatography column. In particular, the stationary phase can be bonded to non-silicon based columns, especially microfabricated metal columns. Non-silicon microfabricated columns may be manufactured and processed at a fraction of the cost of silicon-based columns. In addition, the method can be used to phase-coat conventional capillary columns or silicon-based microfabricated columns.

  9. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  10. Towards Fluid Instabilities of Stationary Non-Killing Horizons

    CERN Document Server

    Fischetti, Sebastian

    2016-01-01

    Flowing black holes are asymptotically locally AdS spacetimes that are stationary but have non-Killing horizons. Holographically, they are dual to a steady-state heat flow in the boundary field theory. We investigate the stability of these black holes in the limit in which they are well-described by the relativistic conformal Navier-Stokes equations. More precisely, we study the quasi-normal modes of the linearized ideal fluid equations. Though we find no unstable modes, there are an infinite number at finite transverse momentum which are arbitrarily long-lived. This suggests the possibility that either non-modal effects or nonlinear interactions between these modes can give rise to new types of gravitational instabilities.

  11. Towards fluid instabilities of stationary non-Killing horizons

    Science.gov (United States)

    Fischetti, Sebastian; Way, Benson

    2016-12-01

    Flowing black holes are asymptotically locally AdS spacetimes that are stationary but have non-Killing horizons. Holographically, they are dual to a steady-state heat flow in the boundary field theory. We investigate the stability of these black holes in the limit in which they are well-described by the relativistic conformal Navier-Stokes equation. More precisely, we study the quasi-normal modes of the linearized ideal fluid equations. Though we find no unstable modes, there are an infinite number of modes at finite transverse momentum which are arbitrarily long-lived. This suggests the possibility that either non-modal effects or nonlinear interactions between these modes can give rise to new types of gravitational instabilities.

  12. Shift ergodicity for stationary Markov processes

    Institute of Scientific and Technical Information of China (English)

    东金文

    2001-01-01

    In this paper shift ergodicity and related topics are studied for certain stationary processes. We first present a simple proof of the conclusion that every stationary Markov process is a generalized convex combination of stationary ergodic Markov processes. A direct consequence is that a stationary distribution of a Markov process is extremal if and only if the corresponding stationary Markov process is time ergodic and every stationary distribution is a generalized convex combination of such extremal ones. We then consider space ergodicity for spin flip particle systems. We prove space shift ergodicity and mixing for certain extremal invariant measures for a class of spin systems, in which most of the typical models, such as the Voter Models and the Contact Models, are included. As a consequence of these results we see that for such systems, under each of those extremal invariant measures, the space and time means of an observable coincide, an important phenomenon in statistical physics. Our results provide partial answers to certain interesting problems in spin systems.

  13. Stationary states in quantum walk search

    Science.gov (United States)

    PrÅ«sis, Krišjānis; Vihrovs, Jevgěnijs; Wong, Thomas G.

    2016-09-01

    When classically searching a database, having additional correct answers makes the search easier. For a discrete-time quantum walk searching a graph for a marked vertex, however, additional marked vertices can make the search harder by causing the system to approximately begin in a stationary state, so the system fails to evolve. In this paper, we completely characterize the stationary states, or 1-eigenvectors, of the quantum walk search operator for general graphs and configurations of marked vertices by decomposing their amplitudes into uniform and flip states. This infinitely expands the number of known stationary states and gives an optimization procedure to find the stationary state closest to the initial uniform state of the walk. We further prove theorems on the existence of stationary states, with them conditionally existing if the marked vertices form a bipartite connected component and always existing if nonbipartite. These results utilize the standard oracle in Grover's algorithm, but we show that a different type of oracle prevents stationary states from interfering with the search algorithm.

  14. Non-stationary Operation Regimes of the Gas Bearings

    Directory of Open Access Journals (Sweden)

    Ilina Tamara Evgenevna

    2014-07-01

    Full Text Available This review provides of basic information on non-stationary operation regimes of the gas bearings. The causes and mechanisms of maintaining the oscillation of the rotor’s gas suspensions are discussed. A brief review of linear, nonlinear and resonant vibrational effect is given. The questions on the oscillations in the layer of gas and liquid lubrication in the bearings are elaborated. A classification of non-stationary processes in gas bearings is given. Brief information on issues such as "frequency capture", "Sommerfeld effect", "a half-speed and fraction-speed vortex", "pneumatic hammer", "consumption oscillations in nozzles". The main tasks for the gas-static bearing’s control system are formulated. The results of calculations of the reaction in gas-static rotor bearings on a single external influence. It is shown that when the external load, the impact of external forces and the gas pressure in the lubricating gap rotor motion seeks to limit discrete trajectories. Thus, the radius is changed stepwise precession and not continuously. Increasing supply pressure in the lubricating gap fluctuations can be suppressed by decreasing the diameter of the precession.

  15. Nonlinear optics

    CERN Document Server

    Bloembergen, Nicolaas

    1996-01-01

    Nicolaas Bloembergen, recipient of the Nobel Prize for Physics (1981), wrote Nonlinear Optics in 1964, when the field of nonlinear optics was only three years old. The available literature has since grown by at least three orders of magnitude.The vitality of Nonlinear Optics is evident from the still-growing number of scientists and engineers engaged in the study of new nonlinear phenomena and in the development of new nonlinear devices in the field of opto-electronics. This monograph should be helpful in providing a historical introduction and a general background of basic ideas both for expe

  16. Stationary Liquid Fuel Fast Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Won Sik [Purdue Univ., West Lafayette, IN (United States); Grandy, Andrew [Argonne National Lab. (ANL), Argonne, IL (United States); Boroski, Andrew [Argonne National Lab. (ANL), Argonne, IL (United States); Krajtl, Lubomir [Argonne National Lab. (ANL), Argonne, IL (United States); Johnson, Terry [Argonne National Lab. (ANL), Argonne, IL (United States)

    2015-09-30

    For effective burning of hazardous transuranic (TRU) elements of used nuclear fuel, a transformational advanced reactor concept named SLFFR (Stationary Liquid Fuel Fast Reactor) was proposed based on stationary molten metallic fuel. The fuel enters the reactor vessel in a solid form, and then it is heated to molten temperature in a small melting heater. The fuel is contained within a closed, thick container with penetrating coolant channels, and thus it is not mixed with coolant nor flow through the primary heat transfer circuit. The makeup fuel is semi- continuously added to the system, and thus a very small excess reactivity is required. Gaseous fission products are also removed continuously, and a fraction of the fuel is periodically drawn off from the fuel container to a processing facility where non-gaseous mixed fission products and other impurities are removed and then the cleaned fuel is recycled into the fuel container. A reference core design and a preliminary plant system design of a 1000 MWt TRU- burning SLFFR concept were developed using TRU-Ce-Co fuel, Ta-10W fuel container, and sodium coolant. Conservative design approaches were adopted to stay within the current material performance database. Detailed neutronics and thermal-fluidic analyses were performed to develop a reference core design. Region-dependent 33-group cross sections were generated based on the ENDF/B-VII.0 data using the MC2-3 code. Core and fuel cycle analyses were performed in theta-r-z geometries using the DIF3D and REBUS-3 codes. Reactivity coefficients and kinetics parameters were calculated using the VARI3D perturbation theory code. Thermo-fluidic analyses were performed using the ANSYS FLUENT computational fluid dynamics (CFD) code. Figure 0.1 shows a schematic radial layout of the reference 1000 MWt SLFFR core, and Table 0.1 summarizes the main design parameters of SLFFR-1000 loop plant. The fuel container is a 2.5 cm thick cylinder with an inner radius of 87.5 cm. The fuel

  17. A Nonlinear Approach to Tunisian Inflation Rate

    Directory of Open Access Journals (Sweden)

    Thouraya Boujelbène Dammak

    2016-09-01

    Full Text Available In this study, we investigated the properties and the macroeconomic performance of the nonlinearity of the Inflation Rate Set in Tunisia. We developed an inference asymptotic theory for an unrestricted two-regime threshold autoregressive (TAR model with an autoregressive unit root. We proposed two types of tests namely asymptotic and bootstrap-based. These tests as well as the distribution theory allow a joint consideration of nonlinear thresholds and non-stationary unit roots. Our empirical results reveal a strong evidence of a threshold effect. This makes clear the possibility of non stationary and nonlinear of the Monthly Inflation Rate in Tunisia for the 1994.01-2011.06 period. While the Perron test found a unit root, our TAR unit root tests are arguably significant. Then, the evidence is quite strong that the inflation rate is not a unit root process.

  18. Model of strong stationary vortex turbulence in space plasmas

    Directory of Open Access Journals (Sweden)

    G. D. Aburjania

    2009-01-01

    Full Text Available This paper investigates the macroscopic consequences of nonlinear solitary vortex structures in magnetized space plasmas by developing theoretical model of plasma turbulence. Strongly localized vortex patterns contain trapped particles and, propagating in a medium, excite substantial density fluctuations and thus, intensify the energy, heat and mass transport processes, i.e., such vortices can form strong vortex turbulence. Turbulence is represented as an ensemble of strongly localized (and therefore weakly interacting vortices. Vortices with various amplitudes are randomly distributed in space (due to collisions. For their description, a statistical approach is applied. It is supposed that a stationary turbulent state is formed by balancing competing effects: spontaneous development of vortices due to nonlinear twisting of the perturbations' fronts, cascading of perturbations into short scales (direct spectral cascade and collisional or collisionless damping of the perturbations in the short-wave domain. In the inertial range, direct spectral cascade occurs through merging structures via collisions. It is shown that in the magneto-active plasmas, strong turbulence is generally anisotropic Turbulent modes mainly develop in the direction perpendicular to the local magnetic field. It is found that it is the compressibility of the local medium which primarily determines the character of the turbulent spectra: the strong vortex turbulence forms a power spectrum in wave number space. For example, a new spectrum of turbulent fluctuations in k−8/3 is derived which agrees with available experimental data. Within the framework of the developed model particle diffusion processes are also investigated. It is found that the interaction of structures with each other and particles causes anomalous diffusion in the medium. The effective coefficient of diffusion has a square root dependence on the stationary level of noise.

  19. Nonlinear supratransmission

    Energy Technology Data Exchange (ETDEWEB)

    Geniet, F; Leon, J [Physique Mathematique et Theorique, CNRS-UMR 5825, 34095 Montpellier (France)

    2003-05-07

    A nonlinear system possessing a natural forbidden band gap can transmit energy of a signal with a frequency in the gap, as recently shown for a nonlinear chain of coupled pendulums (Geniet and Leon 2002 Phys. Rev. Lett. 89 134102). This process of nonlinear supratransmission, occurring at a threshold that is exactly predictable in many cases, is shown to have a simple experimental realization with a mechanical chain of pendulums coupled by a coil spring. It is then analysed in more detail. First we go to different (nonintegrable) systems which do sustain nonlinear supratransmission. Then a Josephson transmission line (a one-dimensional array of short Josephson junctions coupled through superconducting wires) is shown to also sustain nonlinear supratransmission, though being related to a different class of boundary conditions, and despite the presence of damping, finiteness, and discreteness. Finally, the mechanism at the origin of nonlinear supratransmission is found to be a nonlinear instability, and this is briefly discussed here.

  20. NON-STATIONARY STOKES FLOWS UNDER LEAK BOUNDARY CONDITIONS OF FRICTION TYPE

    Institute of Scientific and Technical Information of China (English)

    Hiroshi Fujita

    2001-01-01

    This paper is concerned with the initial value problem for non-stationary Stokes flows,under a certain non-linear boundary condition which can be called the leak boundarycondition of friction type. Theoretically, our main purpose is to show the strong solvability(i.e.,the unique existence of the L2-strong solution) of this initial value problem by meansof the non-linear semi-group theory originated with Y. Komura. The method of analysiscan be applied to other boundary or interface conditions of friction type. It should benoted that the result yields a sound basis of simulation methods for evolution problemsinvolving these conditions.

  1. Suitability of teicoplanin-aglycone bonded stationary phase for simulated moving bed enantio separation of racemic amino acids employing composition-constrained eluents

    NARCIS (Netherlands)

    Bechtold, M; Heinemann, M; Panke, S

    2006-01-01

    The suitability of a teicoplanin-aglycone based chiral stationary phase for the simulated moving bed (SMB) enantioseparation of amino acids under enzyme-compatible conditions was shown following a procedure that is based solely on model-based simulations and HPLC experiments. A set of eight amino ac

  2. Comparative study by simulation of photovoltaic pumping systems with stationary and polar tracking arrays

    Energy Technology Data Exchange (ETDEWEB)

    Illanes, R.; De Francisco, A. [Universidad Politecnica de Madrid, E.T.S.I. de Montes, Madrid (Spain); Torres, J.L.; De Blas, M. [Universidad Publica de Navarra, Dept. Proyectos e Ingenieria Rural, Navarra (Spain); Appelbaum, J. [Tel Aviv Univ., Faculty of Engineering, Tel Aviv (Israel)

    2003-07-01

    Using mathematical models for the different components of the photovoltaic pumping system: generator, inverter (if applicable), motors, pumps and piping, we have developed a computer program that, for given irradiance and temperature data, calculates the flow of water pumped at any given time. The program has been applied to study the hourly and yearly water flow pumped by a photovoltaic pumping system located in Madrid, employing centrifugal pumps powered by AC motors. The photovoltaic generator consists of, in one case, a stationary array and in the second case a polar tracking array. The hourly radiation data were estimated from the distribution of the atmospheric clearness coefficients and the monthly average daily radiation on a horizontal surface. The results of this study show that the use of a polar tracking array increases the average yearly water flow compared with the stationary array more than the corresponding increase of the incident radiation on the arrays. (Author)

  3. Practical Nonlinearities

    Science.gov (United States)

    2016-07-01

    Advanced Research Projects Agency (DARPA) Dynamics-Enabled Frequency Sources (DEFYS) program is focused on the convergence of nonlinear dynamics and...Early work in this program has shown that nonlinear dynamics can provide performance advantages. However, the pathway from initial results to...dependent nonlinear stiffness observed in these devices. This work is ongoing, and will continue through the final period of this program . Reference 9

  4. Nonlinear oscillations

    CERN Document Server

    Nayfeh, Ali Hasan

    1995-01-01

    Nonlinear Oscillations is a self-contained and thorough treatment of the vigorous research that has occurred in nonlinear mechanics since 1970. The book begins with fundamental concepts and techniques of analysis and progresses through recent developments and provides an overview that abstracts and introduces main nonlinear phenomena. It treats systems having a single degree of freedom, introducing basic concepts and analytical methods, and extends concepts and methods to systems having degrees of freedom. Most of this material cannot be found in any other text. Nonlinear Oscillations uses sim

  5. Nonlinear Science

    CERN Document Server

    Yoshida, Zensho

    2010-01-01

    This book gives a general, basic understanding of the mathematical structure "nonlinearity" that lies in the depths of complex systems. Analyzing the heterogeneity that the prefix "non" represents with respect to notions such as the linear space, integrability and scale hierarchy, "nonlinear science" is explained as a challenge of deconstruction of the modern sciences. This book is not a technical guide to teach mathematical tools of nonlinear analysis, nor a zoology of so-called nonlinear phenomena. By critically analyzing the structure of linear theories, and cl

  6. Nonlinear analysis

    CERN Document Server

    Nanda, Sudarsan

    2013-01-01

    "Nonlinear analysis" presents recent developments in calculus in Banach space, convex sets, convex functions, best approximation, fixed point theorems, nonlinear operators, variational inequality, complementary problem and semi-inner-product spaces. Nonlinear Analysis has become important and useful in the present days because many real world problems are nonlinear, nonconvex and nonsmooth in nature. Although basic concepts have been presented here but many results presented have not appeared in any book till now. The book could be used as a text for graduate students and also it will be useful for researchers working in this field.

  7. Nonlinear Waves

    CERN Document Server

    Kalinowski, M W

    2016-01-01

    A method for solving a quasilinear nonelliptical equation of the second order is developed and we give classification and parametrization of simple elements of the equation.We find exact solutions of an equation for potential stationary flow of a compressible gas in a supersonic region as an example of the method.

  8. STATIONARY CONNECTED CURVES IN HILBERT SPACES

    Directory of Open Access Journals (Sweden)

    Raed Hatamleh

    2014-01-01

    Full Text Available In this article the structure of non-stationary curves which are stationary connected in Hilbert space is studied using triangular models of non-self-adjoint operator. The concept of evolutionary representability plays here an important role. It is proved that if one of two curves in Hilbert space is evolutionary representable and the curves are stationary connected, then another curve is evolutionary representable too. These curves are studied firstly. The structure of a cross-correlation function in the case when operator, defining the evolutionary representation, has one-dimensional non-Hermitian subspace (the spectrum is discreet and situated in the upper complex half-plane or has infinite multiplicity at zero (Volterra operator is studied.

  9. Stationary axisymmetric black holes with matter

    CERN Document Server

    Chodosh, Otis

    2015-01-01

    We provide a geometric framework for the construction of non-vacuum black holes whose metrics are stationary and axisymmetric. Under suitable assumptions we show that the Einstein equations reduce to an Einstein-harmonic map type system and analyze the compatibility of the resulting equations. This framework will be fundamental to our forthcoming construction of metric-stationary axisymmetric bifurcations of Kerr solving the Einstein--Klein--Gordon system, and as such, we include specializations of all of our formulas to the case of a time-periodic massive scalar field.

  10. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  11. Nonlinearity and hysteresis of resonant strain gauges

    NARCIS (Netherlands)

    Gui, Chengqun; Legtenberg, Rob; Tilmans, Harrie A.C.; Fluitman, Jan H.J; Elwenspoek, Miko

    1998-01-01

    The nonlinearity and hysteresis effects of the electrostatically activated voltage-driven resonant microbridges have been studied theoretically and experimentally. It is shown that in order to avoid vibration instability and hysteresis to occur, the choices of the ac and dc driving voltages and of t

  12. Normal form of particle motion under the influence of an AC dipole

    CERN Document Server

    Tomás, R

    2002-01-01

    AC dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the AC dipole is adiabatically turned on and off. Therefore the AC dipole seems to be an adequate tool for non-linear diagnostics provided the particle motion is well described in presence of the AC dipole and non-linearities. Normal Forms and Lie algebra are powerful tools to study the non-linear content of an accelerator lattice. In this article a way to obtain the Normal Form of the Hamiltonian of an accelerator with an AC dipole is described. The particle motion to first order in the non-linearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the AC dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn moti...

  13. Normal form of particle motion under the influence of an ac dipole

    Directory of Open Access Journals (Sweden)

    R. Tomás

    2002-05-01

    Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.

  14. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  15. Faith and oscillations recovered: On analyzing EEG/MEG signals during tACS.

    Science.gov (United States)

    Neuling, Toralf; Ruhnau, Philipp; Weisz, Nathan; Herrmann, Christoph S; Demarchi, Gianpaolo

    2017-02-15

    Despite recent success in analyzing brain oscillations recorded during transcranial alternating current stimulation (tACS), the field still requires further research to establish standards in artifact removal methods. This includes taking a step back from the removal of the tACS artifact and thoroughly characterizing the to-be-removed artifact. A recent study by Noury et al. (2016) contributed importantly to this endeavour by showing the existence of nonlinear artefacts in the tACS signal as seen by MEG and EEG. Unfortunately however this paper conveys the message that current artifact removal attempts have failed altogether and that-based on these available tools-brain oscillations recorded during tACS cannot be analyzed using MEG and EEG. Here we want to balance this overly pessimistic conclusion: In-depth reanalyses of our own data and phantom-head measurements indicate that nonlinearities can occur, but only when technical limits of the stimulator are reached. As such they are part of the "real" stimulation and not a specific MEG analysis problem. Future tACS studies should consider these technical limits to avoid any nonlinear modulations of the tACS artifact. We conclude that even with current approaches, brain oscillations recorded during tACS can be meaningfully studied in many practical cases.

  16. Stationary axion/dilaton solutions and supersymmetry

    NARCIS (Netherlands)

    Bergshoeff, E. A.; Kallosh, R.; Ortín, Tomas

    1996-01-01

    We present a new set of supersymmetric stationary solutions of pure N = 4, d = 4 supergravity (and, hence, of low-energy effective string theory) that generalize (and include) the Israel-Wilson-Pejes solutions of Einstein-Maxwell theory. All solutions have 1/4 of the supersymmetries unbroken and som

  17. On non-stationary threshold autoregressive models

    CERN Document Server

    Liu, Weidong; Shao, Qi-Man; 10.3150/10-BEJ306

    2011-01-01

    In this paper we study the limiting distributions of the least-squares estimators for the non-stationary first-order threshold autoregressive (TAR(1)) model. It is proved that the limiting behaviors of the TAR(1) process are very different from those of the classical unit root model and the explosive AR(1).

  18. SS 433: Stationary lines and primary eclipses

    CERN Document Server

    Bowler, M G

    2015-01-01

    Some stationary lines in the emission spectra of SS 433 are eclipsed, but most are not. Lines attributed to a circumbinary disk are not eclipsed, but double in relative intensity during primary eclipse. A C II doublet is eclipsed and Doppler shifts over two periods yield an orbital speed of 176 +/- 13 km/s.

  19. Stationary Double Layers in a Collisionless Magnetoplasma

    DEFF Research Database (Denmark)

    Noriyoshi, Sato; Mieno, Tetsu; Hatakeyama, Rikizo;

    1983-01-01

    Stationary double layers are generated in a magnetoplasma by applying potential differences between two heated plates on which the plasma is produced by surface ionization. By measuring the double-layer formation process, a localized potential drop is found to be formed initially in front of the ...

  20. Realizability of stationary spherically symmetric transonic accretion

    CERN Document Server

    Ray, A K; Ray, Arnab K.

    2002-01-01

    The spherically symmetric stationary transonic (Bondi) flow is considered a classic example of an accretion flow. This flow, however, is along a separatrix, which is usually not physically realizable. We demonstrate, using a pedagogical example, that it is the dynamics which selects the transonic flow.

  1. The stationary states of interacting fields

    NARCIS (Netherlands)

    Frazer, W.R.; Hove, Léon van

    1958-01-01

    As an application of a time-independent perturbation formalism developed earlier for systems with many degrees of freedom, we give in terms of diagrams the general perturbation expressions for the exact stationary states of interacting fields. The physical vacuum is obtained by applying to the bare

  2. Calendar Year 2016 Stationary Source Emissions Inventory

    Energy Technology Data Exchange (ETDEWEB)

    Evelo, Stacie [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-01-01

    The City of Albuquerque (COA) Environmental Health Department Air Quality Program has issued stationary source permits and registrations the Department of Energy/Sandia Field Office for operations at the Sandia National Laboratories/New Mexico. This emission inventory report meets the annual reporting compliance requirements for calendar year (CY) 2016 as required by the COA.

  3. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  4. Convection in Binary Fluid Mixtures; 1, Extended Traveling Wave and Stationary States

    CERN Document Server

    Barten, W; Kamps, M; Schmitz, R

    1995-01-01

    Nonlinear convection structures are investigated in quantitative detail as a function of Rayleigh number for several negative and positive Soret coupling strengths (separation ratios) and different Lewis and Prandtl numbers characterizing different mixtures. A finite difference method was used to solve the full hydrodynamic field equations in a range of experimentally accessible parameters. We elucidate the important role that the concentration field plays in the nonlinear states of stationary overturning convection (SOC) and of traveling wave (TW) convection. Structural differences in the concentration boundary layers and of the concentration plumes in TW's and SOC's and their physical consequences are discussed. These properties show that the states con- sidered here are indeed strongly nonlinear, as expected from the magnitude of advection and diffusion in the concentration balance. The bifurcation behaviour of the states is analysed using different order parameters such as flow intensity, Nusselt number, ...

  5. Nonlinear Reconstruction

    CERN Document Server

    Zhu, Hong-Ming; Pen, Ue-Li; Chen, Xuelei; Yu, Hao-Ran

    2016-01-01

    We present a direct approach to non-parametrically reconstruct the linear density field from an observed non-linear map. We solve for the unique displacement potential consistent with the non-linear density and positive definite coordinate transformation using a multigrid algorithm. We show that we recover the linear initial conditions up to $k\\sim 1\\ h/\\mathrm{Mpc}$ with minimal computational cost. This reconstruction approach generalizes the linear displacement theory to fully non-linear fields, potentially substantially expanding the BAO and RSD information content of dense large scale structure surveys, including for example SDSS main sample and 21cm intensity mapping.

  6. Nonlinear optics

    CERN Document Server

    Boyd, Robert W

    2013-01-01

    Nonlinear Optics is an advanced textbook for courses dealing with nonlinear optics, quantum electronics, laser physics, contemporary and quantum optics, and electrooptics. Its pedagogical emphasis is on fundamentals rather than particular, transitory applications. As a result, this textbook will have lasting appeal to a wide audience of electrical engineering, physics, and optics students, as well as those in related fields such as materials science and chemistry.Key Features* The origin of optical nonlinearities, including dependence on the polarization of light* A detailed treatment of the q

  7. Exact Stationary and Non-stationary Solutions to Inelastic Maxwell Model with Infinite Energy

    Science.gov (United States)

    Ilyin, Oleg

    2016-11-01

    The one-dimensional inelastic Boltzmann equation with a constant collision rate (the Maxwell model) is considered. It is shown that for special values of restitution parameter there exists a stationary solution with the characteristic function in the form e^{-P(log (z))z}, where P is a periodic function. The corresponding distribution function belongs to a one special class of stochastic processes termed as a generalized stable in the probability theory. The Fourier transform of the non-stationary equation has the solution bigl (1+P(log (z))zbigr )e^{-Q(log (z))z}. It is proved that this solution is a characteristic function if periodic functions P, Q satisfy some not very restrictive conditions. The stationary and non-stationary solutions correspond to a gas with infinite temperature.

  8. On the Existence of Bright Solitons in Cubic-Quintic Nonlinear Schrödinger Equation with Inhomogeneous Nonlinearity

    Directory of Open Access Journals (Sweden)

    Juan Belmonte-Beitia

    2008-01-01

    Full Text Available We give a proof of the existence of stationary bright soliton solutions of the cubic-quintic nonlinear Schrödinger equation with inhomogeneous nonlinearity. By using bifurcation theory, we prove that the norm of the positive solution goes to zero as the parameter λ, called chemical potential in the Bose-Einstein condensates' literature, tends to zero. Moreover, we solve the time-dependent cubic-quintic nonlinear Schrödinger equation with inhomogeneous nonlinearities by using a numerical method.

  9. Nonlinear nanomechanical resonators for quantum optoelectromechanics

    CERN Document Server

    Rips, S; Hartmann, M J

    2012-01-01

    We present a scheme for enhancing the anharmonicity of nanomechanical resonators by subjecting them to inhomogenous electrostatic fields. We show that this approach enables access to a novel regime of optomechanics, where the nonlinearity per quanta of the mechanical motion becomes comparable to the linewidth of the optical cavities employed. In this "resolved nonlinearity regime" transitions between phonon Fock states of the mechanical resonator can be selectively addressed. As one application we show that our approach would allow to prepare stationary phonon Fock states in experimentally realistic devices. Such states are manifestly non-classical as they show pronounced negative Wigner functions. We calculate the mechanical steady state by tracing out the cavity modes in the weak optomechanical coupling limit and corroborate our results by a numerical analysis of the full dynamics including the cavity modes. Finally, we show how the negativity of the stationary states' Wigner function can be read off the ou...

  10. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  11. Nonlinear optimization

    CERN Document Server

    Ruszczynski, Andrzej

    2011-01-01

    Optimization is one of the most important areas of modern applied mathematics, with applications in fields from engineering and economics to finance, statistics, management science, and medicine. While many books have addressed its various aspects, Nonlinear Optimization is the first comprehensive treatment that will allow graduate students and researchers to understand its modern ideas, principles, and methods within a reasonable time, but without sacrificing mathematical precision. Andrzej Ruszczynski, a leading expert in the optimization of nonlinear stochastic systems, integrates t

  12. Nonlinear Dynamics in Double Square Well Potential

    CERN Document Server

    Khomeriki, Ramaz; Ruffo, Stefano; Wimberger, Sandro; 10.1007/s11232-007-0096-y

    2009-01-01

    Considering the coherent nonlinear dynamics in double square well potential we find the example of coexistence of Josephson oscillations with a self-trapping regime. This macroscopic bistability is explained by proving analytically the simultaneous existence of symmetric, antisymmetric and asymmetric stationary solutions of the associated Gross-Pitaevskii equation. The effect is illustrated and confirmed by numerical simulations. This property allows to make suggestions on possible experiments using Bose-Einstein condensates in engineered optical lattices or weakly coupled optical waveguide arrays.

  13. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  14. The ac stark shift and space-borne rubidium atomic clocks

    Science.gov (United States)

    Formichella, V.; Camparo, J.; Sesia, I.; Signorile, G.; Galleani, L.; Huang, M.; Tavella, P.

    2016-11-01

    Due to its small size, low weight, and low power consumption, the Rb atomic frequency standard (RAFS) is routinely the first choice for atomic timekeeping in space. Consequently, though the device has very good frequency stability (rivaling passive hydrogen masers), there is interest in uncovering the fundamental processes limiting its long-term performance, with the goal of improving the device for future space systems and missions. The ac Stark shift (i.e., light shift) is one of the more likely processes limiting the RAFS' long-term timekeeping ability, yet its manifestation in the RAFS remains poorly understood. In part, this comes from the fact that light-shift induced frequency fluctuations must be quantified in terms of the RAFS' light-shift coefficient and the output variations in the RAFS' rf-discharge lamp, which is a nonlinear inductively-couple plasma (ICP). Here, we analyze the light-shift effect for a family of 10 on-orbit Block-IIR GPS RAFS, examining decade-long records of their on-orbit frequency and rf-discharge lamp fluctuations. We find that the ICP's light intensity variations can take several forms: deterministic aging, jumps, ramps, and non-stationary noise, each of which affects the RAFS' frequency via the light shift. Correlating these light intensity changes with RAFS frequency changes, we estimate the light-shift coefficient, κLS, for the family of RAFS: κLS = -(1.9 ± 0.3) × 10-12/%. The 16% family-wide variation in κLS indicates that while each RAFS may have its own individual κLS, the variance of κLS among similarly designed RAFS can be relatively small. Combining κLS with our estimate of the ICP light intensity's non-stationary noise, we find evidence that random-walk frequency noise in high-quality space-borne RAFS is strongly influenced by the RAFS' rf-discharge lamp via the light shift effect.

  15. Universal portfolios generated by weakly stationary processes

    Science.gov (United States)

    Tan, Choon Peng; Pang, Sook Theng

    2014-12-01

    Recently, a universal portfolio generated by a set of independent Brownian motions where a finite number of past stock prices are weighted by the moments of the multivariate normal distribution is introduced and studied. The multivariate normal moments as polynomials in time consequently lead to a constant rebalanced portfolio depending on the drift coefficients of the Brownian motions. For a weakly stationary process, a different type of universal portfolio is proposed where the weights on the stock prices depend only on the time differences of the stock prices. An empirical study is conducted on the returns achieved by the universal portfolios generated by the Ornstein-Uhlenbeck process on selected stock-price data sets. Promising results are demonstrated for increasing the wealth of the investor by using the weakly-stationary-process-generated universal portfolios.

  16. Relativistic elasticity of stationary fluid branes

    DEFF Research Database (Denmark)

    Armas, J.; Obers, N.A.

    2013-01-01

    Fluid mechanics can be formulated on dynamical surfaces of arbitrary codimension embedded in a background space-time. This has been the main object of study of the blackfold approach in which the emphasis has primarily been on stationary fluid configurations. Motivated by this approach we show...... under certain conditions that a given stationary fluid configuration living on a dynamical surface of vanishing thickness and satisfying locally the first law of thermodynamics will behave like an elastic brane when the surface is subject to small deformations. These results, which are independent...... of the number of space-time dimensions and of the fluid arising from a gravitational dual, reveal the (electro)elastic character of (charged) black branes when considering extrinsic perturbations....

  17. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, M.; Illerup, J. B.

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOX, NMVOC, CH4, CO, CO2, N2O, particulate matter, heavy metals, dioxins and PAH. Since 1990 the fuel consumption...... in stationary combustion has increased by 14% - the fossil fuel consumption however only by 8%. Despite the increased fuel consumption the emission of several pollutants has decreased due to the improved flue gas cleaning technology, improved burner technology and the change of fuel type used. A considerable...... decrease of the SO2, NOX and heavy metal emissions is mainly a result of decreased emissions from large power plants and waste incineration plants. The greenhouse gas emission has decreased 1,3% since 1990. The emission of CH4, however, has increased due to increased use of lean-burn gas engines in CHP...

  18. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, M.; Illerup, J. B.

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are: SO2, NOx, NMVOC, CH4, CO, CO2, N2O, particulate matter, heavy metals, dioxins and PAH. Since 1990 the fuel consumption...... in stationary combustion has increased by 12% - the fossil fuel consumption however only by 6%. Despite the increased fuel consumption the emission of several pollutants have decreased due to the improved flue gas cleaning technology, improved burner technology and the change of fuel type used. A considerable...... decrease of the SO2, NOx and heavy metal emissions is mainly a result of decreased emissions from large power plants and waste incineration plants. The greenhouse gas emission has decreased 1,5% since 1990. The emission of CH4, however, has increased due to increased use of lean-burn gas engines in CHP...

  19. Stationary populations with below-replacement fertility

    Directory of Open Access Journals (Sweden)

    Carl Schmertmann

    2012-04-01

    Full Text Available BACKGROUND A population with sustained below-replacement fertility and constant immigration eventually becomes stationary. Stationary-through-immigration (SI populations have unusual age structures that depend on the distribution of immigrants' arrival ages. OBJECTIVE I summarize known formal relationships between the distribution of immigrants' entry ages and the long-run size and structure of SI populations. I clarify a previously published result about SI dependency ratios. RESULTS The long-run size and age structure of an SI population depend on the remaining life expectancies of arriving immigrants, but are also sensitive to the expected numbers of native children born after arrival. Numerical calculations with contemporary Austrian data show (1 contrary to previously published results, immigration flows need not be concentrated in early working ages in order to ensure low overall dependency, and (2 the SI dependency ratio is minimized when all immigrants are in their mid-30s.

  20. Stationary SMS lenses for concentrating photovoltaics

    Science.gov (United States)

    Kotsidas, Panagiotis; Chatzi, Eleni; Modi, Vijay

    2010-08-01

    This paper presents a novel approach regarding the design of stationary, non imaging, refractive lenses with high acceptance angles. A lens lies on a stationary aperture and as the sun moves throughout the day, the concentrated focal spot is tracked by a moving solar cell. The purpose of this work is to replace the 2-axis tracking of the sun with internal motion of the miniaturized solar cell inside the module. We show families of linear lenses with wide acceptance angles 60. and 30. achieving moderate concentrations of 10 - 30 suns. The lens is designed with a variation of the simultaneous multiple surface (SMS) technique which is combined with a genetic algorithm to optimize the free variables of the problem.

  1. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, M.; Illerup, J. B.

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOX, NMVOC, CH4, CO, CO2, N2O, particulate matter, heavy metals, dioxins and PAH. Since 1990 the fuel consumption...... in stationary combustion has increased by 14% - the fossil fuel consumption however only by 8%. Despite the increased fuel consumption the emission of several pollutants has decreased due to the improved flue gas cleaning technology, improved burner technology and the change of fuel type used. A considerable...... plants. The emission of PAH increased as a result of the increased combustion of wood in residential boilers and stoves. Uncertainties for the emissions and trends have been estimated...

  2. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, M.; Illerup, J. B.

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are: SO2, NOx, NMVOC, CH4, CO, CO2, N2O, particulate matter, heavy metals, dioxins and PAH. Since 1990 the fuel consumption...... in stationary combustion has increased by 12% - the fossil fuel consumption however only by 6%. Despite the increased fuel consumption the emission of several pollutants have decreased due to the improved flue gas cleaning technology, improved burner technology and the change of fuel type used. A considerable...... plants. The emission of PAH increased as a result of the increased combustion of wood in residential boilers and stoves. Uncertainties for the emissions and trends have been estimated....

  3. Relativistic Elasticity of Stationary Fluid Branes

    CERN Document Server

    Armas, Jay

    2012-01-01

    Fluid mechanics can be formulated on dynamical surfaces of arbitrary co-dimension embedded in a background space-time. This has been the main object of study of the blackfold approach in which the emphasis has primarily been on stationary fluid configurations. Motivated by this approach we show under certain conditions that a given stationary fluid configuration living on a dynamical surface of vanishing thickness and satisfying locally the first law of thermodynamics will behave like an elastic brane when the surface is subject to small deformations. These results, which are independent of the number of space-time dimensions and of the fluid arising from a gravitational dual, reveal the (electro)elastic character of (charged) black branes when considering extrinsic perturbations.

  4. Stability of stationary states of non-local equations with singular interaction potentials

    KAUST Repository

    Fellner, Klemens

    2011-04-01

    We study the large-time behaviour of a non-local evolution equation for the density of particles or individuals subject to an external and an interaction potential. In particular, we consider interaction potentials which are singular in the sense that their first derivative is discontinuous at the origin.For locally attractive singular interaction potentials we prove under a linear stability condition local non-linear stability of stationary states consisting of a finite sum of Dirac masses. For singular repulsive interaction potentials we show the stability of stationary states of uniformly bounded solutions under a convexity condition.Finally, we present numerical simulations to illustrate our results. © 2010 Elsevier Ltd.

  5. Forms of density regulation and (quasi-) stationary distributions of population sizes in birds

    DEFF Research Database (Denmark)

    Sæther, Bernt-Erik; Engen, Steinar; Grøtan, Vidar;

    2008-01-01

    that have grown from very small population sizes followed by a period of fluctuations around K. We then use these parameters to estimate the quasi-stationary distribution of population size. There were often large uncertainties in these parameters specifying the form of density regulation that were...... generally independent of the duration of the study period. In contrast, precision in the estimates of environmental variance increased with the length of the time series. In most of the populations, a large proportion of the probability density of the (quasi-) stationary distribution of population sizes......The theta-logistic model of density regulation is an especially flexible class of density regulation models where different forms of non-linear density regulation can be expressed by only one parameter, u. Estimating the parameters of the thetalogistic model is, however, challenging. This is mainly...

  6. EMPLOYMENT, PRODUCTION AND CONSUMPTION WITH RANDOM UPDATE: NON-EQUILIBRIUM STATIONARY STATE EQUATIONS

    Directory of Open Access Journals (Sweden)

    Hynek Lavička

    2013-12-01

    Full Text Available In this work, we investigate the Model of Employment, Production and Consumption, as introduced in a series of papers by I. Wright [1–3] from the perspective of statistical physics, and we focus on the presence of equilibrium. The model itself belongs to the class of multi-agent computational models, which aim to explain macro-economic behavior using explicit micro-economic interactions.Based on the mean-field approximation, we form the Fokker-Plank equation(s and then formulate conditions forming the stationary solution, which results in a system of non-linear integral-differential equations. This approximation then allows the presence of non-equilibrium stationary states, where the model is a mixed additive-multiplicative model.

  7. Is the Labour Force Participation Rate Non-Stationary in Romania?

    Directory of Open Access Journals (Sweden)

    Tiwari Aviral Kumar

    2015-01-01

    Full Text Available The purpose of this paper is to test hysteresis of the Romanian labour force participation rate, by using time series data, with quarterly frequency, covering the period 1999Q1-2013Q4. The main results reveal that the Romanian labour force participation rate is a nonlinear process and has a partial unit root (i.e. it is stationary in the first regime and non-stationary in the second one, the main breaking point being registered around year 2005. In this context, the value of using unemployment rate as an indicator for capturing joblessness in this country is debatable. Starting from 2005, the participation rate has not followed long-term changes in unemployment rate, the disturbances having permanent effects on labour force participation rate.

  8. Superheater Tube Flat Wall Stationary Temperature Field

    Directory of Open Access Journals (Sweden)

    Parpiev A.T.

    2016-01-01

    Full Text Available The BKZ-220-100-9 steam generator platen superheater tube flat wall stationary temperature fields analysis have been made. The six steel grades, using in boiler fabrication, namely, St. 10, St. 20, 12H1MF, 15HM, 1H18N9T and 12H18N12T, have been used. The temperature curves calculation has been made by using outer and inner surface heat-transfer coefficients nine different combinations.

  9. Canceling Stationary Interference Signals Exploiting Secondary Data

    OpenAIRE

    Swärd, Johan; Jakobsson, Andreas

    2014-01-01

    In this paper, we propose a novel interference cancellation method that exploits secondary data to estimate stationary interference components present in both the primary and the secondary data sets, thereby allowing for the removal of such interference from the data sets, even when these components share frequencies with the signal of interest. The algorithm estimates the present interference components one frequency at a time, thus enabling for a computationally efficient algorithm, that re...

  10. Capacity of the Stationary Gaussian Channel

    Science.gov (United States)

    1988-03-01

    defined by a covariance function rW - 1 - corresponding to a rational spectral density function 4w. Hw will denote the REHS of rw with parameter set tO,m...wide sense (w.s.) stationary processes X with a SDF ( spectral density function ), denoted by tx, such that I/Ow is bounded and f A -{X)d& 2rP. The

  11. Variance of partial sums of stationary sequences

    CERN Document Server

    Deligiannidis, George

    2012-01-01

    Let $X_1, X_2,...$ be a centred sequence of weakly stationary random variables with spectral measure $F$ and partial sums $S_n = X_1 +...+ X_n$, and let $G(x) = \\int_{-x}^x F(\\rd x)$. We show that $\\var(S_n)$ is regularly varying of index $\\gamma$ at infinity, if and only if $G(x)$ is regularly varying of index $2-\\gamma$ at the origin ($0<\\gamma<2$).

  12. Generalization error bounds for stationary autoregressive models

    CERN Document Server

    McDonald, Daniel J; Schervish, Mark

    2011-01-01

    We derive generalization error bounds for stationary univariate autoregressive (AR) models. We show that the stationarity assumption alone lets us treat the estimation of AR models as a regularized kernel regression without the need to further regularize the model arbitrarily. We thereby bound the Rademacher complexity of AR models and apply existing Rademacher complexity results to characterize the predictive risk of AR models. We demonstrate our methods by predicting interest rate movements.

  13. 49 CFR 325.55 - Ambient conditions; stationary test.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Ambient conditions; stationary test. 325.55... MOTOR CARRIER NOISE EMISSION STANDARDS Measurement of Noise Emissions; Stationary Test § 325.55 Ambient conditions; stationary test. (a)(1) Sound. The ambient A-weighted sound level at the microphone...

  14. Multi-scale Quantitative Precipitation Forecasting Using Nonlinear and Nonstationary Teleconnection Signals and Artificial Neural Network Models

    Science.gov (United States)

    Global sea surface temperature (SST) anomalies can affect terrestrial precipitation via ocean-atmosphere interaction known as climate teleconnection. Non-stationary and non-linear characteristics of the ocean-atmosphere system make the identification of the teleconnection signals...

  15. Steady-state analysis of ac subharmonic generation in photorefractive sillenite crystals

    DEFF Research Database (Denmark)

    Johansen, P.M.; Pedersen, H.C.; Podivilov, E.V.;

    1998-01-01

    The stationary solution is obtained for the photorefractive subharmonic gratings excited in crystals of the sillenite family by a standing light interference pattern and an applied ac electric field. We show that the main subharmonic with doubled spatial period may become unstable against...... excitation of the subharmonic with quadrupled spatial period. The threshold condition for this bifurcation is found. [S1050-2947(98)05808-9]....

  16. Nonlinear susceptibility magnitude imaging of magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ficko, Bradley W., E-mail: Bradley.W.Ficko@Dartmouth.edu; Giacometti, Paolo; Diamond, Solomon G.

    2015-03-15

    This study demonstrates a method for improving the resolution of susceptibility magnitude imaging (SMI) using spatial information that arises from the nonlinear magnetization characteristics of magnetic nanoparticles (mNPs). In this proof-of-concept study of nonlinear SMI, a pair of drive coils and several permanent magnets generate applied magnetic fields and a coil is used as a magnetic field sensor. Sinusoidal alternating current (AC) in the drive coils results in linear mNP magnetization responses at primary frequencies, and nonlinear responses at harmonic frequencies and intermodulation frequencies. The spatial information content of the nonlinear responses is evaluated by reconstructing tomographic images with sequentially increasing voxel counts using the combined linear and nonlinear data. Using the linear data alone it is not possible to accurately reconstruct more than 2 voxels with a pair of drive coils and a single sensor. However, nonlinear SMI is found to accurately reconstruct 12 voxels (R{sup 2}=0.99, CNR=84.9) using the same physical configuration. Several time-multiplexing methods are then explored to determine if additional spatial information can be obtained by varying the amplitude, phase and frequency of the applied magnetic fields from the two drive coils. Asynchronous phase modulation, amplitude modulation, intermodulation phase modulation, and frequency modulation all resulted in accurate reconstruction of 6 voxels (R{sup 2}>0.9) indicating that time multiplexing is a valid approach to further increase the resolution of nonlinear SMI. The spatial information content of nonlinear mNP responses and the potential for resolution enhancement with time multiplexing demonstrate the concept and advantages of nonlinear SMI. - Highlights: • Development of a nonlinear susceptibility magnitude imaging model • Demonstration of nonlinear SMI with primary and harmonic frequencies • Demonstration of nonlinear SMI with primary and intermodulation

  17. Nonlinear channelizer

    Science.gov (United States)

    In, Visarath; Longhini, Patrick; Kho, Andy; Neff, Joseph D.; Leung, Daniel; Liu, Norman; Meadows, Brian K.; Gordon, Frank; Bulsara, Adi R.; Palacios, Antonio

    2012-12-01

    The nonlinear channelizer is an integrated circuit made up of large parallel arrays of analog nonlinear oscillators, which, collectively, serve as a broad-spectrum analyzer with the ability to receive complex signals containing multiple frequencies and instantaneously lock-on or respond to a received signal in a few oscillation cycles. The concept is based on the generation of internal oscillations in coupled nonlinear systems that do not normally oscillate in the absence of coupling. In particular, the system consists of unidirectionally coupled bistable nonlinear elements, where the frequency and other dynamical characteristics of the emergent oscillations depend on the system's internal parameters and the received signal. These properties and characteristics are being employed to develop a system capable of locking onto any arbitrary input radio frequency signal. The system is efficient by eliminating the need for high-speed, high-accuracy analog-to-digital converters, and compact by making use of nonlinear coupled systems to act as a channelizer (frequency binning and channeling), a low noise amplifier, and a frequency down-converter in a single step which, in turn, will reduce the size, weight, power, and cost of the entire communication system. This paper covers the theory, numerical simulations, and some engineering details that validate the concept at the frequency band of 1-4 GHz.

  18. Stability of two-dimensional spatial solitons in nonlocal nonlinear media

    DEFF Research Database (Denmark)

    Skupin, S.; Bang, Ole; Edmundson, D.;

    2006-01-01

    We discuss the existence and stability of two-dimensional solitons in media with spatially nonlocal nonlinear response. We show that such systems, which include thermal nonlinearity and dipolar Bose-Einstein condensates, may support a variety of stationary localized structures, including rotating...

  19. Exact bright and dark spatial soliton solutions in saturable nonlinear media

    Energy Technology Data Exchange (ETDEWEB)

    Calvo, Gabriel F. [Departamento de Matematicas, E.T.S. de Ingenieros Industriales, Instituto de Matematica Aplicada a la Ciencia y la Ingenieria (IMACI), E.T.S.I. Industriales, Avda. Camilo Jose Cela, 3, Universidad de Castilla-La Mancha, 13071 Ciudad Real (Spain); Belmonte-Beitia, Juan [Departamento de Matematicas, E.T.S. de Ingenieros Industriales, Instituto de Matematica Aplicada a la Ciencia y la Ingenieria (IMACI), E.T.S.I. Industriales, Avda. Camilo Jose Cela, 3, Universidad de Castilla-La Mancha, 13071 Ciudad Real (Spain)], E-mail: Juan.Belmonte@uclm.es; Perez-Garcia, Victor M. [Departamento de Matematicas, E.T.S. de Ingenieros Industriales, Instituto de Matematica Aplicada a la Ciencia y la Ingenieria (IMACI), E.T.S.I. Industriales, Avda. Camilo Jose Cela, 3, Universidad de Castilla-La Mancha, 13071 Ciudad Real (Spain)

    2009-08-30

    We present exact analytical bright and dark (black and grey) solitary wave solutions of a nonlinear Schroedinger-type equation describing the propagation of spatial beams in media exhibiting a saturable nonlinearity (such as centrosymmetric photorefractive materials). A qualitative study of the stationary equation is carried out together with a discussion of the stability of the solutions.

  20. Effect of AC electric fields on the stabilization of premixed bunsen flames

    KAUST Repository

    Kim, Minkuk

    2011-01-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

  1. Nonlinear dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Turchetti, G. (Bologna Univ. (Italy). Dipt. di Fisica)

    1989-01-01

    Research in nonlinear dynamics is rapidly expanding and its range of applications is extending beyond the traditional areas of science where it was first developed. Indeed while linear analysis and modelling, which has been very successful in mathematical physics and engineering, has become a mature science, many elementary phenomena of intrinsic nonlinear nature were recently experimentally detected and investigated, suggesting new theoretical work. Complex systems, as turbulent fluids, were known to be governed by intrinsically nonlinear laws since a long time ago, but received purely phenomenological descriptions. The pioneering works of Boltzmann and Poincare, probably because of their intrinsic difficulty, did not have a revolutionary impact at their time; it is only very recently that their message is reaching a significant number of mathematicians and physicists. Certainly the development of computers and computer graphics played an important role in developing geometric intuition of complex phenomena through simple numerical experiments, while a new mathematical framework to understand them was being developed.

  2. A Stationary Universe and the Basics of Relativity Theory

    CERN Document Server

    Ostermann, P

    2002-01-01

    Spectral rods and atomic clocks do not indicate true cosmic space and true cosmic time. Independent of any theory of gravitation the ephemeris time is understood to be that scale on which the motion of a single ideal planet would show constant periods from periastron to periastron in the field of an ideal star. Not only atomic clocks but also planetary clocks are natural ones. Though, they don't show the same time. There is a preferred Euclidean cosmic reference frame in which the galaxies statistically are at rest. The equivalence principle is valid in local gravitational fields as well as Galilei's law of inertia at great distance from sources, where the speed of light is constant. A stationary cosmic line element of general relativity seems to be in harmony with essential observational facts, though only as far as one can expect solving the nonlinear Einstein equations neglecting all spatial inhomogeneities. A negative cosmic gravitational pressure results of one third of the critical energy density. The c...

  3. Two-dimensional effects in nonlinear Kronig-Penney models

    DEFF Research Database (Denmark)

    Gaididei, Yuri Borisovich; Christiansen, Peter Leth; Rasmussen, Kim

    1997-01-01

    An analysis of two-dimensional (2D) effects in the nonlinear Kronig-Penney model is presented. We establish an effective one-dimensional description of the 2D effects, resulting in a set of pseudodifferential equations. The stationary states of the 2D system and their stability is studied...

  4. Solidification of ternary systems with a nonlinear phase diagram

    Science.gov (United States)

    Alexandrov, D. V.; Dubovoi, G. Yu.; Malygin, A. P.; Nizovtseva, I. G.; Toropova, L. V.

    2017-02-01

    The directional solidification of a ternary system with an extended phase transition region is theoretically studied. A mathematical model is developed to describe quasi-stationary solidification, and its analytical solution is constructed with allowance for a nonlinear liquidus line equation. A deviation of the liquidus equation from a linear function is shown to result in a substantial change in the solidification parameters.

  5. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  6. AcEST: DK956383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TAC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF S...AC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF Sb

  7. Communication: Newton homotopies for sampling stationary points of potential energy landscapes.

    Science.gov (United States)

    Mehta, Dhagash; Chen, Tianran; Hauenstein, Jonathan D; Wales, David J

    2014-09-28

    One of the most challenging and frequently arising problems in many areas of science is to find solutions of a system of multivariate nonlinear equations. There are several numerical methods that can find many (or all if the system is small enough) solutions but they all exhibit characteristic problems. Moreover, traditional methods can break down if the system contains singular solutions. Here, we propose an efficient implementation of Newton homotopies, which can sample a large number of the stationary points of complicated many-body potentials. We demonstrate how the procedure works by applying it to the nearest-neighbor ϕ(4) model and atomic clusters.

  8. Communication: Newton homotopies for sampling stationary points of potential energy landscapes

    Energy Technology Data Exchange (ETDEWEB)

    Mehta, Dhagash, E-mail: dmehta@nd.edu [Department of Applied and Computational Mathematics and Statistics, University of Notre Dame, Notre Dame, Indiana 46556 (United States); University Chemical Laboratory, The University of Cambridge, Cambridge CB2 1EW (United Kingdom); Chen, Tianran, E-mail: chentia1@msu.edu [Department of Mathematics, Michigan State University, East Lansing, Michigan 48823 (United States); Hauenstein, Jonathan D., E-mail: hauenstein@nd.edu [Department of Applied and Computational Mathematics and Statistics, University of Notre Dame, Notre Dame, Indiana 46556 (United States); Wales, David J., E-mail: dw34@cam.ac.uk [University Chemical Laboratory, The University of Cambridge, Cambridge CB2 1EW (United Kingdom)

    2014-09-28

    One of the most challenging and frequently arising problems in many areas of science is to find solutions of a system of multivariate nonlinear equations. There are several numerical methods that can find many (or all if the system is small enough) solutions but they all exhibit characteristic problems. Moreover, traditional methods can break down if the system contains singular solutions. Here, we propose an efficient implementation of Newton homotopies, which can sample a large number of the stationary points of complicated many-body potentials. We demonstrate how the procedure works by applying it to the nearest-neighbor ϕ{sup 4} model and atomic clusters.

  9. Natural curvilinear coordinates for ideal MHD equations. Non-stationary flows with constant total pressure

    Energy Technology Data Exchange (ETDEWEB)

    Golovin, Sergey V., E-mail: sergey@hydro.nsc.r [Lavrentyev Institute of Hydrodynamics SB RAS, 630090 Novosibirsk (Russian Federation); Department of Mechanics and Mathematics, Novosibirsk State University, 630090 Novosibirsk (Russian Federation)

    2011-01-17

    Equations of magnetohydrodynamics (MHD) in the natural curvilinear system of coordinates where trajectories and magnetic lines play a role of coordinate curves are reduced to the non-linear vector wave equation coupled with the incompressibility condition in the form of the generalized Cauchy integral. The symmetry group of obtained equation, equivalence transformation, and group classification with respect to the constitutive equation are calculated. New exact solutions with functional arbitrariness describing non-stationary incompressible flows with constant total pressure are given by explicit formulae. The corresponding magnetic surfaces have the shape of deformed nested cylinders, tori, or knotted tubes.

  10. Numerical Solution of Problem for Non-Stationary Heat Conduction in Multi-Layer Bodies

    Directory of Open Access Journals (Sweden)

    R. I. Еsman

    2007-01-01

    Full Text Available A mathematical model for non-stationary heat conduction of multi-layer bodies has been developed. Dirac’s δ-function is used to take into account phase and chemical transformations in one of the wall layers. While formulating a problem non-linear heat conduction equations have been used with due account of dependence of thermal and physical characteristics on temperature. Solution of the problem is realized with the help of methods of a numerical experiment and computer modeling.

  11. Supervised and unsupervised condition monitoring of non-stationary acoustic emission signals

    DEFF Research Database (Denmark)

    Sigurdsson, Sigurdur; Pontoppidan, Niels Henrik; Larsen, Jan

    2005-01-01

    We are pursuing a system that monitors the engine condition under multiple load settings, i.e. under non-stationary operating conditions. The running speed when data acquired under simulated marine conditions (different load settings on the propeller curve) was in the range from approximately 70...... approaches perform well, which indicates that unsupervised models, modelled without faulty data, may be used for accurate condition monitoring....... condition changes across load changes. In this paper we approach this load interpolation problem with supervised and unsupervised learning, i.e. model with normal and fault examples and normal examples only, respectively. We apply non-linear methods for the learning of engine condition changes. Both...

  12. Plasmon-soliton waves in planar slot waveguides: II. Results for stationary waves and stability analysis

    CERN Document Server

    Walasik, Wiktor; Renversez, Gilles

    2016-01-01

    We describe the results of the two methods we developed to calculate the stationary nonlinear solutions in one-dimensional plasmonic slot waveguides made of a finite-thickness nonlinear dielectric core surrounded by metal regions. These two methods are described in detail in the preceding article [Walasik et al., submitted]. For symmetric waveguides, we provide the nonlinear dispersion curves obtained using the two methods and compare them. We describe the well known low-order modes and the higher-modes that were not described before. All the modes are classified into two families: modes with and without nodes. We also compare nonlinear modes with nodes with the linear modes in similar linear slot waveguides with a homogeneous core. We recover the symmetry breaking Hopf bifurcation of the first symmetric nonlinear mode toward an asymmetric mode and we show that one of the higher modes also exhibits a bifurcation. We study the behavior of the bifurcation of the fundamental mode as a function of the permittivit...

  13. Applications of exact linearization techniques for steady-state stability enhancement in a weak ac/dc system

    Energy Technology Data Exchange (ETDEWEB)

    Kaprielian, S.; Clements, K. (Dept. of Electrical Engineering, Worcester Polytechnic Inst., Worcester, MA (US)); Turi, J. (Texas Univ., Richardson, TX (United States))

    1992-05-01

    A nonlinear control strategy to improve the steady-state stability of a weak AC/DC power system is presented. The approach described in this paper is based on the extension of feedback linearization techniques to nonlinear descriptor system models. This method produces a nonlinear control strategy which is capable of enhancing system performance for various system operating conditions. This claim is supported with simulation results.

  14. The Power of Unit Root Tests Against Nonlinear Local Alternatives

    DEFF Research Database (Denmark)

    Demetrescu, Matei; Kruse, Robinson

    of Econometrics 112, 359-379) in comparison to the linear Dickey-Fuller test. To this end, we consider different adjustment schemes for deterministic terms. We provide asymptotic results which imply that the error variance has a severe impact on the behavior of the tests in the nonlinear case; the reason...... by simulation. Furthermore, our own simulation results suggest that the user-specied adjustment scheme for deterministic components (e.g. OLS, GLS, or recursive adjustment) has a much higher impact on the power of unit root tests than accounting for nonlinearity, at least under local (linear or nonlinear......This article extends the analysis of local power of unit root tests in a nonlinear direction by considering local nonlinear alternatives and tests built specically against stationary nonlinear models. In particular, we focus on the popular test proposed by Kapetanios et al. (2003, Journal...

  15. Nonlinear Systems.

    Science.gov (United States)

    Seider, Warren D.; Ungar, Lyle H.

    1987-01-01

    Describes a course in nonlinear mathematics courses offered at the University of Pennsylvania which provides an opportunity for students to examine the complex solution spaces that chemical engineers encounter. Topics include modeling many chemical processes, especially those involving reaction and diffusion, auto catalytic reactions, phase…

  16. Damage detection using transient trajectories in phase-space with extended random decrement technique under non-stationary excitations

    Science.gov (United States)

    Liu, Gang; Mao, Zhu; Todd, Michael

    2016-11-01

    This paper proposes a damage detection method based on the geometrical variation of transient trajectories in phase-space, and the proposed methodology is compatible with non-stationary excitations (e.g., earthquake-induced ground motion). The work presented assumes zero-mean non-stationary excitation, and extends the random decrement technique to convert non-stationary response signals of the structure into free-vibration data. Transient trajectories of the structure are reconstructed via the embedding theorem from the converted free-vibration data, and trajectories are mapped successively into phase-space to enhance statistical analysis. Based upon the characterized system dynamics in terms of phase-space, the time prediction error is adopted as the damage index. To identify the presence and severity of damage in a statistically rigorous way, receiver operating characteristic curves and the Bhattacharyya distance are employed. The results from both numerical simulations and experiments validate the proposed framework, when the test structures are subject to non-stationary excitations. The extension achieved in this paper enables the phase-space damage detection approach to be compatible with non-stationary scenarios, such as traffic, wind, and earthquake loadings. Moreover, the results indicate that this phase-state-based method is able to identify damage-induced nonlinearity in response, which is an intrinsic characteristic associated with most structural damage types.

  17. Novel roaming and stationary tethered aerial robots for continuous mobile missions in nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Gu, Beom W.; Choi, Su Y.; Rim, Chun T. [Dept. of Nuclear and Quantum Engineering, KAIST, Daejeon (Korea, Republic of); Choi, Young Soo [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Cai, Guowei; Seneviratne, Lakmal [Dept. of Aerospace Engineering, Khalifa University, Abu Dhabi (United Arab Emirates)

    2016-08-15

    In this paper, new tethered aerial robots including roaming tethered aerial robots (RTARs) for radioactive material sampling and stationary tethered aerial robots (STARs) for environment monitoring are proposed to meet extremely-long-endurance missions of nuclear power plants. The flight of the proposed tethered aerial robots may last for a few days or even a few months as long as the tethered cable provides continuous power. A high voltage AC or DC power system was newly adopted to reduce the mass of the tethered cable. The RTAR uses a tethered cable spooled from the aerial robot and an aerial tension control system. The aerial tension control system provides the appropriate tension to the tethered cable, which is accordingly laid down on the ground as the RTAR roams. The STAR includes a tethered cable spooled from the ground and a ground tension control system, which enables the STAR to reach high altitudes. Prototypes of the RTAR and STAR were designed and successfully demonstrated in outdoor environments, where the load power, power type, operating frequency, and flight attitude of the RTAR and STAR were: 180 W, AC 100 kHz, and 20 m; and 300 W, AC or DC 100 kHz, and 80 m, respectively.

  18. Stationary one-dimensional dispersive shock waves

    CERN Document Server

    Kartashov, Yaroslav V

    2011-01-01

    We address shock waves generated upon the interaction of tilted plane waves with negative refractive index defect in defocusing media with linear gain and two-photon absorption. We found that in contrast to conservative media where one-dimensional dispersive shock waves usually exist only as nonstationary objects expanding away from defect or generating beam, the competition between gain and two-photon absorption in dissipative medium results in the formation of localized stationary dispersive shock waves, whose transverse extent may considerably exceed that of the refractive index defect. One-dimensional dispersive shock waves are stable if the defect strength does not exceed certain critical value.

  19. Stationary stochastic processes for scientists and engineers

    CERN Document Server

    Lindgren, Georg; Sandsten, Maria

    2013-01-01

    ""This book is designed for a first course in stationary stochastic processes in science and engineering and does a very good job in introducing many concepts and ideas to students in these fields. … the book has probably been tested in the classroom many times, which also manifests itself in its virtual lack of typos. … Another great feature of the book is that it contains a wealth of worked example from many different fields. These help clarify concepts and theorems and I believe students will appreciate them-I certainly did. … The book is well suited for a one-semester course as it contains

  20. Carbon nanotube stationary phases for microchip electrochromatography

    DEFF Research Database (Denmark)

    Mogensen, Klaus Bo; Bøggild, Peter; Kutter, Jörg Peter

    nanotubes are very interesting for integration in especially microfluidic devices, because they can readily be grown on planar substrates by means of chemical vapour deposition. In this way the cumbersome process of packing of the stationary phase in the finished microfluidic channels is avoided and the CNT......, microfluidic devices with microfabricated carbon nanotube columns for electrochromatographic separations will be presented. The electrically conductive carbon nanotube layer has been patterned into hexoganol micropillars in order to support electroosmotic flow without forming gas bubbles from electrolysis...

  1. Numerical Methods for Finding Stationary Gravitational Solutions

    CERN Document Server

    Dias, Oscar J C; Way, Benson

    2015-01-01

    The wide applications of higher dimensional gravity and gauge/gravity duality have fuelled the search for new stationary solutions of the Einstein equation (possibly coupled to matter). In this topical review, we explain the mathematical foundations and give a practical guide for the numerical solution of gravitational boundary value problems. We present these methods by way of example: resolving asymptotically flat black rings, singly-spinning lumpy black holes in anti-de Sitter (AdS), and the Gregory-Laflamme zero modes of small rotating black holes in AdS$_5\\times S^5$. We also include several tools and tricks that have been useful throughout the literature.

  2. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  3. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  4. Stationary Large Amplitude Dynamics of the Finite Chain of Harmonically Coupled Pendulums

    CERN Document Server

    Smirnov, Valeri V

    2016-01-01

    We present an analytical description of the large-amplitude stationary oscillations of the finite discrete system of harmonically-coupled pendulums without any restrictions to their amplitudes (excluding a vicinity of $\\pi$). Although this model has numerous applications in different fields of physics it was studied earlier in the infinite limit only. The developed approach allows to find the dispersion relations for arbitrary amplitudes of the nonlinear normal modes. We underline that the long-wavelength approximation, which is described by well- known sine-Gordon equation leads to inadequate zone structure for the amplitude order of $\\pi/2$ even if the chain is long enough. The extremely complex zone structure at the large amplitudes corresponds to lot of resonances between nonlinear normal modes even with strongly different wave numbers. Due to complexity of the dispersion relations the more short wavelength modes can possess the smaller frequencies. The numerical simulation of the dynamics of the finite-l...

  5. Complete classification of stationary flows with constant total pressure of ideal incompressible infinitely conducting fluid

    CERN Document Server

    Golovin, S V

    2011-01-01

    The exhaustive classification of stationary incompressible flows with constant total pressure of ideal infinitely electrically conducting fluid is given. By introduction of curvilinear coordinates based on streamlines and magnetic lines of the flow the system of magnetohydrodynamics (MHD) equations is reduced to a nonlinear vector wave equation extended by the incompressibility condition in a form of a generalized Cauchy integral. For flows with constant total pressure the wave equation is explicitly integrated, whereas the incompressibility condition is reduced to a scalar equation for functions, depending on different sets of variables. The central difficulty of the investigation is the separation of variables in the scalar equation, and integration of the resulting overdetermined systems of nonlinear partially differential equations. The canonical representatives of all possible types of solutions together with equivalence transformations, that extend the canonical set to the whole amount of solutions are ...

  6. Feasibility of a stationary micro-SQUID

    CERN Document Server

    Berger, Jorge

    2016-01-01

    The standard operation of a dc SQUID leads to oscillatory electric fields that emit electromagnetic radiation and can change the state of the measured sample. A stationary SQUID could be advantageous when back action on the measured sample has to be avoided. We study a superconducting loop that encloses a magnetic flux, connected to a superconducting and to a normal electrode, when a fixed electric current between the electrodes flows through the loop. The considered circuit does not contain Josephson junctions. We find that in a very broad range of parameters the current flow converges to a stationary regime. The potential difference between the electrodes depends on the magnetic flux, so that measuring this voltage would provide information on the enclosed flux. The influence of thermal noise was estimated. The sizes of the voltage and of the power dissipation could be appropriate for the design of a practical fluxmeter. We found narrow ranges of flux at which the voltage varies sharply with the flux.

  7. Information Spreading in Stationary Markovian Evolving Graphs

    CERN Document Server

    Clementi, Andrea; Pasquale, Francesco; Silvestri, Riccardo

    2011-01-01

    Markovian evolving graphs are dynamic-graph models where the links among a fixed set of nodes change during time according to an arbitrary Markovian rule. They are extremely general and they can well describe important dynamic-network scenarios. We study the speed of information spreading in the "stationary phase" by analyzing the completion time of the "flooding mechanism". We prove a general theorem that establishes an upper bound on flooding time in any stationary Markovian evolving graph in terms of its node-expansion properties. We apply our theorem in two natural and relevant cases of such dynamic graphs. "Geometric Markovian evolving graphs" where the Markovian behaviour is yielded by "n" mobile radio stations, with fixed transmission radius, that perform independent random walks over a square region of the plane. "Edge-Markovian evolving graphs" where the probability of existence of any edge at time "t" depends on the existence (or not) of the same edge at time "t-1". In both cases, the obtained upper...

  8. Stationary versus non-stationary (13)C-MFA: a comparison using a consistent dataset.

    Science.gov (United States)

    Noack, Stephan; Nöh, Katharina; Moch, Matthias; Oldiges, Marco; Wiechert, Wolfgang

    2011-07-10

    Besides the well-established (13)C-metabolic flux analysis ((13)C-MFA) which characterizes a cell's fluxome in a metabolic and isotopic stationary state a current area of research is isotopically non-stationary MFA. Non-stationary (13)C-MFA uses short-time isotopic transient data instead of long-time isotopic equilibrium data and thus is capable to resolve fluxes within much shorter labeling experiments. However, a comparison of both methods with data from one single experiment has not been made so far. In order to create a consistent database for directly comparing both methods a (13)C-labeling experiment in a fed-batch cultivation with a Corynebacterium glutamicum lysine producer was carried out. During the experiment the substrate glucose was switched from unlabeled to a specifically labeled glucose mixture which was immediately traced by fast sampling and metabolite quenching. The time course of labeling enrichments in intracellular metabolites until isotopic stationarity was monitored by LC-MS/MS. The resulting dataset was evaluated using the classical as well as the isotopic non-stationary MFA approach. The results show that not only the obtained relative data, i.e. intracellular flux distributions, but also the more informative quantitative fluxome data significantly depend on the combination of the measurements and the underlying modeling approach used for data integration. Taking further criteria on the experimental and computational part into consideration, the current limitations of both methods are demonstrated and possible pitfalls are concluded.

  9. SEISMIC RANDOM VIBRATION ANALYSIS OF LOCALLY NONLINEAR STRUCTURES

    Institute of Scientific and Technical Information of China (English)

    ZhaoYan; LinJiahao; ZhangYahui; AnWei

    2003-01-01

    A nonlinear seismic analysis method for complex frame structures subjected to stationary random ground excitations is proposed. The nonlinear elasto-plastic behaviors may take place only on a small part of the structure. The Bouc-Wen differential equation model is used to model the hysteretic characteristics of the nonlinear components. The Pseudo Excitation Method (PEM) is used in solving the linearized random differential equations to replace the solution of the less efficient Lyapunov equation. Numerical results of a real bridge show that .the method proposed is effective for practical engineering analysis.

  10. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    Present MGs incorporate AC and DC sources and loads along with storage and power ... Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle ... But in case of renewable based MGs, where small and intermittent sources ...

  11. Effect of ac electric fields on counterflow diffusion flame of methane

    KAUST Repository

    Chul Choi, Byung

    2012-08-01

    The effect of electric fields on the response of diffusion flames in a counterflow has been investigated experimentally by varying the AC voltage and frequency. The result showed that the flame was stationary with high AC frequency above the threshold frequency, and it increased with the applied voltage and then leveled off at 35 Hz. Below the threshold frequency, however, the flame oscillated with a frequency that was synchronized with the applied AC frequency. This oscillation can be attributed to the ionic wind effect due to the generation of bulk flow, which arises from the momentum transfer by molecular collisions between neutral molecules and ions, where the ions in the reaction zone were accelerated by the Lorentz force. © 2012 The Korean Society of Mechanical Engineers.

  12. The maximal process of nonlinear shot noise

    Science.gov (United States)

    Eliazar, Iddo; Klafter, Joseph

    2009-05-01

    In the nonlinear shot noise system-model shots’ statistics are governed by general Poisson processes, and shots’ decay-dynamics are governed by general nonlinear differential equations. In this research we consider a nonlinear shot noise system and explore the process tracking, along time, the system’s maximal shot magnitude. This ‘maximal process’ is a stationary Markov process following a decay-surge evolution; it is highly robust, and it is capable of displaying both a wide spectrum of statistical behaviors and a rich variety of random decay-surge sample-path trajectories. A comprehensive analysis of the maximal process is conducted, including its Markovian structure, its decay-surge structure, and its correlation structure. All results are obtained analytically and in closed-form.

  13. An intelligent approach for variable size segmentation of non-stationary signals.

    Science.gov (United States)

    Azami, Hamed; Hassanpour, Hamid; Escudero, Javier; Sanei, Saeid

    2015-09-01

    In numerous signal processing applications, non-stationary signals should be segmented to piece-wise stationary epochs before being further analyzed. In this article, an enhanced segmentation method based on fractal dimension (FD) and evolutionary algorithms (EAs) for non-stationary signals, such as electroencephalogram (EEG), magnetoencephalogram (MEG) and electromyogram (EMG), is proposed. In the proposed approach, discrete wavelet transform (DWT) decomposes the signal into orthonormal time series with different frequency bands. Then, the FD of the decomposed signal is calculated within two sliding windows. The accuracy of the segmentation method depends on these parameters of FD. In this study, four EAs are used to increase the accuracy of segmentation method and choose acceptable parameters of the FD. These include particle swarm optimization (PSO), new PSO (NPSO), PSO with mutation, and bee colony optimization (BCO). The suggested methods are compared with other most popular approaches (improved nonlinear energy operator (INLEO), wavelet generalized likelihood ratio (WGLR), and Varri's method) using synthetic signals, real EEG data, and the difference in the received photons of galactic objects. The results demonstrate the absolute superiority of the suggested approach.

  14. An intelligent approach for variable size segmentation of non-stationary signals

    Directory of Open Access Journals (Sweden)

    Hamed Azami

    2015-09-01

    Full Text Available In numerous signal processing applications, non-stationary signals should be segmented to piece-wise stationary epochs before being further analyzed. In this article, an enhanced segmentation method based on fractal dimension (FD and evolutionary algorithms (EAs for non-stationary signals, such as electroencephalogram (EEG, magnetoencephalogram (MEG and electromyogram (EMG, is proposed. In the proposed approach, discrete wavelet transform (DWT decomposes the signal into orthonormal time series with different frequency bands. Then, the FD of the decomposed signal is calculated within two sliding windows. The accuracy of the segmentation method depends on these parameters of FD. In this study, four EAs are used to increase the accuracy of segmentation method and choose acceptable parameters of the FD. These include particle swarm optimization (PSO, new PSO (NPSO, PSO with mutation, and bee colony optimization (BCO. The suggested methods are compared with other most popular approaches (improved nonlinear energy operator (INLEO, wavelet generalized likelihood ratio (WGLR, and Varri’s method using synthetic signals, real EEG data, and the difference in the received photons of galactic objects. The results demonstrate the absolute superiority of the suggested approach.

  15. Non-Stationary Hydrologic Frequency Analysis using B-Splines Quantile Regression

    Science.gov (United States)

    Nasri, B.; St-Hilaire, A.; Bouezmarni, T.; Ouarda, T.

    2015-12-01

    Hydrologic frequency analysis is commonly used by engineers and hydrologists to provide the basic information on planning, design and management of hydraulic structures and water resources system under the assumption of stationarity. However, with increasing evidence of changing climate, it is possible that the assumption of stationarity would no longer be valid and the results of conventional analysis would become questionable. In this study, we consider a framework for frequency analysis of extreme flows based on B-Splines quantile regression, which allows to model non-stationary data that have a dependence on covariates. Such covariates may have linear or nonlinear dependence. A Markov Chain Monte Carlo (MCMC) algorithm is used to estimate quantiles and their posterior distributions. A coefficient of determination for quantiles regression is proposed to evaluate the estimation of the proposed model for each quantile level. The method is applied on annual maximum and minimum streamflow records in Ontario, Canada. Climate indices are considered to describe the non-stationarity in these variables and to estimate the quantiles in this case. The results show large differences between the non-stationary quantiles and their stationary equivalents for annual maximum and minimum discharge with high annual non-exceedance probabilities. Keywords: Quantile regression, B-Splines functions, MCMC, Streamflow, Climate indices, non-stationarity.

  16. Static- and Stationary-complete Spacetimes: Algebraic and Causal Structures

    CERN Document Server

    Harris, Steven G

    2014-01-01

    This is intended as an analysis of the global properties of static and stationary spacetimes with complete (timelike) Killing field, with particular attention to quotients by group actions. This is presented in terms of algebraic structures which are fairly simple for the static case and more involved for the stationary case; the most important tool, the fundamental cocycle, is a cohomological class for static spacetimes but of somewhat looser structure in the stationary case. In particular: (1) A new measurement, similar to the spacetime interval in Minkowski space, is devised for detecting whether two points are causally related in a stationary spacetime; this proves very useful for analysis. (2) All stationary spacetimes are categorized by how they behave with respect to the fundamental cocycle; this enables a complete characterization of global causality properties. (3) It is shown how these tools determine whether global hyperbolicity of a stationary spacetime is inherited by its quotients. (4) Examples ...

  17. Dielectric relaxation and ac conductivity of sodium tungsten phosphate glasses

    Indian Academy of Sciences (India)

    B Singh; P S Tarsikka; L Singh

    2002-10-01

    Studies of dielectric relaxation and ac conductivity have been made on three samples of sodium tungsten phosphate glasses over a temperature range of 77–420 K. Complex relative permittivity data have been analyzed using dielectric modulus approach. Conductivity relaxation frequency increases with the increase of temperature. Activation energy for conductivity relaxation has also been evaluated. Measured ac conductivity (m()) has been found to be higher than dc at low temperatures whereas at high temperature m() becomes equal to dc at all frequencies. The ac conductivity obeys the relation ac() = A over a considerable range of low temperatures. Values of exponent are nearly equal to unity at about 78 K and the values decrease non-linearly with the increase of temperature. Values of the number density of states at Fermi level ((F)) have been evaluated at 80 K assuming values of electron wave function decay constant to be 0.5 (Å)-1. Values of (F) have the order 1020 which are well within the range suggested for localized states. Present values of (F) are smaller than those for tungsten phosphate glasses.

  18. On general filtering problem of stationary processes with fixed transformation

    Directory of Open Access Journals (Sweden)

    Li Long

    2011-01-01

    Full Text Available Abstract A fixed transformation are given for one-dimensional stationary processes in this paper. Based on this, we propose a general filtering problem of stationary processes with fixed transformation. Finally, on a stationary processes with no any additional conditions, we get the spectral characteristics of P H η ( t ξ in the space L2(FX(dλ, and then we calculate the value of the best predict quantity Q of the general filtering problem.

  19. Stationary phase optimized selectivity supercritical fluid chromatography (SOS-SFC)

    OpenAIRE

    Delahaye, Sander; Lynen, Frederic

    2013-01-01

    In stationary phase optimized selectivity liquid chromatography (SOS-LC) the stationary phase becomes a tunable parameter by connecting column segments with variable lengths of different stationary phases. An optimization procedure and algorithm based on the PRISMA model for optimization of the mobile phase in LC was developed to apply this strategy for isocratic and gradient separations. An optimized column segment combination, giving the highest separation selectivity for all compounds in a...

  20. An Entropy Measure of Non-Stationary Processes

    Directory of Open Access Journals (Sweden)

    Ling Feng Liu

    2014-03-01

    Full Text Available Shannon’s source entropy formula is not appropriate to measure the uncertainty of non-stationary processes. In this paper, we propose a new entropy measure for non-stationary processes, which is greater than or equal to Shannon’s source entropy. The maximum entropy of the non-stationary process has been considered, and it can be used as a design guideline in cryptography.

  1. Gaussian semiparametric estimation of non-stationary time series

    OpenAIRE

    Velasco, Carlos

    1998-01-01

    Generalizing the definition of the memory parameter d in terms of the differentiated series, we showed in Velasco (Non-stationary log-periodogram regression, Forthcoming J. Economet., 1997) that it is possible to estimate consistently the memory of non-stationary processes using methods designed for stationary long-range-dependent time series. In this paper we consider the Gaussian semiparametric estimate analysed by Robinson (Gaussian semiparametric estimation of long range dependence. Ann. ...

  2. Analysis of structural seismic behaviour: from non stationary to non linear effects

    Science.gov (United States)

    Carlo Ponzo, Felice; Ditommaso, Rocco; Monaco, Lisa

    2014-05-01

    to either non-linearity (i.e. Damage) or non-stationary phenomenon (the particular combination of input and response). This fact may lead to erroneous conclusions attributing the frequency variations to the structural damage instead that to non-stationary phenomena. This article deals with the theoretical foundation of the analysis of non-stationary behaviour of structures, and then provides experimental evidence in order to distinguish non-linearity from simple non-stationary phenomena. Further work must be performed in order to fully validate this kind of approach and to completely define these threshold for various structural forms and building typologies. REFERENCES Ponzo F. C., Ditommaso R., Auletta G., Mossucca A. (2010). A Fast Method for Structural Health Monitoring of Italian Strategic Reinforced Concrete Buildings. Bulletin of Earthquake Engineering. Volume 8, Number 6, pp. 1421-1434. DOI: 10.1007/s10518-010-9194-6.

  3. An Automated Ac Susceptibility Set up Fabricated Using a Closed-Cycle Helium Refrigerator

    CERN Document Server

    Kundu, S

    2011-01-01

    We have described here the design and operation of an automated ac susceptibility set up using a closed cycle helium refrigerator. This set up is useful for measuring linear and nonlinear magnetic susceptibilities of various magnetic materials. The working temperature range is 2 K to 300 K. The overall sensitivity of the set up is found to be 10-3 emu.

  4. Stationary Charged Scalar Clouds around Black Holes in String Theory

    CERN Document Server

    Bernard, Canisius

    2016-01-01

    It was reported that Kerr-Newman black holes can support linear charged scalar field in their exterior regions. This stationary massive charged scalar field can form a bound-state and these bound-states are called stationary scalar clouds. In this paper, we study that Kerr-Sen black holes can also support stationary massive charged scalar clouds by matching the near and far region solutions of the radial part of Klein-Gordon wave equation. We also review stationary scalar clouds within the background of static electrically charged black hole solution in the low energy limit of heterotic string field theory namely the GMGHS black holes.

  5. Stationary charged scalar clouds around black holes in string theory

    Science.gov (United States)

    Bernard, Canisius

    2016-10-01

    It was reported that Kerr-Newman black holes can support linear charged scalar fields in their exterior regions. These stationary massive charged scalar fields can form bound states, which are called stationary scalar clouds. In this paper, we show that Kerr-Sen black holes can also support stationary massive charged scalar clouds by matching the near- and far-region solutions of the radial part of the Klein-Gordon wave equation. We also review stationary scalar clouds within the background of static electrically charged black hole solutions in the low-energy limit of heterotic string field theory, namely, the Gibbons-Maeda-Garfinkle-Horowitz-Strominger black holes.

  6. L0 Regularized Stationary-time Estimation for Crowd Analysis.

    Science.gov (United States)

    Yi, Shuai; Wang, Xiaogang; Lu, Cewu; Jia, Jiaya; Li, Hongsheng

    2016-04-29

    In this paper, we tackle the problem of stationary crowd analysis which is as important as modeling mobile groups in crowd scenes and finds many important applications in crowd surveillance. Our key contribution is to propose a robust algorithm for estimating how long a foreground pixel becomes stationary. It is much more challenging than only subtracting background because failure at a single frame due to local movement of objects, lighting variation, and occlusion could lead to large errors on stationary-time estimation. To achieve robust and accurate estimation, sparse constraints along spatial and temporal dimensions are jointly added by mixed partials (which are second-order gradients) to shape a 3D stationary-time map. It is formulated as an L0 optimization problem. Besides background subtraction, it distinguishes among different foreground objects, which are close or overlapped in the spatio-temporal space by using a locally shared foreground codebook. The proposed technologies are further demonstrated through three applications. 1) Based on the results of stationary-time estimation, twelve descriptors are proposed to detect four types of stationary crowd activities. 2) The averaged stationary-time map is estimated to analyze crowd scene structures. 3) The result of stationary-time estimation is also used to study the influence of stationary crowd groups to traffic patterns.

  7. Numerical Simulation of Non-Linear Wave Propagation in Waters of Mildly Varying Topography with Complicated Boundary

    Institute of Scientific and Technical Information of China (English)

    张洪生; 洪广文; 丁平兴; 曹振轶

    2001-01-01

    In this paper, the characteristics of different forms of mild slope equations for non-linear wave are analyzed, and new non-linear theoretic models for wave propagation are presented, with non-linear terms added to the mild slope equations for non-stationary linear waves and dissipative effects considered. Numerical simulation models are developed of non-linear wave propagation for waters of mildly varying topography with complicated boundary, and the effects are studied of different non-linear corrections on calculation results of extended mild slope equations. Systematical numerical simulation tests show that the present models can effectively reflect non-linear effects.

  8. Separable geodesic action slicing in stationary spacetimes

    CERN Document Server

    Bini, Donato; Jantzen, Robert T

    2014-01-01

    A simple observation about the action for geodesics in a stationary spacetime with separable geodesic equations leads to a natural class of slicings of that spacetime whose orthogonal geodesic trajectories represent freely falling observers. The time coordinate function can then be taken to be the observer proper time, leading to a unit lapse function. This explains some of the properties of the original Painlev\\'e-Gullstrand coordinates on the Schwarzschild spacetime and their generalization to the Kerr-Newman family of spacetimes, reproducible also locally for the G\\"odel spacetime. For the static spherically symmetric case the slicing can be chosen to be intrinsically flat with spherically symmetric geodesic observers, leaving all the gravitational field information in the shift vector field.

  9. Stationary phases for superheated water chromatography

    CERN Document Server

    Saha, S

    2002-01-01

    This project focused on the comparison of conventional liquid chromatography and superheated water chromatography. It examined the differences in efficiency and retention of a range of different stationary phases. Alkyl aryl ketones and eight aromatic compounds were separated on PBD-zirconia, Xterra RP 18, Luna C sub 1 sub 8 (2) and Oasis HLB columns using conventional LC and superheated water chromatography system. The retention indices were determined in the different eluents. On changing the organic component of the eluent from methanol to acetonitrile to superheated water considerable improvements were found in the peak shapes and column efficiencies on the PBD-zirconia and Oasis HLB columns. PS-DVB, PBD-zirconia and Xterra RP 18 columns have been used in efficiency studies. It was found that simply elevating the column temperature did not increase the efficiency of a separation in superheated water chromatography. The efficiency depended on flow rate, injection volume and also mobile phase preheating sys...

  10. Learning Markov models for stationary system behaviors

    DEFF Research Database (Denmark)

    Chen, Yingke; Mao, Hua; Jaeger, Manfred

    2012-01-01

    Establishing an accurate model for formal verification of an existing hardware or software system is often a manual process that is both time consuming and resource demanding. In order to ease the model construction phase, methods have recently been proposed for automatically learning accurate...... system models from data in the form of observations of the target system. Common for these approaches is that they assume the data to consist of multiple independent observation sequences. However, for certain types of systems, in particular many running embedded systems, one would only have access...... the learned model. Experiments demonstrate that system properties (formulated as stationary probabilities of LTL formulas) can be reliably identified using the learned model....

  11. Effective complexity of stationary process realizations

    CERN Document Server

    Ay, Nihat; Szkola, Arleta

    2010-01-01

    The concept of effective complexity of an object as the minimal description length of its regularities has been initiated by Gell-Mann and Lloyd. Based on their work we gave a precise definition of effective complexity of finite binary strings in terms of algorithmic information theory in our previous paper. Here we study the effective complexity of strings generated by stationary processes. Sufficiently long typical process realizations turn out to be effectively simple under any linear scaling with the string's length of the parameter $\\Delta$ which determines the minimization domain. For a class of computable ergodic processes including i.i.d. and ergodic Markovian processes a stronger result can be shown: There exist sublinear scalings of $\\Delta$ for which typical realizations turn out to be effectively simple. Our results become most transparent in the context of coarse effective complexity --a modification of plain effective complexity, where $\\Delta$ appears as a minimization argument. A similar modif...

  12. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Plejdrup, Marlene Schmidt

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOx, NMVOC, CH4, CO, CO2, N2O, particulate matter, heavy metals, dioxins, HCB and PAH. The CO2 emission in 2007 was 10......% lower than in 1990. However fluctuations in the emission level are large as a result of electricity import/export. The emission of CH4 has increased due to increased use of lean-burn gas engines in combined heating and power (CHP) plants. However the emission has decreased in recent years due...... to structural changes in the Danish electricity market. The N2O emission was higher in 2007 than in 1990 but the fluctuations in the time-series are significant. A considerable decrease of the SO2, NOx and heavy metal emissions is mainly a result of decreased emissions from large power plants and waste...

  13. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Plejdrup, Marlene Schmidt

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOx, NMVOC, CH4, CO, CO2, N2O, NH3, particulate matter, heavy metals, PCDD/F, HCB and PAH. The CO2 emission in 2011...... of decreased emissions from large power plants and waste incineration plants. The combustion of wood in residential plants has increased considerably until 2007 resulting in increased emission of PAH and particulate matter. The emission of NMVOC has increased since 1990 as a result of both the increased...... was 30 % lower than in 1990. However, fluctuations in the emission level are large as a result of electricity import/export. The emission of CH4 has increased due to increased use of lean-burn gas engines in combined heating and power (CHP) plants. In recent years, the emission has declined. This is due...

  14. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Plejdrup, Marlene Schmidt

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOx, NMVOC, CH4, CO, CO2, N2O, NH3, particulate matter, heavy metals, dioxins, HCB and PAH. The CO2 emission in 2008...... incineration plants. The combustion of wood in residential plants has increased considerably in recent years resulting in increased emission of PAH, particulate matter and CO. The emission of NMVOC has increased since 1990 as a result of both the increased combustion of wood in residential plants...... was 16 % lower than in 1990. However, fluctuations in the emission level are large as a result of electricity import/export. The emission of CH4 has increased due to increased use of lean-burn gas engines in combined heating and power (CHP) plants. However, the emission has decreased in recent years due...

  15. Stationary Traffic In The Urban Planning System

    Directory of Open Access Journals (Sweden)

    Ivica Martinić

    2005-03-01

    Full Text Available Since ancient times human lives pulsed between two poles- moving and stationmy. Moving as element of functioning issupplemented by standing. Today, when modem life in cities isbased on using passenger cars as the dominant means of mobility,the explosion of their number is the generator of the growingproblems both of the moving and of the stationary traffic. Consideringparking as direct product of the moving traffic, usuallyits negative characteristics are mentioned such as greater volumeof parking, fines, legal-regulative and safety aspects, degradationof other swfaces by the parked vehicles, etc. Never oralmostnever does one speak about the origin of the problem, andthis would be the only way to find its solution.

  16. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Plejdrup, Marlene Schmidt

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOx, NMVOC, CH4, CO, CO2, N2O, particulate matter, heavy metals, dioxins, HCB and PAH. The CO2 emission in 2007 was 10...... incineration plants. The combustion of wood in residential plants has increased considerably in recent years resulting in increased emission of PAH, particulate matter and CO. The emission of NMVOC has increased since 1990 as a result of both the increased combustion of wood in residential plants...... and the increased emission from lean-burn gas engines. The dioxin emission decreased since 1990 due to flue gas cleaning on waste incineration plants. However in recent years the emission has increased as a result of the increased combustion of wood in residential plants....

  17. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Plejdrup, Marlene Schmidt

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOx, NMVOC, CH4, CO, CO2, N2O, NH3, particulate matter, heavy metals, PCDD/F, HCB and PAH. The CO2 emission in 2011...... of decreased emissions from large power plants and waste incineration plants. The combustion of wood in residential plants has increased considerably until 2007 resulting in increased emission of PAH and particulate matter. The emission of NMVOC has increased since 1990 as a result of both the increased...... combustion of wood in residential plants and the increased emission from lean-burn gas engines. The PCDD/F emission decreased since 1990 due to flue gas cleaning on waste incineration plants....

  18. Danish emission inventories for stationary combustion plants

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Plejdrup, Marlene Schmidt

    Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOx, NMVOC, CH4, CO, CO2, N2O, NH3, particulate matter, heavy metals, dioxins, HCB and PAH. The CO2 emission in 2008...... incineration plants. The combustion of wood in residential plants has increased considerably in recent years resulting in increased emission of PAH, particulate matter and CO. The emission of NMVOC has increased since 1990 as a result of both the increased combustion of wood in residential plants...... and the increased emission from lean-burn gas engines. The dioxin emission decreased since 1990 due to flue gas cleaning on waste incineration plants. However in recent years the emission has increased as a result of the increased combustion of wood in residential plants....

  19. Baroclinic stationary waves in aquaplanet models

    Science.gov (United States)

    Lucarini, V.; Zappa, G.

    2012-04-01

    An aquaplanet model is used to study the nature of the highly persistent low frequency waves that have been observed in models forced by zonally symmetric boundary conditions. Using the Hayashi spectral analysis of the extratropical waves, we find that a quasi-stationary (QS) wave five belongs to a wave packet obeying a well defined dispersion relation with eastward group velocity. The components of the dispersion relation with k>5 baroclinically convert eddy available potential energy into eddy kinetic energy, while those with kinverse energy cascade, which had been previously proposed as a main forcing for this type of waves, only acts as a positive feedback on its predominantly baroclinic energetics. The QS wave is reinforced by a phase lock to an analogous pattern in the tropical convection, which provides further amplification to the wave. We also find that the Pedlosky bounds on the phase speed of unstable waves provide guidance in explaining the latitudinal structure of the energy conversion, which is shown to be more enhanced where the zonal westerly surface wind is weaker. The wave energy is then trapped in the wave guide created by the upper tropospheric jet stream. In agreement with Green's theory, as the equator to pole SST difference is reduced the stationary marginally stable component shifts toward higher wavenumbers, while the wave five becomes neutral and westward propagating. Some properties of the aquaplanet QS waves are found in interesting agreement with a low frequency wave observed by Salby (1982) in the southern hemisphere DJF, so that this perspective on low frequency variability might be, apart from its value in terms of basic geophysical fluid dynamics, of specific interest for studying the Earth's atmosphere.

  20. Active Nonlinear Feedback Control for Aerospace Systems. Processor

    Science.gov (United States)

    1990-12-01

    Stabilizability of Uncertain Linear Systems: Existence of a Nonlinear Stabilizing Control Does Not Imply Existence of a Linear Stabilizing Control ," IEEE Trans...799-802, 1985. 13. I. R. Petersen, "Quadratic Stabilizability of Uncertain Linear Systems: Existence of a Nonlinear Stabilizing Control Does Not Imply...Existence of a Linear Stabilizing Control ," IEEE Trans. Autom. Contr., Vol. AC-30, pp. 291-293, 1985. 14. B. R. Barmish and A. R. Galimidi

  1. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed.......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  2. Oscillating nonlinear acoustic shock waves

    DEFF Research Database (Denmark)

    Gaididei, Yuri; Rasmussen, Anders Rønne; Christiansen, Peter Leth

    2016-01-01

    We investigate oscillating shock waves in a tube using a higher order weakly nonlinear acoustic model. The model includes thermoviscous effects and is non isentropic. The oscillating shock waves are generated at one end of the tube by a sinusoidal driver. Numerical simulations show...... that at resonance a stationary state arise consisting of multiple oscillating shock waves. Off resonance driving leads to a nearly linear oscillating ground state but superimposed by bursts of a fast oscillating shock wave. Based on a travelling wave ansatz for the fluid velocity potential with an added 2'nd order...... polynomial in the space and time variables, we find analytical approximations to the observed single shock waves in an infinitely long tube. Using perturbation theory for the driven acoustic system approximative analytical solutions for the off resonant case are determined....

  3. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  4. Preparation of new hybrid organic/inorganic polymeric chiral stationary phases for ligand-exchange chromatography

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Three new hybrid organic/inorganic polymeric ligand-exchange chiral stationary phases were developed by radical chain transfer reaction and surface grafting on silica gel, and successfully used for the enantioseparations of DL-amino acids and DL-hydroxyl acids. The resolutions were achieved by using water containing 2.0 × 10-4 mol/L of CuAc2 as a mobile phase, column temperature of 40 ℃, flow rate of 1.0 mL/min and detection at UV 254 mn. The elution order of D-isomer before L-isomer was observed for all DL-amino acids resolved except DL-Pro.

  5. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  6. Electrothermal ac electro-osmosis

    Science.gov (United States)

    Gagnon, Zachary R.; Chang, Hsueh-Chia

    2009-01-01

    Two ac polarization mechanisms, charge accumulation due to electrode double layer charging and bulk permittivity/conductivity gradients generated by Joule heating, are combined in the double layer by introducing zwitterions to produce a new ac electrokinetic pump with the largest velocity (>1 mm/s) and flow penetration depth (100 μm) reported for low-conductivity fluids. The large fluid velocity is due to a quartic scaling with respect to voltage, as is true of electrothermal flow, but exhibits a clear maximum at a frequency corresponding to the electrode double layer inverse RC time.

  7. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  8. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  9. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  10. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  11. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  12. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  13. AcEST: DK947455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 246 9e-64 tr|A8QIH7|A8QIH7_MORAL Chlor...DPTARSDNGSCEYEFKE 479 >tr|A8QIH7|A8QIH7_MORAL Chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase ac

  14. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  15. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  16. Scale parameters in stationary and non-stationary GEV modeling of extreme precipitation

    Science.gov (United States)

    Panagoulia, Dionysia; Economou, Polychronis; Caroni, Chrys

    2013-04-01

    The generalized extreme value (GEV) distribution is often fitted to environmental time series of extreme values such as annual maxima of daily precipitation. We study two methodological issues here. First we compare methods of selecting the best model among a set of 16 GEV models that allow non-stationary scale and location parameters. Results of simulation studies showed that both the Akaike information criterion (AIC) and the Bayesian information criterion (BIC) correctly detected non-stationarity but the BIC was superior in selecting the correct model more often. The second issue is how best to produce confidence intervals (CIs) for the parameters of the model and other quantities such as the return levels that are usually required for hydrological and climatological time series. Four bootstrap CIs - normal, percentile, basic, and bias corrected and accelerated (BCa) - constructed by random-t resampling, fixed-t resampling and the parametric bootstrap methods were compared. CIs for parameters of the stationary model do not present major differences. CIs for the more extreme quantiles tend to become very wide for all bootstrap methods. For non-stationary GEV models with linear time dependence of location or log-linear time dependence of scale, coverage probabilities of the CIs are reasonably accurate for the parameters. For the extreme percentiles, the BCa method is best overall and the fixed-t method also gives good average coverage probabilities.

  17. Rehabilitation of patients with rheumatoid arthritis treated in stationary spa treatment

    Directory of Open Access Journals (Sweden)

    Amila Jaganjac

    2015-04-01

    Full Text Available Introduction: Rheumatic diseases are nonsurgical diseases of the locomotor system and connective tissue. Rheumatoid arthritis (RA is a systemic inflammatory disease of connective tissue of unknown cause, with progressive chronic or subacute course. The aim of the research is to determine whether stationary spa treatment leads to improvement of the functional status in patients with rheumatoid arthritis. Methods: We included 35 patients with diagnosis of rheumatoid arthritis, referred for treatment at the spa " Ilidža " Gradačac from February to April 2014. Patients not adhering to treatment protocols were excluded. We used Visual analogue pain scale (VAS, HAQ questionnaire and assessment of the clinical condition before and after the treatment based on the scores 1-5.Results: There were 32 female and 3 male patients. The average age was 62.28±8.31 years. Based on the HAQ, 12 patients had no difficulties, 9 of them perform activities with little difficulties, 10 with many difficulties, and 4 patients cannot perform certain activities. Before treatment VAS was 6.63±2.36, and after treatment the 2.51±2.27. Ratings of clinical condition before treatment was 2.38±0.74, and after the treatment 3.64±0.98. The most frequently used therapies were kinesitherapy, magnetotherapy and interferential electricity. Conclusions: Stationary treatment at the spa „Ilidža“ Gradačac leads to an improvement of the functional status in patients with rheumatoid arthritis.

  18. Stationary MHD equilibria describing azimuthal rotations in symmetric plasmas

    Science.gov (United States)

    da Silva, Sidney T.; Viana, Ricardo L.

    2016-12-01

    We consider the stationary magnetohydrodynamical (MHD) equilibrium equation for an axisymmetric plasma undergoing azimuthal rotations. The case of cylindrical symmetry is treated, and we present two semi-analytical solutions for the stationary MHD equilibrium equations, from which a number of physical properties of the magnetically confined plasma are derived.

  19. Stationary solutions of equations of incompressible viscoelastic polymer liquid

    Science.gov (United States)

    Bambaeva, N. V.; Blokhin, A. M.

    2014-05-01

    The equations describing flows of an incompressible viscoelastic polymer liquid are studied. Stationary solutions similar to the Poiseuille and Couette solutions for the system of the Navier-Stokes equations are constructed. Stationary discontinuous solutions of the polymer liquid equation are also considered.

  20. 30 CFR 57.4561 - Stationary diesel equipment underground.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Stationary diesel equipment underground. 57... AND NONMETAL MINE SAFETY AND HEALTH SAFETY AND HEALTH STANDARDS-UNDERGROUND METAL AND NONMETAL MINES... underground. Stationary diesel equipment underground shall be— (a) Supported on a noncombustible base; and (b...

  1. Weighted least squares stationary approximations to linear systems.

    Science.gov (United States)

    Bierman, G. J.

    1972-01-01

    Investigation of the problem of replacing a certain time-varying linear system by a stationary one. Several quadratic criteria are proposed to aid in determining suitable candidate systems. One criterion for choosing the matrix B (in the stationary system) is initial-condition dependent, and another bounds the 'worst case' homogeneous system performance. Both of these criteria produce weighted least square fits.

  2. Study of plasmonic slot waveguides with a nonlinear metamaterial core: semi-analytical and numerical methods

    CERN Document Server

    Elsawy, Mahmoud M R

    2016-01-01

    Two distinct models are developed to investigate the transverse magnetic stationary solutions propagating in one-dimensional anisotropic nonlinear plasmonic structures made from a nonlinear metamaterial core of Kerr-type embedded between two semi-infinite metal claddings. The first model is semi-analytical, in which we assumed that the anisotropic nonlinearity depends only on the transverse component of the electric field and that the nonlinear refractive index modification is small compared to the linear one. This method allows us to derive analytically the field profiles and the nonlinear dispersion relations in terms of the Jacobi elliptical functions. The second model is fully numerical, it is based on the finite-element method in which all the components of the electric field are considered in the Kerr-type nonlinearity with no presumptions on the nonlinear refractive index change. Our finite-element based model is valid beyond weak nonlinearity regime and generalize the well-known single-component fixed...

  3. On tail behavior of nonlinear autoregressive functional conditional heteroscedastic model with heavy-tailed innovations

    Institute of Scientific and Technical Information of China (English)

    PAN; Jiazhu; WU; Guangxu

    2005-01-01

    We study the tail probability of the stationary distribution of nonparametric nonlinear autoregressive functional conditional heteroscedastic (NARFCH) model with heavytailed innovations. Our result shows that the tail of the stationary marginal distribution of an NARFCH series is heavily dependent on its conditional variance. When the innovations are heavy-tailed, the tail of the stationary marginal distribution of the series will become heavier or thinner than that of its innovations. We give some specific formulas to show how the increment or decrement of tail heaviness depends on the assumption on the conditional variance function. Some examples are given.

  4. Time reversibility from visibility graphs of non-stationary processes

    CERN Document Server

    Lacasa, Lucas

    2015-01-01

    Visibility algorithms are a family of methods to map time series into networks, with the aim of describing the structure of time series and their underlying dynamical properties in graph-theoretical terms. Here we explore some properties of both natural and horizontal visibility graphs associated to several non-stationary processes, and we pay particular attention to their capacity to assess time irreversibility. Non-stationary signals are (infinitely) irreversible by definition (independently of whether the process is Markovian or producing entropy at a positive rate), and thus the link between entropy production and time series irreversibility has only been explored in non-equilibrium stationary states. Here we show that the visibility formalism naturally induces a new working definition of time irreversibility, which allows to quantify several degrees of irreversibility for stationary and non-stationary series, yielding finite values that can be used to efficiently assess the presence of memory and off-equ...

  5. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  6. Phase-sensitive detection of both inductive and non-inductive ac voltages in ferromagnetic resonance

    Science.gov (United States)

    Weiler, Mathias; Shaw, Justin M.; Nembach, Hans T.; Schoen, Martin A.; Boone, Carl T.; Silva, Thomas J.

    2014-03-01

    Spin pumping causes significant damping in ultrathin ferromagnetic/normal metal (NM) multilayers via spin-current generation of both dc and ac character in the NM system. While the nonlinear dc component has been investigated in detail by utilization of the inverse spin Hall effect (iSHE) in NMs, much less is known about the linear ac component that is presumably much larger in the small-excitation limit. We measured generated ac voltages in a wide variety of Permalloy/NM multilayers via vector-network-analyzer ferromagnetic resonance. We employ a custom, impedance-matched, broadband microwave coupler that features a ferromagnetic thin film reference resonator to accurately compare ac voltage amplitudes and phases between varieties of multilayers. By use of the fact that inductive and ac iSHE signals are phase-shifted by π/2, we find that inductive signals are major contributors in all investigated samples. It is only by comparison of the phase and amplitude of the recorded ac voltages between multiple samples that we can extract the non-inductive contributions due to spin-currents. Voltages due to the ac iSHE in Permalloy(10nm)/platinum(5nm) bilayers are weaker than inductive signals, in agreement with calculations based upon recent theoretical predictions. M.W. acknowledges financial support by the German Academic Exchange service (DAAD).

  7. Coexistence of competitors mediated by nonlinear noise

    Science.gov (United States)

    Siekmann, Ivo; Bengfort, Michael; Malchow, Horst

    2017-06-01

    Stochastic reaction-diffusion equations are a popular modelling approach for studying interacting populations in a heterogeneous environment under the influence of environmental fluctuations. Although the theoretical basis of alternative models such as Fokker-Planck diffusion is not less convincing, movement of populations is most commonly modelled using the diffusion law due to Fick. An interesting feature of Fokker-Planck diffusion is the fact that for spatially varying diffusion coefficients the stationary solution is not a homogeneous distribution - in contrast to Fick's law of diffusion. Instead, concentration accumulates in regions of low diffusivity and tends to lower levels for areas of high diffusivity. Thus, we may interpret the stationary distribution of the Fokker-Planck diffusion as a reflection of different levels of habitat quality. Moreover, the most common model for environmental fluctuations, linear multiplicative noise, is based on the assumption that individuals respond independently to stochastic environmental fluctuations. For large population densities the assumption of independence is debatable and the model further implies that noise intensities can increase to arbitrarily high levels. Therefore, instead of the commonly used linear multiplicative noise model, we implement environmental variability by an alternative nonlinear noise term which never exceeds a certain maximum noise intensity. With Fokker-Planck diffusion and the nonlinear noise model replacing the classical approaches we investigate a simple invasive system based on the Lotka-Volterra competition model. We observe that the heterogeneous stationary distribution generated by Fokker-Planck diffusion generally facilitates the formation of segregated habitats of resident and invader. However, this segregation can be broken by nonlinear noise leading to coexistence of resident and invader across the whole spatial domain, an effect that would not be possible in the non

  8. Regime shifts under forcing of non-stationary attractors: Conceptual model and case studies in hydrologic systems

    Science.gov (United States)

    Park, Jeryang; Rao, P. Suresh C.

    2014-11-01

    We present here a conceptual model and analysis of complex systems using hypothetical cases of regime shifts resulting from temporal non-stationarity in attractor strengths, and then present selected published cases to illustrate such regime shifts in hydrologic systems (shallow aquatic ecosystems; water table shifts; soil salinization). Complex systems are dynamic and can exist in two or more stable states (or regimes). Temporal variations in state variables occur in response to fluctuations in external forcing, which are modulated by interactions among internal processes. Combined effects of external forcing and non-stationary strengths of alternative attractors can lead to shifts from original to alternate regimes. In systems with bi-stable states, when the strengths of two competing attractors are constant in time, or are non-stationary but change in a linear fashion, regime shifts are found to be temporally stationary and only controlled by the characteristics of the external forcing. However, when attractor strengths change in time non-linearly or vary stochastically, regime shifts in complex systems are characterized by non-stationary probability density functions (pdfs). We briefly discuss implications and challenges to prediction and management of hydrologic complex systems.

  9. Regime shifts under forcing of non-stationary attractors: Conceptual model and case studies in hydrologic systems.

    Science.gov (United States)

    Park, Jeryang; Rao, P Suresh C

    2014-11-15

    We present here a conceptual model and analysis of complex systems using hypothetical cases of regime shifts resulting from temporal non-stationarity in attractor strengths, and then present selected published cases to illustrate such regime shifts in hydrologic systems (shallow aquatic ecosystems; water table shifts; soil salinization). Complex systems are dynamic and can exist in two or more stable states (or regimes). Temporal variations in state variables occur in response to fluctuations in external forcing, which are modulated by interactions among internal processes. Combined effects of external forcing and non-stationary strengths of alternative attractors can lead to shifts from original to alternate regimes. In systems with bi-stable states, when the strengths of two competing attractors are constant in time, or are non-stationary but change in a linear fashion, regime shifts are found to be temporally stationary and only controlled by the characteristics of the external forcing. However, when attractor strengths change in time non-linearly or vary stochastically, regime shifts in complex systems are characterized by non-stationary probability density functions (pdfs). We briefly discuss implications and challenges to prediction and management of hydrologic complex systems.

  10. Nonlinear resonances

    CERN Document Server

    Rajasekar, Shanmuganathan

    2016-01-01

    This introductory text presents the basic aspects and most important features of various types of resonances and anti-resonances in dynamical systems. In particular, for each resonance, it covers the theoretical concepts, illustrates them with case studies, and reviews the available information on mechanisms, characterization, numerical simulations, experimental realizations, possible quantum analogues, applications and significant advances made over the years. Resonances are one of the most fundamental phenomena exhibited by nonlinear systems and refer to specific realizations of maximum response of a system due to the ability of that system to store and transfer energy received from an external forcing source. Resonances are of particular importance in physical, engineering and biological systems - they can prove to be advantageous in many applications, while leading to instability and even disasters in others. The book is self-contained, providing the details of mathematical derivations and techniques invo...

  11. Nonlinear Dynamics

    Institute of Scientific and Technical Information of China (English)

    1996-01-01

    3.1 A Unified Nonlinear Feedback Functional Method for Study Both Control and Synchronization of Spatiotemporal Chaos Fang Jinqing Ali M. K. (Department of Physics, The University of Lethbridge,Lethbridge, Alberta T1K 3M4,Canada) Two fundamental questions dominate future chaos control theories.The first is the problem of controlling hyperchaos in higher dimensional systems.The second question has yet to be addressed:the problem of controlling spatiotemporal chaos in a spatiotemporal system.In recent years, control and synchronization of spatiotemporal chaos and hyperchaos have became a much more important and challenging subject. The reason for this is the control and synchronism of such behaviours have extensive and great potential of interdisciplinary applications, such as security communication, information processing, medicine and so on. However, this subject is not much known and remains an outstanding open.

  12. RF Circuit linearity optimization using a general weak nonlinearity model

    NARCIS (Netherlands)

    Cheng, W.; Oude Alink, M.S.; Annema, Anne J.; Croon, Jeroen A.; Nauta, Bram

    2012-01-01

    This paper focuses on optimizing the linearity in known RF circuits, by exploring the circuit design space that is usually available in today’s deep submicron CMOS technologies. Instead of using brute force numerical optimizers we apply a generalized weak nonlinearity model that only involves AC

  13. Nonlinear dynamics of a parametrically driven sine-Gordon system

    DEFF Research Database (Denmark)

    Grønbech-Jensen, Niels; Kivshar, Yuri S.; Samuelsen, Mogens Rugholm

    1993-01-01

    We consider a sine-Gordon system, driven by an ac parametric force in the presence of loss. It is demonstrated that a breather can be maintained in a steady state at half of the external frequency. In the small-amplitude limit the effect is described by an effective nonlinear Schrodinger equation...

  14. Stationary flow conditions in pulsed supersonic beams.

    Science.gov (United States)

    Christen, Wolfgang

    2013-10-21

    We describe a generally applicable method for the experimental determination of stationary flow conditions in pulsed supersonic beams, utilizing time-resolved electron induced fluorescence measurements of high pressure jet expansions of helium. The detection of ultraviolet photons from electronically excited helium emitted very close to the nozzle exit images the valve opening behavior-with the decided advantage that a photon signal is not affected by beam-skimmer and beam-residual gas interactions; it thus allows to conclusively determine those operation parameters of a pulsed valve that yield complete opening. The studies reveal that a "flat-top" signal, indicating constant density and commonly considered as experimental criterion for continuous flow, is insufficient. Moreover, translational temperature and mean terminal flow velocity turn out to be significantly more sensitive in testing for the equivalent behavior of a continuous nozzle source. Based on the widely distributed Even-Lavie valve we demonstrate that, in principle, it is possible to achieve quasi-continuous flow conditions even with fast-acting valves; however, the two prerequisites are a minimum pulse duration that is much longer than standard practice and previous estimates, and a suitable tagging of the appropriate beam segment.

  15. Growth of microalgae in autotrophic stationary systems

    Directory of Open Access Journals (Sweden)

    Paulo Cunha

    2008-06-01

    Full Text Available In this paper we evaluate the growth of nine marine microalgae species (Nannochloropsis oculata, Thalassiosira pseudonana, Phaeodactylum tricornutum, Isochrysis galbana, Tetraselmis suecica, Tetraselmis chuii, Chaetoceros muelleri, Thalassiosira fluviatilis and Isochrysis sp. and one freshwater species (Chlorella vulgaris under stationary autotrophy conditions, using erlenmeyers fl asks with 800mL of culture medium exposed to constant light intensities providing a photon flux density of about 150μmol.m-2.s-1 and 25±2oC temperature and constant air flow. The experiment was carried out in a controlled environment considering a block delineating randomized over time with three replicates. The Nannochloropsis oculata showed the highest value of maximum cellular density, but with a longer period of time and a lower growth rate. This was probably due to its tiny cell size, demanding a large number of cells per volume to attain its optimum conditions for light, nutrients, water and atmospheric carbon dioxide. In addition, in spite of showing one of the lowest values of maximum cellular density, Thalassiosira fluviatilis was the species that reached its maximum in a short period of time at the highest growth rate. Chlorella vulgaris was the only freshwater species tested and it showed the poorest performance for all the variables analyzed in the current study.

  16. Baroclinic stationary waves in aquaplanet models

    CERN Document Server

    Zappa, Giuseppe; Navarra, Antonio; 10.1175/2011JAS3573.1

    2011-01-01

    An aquaplanet model is used to study the nature of the highly persistent low frequency waves that have been observed in models forced by zonally symmetric boundary conditions. Using the Hayashi spectral analysis of the extratropical waves, we find that a quasi-stationary (QS) wave five belongs to a wave packet obeying a well defined dispersion relation with eastward group velocity. The components of the dispersion relation with k>5 baroclinically convert eddy available potential energy into eddy kinetic energy, while those with k<5 are baroclinically neutral. In agreement with the Green's model of baroclinic instability, the wave five is weakly unstable, and the inverse energy cascade, which had been previously proposed as a main forcing for this type of waves, only acts as a positive feedback on its predominantly baroclinic energetics. The QS wave is reinforced by a phase lock to an analogous pattern in the tropical convection, which provides further amplification to the wave. We also find that the Pedlos...

  17. Stationary intraoral tomosynthesis for dental imaging

    Science.gov (United States)

    Inscoe, Christina R.; Wu, Gongting; Soulioti, Danai E.; Platin, Enrique; Mol, Andre; Gaalaas, Laurence R.; Anderson, Michael R.; Tucker, Andrew W.; Boyce, Sarah; Shan, Jing; Gonzales, Brian; Lu, Jianping; Zhou, Otto

    2017-03-01

    Despite recent advances in dental radiography, the diagnostic accuracies for some of the most common dental diseases have not improved significantly, and in some cases remain low. Intraoral x-ray is the most commonly used x-ray diagnostic tool in dental clinics. It however suffers from the typical limitations of a 2D imaging modality including structure overlap. Cone-beam computed tomography (CBCT) uses high radiation dose and suffers from image artifacts and relatively low resolution. The purpose of this study is to investigate the feasibility of developing a stationary intraoral tomosynthesis (s-IOT) using spatially distributed carbon nanotube (CNT) x-ray array technology, and to evaluate its diagnostic accuracy compared to conventional 2D intraoral x-ray. A bench-top s-IOT device was constructed using a linear CNT based X-ray source array and a digital intraoral detector. Image reconstruction was performed using an iterative reconstruction algorithm. Studies were performed to optimize the imaging configuration. For evaluation of s-IOT's diagnostic accuracy, images of a dental quality assurance phantom, and extracted human tooth specimens were acquired. Results show s-IOT increases the diagnostic sensitivity for caries compared to intraoral x-ray at a comparable dose level.

  18. Model of non-stationary, inhomogeneous turbulence

    Science.gov (United States)

    Bragg, Andrew D.; Kurien, Susan; Clark, Timothy T.

    2017-02-01

    We compare results from a spectral model for non-stationary, inhomogeneous turbulence (Besnard et al. in Theor Comp Fluid Dyn 8:1-35, 1996) with direct numerical simulation (DNS) data of a shear-free mixing layer (SFML) (Tordella et al. in Phys Rev E 77:016309, 2008). The SFML is used as a test case in which the efficacy of the model closure for the physical-space transport of the fluid velocity field can be tested in a flow with inhomogeneity, without the additional complexity of mean-flow coupling. The model is able to capture certain features of the SFML quite well for intermediate to long times, including the evolution of the mixing-layer width and turbulent kinetic energy. At short-times, and for more sensitive statistics such as the generation of the velocity field anisotropy, the model is less accurate. We propose two possible causes for the discrepancies. The first is the local approximation to the pressure-transport and the second is the a priori spherical averaging used to reduce the dimensionality of the solution space of the model, from wavevector to wavenumber space. DNS data are then used to gauge the relative importance of both possible deficiencies in the model.

  19. Stationary radiation cataracts: an animal model

    Energy Technology Data Exchange (ETDEWEB)

    Holsclaw, D.S.; Merriam, G.R. Jr; Medvedovsky, C.; Worgul, B.V. (Columbia Univ., New York, NY (USA)); Rothstein, H. (Fordham Univ., New York, NY (USA))

    1989-03-01

    This report describes the induction of stationary radiation cataracts in postmetamorphic bullfrogs following ocular irradiation with a 10 Gy dose of X-rays. The eyes of non-irradiated animals and animals irradiated with 25 Gy served as controls. The 25 Gy irradiated lenses rapidly progressed to complete opacification (4+) by 26 weeks, while lenses exposed to 10 Gy advanced to the 2.5+ stage by 35 weeks and progressed no further. In the lower dose lenses, transparent cortex began to appear anteriorly and posteriorly between the capsule and opaque fibers at 45 weeks. As the clear fibers accumulated, the disrupted region came to occupy increasingly deeper cortex. Histologically, opacities in both groups were preceded by disorganization of the bow cytoarchitecture, meridional row disorganization, and the appearance in the lens epithelium of nuclear polymorphism, fragmented nuclei, micronuclei, clusters of nuclei, and abnormal mitotic figures. In the lenses exposed to the 25 Gy dose, this damage continued to worsen, so that the 4+ stage was characterized by extensive epithelial cell death, absence of the lens bow, degenerated fiber masses, and liquefied substrata. In contrast, prior to the appearance of transparent cortex in the 10 Gy group, the lens epithelial aberrations, arc of the bow, and meridional row disorganization were all observed to improve. Further, by 69 weeks, the lens epithelium appeared as a largely homogeneous population, and the meridional rows and the arc of the bow had become reestablished. (author).

  20. An experimental stationary quadrotor with variable DOF

    Indian Academy of Sciences (India)

    Vasfi Emre Ömürlü; Utku Büyükşahin; Remzi Artar; Ahmet Kirli; M Nurullah Turgut

    2013-04-01

    Unmanned air vehicles (UAV) and especially quadrotors have drawn great attention in recent years because of their maneuverability, ease of design and control. Most of the works concentrate mostly on control; yet, design and communication are also some sub-topics. In this research, a stationary, four rotor air vehicle with limited/controlled degree of freedom is constructed so that various control algorithms and their changing effects with varying vehicle dynamics can be studied on the ground for safety purposes. Ascending/descending, pitch/yaw/roll motions can be limited/controlled by setting the vehicle’s degree of freedom mechanically, resulting better net observability of the control algorithms on the vehicle’s dynamic performance. Design, in terms of mechanics, mechatronics and software is presented and the usability of the system is shown. Parallel self tuning fuzzy PD + PD control is applied to the system for preliminary studies and results are discussed. Inspite of the sensor noise, satisfactory pitch/roll/yaw control is achieved.

  1. Control of NOx during stationary combustion

    Energy Technology Data Exchange (ETDEWEB)

    James T. Yeh; Wei-Yin Chen

    2004-11-01

    Nitrogen oxides (NOx) and sulfur oxides (SOx) emissions are primary contributors to acid rain, which is associated with a number of effects including acidification of lakes and streams, accelerated corrosion of buildings, and visibility impairment. Among the various nitrogen oxides emitted from stationary combustion; nitrogen oxide (NO), nitrous oxide (N{sub 2}O), and nitrogen dioxide (NO{sub 2}) are stable, and NO predominates (over 90%). In health effects, NO{sub 2} can irritate the lungs and lower resistance to respiratory infection. In the area of ozone nonattainment, NOx and volatile organic compounds (VOCs) react in the atmosphere to form ozone, a photochemical oxidant and a major component of smog. Atmospheric ozone can cause respiratory problems by damaging lung tissue and reducing lung function. It is generally believed that over 80% of the total NOx emitted to the atmosphere originate at sources where fossil fuels and industrial wastes are burned. About one-half of the emissions are produced during combustion of fossil fuels in the utility industries. The rate of NOx formation is affected by fuel nitrogen content and by combustor design parameters. Higher firing temperature and combustor pressure increase NOx emissions. Nitric acid plants also produce large amounts of NOx as waste gas, but in much higher concentration than emissions from utility boiler flue gas.

  2. Stationary power fuel cell commercialization status worldwide

    Energy Technology Data Exchange (ETDEWEB)

    Williams, M.C. [Dept. of Energy, Morgantown, WV (United States)

    1996-12-31

    Fuel cell technologies for stationary power are set to play a role in power generation applications worldwide. The worldwide fuel cell vision is to provide powerplants for the emerging distributed generation and on-site markets. Progress towards commercialization has occurred in all fuel cell development areas. Around 100 ONSI phosphoric acid fuel cell (PAFC) units have been sold, with significant foreign sales in Europe and Japan. Fuji has apparently overcome its PAFC decay problems. Industry-driven molten carbonate fuel cell (MCFC) programs in Japan and the U.S. are conducting megawatt (MW)-class demonstrations, which are bringing the MCFC to the verge of commercialization. Westinghouse Electric, the acknowledged world leader in tubular solid oxide fuel cell (SOFC) technology, continues to set performance records and has completed construction of a 4-MW/year manufacturing facility in the U.S. Fuel cells have also taken a major step forward with the conceptual development of ultra-high efficiency fuel cell/gas turbine plants. Many SOFC developers in Japan, Europe, and North America continue to make significant advances.

  3. Nonlinear nonequilibrium quasiparticle relaxation in Josephson junctions.

    Science.gov (United States)

    Krasnov, V M

    2009-11-27

    I solve numerically a full set of nonlinear kinetic balance equations for stacked Josephson junctions, which allows analysis of strongly nonequilibrium phenomena. It is shown that nonlinearity becomes significant already at very small disequilibrium. The following new, nonlinear effects are obtained: (i) At even-gap voltages V = 2nDelta/e (n = 2, 3, ...) nonequilibrium bosonic bands overlap. This leads to enhanced emission of Omega = 2Delta bosons and to the appearance of dips in tunnel conductance. (ii) A new type of radiative solution is found at strong disequilibrium. It is characterized by the fast stimulated relaxation of quasiparticles. A stack in this state behaves as a light emitting diode and directly converts electric power to boson emission, without utilization of the ac-Josephson effect. The phenomenon can be used for realization of a new type of superconducting cascade laser in the THz frequency range.

  4. The transformed-stationary approach: a generic and simplified methodology for non-stationary extreme value analysis

    Science.gov (United States)

    Mentaschi, Lorenzo; Vousdoukas, Michalis; Voukouvalas, Evangelos; Sartini, Ludovica; Feyen, Luc; Besio, Giovanni; Alfieri, Lorenzo

    2016-09-01

    Statistical approaches to study extreme events require, by definition, long time series of data. In many scientific disciplines, these series are often subject to variations at different temporal scales that affect the frequency and intensity of their extremes. Therefore, the assumption of stationarity is violated and alternative methods to conventional stationary extreme value analysis (EVA) must be adopted. Using the example of environmental variables subject to climate change, in this study we introduce the transformed-stationary (TS) methodology for non-stationary EVA. This approach consists of (i) transforming a non-stationary time series into a stationary one, to which the stationary EVA theory can be applied, and (ii) reverse transforming the result into a non-stationary extreme value distribution. As a transformation, we propose and discuss a simple time-varying normalization of the signal and show that it enables a comprehensive formulation of non-stationary generalized extreme value (GEV) and generalized Pareto distribution (GPD) models with a constant shape parameter. A validation of the methodology is carried out on time series of significant wave height, residual water level, and river discharge, which show varying degrees of long-term and seasonal variability. The results from the proposed approach are comparable with the results from (a) a stationary EVA on quasi-stationary slices of non-stationary series and (b) the established method for non-stationary EVA. However, the proposed technique comes with advantages in both cases. For example, in contrast to (a), the proposed technique uses the whole time horizon of the series for the estimation of the extremes, allowing for a more accurate estimation of large return levels. Furthermore, with respect to (b), it decouples the detection of non-stationary patterns from the fitting of the extreme value distribution. As a result, the steps of the analysis are simplified and intermediate diagnostics are

  5. Waveform control method for mitigating harmonics of inverter systems with nonlinear load

    DEFF Research Database (Denmark)

    Wang, Haoran; Zhu, Guorong; Fu, Xiaobin;

    2015-01-01

    DC power systems connecting to single-phase DC/AC inverters with nonlinear loads will have their DC sources being injected with AC ripple currents containing a low-frequency component at twice the output voltage frequency of the inverter and also other current harmonics. Such a current may create...... instability in the DC power system, lower its efficiency, and shorten the lifetime of the DC source. This paper presents a general waveform control method that can mitigate the injection of the low-frequency ripple current by the single-phase DC/AC inverter into the DC source. It also discusses the inhibiting...... ability of the waveform control method on other coexisting harmonics, while the DC source delivers AC power to a nonlinear load. With the application of the waveform control, the average DC output power is supplied by the DC source, while the other harmonics pulsation power can be confined to the AC side...

  6. Nonlinear projective filtering in a data stream

    CERN Document Server

    Schreiber, T; Schreiber, Thomas; Richter, Marcus

    1998-01-01

    We introduce a modified algorithm to perform nonlinear filtering of a time series by locally linear phase space projections. Unlike previous implementations, the algorithm can be used not only for a posteriori processing but includes the possibility to perform real time filtering in a data stream. The data base that represents the phase space structure generated by the data is updated dynamically. This also allows filtering of non-stationary signals and dynamic parameter adjustment. We discuss exemplary applications, including the real time extraction of the fetal electrocardiogram from abdominal recordings.

  7. Nonlinear susceptibility magnitude imaging of magnetic nanoparticles

    Science.gov (United States)

    Ficko, Bradley W.; Giacometti, Paolo; Diamond, Solomon G.

    2015-03-01

    This study demonstrates a method for improving the resolution of susceptibility magnitude imaging (SMI) using spatial information that arises from the nonlinear magnetization characteristics of magnetic nanoparticles (mNPs). In this proof-of-concept study of nonlinear SMI, a pair of drive coils and several permanent magnets generate applied magnetic fields and a coil is used as a magnetic field sensor. Sinusoidal alternating current (AC) in the drive coils results in linear mNP magnetization responses at primary frequencies, and nonlinear responses at harmonic frequencies and intermodulation frequencies. The spatial information content of the nonlinear responses is evaluated by reconstructing tomographic images with sequentially increasing voxel counts using the combined linear and nonlinear data. Using the linear data alone it is not possible to accurately reconstruct more than 2 voxels with a pair of drive coils and a single sensor. However, nonlinear SMI is found to accurately reconstruct 12 voxels (R2=0.99, CNR=84.9) using the same physical configuration. Several time-multiplexing methods are then explored to determine if additional spatial information can be obtained by varying the amplitude, phase and frequency of the applied magnetic fields from the two drive coils. Asynchronous phase modulation, amplitude modulation, intermodulation phase modulation, and frequency modulation all resulted in accurate reconstruction of 6 voxels (R2>0.9) indicating that time multiplexing is a valid approach to further increase the resolution of nonlinear SMI. The spatial information content of nonlinear mNP responses and the potential for resolution enhancement with time multiplexing demonstrate the concept and advantages of nonlinear SMI.

  8. Nonlinear fitness landscape of a molecular pathway.

    Directory of Open Access Journals (Sweden)

    Lilia Perfeito

    2011-07-01

    Full Text Available Genes are regulated because their expression involves a fitness cost to the organism. The production of proteins by transcription and translation is a well-known cost factor, but the enzymatic activity of the proteins produced can also reduce fitness, depending on the internal state and the environment of the cell. Here, we map the fitness costs of a key metabolic network, the lactose utilization pathway in Escherichia coli. We measure the growth of several regulatory lac operon mutants in different environments inducing expression of the lac genes. We find a strikingly nonlinear fitness landscape, which depends on the production rate and on the activity rate of the lac proteins. A simple fitness model of the lac pathway, based on elementary biophysical processes, predicts the growth rate of all observed strains. The nonlinearity of fitness is explained by a feedback loop: production and activity of the lac proteins reduce growth, but growth also affects the density of these molecules. This nonlinearity has important consequences for molecular function and evolution. It generates a cliff in the fitness landscape, beyond which populations cannot maintain growth. In viable populations, there is an expression barrier of the lac genes, which cannot be exceeded in any stationary growth process. Furthermore, the nonlinearity determines how the fitness of operon mutants depends on the inducer environment. We argue that fitness nonlinearities, expression barriers, and gene-environment interactions are generic features of fitness landscapes for metabolic pathways, and we discuss their implications for the evolution of regulation.

  9. Quantum stability of nonlinear wave type solutions with intrinsic mass parameter in QCD

    Science.gov (United States)

    Kim, Youngman; Lee, Bum-Hoon; Pak, D. G.; Park, Chanyong; Tsukioka, Takuya

    2017-09-01

    The problem of the existence of a stable vacuum field in pure QCD is revised. Our approach is based on using classical stationary nonlinear wave type solutions with an intrinsic mass scale parameter. Such solutions can be treated as quantum-mechanical wave functions describing massive spinless states in quantum theory. We verify whether nonlinear wave type solutions can form a stable vacuum field background within the framework of the effective action formalism. We demonstrate that there is a special class of stationary generalized Wu-Yang monopole solutions that are stable against quantum gluon fluctuations.

  10. Localized excitations in discrete nonlinear Schrodinger systems: Effects of nonlocal dispersive interactions and noise

    DEFF Research Database (Denmark)

    Rasmussen, Kim; Christiansen, Peter Leth; Johansson, Magnus

    1998-01-01

    A one-dimensional discrete nonlinear Schrodinger (DNLS) model with the power dependence, r(-s) on the distance r, of dispersive interactions is proposed. The stationary states of the system are studied both analytically and numerically. Two kinds of trial functions, exp-like and sech-like are exp......A one-dimensional discrete nonlinear Schrodinger (DNLS) model with the power dependence, r(-s) on the distance r, of dispersive interactions is proposed. The stationary states of the system are studied both analytically and numerically. Two kinds of trial functions, exp-like and sech...

  11. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  12. Nonlinear Materials Characterization Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Nonlinear Materials Characterization Facility conducts photophysical research and development of nonlinear materials operating in the visible spectrum to protect...

  13. Shift ergodicity for stationary Markov processes

    Institute of Scientific and Technical Information of China (English)

    CHEN; Jinwen(

    2001-01-01

    [1]Liggett, T. M., Interacting Particle Systems, New York: Springer-Verlag, 1985.[2]Andjel, E. D., Ergodic and mixing properties of equilibrium measures for Markov processes, Trans. of the AMS, 1990, 318:601-614.[3]Franchi, J., Asymptotic windings of ergodic diffusion, Stoch. Processes Appl., 1996, 62: 277-298.[4]Golden, K. , Goldstein, S., Lebowitz, J. L., Nash estimates and the asymptotic behavior of diffusion, Ann. Prob., 1988,16: 1127-1146.[5]Gordin. M. I., Lifsic, B. A. , The central limit theorem for stationary ergodic Markov process, Dokl, Akad. Nauk SSSR,1978, 19: 392-393.[6]Orey, S., Large deviations in ergodic theory, Seminar on Stochastic Processes, 1985, 12: 195-249.[7]Veretenikov, A. Y., On large deviations for ergodic process empirical measures, Adv. Sov. Math., 1992, 12: 125-133.[8]Deuschel, J. D., Stroock, D. W., Large Deviations, San Diego, CA: Academic Press, 1989.[9]Rosenblatt, M., Markov Processes, Structure and Asymptotic Behavior, Berlin: Springer-Verlag, 1971.[10]Liggett, T. M., Stochastic Interacting Systems: Contact, Voter, and Exclusion Processes, Berlin: Springer-Verlag, 1999.[11]Albevrio, S., Kondratiev, Y. G., Rockner, M., Ergodicity of L2-semigroups and extremality of Gibbs states, J. Funct.Anal. , 1997, 144: 293-423.[12]Liverani, C. , Olla, S. , Ergodicity in infinite Hamiltonian systems with conservative noise, Probab. Th. Rel. Fields, 1996,106: 401-445.[13]Varadhan, S. P. S., Large Deviations and Applications, Philadelphia: SIAM, 1984.[14]Chen, J. W. , A variational principle for Markov processes, J. Stat. Phys. , 1999, 96: 1359-1364.

  14. Non-Stationary Dynamics Data Analysis with Wavelet-Svd Filtering

    Science.gov (United States)

    Brenner, M. J.

    2003-07-01

    Non-stationary time-frequency analysis is used for identification and classification of aeroelastic and aeroservoelastic dynamics. Time-frequency multiscale wavelet processing generates discrete energy density distributions. The distributions are processed using the singular-value decomposition (SVD). Discrete density functions derived from the SVD generate moments that detect the principal features in the data. The SVD standard basis vectors are applied and then compared with a transformed-SVD, or TSVD, which reduces the number of features into more compact energy density concentrations. Finally, from the feature extraction, wavelet-based modal parameter estimation is applied. The primary objective is the automation of time-frequency analysis with modal system identification. The contribution is a more general approach in which distinct analysis tools are merged into a unified procedure for linear and non-linear data analysis. This method is first applied to aeroelastic pitch-plunge wing section models. Instability is detected in the linear system, and non-linear dynamics are observed from the time-frequency map and parameter estimates of the non-linear system. Aeroelastic and aeroservoelastic flight data from the drone for aerodynamic and structural testing and F18 aircraft are also investigated and comparisons made between the SVD and TSVD results. Input-output data are used to show that this process is an efficient and reliable tool for automated on-line analysis. Published by Elsevier Science Ltd.

  15. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  16. Nonlinear dynamics of a double bilipid membrane.

    Science.gov (United States)

    Sample, C; Golovin, A A

    2007-09-01

    The nonlinear dynamics of a biological double membrane that consists of two coupled lipid bilayers, typical of some intracellular organelles such as mitochondria or nuclei, is studied. A phenomenological free-energy functional is formulated in which the curvatures of the two parts of the double membrane and the distance between them are coupled to the lipid chemical composition. The derived nonlinear evolution equations for the double-membrane dynamics are studied analytically and numerically. A linear stability analysis is performed, and the domains of parameters are found in which the double membrane is stable. For the parameter values corresponding to an unstable membrane, numerical simulations are performed that reveal various types of complex dynamics, including the formation of stationary, spatially periodic patterns.

  17. Pattern selection as a nonlinear eigenvalue problem

    CERN Document Server

    Büchel, P

    1996-01-01

    A unique pattern selection in the absolutely unstable regime of driven, nonlinear, open-flow systems is reviewed. It has recently been found in numerical simulations of propagating vortex structures occuring in Taylor-Couette and Rayleigh-Benard systems subject to an externally imposed through-flow. Unlike the stationary patterns in systems without through-flow the spatiotemporal structures of propagating vortices are independent of parameter history, initial conditions, and system length. They do, however, depend on the boundary conditions in addition to the driving rate and the through-flow rate. Our analysis of the Ginzburg-Landau amplitude equation elucidates how the pattern selection can be described by a nonlinear eigenvalue problem with the frequency being the eigenvalue. Approaching the border between absolute and convective instability the eigenvalue problem becomes effectively linear and the selection mechanism approaches that of linear front propagation. PACS: 47.54.+r,47.20.Ky,47.32.-y,47.20.Ft

  18. Stationary and Dynamical Solutions of the Gross-Pitaevskii Equation for a Bose-Einstein Condensate in a PT symmetric Double Well

    Directory of Open Access Journals (Sweden)

    Holger Cartarius

    2013-01-01

    Full Text Available We investigate the Gross-Pitaevskii equation for a Bose-Einstein condensate in a PT symmetric double-well potential by means of the time-dependent variational principle and numerically exact solutions. A one-dimensional and a fully three-dimensional setup are used. Stationary states are determined and the propagation of wave function is investigated using the time-dependent Gross-Pitaevskii equation. Due to the nonlinearity of the Gross-Pitaevskii equation the potential dependson the wave function and its solutions decide whether or not the Hamiltonian itself is PT symmetric. Stationary solutions with real energy eigenvalues fulfilling exact PT symmetry are found as well as PT broken eigenstates with complex energies. The latter describe decaying or growing probability amplitudes and are not true stationary solutions of the time-dependent Gross-Pitaevskii equation. However, they still provide qualitative information about the time evolution of the wave functions.

  19. Nonlinear singular vectors and nonlinear singular values

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A novel concept of nonlinear singular vector and nonlinear singular value is introduced, which is a natural generalization of the classical linear singular vector and linear singular value to the nonlinear category. The optimization problem related to the determination of nonlinear singular vectors and singular values is formulated. The general idea of this approach is demonstrated by a simple two-dimensional quasigeostrophic model in the atmospheric and oceanic sciences. The advantage and its applications of the new method to the predictability, ensemble forecast and finite-time nonlinear instability are discussed. This paper makes a necessary preparation for further theoretical and numerical investigations.

  20. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  1. Likelihood-Based Inference in Nonlinear Error-Correction Models

    DEFF Research Database (Denmark)

    Kristensen, Dennis; Rahbæk, Anders

    We consider a class of vector nonlinear error correction models where the transfer function (or loadings) of the stationary relation- ships is nonlinear. This includes in particular the smooth transition models. A general representation theorem is given which establishes the dynamic properties...... of the process in terms of stochastic and deter- ministic trends as well as stationary components. In particular, the behaviour of the cointegrating relations is described in terms of geo- metric ergodicity. Despite the fact that no deterministic terms are included, the process will have both stochastic trends...... and a linear trend in general. Gaussian likelihood-based estimators are considered for the long- run cointegration parameters, and the short-run parameters. Asymp- totic theory is provided for these and it is discussed to what extend asymptotic normality and mixed normaity can be found. A simulation study...

  2. Bootstrap approaches and confidence intervals for stationary and non-stationary long-range dependence processes

    Science.gov (United States)

    Franco, Glaura C.; Reisen, Valderio A.

    2007-03-01

    This paper deals with different bootstrap approaches and bootstrap confidence intervals in the fractionally autoregressive moving average (ARFIMA(p,d,q)) process [J. Hosking, Fractional differencing, Biometrika 68(1) (1981) 165-175] using parametric and semi-parametric estimation techniques for the memory parameter d. The bootstrap procedures considered are: the classical bootstrap in the residuals of the fitted model [B. Efron, R. Tibshirani, An Introduction to the Bootstrap, Chapman and Hall, New York, 1993], the bootstrap in the spectral density function [E. Paparoditis, D.N Politis, The local bootstrap for periodogram statistics. J. Time Ser. Anal. 20(2) (1999) 193-222], the bootstrap in the residuals resulting from the regression equation of the semi-parametric estimators [G.C Franco, V.A Reisen, Bootstrap techniques in semiparametric estimation methods for ARFIMA models: a comparison study, Comput. Statist. 19 (2004) 243-259] and the Sieve bootstrap [P. Bühlmann, Sieve bootstrap for time series, Bernoulli 3 (1997) 123-148]. The performance of these procedures and confidence intervals for d in the stationary and non-stationary ranges are empirically obtained through Monte Carlo experiments. The bootstrap confidence intervals here proposed are alternative procedures with some accuracy to obtain confidence intervals for d.

  3. Thermal Radiation of a General Non-stationary Black Hole

    Institute of Scientific and Technical Information of China (English)

    杨成全; 任秦安; 赵峥

    1994-01-01

    The thermal radiation of the most general non-stationary black holes is discussed in this paper.The universal representatives determining the location of an event horizon and the temperature function are given.

  4. Stationary solutions for conservation laws with singular nonlocal sources

    Science.gov (United States)

    Coclite, Giuseppe Maria; Coclite, Mario Michele

    The existence of an a.e. positive stationary solution with bounded variation in [0,1] for an integro-differential conservation law with source depending on a function singular in the origin is proved.

  5. On the Causality between Multiple Locally Stationary Processes

    Directory of Open Access Journals (Sweden)

    Junichi Hirukawa

    2012-01-01

    Full Text Available When one would like to describe the relations between multivariate time series, the concepts of dependence and causality are of importance. These concepts also appear to be useful when one is describing the properties of an engineering or econometric model. Although the measures of dependence and causality under stationary assumption are well established, empirical studies show that these measures are not constant in time. Recently one of the most important classes of nonstationary processes has been formulated in a rigorous asymptotic framework by Dahlhaus in (1996, (1997, and (2000, called locally stationary processes. Locally stationary processes have time-varying spectral densities whose spectral structures smoothly change in time. Here, we generalize measures of linear dependence and causality to multiple locally stationary processes. We give the measures of linear dependence, linear causality from one series to the other, and instantaneous linear feedback, at time t and frequency λ.

  6. 7 CFR 2902.28 - Stationary equipment hydraulic fluids.

    Science.gov (United States)

    2010-01-01

    ... formulated for use in stationary hydraulic equipment systems that have various mechanical parts, such as cylinders, pumps, valves, pistons, and gears, that are used for the transmission of power (and also...

  7. Complex dynamics and morphogenesis an introduction to nonlinear science

    CERN Document Server

    Misbah, Chaouqi

    2017-01-01

    This book offers an introduction to the physics of nonlinear phenomena through two complementary approaches: bifurcation theory and catastrophe theory. Readers will be gradually introduced to the language and formalisms of nonlinear sciences, which constitute the framework to describe complex systems. The difficulty with complex systems is that their evolution cannot be fully predicted because of the interdependence and interactions between their different components. Starting with simple examples and working toward an increasing level of universalization, the work explores diverse scenarios of bifurcations and elementary catastrophes which characterize the qualitative behavior of nonlinear systems. The study of temporal evolution is undertaken using the equations that characterize stationary or oscillatory solutions, while spatial analysis introduces the fascinating problem of morphogenesis. Accessible to undergraduate university students in any discipline concerned with nonlinear phenomena (physics, mathema...

  8. Solutions to a nonlinear drift-diffusion model for semiconductors

    Directory of Open Access Journals (Sweden)

    Weifu Fang

    1999-05-01

    Full Text Available A nonlinear drift-diffusion model for semiconductors is analyzed to show the existence of non-vacuum global solutions and stationary solutions. The long time behavior of the solutions is studied by establishing the existence of an absorbing set and a compact attractor of the dynamical system. Parallel results on vacuum solutions are also obtained under weaker conditions on model parameters.

  9. Chaoticons described by nonlocal nonlinear Schrödinger equation

    Science.gov (United States)

    Zhong, Lanhua; Li, Yuqi; Chen, Yong; Hong, Weiyi; Hu, Wei; Guo, Qi

    2017-01-01

    It is shown that the unstable evolutions of the Hermite-Gauss-type stationary solutions for the nonlocal nonlinear Schrödinger equation with the exponential-decay response function can evolve into chaotic states. This new kind of entities are referred to as chaoticons because they exhibit not only chaotic properties (with positive Lyapunov exponents and spatial decoherence) but also soliton-like properties (with invariant statistic width and interaction of quasi-elastic collisions). PMID:28134268

  10. Nonlinear Alfvén Waves in a Vlasov Plasma

    DEFF Research Database (Denmark)

    Bell, T.F.

    1965-01-01

    Stationary solutions to the nonlinear Vlasov—Boltzmann equations are considered which represent one-dimensional electromagnetic waves in a hot magnetoplasma. These solutions appear in arbitrary reference frames as circularly polarized, sinusoidal waves of unlimited amplitude, i.e., as nonlinear...... Alfvén waves. Solutions are found implicitly by deriving a set of integral dispersion relations which link the wave characteristics with the particle distribution functions. A physical discussion is given of the way in which the Alfvén waves can trap particles, and it is shown that the presence...

  11. Likelihood-Based Inference in Nonlinear Error-Correction Models

    DEFF Research Database (Denmark)

    Kristensen, Dennis; Rahbæk, Anders

    We consider a class of vector nonlinear error correction models where the transfer function (or loadings) of the stationary relation- ships is nonlinear. This includes in particular the smooth transition models. A general representation theorem is given which establishes the dynamic properties...... and a linear trend in general. Gaussian likelihood-based estimators are considered for the long- run cointegration parameters, and the short-run parameters. Asymp- totic theory is provided for these and it is discussed to what extend asymptotic normality and mixed normaity can be found. A simulation study...

  12. Faster Simulation Methods for the Non-Stationary Random Vibrations of Non-Linear MDOF Systems

    DEFF Research Database (Denmark)

    Askar, A.; Köylüoglu, H. U.; Nielsen, Søren R. K.

    . Such a treatment offers higher rates of convergence, faster speed and higher accuracy. These procedures are compared to the direct Monte Carlo simulation procedure, which uses a fourth order Runge-Kutta scheme with the white noise process approximated by a broad band Ruiz-Penzien broken line process...

  13. Tunnelling effect of the non-stationary Kerr black hole

    Institute of Scientific and Technical Information of China (English)

    Yang Shu-Zheng; Chen De-You

    2008-01-01

    Extending Parikh and Wilezek's work to the non-stationary black hole, we study the Hawking radiation of the non-stationary Kerr black hole by the Hamilton-Jacobi method. The result shows that the radiation spectrum is not purely thermal and the tunnelling probability is related to the change of Bekenstein-Hawking entropy, which gives a correction to the Hawking thermal radiation of the black hole.

  14. Local polynomial Whittle estimation covering non-stationary fractional processes

    DEFF Research Database (Denmark)

    Nielsen, Frank

    This paper extends the local polynomial Whittle estimator of Andrews & Sun (2004) to fractionally integrated processes covering stationary and non-stationary regions. We utilize the notion of the extended discrete Fourier transform and periodogram to extend the local polynomial Whittle estimator ...... study illustrates the performance of the proposed estimator compared to the classical local Whittle estimator and the local polynomial Whittle estimator. The empirical justi.cation of the proposed estimator is shown through an analysis of credit spreads....

  15. Measuring and Modelling Crowd Flows - Fusing Stationary and Tracking Data

    OpenAIRE

    Treiber, Martin

    2016-01-01

    The two main data categories of vehicular traffic flow, stationary detector data and floating-car data, are also available for many Marathons and other mass-sports events: Loop detectors and other stationary data sources find their counterpart in the RFID tags of the athletes recording the split times at several stations during the race. Additionally, more and more athletes use smart-phone apps generating track data points that are the equivalent of floating-car data. We present a methodology...

  16. Robust Burg estimation of stationary autoregressive mixtures covariance

    Science.gov (United States)

    Decurninge, Alexis; Barbaresco, Frédéric

    2015-01-01

    Burg estimators are classically used for the estimation of the autocovariance of a stationary autoregressive process. We propose to consider scale mixtures of stationary autoregressive processes, a non-Gaussian extension of the latter. The traces of such processes are Spherically Invariant Random Vectors (SIRV) with a constraint on the scatter matrix due to the autoregressive model. We propose adaptations of the Burg estimators to the considered models and their associated robust versions based on geometrical considerations.

  17. Stationary density matrix of a pumped polariton system.

    Science.gov (United States)

    Vera, Carlos Andrés; Cabo, Alejandro; González, Augusto

    2009-03-27

    The density matrix rho of a model polariton system is obtained numerically from a master equation which takes account of pumping and losses. In the stationary limit, the coherences between eigenstates of the Hamiltonian are 3 orders of magnitude smaller than the occupations, meaning that the stationary density matrix is approximately diagonal in the energy representation. A weakly distorted grand canonical Gibbs distribution fits well the occupations.

  18. Pushing concentration of stationary solar concentrators to the limit.

    Science.gov (United States)

    Winston, Roland; Zhang, Weiya

    2010-04-26

    We give the theoretical limit of concentration allowed by nonimaging optics for stationary solar concentrators after reviewing sun- earth geometry in direction cosine space. We then discuss the design principles that we follow to approach the maximum concentration along with examples including a hollow CPC trough, a dielectric CPC trough, and a 3D dielectric stationary solar concentrator which concentrates sun light four times (4x), eight hours per day year around.

  19. Geophysics-based method of locating a stationary earth object

    Science.gov (United States)

    Daily, Michael R.; Rohde, Steven B.; Novak, James L.

    2008-05-20

    A geophysics-based method for determining the position of a stationary earth object uses the periodic changes in the gravity vector of the earth caused by the sun- and moon-orbits. Because the local gravity field is highly irregular over a global scale, a model of local tidal accelerations can be compared to actual accelerometer measurements to determine the latitude and longitude of the stationary object.

  20. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  1. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  2. Magnetic Field Evolution in Three-dimensional Simulations of the Stationary Accretion Shock Instability

    Science.gov (United States)

    Endeve, Eirik; Cardall, C.; Budiardja, R.; Beck, S.; Bejnood, A.; Mezzacappa, A.

    2011-01-01

    The stationary accretion shock instability (SASI) plays an important role in modern simulations of core-collapse supernovae. With the intent to study magnetic field generation and the possible impact of magnetic fields during the crucial nonlinear phase leading to the explosion of massive stars, we have carried out high-resolution, three-dimensional magnetohydrodynamic simulations of the SASI. Turbulent flows emerging from the operation of the spiral SASI mode result in exponential growth of the magnetic energy. From initial conditions in the range expected for slowly rotating progenitor stars, we find that saturation of the magnetic energy can occur within a typical explosion time scale. Implications for neutrino-powered supernovae and neutron star magnetization are considered.

  3. Ferrofluid patterns in Hele-Shaw cells: Exact, stable, stationary shape solutions

    Science.gov (United States)

    Lira, Sergio; Miranda, Jose

    2016-11-01

    We investigate a quasi-two-dimensional system composed by an initially circular ferrofluid droplet surrounded by a nonmagnetic fluid of higher density. These immiscible fluids flow in a rotating Hele-Shaw cell, under the influence of an in-plane radial magnetic field. We focus on the situation in which destabilizing bulk magnetic field effects are balanced by stabilizing centrifugal forces. In this framing, we consider the interplay of capillary and magnetic normal traction effects in determining the fluid-fluid interface morphology. By employing a vortex-sheet formalism we have been able to find a family of exact stationary N-fold polygonal shape solutions for the interface. A weakly nonlinear theory is then used to verify that such exact interfacial solutions are in fact stable. We thank CNPq (Brazilian Research Council) for financial support.

  4. Generation of partially coherent stationary time histories with non-Gaussian distributions

    Energy Technology Data Exchange (ETDEWEB)

    Smallwood, D.O.

    1996-08-27

    In a previous paper Smallwood and Paez (1991) showed how to generate realizations of partially coherent stationary normal time histories with a specified cross-spectral density matrix. This procedure is generalized for the case of multiple inputs with a specified cross-spectral density function and a specified marginal probability density function (pdf) for each of the inputs. The specified pdfs are not required to be Gaussian. A zero memory nonlinear (ZMNL) function is developed for each input to transform a Gaussian or normal time history into a time history with a specified non-Gaussian distribution. The transformation functions have the property that a transformed time history will have nearly the same auto spectral density as the original time history. A vector of Gaussian time histories are then generated with the specified cross-spectral density matrix. These waveforms are then transformed into the required time history realizations using the ZMNL function.

  5. Fluctuation-dissipation relation in a spin glass in the non-stationary regime

    Energy Technology Data Exchange (ETDEWEB)

    Herisson, D.; Ocio, M

    2003-05-01

    We present the first experimental determination of the time autocorrelation C(t',t) of magnetization in the non-stationary regime of a spin glass. Quantitative comparison with the corresponding response, the magnetic susceptibility {chi}(t',t), is made possible by the use of a new experimental setup allowing both measurements in the same conditions. Clearly, we observe a non-linear fluctuation-dissipation relation between C and {chi}, depending weakly on the waiting time t'. Following theoretical developments on mean-field models, and lately on short range ones, it is predicted that in the limit of long times, the {chi}(C) relationship should become independent on t'. A scaling procedure allows us to extrapolate to the limit of long waiting times.

  6. Self-Organized Stationary Patterns in Networks of Bistable Chemical Reactions.

    Science.gov (United States)

    Kouvaris, Nikos E; Sebek, Michael; Mikhailov, Alexander S; Kiss, István Z

    2016-10-10

    Experiments with networks of discrete reactive bistable electrochemical elements organized in regular and nonregular tree networks are presented to confirm an alternative to the Turing mechanism for the formation of self-organized stationary patterns. The results show that the pattern formation can be described by the identification of domains that can be activated individually or in combinations. The method also enabled the localization of chemical reactions to network substructures and the identification of critical sites whose activation results in complete activation of the system. Although the experiments were performed with a specific nickel electrodissolution system, they reproduced all the salient dynamic behavior of a general network model with a single nonlinearity parameter. Thus, the considered pattern-formation mechanism is very robust, and similar behavior can be expected in other natural or engineered networked systems that exhibit, at least locally, a treelike structure.

  7. DECAY RATES TOWARD STATIONARY WAVES OF SOLUTIONS FOR DAMPED WAVE EQUATIONS

    Institute of Scientific and Technical Information of China (English)

    Fan Lili; Yin Hui; Zhao Huijiang

    2008-01-01

    This paper is concerned with the initial-boundary value problem for damped wave equations with a nonlinear convection term in the half space R+(utt-uxx+ut+f(u)x=0,t>0,z∈R+,(u(0,x)=u0(x)→u+, as x→+∞, (I)(ut(0,x)=u1(x),u(t,0)=ub.For the non-degenerate case,f'(u+)<0,it is shown in[1]that the above initialboundary value problem admits a unique global solution u(t,x)which converges to the stationary wave φ(x)uniformly in x∈R+as time tends to infinity provided that the initial perturbation and/or the strength of the stationary wave are sufficiently small.Moreover,by using the space-time weighted energy method initiated by Kawashima and Matsumura[2],the convergence rates(including the algebraic convergence rate and the exponential convergence rate)of u(t,x)toward φ(x)are also obtained in[1].We note,however,that the analysis in[1]relies heavily on the assumption that f'(ub)<0.The main purpose of this paper is devoted to discussing the case of f'(ub)=0 and we show that similar results still hold for such a case.Our analysis is based on some delicate energy estimates.

  8. Stability of the stationary solutions of neural field equations with propagation delays.

    Science.gov (United States)

    Veltz, Romain; Faugeras, Olivier

    2011-05-03

    In this paper, we consider neural field equations with space-dependent delays. Neural fields are continuous assemblies of mesoscopic models arising when modeling macroscopic parts of the brain. They are modeled by nonlinear integro-differential equations. We rigorously prove, for the first time to our knowledge, sufficient conditions for the stability of their stationary solutions. We use two methods 1) the computation of the eigenvalues of the linear operator defined by the linearized equations and 2) the formulation of the problem as a fixed point problem. The first method involves tools of functional analysis and yields a new estimate of the semigroup of the previous linear operator using the eigenvalues of its infinitesimal generator. It yields a sufficient condition for stability which is independent of the characteristics of the delays. The second method allows us to find new sufficient conditions for the stability of stationary solutions which depend upon the values of the delays. These conditions are very easy to evaluate numerically. We illustrate the conservativeness of the bounds with a comparison with numerical simulation.

  9. Non-stationary model residuals: information, disinformation and measures of information

    Science.gov (United States)

    Beven, K.

    2012-12-01

    We expect error in applying hydrological models. They are approximate representations of hydrological processes, driven by approximate estimates of boundary fluxes and compared against uncertain observations of discharge (and perhaps other observables). We should expect, from the nonlinear dynamics of hydrological responses and the epistemic nature of many of the sources of uncertainty, that the residuals should be non-stationary in character. This suggests that it might be difficult to find a simple representation of the error characteristics that could be used, for example, to define a likelihood function for parameter estimation. This is often ignored: the likelihood functions used in hydrology have generally been simple, aleatory and stationary (albeit that this is not a conceptual limitation - as one referee put it, in principle an error model can be infinitely complex!). However, the epistemic nature of the uncertainty does raise the issue of how far nonstationary model residuals might be informative about change in the system and how far they reflect epistemic disinformation in inferring the true nature of the system. Some periods of potential calibration data are clearly disinformative in inference (even if informative about observational techniques), but other unusual events might be particularly revealing about the process responses. Is it therefore possible to define measures of information that can reflect some of these difficulties prior to running a model, or must we resort to data assimilation conditional on a model in detecting nonstationarity?

  10. Nonlinearly perturbed semi-Markov processes

    CERN Document Server

    Silvestrov, Dmitrii

    2017-01-01

    The book presents new methods of asymptotic analysis for nonlinearly perturbed semi-Markov processes with a finite phase space. These methods are based on special time-space screening procedures for sequential phase space reduction of semi-Markov processes combined with the systematical use of operational calculus for Laurent asymptotic expansions. Effective recurrent algorithms are composed for getting asymptotic expansions, without and with explicit upper bounds for remainders, for power moments of hitting times, stationary and conditional quasi-stationary distributions for nonlinearly perturbed semi-Markov processes. These results are illustrated by asymptotic expansions for birth-death-type semi-Markov processes, which play an important role in various applications. The book will be a useful contribution to the continuing intensive studies in the area. It is an essential reference for theoretical and applied researchers in the field of stochastic processes and their applications that will cont...

  11. Nonlinear Dynamics of Electrostatically Actuated MEMS Arches

    KAUST Repository

    Al Hennawi, Qais M.

    2015-05-01

    In this thesis, we present theoretical and experimental investigation into the nonlinear statics and dynamics of clamped-clamped in-plane MEMS arches when excited by an electrostatic force. Theoretically, we first solve the equation of motion using a multi- mode Galarkin Reduced Order Model (ROM). We investigate the static response of the arch experimentally where we show several jumps due to the snap-through instability. Experimentally, a case study of in-plane silicon micromachined arch is studied and its mechanical behavior is measured using optical techniques. We develop an algorithm to extract various parameters that are needed to model the arch, such as the induced axial force, the modulus of elasticity, and the initially induced initial rise. After that, we excite the arch by a DC electrostatic force superimposed to an AC harmonic load. A softening spring behavior is observed when the excitation is close to the first resonance frequency due to the quadratic nonlinearity coming from the arch geometry and the electrostatic force. Also, a hardening spring behavior is observed when the excitation is close to the third (second symmetric) resonance frequency due to the cubic nonlinearity coming from mid-plane stretching. Then, we excite the arch by an electric load of two AC frequency components, where we report a combination resonance of the summed type. Agreement is reported among the theoretical and experimental work.

  12. Positive Solutions for the Discrete Nonlinear Schrödinger Equation: A Priori Estimates and Convergence

    OpenAIRE

    Verbitsky, Anton

    2014-01-01

    We consider the discrete nonlinear stationary Schrödinger equation on a bounded n-dimensional box and on the whole space. In the first case we derive the existence of a positive classical solution of the corresponding continuous problem from a uniform a priori bound on positive discrete solutions for a general right hand side. In the second case we derive a uniform a priori bound on positive discrete solutions for the Schrödinger-type nonlinearity.

  13. Stationary spots and stationary arcs induced by advection in a one-activator, two-inhibitor reactive system.

    Science.gov (United States)

    Berenstein, Igal; Bullara, Domenico; De Decker, Yannick

    2014-09-01

    This paper studies the spatiotemporal dynamics of a reaction-diffusion-advection system corresponding to an extension of the Oregonator model, which includes two inhibitors instead of one. We show that when the reaction-diffusion, two-dimensional problem displays stationary patterns the addition of a plug flow can induce the emergence of new types of stationary structures. These patterns take the form of spots or arcs, the size and the spacing of which can be controlled by the flow.

  14. NONLINEAR EXPECTATIONS AND NONLINEAR MARKOV CHAINS

    Institute of Scientific and Technical Information of China (English)

    PENG SHIGE

    2005-01-01

    This paper deals with nonlinear expectations. The author obtains a nonlinear generalization of the well-known Kolmogorov's consistent theorem and then use it to construct filtration-consistent nonlinear expectations via nonlinear Markov chains. Compared to the author's previous results, i.e., the theory of g-expectations introduced via BSDE on a probability space, the present framework is not based on a given probability measure. Many fully nonlinear and singular situations are covered. The induced topology is a natural generalization of Lp-norms and L∞-norm in linear situations.The author also obtains the existence and uniqueness result of BSDE under this new framework and develops a nonlinear type of von Neumann-Morgenstern representation theorem to utilities and present dynamic risk measures.

  15. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  16. Mathematical model for the power supply system of an autonomous object with an AC power transmission over a cable rope

    Science.gov (United States)

    Rulevskiy, V. M.; Bukreev, V. G.; Shandarova, E. B.; Kuleshova, E. O.; Shandarov, S. M.; Vasilyeva, Yu Z.

    2017-02-01

    A modeling problem of the power system, which provides an AC power transmission to a submersible device over the conducting rope, was considered. The power supply system units and their parameters are described. The system multi-dimensional mathematical model in the variables state space with regard to the nonlinear characteristic of system elements is proposed.

  17. Fuel cells - a new contributor to stationary power

    Science.gov (United States)

    Dufour, Angelo U.

    Stationary power generation historically started as distributed generation near the user, with the configuration of a very open market, where a lot of small competing utilities were offering electricity to the customers. At a second time it became a `monopolistic' business because of technical reasons. Big steam turbines and electric generators, allowing better efficiencies, were more conveniently installed in very large power plants, necessarily located in sites far away from where the power was needed, and the transmission losses were bounded by AC high voltage technology. The Governments were, therefore, trying to balance the power of monopolies, that were limiting the economical development of the countries, by strengthening the concept of electrical energy price public control and, alternatively, by establishing rules to allow a free flow of electricity from one region to the other, or taking direct control through ownership of big and small utilities. The most effective way of making the electric energy system competitive has proved to be the opening of a partial competition in the generation field by forcing the utilities to compare the cost of their energy, produced with new centralised plants, to the price of the available energy, coming from combined heat and power dispersed generators. In fact, with reference to this cost, all the peculiar features of large central stations and dispersed generators were taken into account, like the widespread use of natural gas, the investment risk reduction with single smaller increments of capacity, the transmission and distribution siting difficulties and high costs, the improved system reliability, and, finally, the high quality electric power. Fuel Cells are a recently become available technology for distributed electrical energy production, because they share the main typical aspects, relevant for a distributed power system, like compatibility with other modular subsystem packages, fully automation possibility

  18. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  19. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  20. Non-parametric system identification from non-linear stochastic response

    DEFF Research Database (Denmark)

    Rüdinger, Finn; Krenk, Steen

    2001-01-01

    An estimation method is proposed for identification of non-linear stiffness and damping of single-degree-of-freedom systems under stationary white noise excitation. Non-parametric estimates of the stiffness and damping along with an estimate of the white noise intensity are obtained by suitable p...

  1. QUALITATIVE ANALYSIS FOR A CLASS OF SECOND-ORDER NONLINEAR SYSTEM WITH DELAY

    Institute of Scientific and Technical Information of China (English)

    彭奇林

    2001-01-01

    The second-order nonlinear system with delaybeing considered. Four theorems on the stability of zero solution, the boundedness of the solutions, the existence of the periodic solutions, the existence and uniqueness of the stationary oscillation are obtained by means of the Liapunov's second method. The conclusion in the literatures are generalized.

  2. Nonlinear resonances of a single-wall carbon nanotube cantilever

    Science.gov (United States)

    Kim, I. K.; Lee, S. I.

    2015-03-01

    The dynamics of an electrostatically actuated carbon nanotube (CNT) cantilever are discussed by theoretical and numerical approaches. Electrostatic and intermolecular forces between the single-walled CNT and a graphene electrode are considered. The CNT cantilever is analyzed by the Euler-Bernoulli beam theory, including its geometric and inertial nonlinearities, and a one-mode projection based on the Galerkin approximation and numerical integration. Static pull-in and pull-out behaviors are adequately represented by an asymmetric two-well potential with the total potential energy consisting of the CNT elastic energy, electrostatic energy, and the Lennard-Jones potential energy. Nonlinear dynamics of the cantilever are simulated under DC and AC voltage excitations and examined in the frequency and time domains. Under AC-only excitation, a superharmonic resonance of order 2 occurs near half of the primary frequency. Under both DC and AC loads, the cantilever exhibits linear and nonlinear primary and secondary resonances depending on the strength of the excitation voltages. In addition, the cantilever has dynamic instabilities such as periodic or chaotic tapping motions, with a variation of excitation frequency at the resonance branches. High electrostatic excitation leads to complex nonlinear responses such as softening, multiple stability changes at saddle nodes, or period-doubling bifurcation points in the primary and secondary resonance branches.

  3. Modeling and Simulation of Nonlinear Micro-electromechanical Circular Plate

    Directory of Open Access Journals (Sweden)

    Chin-Chia Liu

    2013-09-01

    Full Text Available In the present study, the hybrid differential transformation and finite difference method is applied to analyze the dynamic behavior of the nonlinear micro-electromechanical circular plate actuated by combined DC / AC loading schemes. The analysis takes account of the axial residual stress and hydrostatic pressure acting on micro circular plate upper surface. The dynamic response of the plate as a function of the magnitude of the AC driving voltage is explored. Moreover, the effect of the initial gap height on the pull-in voltage of the plate is systematically explored.

  4. Utilization of non-linear converters for audio amplification

    DEFF Research Database (Denmark)

    Iversen, Niels Elkjær; Birch, Thomas; Knott, Arnold

    2012-01-01

    Class D amplifiers fits the automotive demands quite well. The traditional buck-based amplifier has reduced both the cost and size of amplifiers. However the buck topology is not without its limitations. The maximum peak AC output voltage produced by the power stage is only equal the supply voltage....... The introduction of non-linear converters for audio amplification defeats this limitation. A Cuk converter, designed to deliver an AC peak output voltage twice the supply voltage, is presented in this paper. A 3V prototype has been developed to prove the concept. The prototype shows that it is possible to achieve...

  5. Beam Combining by Phase Transition Nonlinear Media

    Science.gov (United States)

    1990-02-01

    use the Redlich Kwong equation of state for the media we consider. This equation of state can be written RT a p - -b -FT(p.-’ + b)p ; 2-I M (2-1) where...as ac 3 dg-A7 C VA/\\CIIJT (6) The Redlich - Kwong equation of state; i.e., _ RT T-1/2 v-P v(v+P) (7) can be used to compute aP/lT, where the relevant...practical the application of nonlinear phase conjugate techniques to the beam combining of multiple lasers with a coherence characteristic of a

  6. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  7. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  8. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  9. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  10. Stationary Stability for Evolutionary Dynamics in Finite Populations

    Directory of Open Access Journals (Sweden)

    Marc Harper

    2016-08-01

    Full Text Available We demonstrate a vast expansion of the theory of evolutionary stability to finite populations with mutation, connecting the theory of the stationary distribution of the Moran process with the Lyapunov theory of evolutionary stability. We define the notion of stationary stability for the Moran process with mutation and generalizations, as well as a generalized notion of evolutionary stability that includes mutation called an incentive stable state (ISS candidate. For sufficiently large populations, extrema of the stationary distribution are ISS candidates and we give a family of Lyapunov quantities that are locally minimized at the stationary extrema and at ISS candidates. In various examples, including for the Moran and Wright–Fisher processes, we show that the local maxima of the stationary distribution capture the traditionally-defined evolutionarily stable states. The classical stability theory of the replicator dynamic is recovered in the large population limit. Finally we include descriptions of possible extensions to populations of variable size and populations evolving on graphs.

  11. LOCAL DISCONTINUOUS GALERKIN METHODS FOR THREE CLASSES OF NONLINEAR WAVE EQUATIONS

    Institute of Scientific and Technical Information of China (English)

    Yan Xu; Chi-wang Shu

    2004-01-01

    In this paper, we further develop the local discontinuous Galerkin method to solve three classes of nonlinear wave equations formulated by the general KdV-Burgers type equations, the general fifth-order KdV type equations and the fully nonlinear K(n, n, n)equations, and prove their stability for these general classes of nonlinear equations. The schemes we present extend the previous work of Yan and Shu [30, 31] and of Levy, Shu and Yan [24] on local discontinuous Galerkin method solving partial differential equations with higher spatial derivatives. Numerical examples for nonlinear problems are shown to illustrate the accuracy and capability of the methods. The numerical experiments include stationary solitons, soliton interactions and oscillatory solitary wave solutions.The numerical experiments also include the compacton solutions of a generalized fifthorder KdV equation in which the highest order derivative term is nonlinear and the fully nonlinear K(n, n, n) equations.

  12. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  13. Stationary Crossflow Breakdown due to Mixed Mode Spectra of Secondary Instabilities

    Science.gov (United States)

    Li, Fei; Choudhari, Meelan M.; Duan, Lian

    2016-01-01

    Numerical simulations are used to study laminar breakdown characteristics associated with stationary crossflow instability in the boundary-layer flow over a subsonic swept-wing configuration. Previous work involving the linear and nonlinear development of individual, fundamental modes of secondary instability waves is extended by considering the role of more complex, yet controlled, spectra of the secondary instability modes. Direct numerical simulations target a mixed mode transition scenario involving the simultaneous presence of Y and Z modes of secondary instability. For the initial amplitudes investigated in this paper, the Y modes are found to play an insignificant role during the onset of transition, in spite of achieving rather large, O(5%), amplitudes of RMS velocity fluctuation prior to transition. Analysis of the numerical simulations shows that this rather surprising finding can be attributed to the fact that the Y modes are concentrated near the top of the crossflow vortex and exert relatively small influence on the Z modes that reside closer to the surface and can lead to transition via nonlinear spreading that does not involve interactions with the Y mode. Finally, secondary instability calculations reveal that subharmonic modes of secondary instability have substantially lower growth rates than those of the fundamental modes, and hence, are less likely to play an important role during the breakdown process involving complex initial spectra.

  14. Noise Cancellation with Static Mixtures of a Nonstationary Signal and Stationary Noise

    Directory of Open Access Journals (Sweden)

    Sharon Gannot

    2003-01-01

    Full Text Available We address the problem of cancelling a stationary noise component from its static mixtures with a nonstationary signal of interest. Two different approaches, both based on second-order statistics, are considered. The first is the blind source separation (BSS approach which aims at estimating the mixing parameters via approximate joint diagonalization of estimated correlation matrices. Proper exploitation of the nonstationary nature of the desired signal, in contrast to the stationarity of the noise, allows parameterization of the joint diagonalization problem in terms of a nonlinear weighted least squares (WLS problem. The second approach is a denoising approach, which translates into direct estimation of just one of the mixing coefficients via solution of a linear WLS problem, followed by the use of this coefficient to create a noise-only signal to be properly eliminated from the mixture. Under certain assumptions, the BSS approach is asymptotically optimal, yet computationally more intense, since it involves an iterative nonlinear WLS solution, whereas the second approach only requires a closed-form linear WLS solution. We analyze and compare the performance of the two approaches and provide some simulation results which confirm our analysis. Comparison to other methods is also provided.

  15. Simulation of non-stationary ground motion processes (I)

    Institute of Scientific and Technical Information of China (English)

    LIANG Jian-wen

    2005-01-01

    This paper presents a spectral representation method for simulation of non-stationary ground motion processes on the basis of Priestley's evolutionary spectral theory. Following this method, sample processes can be generated using a cosine series formula. It is shown that, these sample processes accurately reflect the prescribed characteristics of the evolutionary power spectral density function when the number of the terms in the cosine series is large enough; and the ensemble expected value and the ensemble autocorrelation function approach the corresponding target functions, respectively, as the sample size increases; and these sample processes are asymptotically normal as the number of the terms in the series tends to infinity. Finally, a few special cases of the formula are discussed, one of which is non-stationary white noise process, and other one is reduced to the formula for simulation of stationary stochastic processes.

  16. Inference for local autocorrelations in locally stationary models.

    Science.gov (United States)

    Zhao, Zhibiao

    2015-04-01

    For non-stationary processes, the time-varying correlation structure provides useful insights into the underlying model dynamics. We study estimation and inferences for local autocorrelation process in locally stationary time series. Our constructed simultaneous confidence band can be used to address important hypothesis testing problems, such as whether the local autocorrelation process is indeed time-varying and whether the local autocorrelation is zero. In particular, our result provides an important generalization of the R function acf() to locally stationary Gaussian processes. Simulation studies and two empirical applications are developed. For the global temperature series, we find that the local autocorrelations are time-varying and have a "V" shape during 1910-1960. For the S&P 500 index, we conclude that the returns satisfy the efficient-market hypothesis whereas the magnitudes of returns show significant local autocorrelations.

  17. Stationary Vortices and Pair Currents in a Trapped Fermion Superfluid

    Science.gov (United States)

    Capuzzi, P.; Hernández, E. S.; Szybisz, L.

    2015-05-01

    We examine the effects of stationary vortices in superfluid Li atoms at zero temperature in the frame of the recently developed fluiddynamical scheme, that includes the pair density and its associated pair current and pair kinetic energy in addition to the fields appearing in the hydrodynamical description of normal fluids. In this frame, the presence of any particle velocity field gives rise to the appearance of a pair current. As an illustration, we consider a stationary vortex with cylindrical geometry in an unpolarized fluid, and examine the effects of the rotational velocity field on the spatial structure of the equilibrium gap and the profiles of the pair current. We show that the latter is intrinsically complex and its imaginary part is the source of a radial drift for the velocity field. We discuss the consequences on the stationary regime.

  18. Non-Stationary Dependence Structures for Spatial Extremes

    KAUST Repository

    Huser, Raphaël

    2016-03-03

    Max-stable processes are natural models for spatial extremes because they provide suitable asymptotic approximations to the distribution of maxima of random fields. In the recent past, several parametric families of stationary max-stable models have been developed, and fitted to various types of data. However, a recurrent problem is the modeling of non-stationarity. In this paper, we develop non-stationary max-stable dependence structures in which covariates can be easily incorporated. Inference is performed using pairwise likelihoods, and its performance is assessed by an extensive simulation study based on a non-stationary locally isotropic extremal t model. Evidence that unknown parameters are well estimated is provided, and estimation of spatial return level curves is discussed. The methodology is demonstrated with temperature maxima recorded over a complex topography. Models are shown to satisfactorily capture extremal dependence.

  19. Simulation of non-stationary ground motion processes (II)

    Institute of Scientific and Technical Information of China (English)

    LIANG Jian-wen

    2005-01-01

    This paper proposes a method for simulation of non-stationary ground motion processes having the identical statistical feature, time-dependent power spectrum, with a given ground motion record, on the basis of review of simulation of non-stationary ground motion processes. The method has the following advantages: the sample processes are non-stationary both in amplitude and frequency, and both the amplitude and frequency non-stationarity depend on the target power spectrum; the power spectrum of any sample process does not necessarily accord with the target power spectrum, but statistically, it strictly accords with the target power spectrum. Finally, the method is verified by simulation of one acceleration record in Landers earthquake.

  20. Retention of Halogenated Solutes on Stationary Phases Containing Heavy Atoms

    Directory of Open Access Journals (Sweden)

    Toshio Miwa

    2013-05-01

    Full Text Available To examine the effects of weak intermolecular interactions on solid-phase extraction (SPE and chromatographic separation, we synthesized some novel stationary phases with a heavy atom effect layer by immobilizing halogenated aromatic rings and hydroxyl groups onto the surface of a hydrophilic base polymer. Using SPE cartridges packed with the functionalized materials, we found that the heavy atom stationary phases could selectively retain halophenols in organic solvents, such as 1-propanol which blocks the hydrogen bonding, or acetonitrile which blocks the p-p interaction. The extraction efficiency of the materials toward the halophenols depended on the dipole moments of phenoxy groups present as functional groups. On the other hand, the extraction efficiency of solutes toward the functional group depended on their molar refractions, i.e., induced dipole moments. The retention of the solutes to the stationary phase ultimately depended on not only strong intermolecular interactions, but also the effects of weak interactions such as the dispersion force.

  1. Terahertz digital holography image denoising using stationary wavelet transform

    Science.gov (United States)

    Cui, Shan-Shan; Li, Qi; Chen, Guanghao

    2015-04-01

    Terahertz (THz) holography is a frontier technology in terahertz imaging field. However, reconstructed images of holograms are inherently affected by speckle noise, on account of the coherent nature of light scattering. Stationary wavelet transform (SWT) is an effective tool in speckle noise removal. In this paper, two algorithms for despeckling SAR images are implemented to THz images based on SWT, which are threshold estimation and smoothing operation respectively. Denoised images are then quantitatively assessed by speckle index. Experimental results show that the stationary wavelet transform has superior denoising performance and image detail preservation to discrete wavelet transform. In terms of the threshold estimation, high levels of decomposing are needed for better denoising result. The smoothing operation combined with stationary wavelet transform manifests the optimal denoising effect at single decomposition level, with 5×5 average filtering.

  2. A numerical approach to finding general stationary vacuum black holes

    CERN Document Server

    Adam, Alexander; Wiseman, Toby

    2011-01-01

    The Harmonic Einstein equation is the vacuum Einstein equation supplemented by a gauge fixing term which we take to be that of DeTurck. For static black holes analytically continued to Riemannian manifolds without boundary at the horizon this equation has previously been shown to be elliptic, and Ricci flow and Newton's method provide good numerical algorithms to solve it. Here we extend these techniques to the arbitrary cohomogeneity stationary case which must be treated in Lorentzian signature. For stationary spacetimes with globally timelike Killing vector the Harmonic Einstein equation is elliptic. In the presence of horizons and ergo-regions it is less obviously so. Motivated by the Rigidity theorem we study a class of stationary black hole spacetimes, considered previously by Harmark, general enough to include the asymptotically flat case in higher dimensions. We argue the Harmonic Einstein equation consistently truncates to this class of spacetimes giving an elliptic problem. The Killing horizons and a...

  3. Nonlinear Chemical Dynamics and Synchronization

    Science.gov (United States)

    Li, Ning

    Alan Turing's work on morphogenesis, more than half a century ago, continues to motivate and inspire theoretical and experimental biologists even today. That said, there are very few experimental systems for which Turing's theory is applicable. In this thesis we present an experimental reaction-diffusion system ideally suited for testing Turing's ideas in synthetic "cells" consisting of microfluidically produced surfactant-stabilized emulsions in which droplets containing the Belousov-Zhabotinsky (BZ) oscillatory chemical reactants are dispersed in oil. The BZ reaction has become the prototype of nonlinear dynamics in chemistry and a preferred system for exploring the behavior of coupled nonlinear oscillators. Our system consists of a surfactant stabilized monodisperse emulsion of drops of aqueous BZ solution dispersed in a continuous phase of oil. In contrast to biology, here the chemistry is understood, rate constants are measured and interdrop coupling is purely diffusive. We explore a large set of parameters through control of rate constants, drop size, spacing, and spatial arrangement of the drops in lines and rings in one-dimension (1D) and hexagonal arrays in two-dimensions (2D). The Turing model is regarded as a metaphor for morphogenesis in biology but not for prediction. Here, we develop a quantitative and falsifiable reaction-diffusion model that we experimentally test with synthetic cells. We quantitatively establish the extent to which the Turing model in 1D describes both stationary pattern formation and temporal synchronization of chemical oscillators via reaction-diffusion and in 2D demonstrate that chemical morphogenesis drives physical differentiation in synthetic cells.

  4. Overdamped motion of interacting particles in general confining potentials: time-dependent and stationary-state analyses

    Science.gov (United States)

    Ribeiro, M. S.; Nobre, F. D.; Curado, E. M. F.

    2012-12-01

    By comparing numerical and analytical results, it is shown that a system of interacting particles under overdamped motion is very well described by a nonlinear Fokker-Planck equation, which can be associated with nonextensive statistical mechanics. The particle-particle interactions considered are repulsive, motivated by three different physical situations: (i) modified Bessel function, commonly used in vortex-vortex interactions, relevant for the flux-front penetration in disordered type-II superconductors; (ii) Yukawa-like forces, useful for charged particles in plasma, or colloidal suspensions; (iii) derived from a Gaussian potential, common in complex fluids, like polymer chains dispersed in a solvent. Moreover, the system is subjected to a general confining potential, φ( x) = ( α| x| z )/ z ( α > 0 , z > 1), so that a stationary state is reached after a sufficiently long time. Recent numerical and analytical investigations, considering interactions of type (i) and a harmonic confining potential ( z = 2), have shown strong evidence that a q-Gaussian distribution, P( x,t), with q = 0, describes appropriately the particle positions during their time evolution, as well as in their stationary state. Herein we reinforce further the connection with nonextensive statistical mechanics, by presenting numerical evidence showing that: (a) in the case z = 2, different particle-particle interactions only modify the diffusion parameter D of the nonlinear Fokker-Planck equation; (b) for z ≠ 2, all cases investigated fit well the analytical stationary solution P st( x), given in terms of a q-exponential (with the same index q = 0) of the general external potential φ( x). In this later case, we propose an approximate time-dependent P( x,t) (not known analytically for z ≠ 2), which is in very good agreement with the simulations for a large range of times, including the approach to the stationary state. The present work suggests that a wide variety of physical phenomena

  5. AC polarographic determination of cloxacillin.

    Science.gov (United States)

    Núñez-Vergara, L J; Silva, M M; Squella, J A

    1982-11-01

    Hydrolysis of cloxacillin at pH 4.0 yields an electroactive product which can be determined by polarography. Depending on the concentration of cloxacillin, one of 2 peaks was obtained: The potential ac peaks for a 4.36 mM cloxacillin solution were peak I, -0.23 V and peak II, -0.13 V. For analytical purposes, the first peak was used. A linear relationship was established for levels of cloxacillin between 2.2 X 10(-5) and 2.2 X 10(-3)M. Average recovery was 98.8% (SD 1.8), indicating satisfactory accuracy for the method. Individual capsule and composite assays as well as interference tests are described.

  6. EDITORIAL: CAMOP: Quantum Non-Stationary Systems CAMOP: Quantum Non-Stationary Systems

    Science.gov (United States)

    Dodonov, Victor V.; Man'ko, Margarita A.

    2010-09-01

    Although time-dependent quantum systems have been studied since the very beginning of quantum mechanics, they continue to attract the attention of many researchers, and almost every decade new important discoveries or new fields of application are made. Among the impressive results or by-products of these studies, one should note the discovery of the path integral method in the 1940s, coherent and squeezed states in the 1960-70s, quantum tunneling in Josephson contacts and SQUIDs in the 1960s, the theory of time-dependent quantum invariants in the 1960-70s, different forms of quantum master equations in the 1960-70s, the Zeno effect in the 1970s, the concept of geometric phase in the 1980s, decoherence of macroscopic superpositions in the 1980s, quantum non-demolition measurements in the 1980s, dynamics of particles in quantum traps and cavity QED in the 1980-90s, and time-dependent processes in mesoscopic quantum devices in the 1990s. All these topics continue to be the subject of many publications. Now we are witnessing a new wave of interest in quantum non-stationary systems in different areas, from cosmology (the very first moments of the Universe) and quantum field theory (particle pair creation in ultra-strong fields) to elementary particle physics (neutrino oscillations). A rapid increase in the number of theoretical and experimental works on time-dependent phenomena is also observed in quantum optics, quantum information theory and condensed matter physics. Time-dependent tunneling and time-dependent transport in nano-structures are examples of such phenomena. Another emerging direction of study, stimulated by impressive progress in experimental techniques, is related to attempts to observe the quantum behavior of macroscopic objects, such as mirrors interacting with quantum fields in nano-resonators. Quantum effects manifest themselves in the dynamics of nano-electromechanical systems; they are dominant in the quite new and very promising field of circuit

  7. Modeling and Estimation of Stationary and Non-stationary Noises of Rubidium Atomic Clock

    Directory of Open Access Journals (Sweden)

    Deepak Mishra,

    2014-07-01

    Full Text Available Noise estimation of atomic clock is one of the important research areas in the field of atomic clock development and application. Most of the atomic clocks are having random-stochastic noises and periodic noises due to temperature variation. Random-stochastic noises have a well identified signature in time domain but periodic noises are difficult to analyze in time domain. However, in this paper, an effort is made to identify and analyze the deterministic trends of both random-stochastic noises and periodic noises due to variation in temperature using an alternate approach of least-squares normalized-error (LSNE regression algorithm. A MATLAB based application with graphical user interface (GUI is developed to estimate and analyze random-stochastic noises and periodic noises and re-estimate the stability of rubidium atomic clock after removing these noises from the raw phase data. The estimation of stationary noises are done using Allan variance from time domain data and noise profile is calculated using curve fit method. The estimation of periodic noises due to temperature variation is carried in frequency domain through spurious analysis of the frequency data of atomic clock.

  8. Non-stationary flow of hydraulic oil in long pipe

    Directory of Open Access Journals (Sweden)

    Hružík Lumír

    2014-03-01

    Full Text Available The paper deals with experimental evaluation and numerical simulation of non-stationary flow of hydraulic oil in a long hydraulic line. Non-stationary flow is caused by a quick closing of valves at the beginning and the end of the pipe. Time dependence of pressure is measured by means of pressure sensors at the beginning and the end of the pipe. A mathematical model of a given circuit is created using Matlab SimHydraulics software. The long line is simulated by means of segmented pipe. The simulation is verified by experiment.

  9. Stationary Scalar Clouds Around Maximally Rotating Linear Dilaton Black Holes

    CERN Document Server

    Sakalli, I

    2016-01-01

    We investigate the wave dynamics of a charged massive scalar field propagating in a maximally rotating (extremal) linear dilaton black hole geometry. We prove the existence of a discrete and infinite family of resonances describing non-decaying (stationary) scalar configurations (clouds) enclosing these rapidly rotating black holes. The results obtained signal the potential stationary scalar field distributions (dark matter) around the extremal linear dilaton black holes. In particular, we analytically compute the effective height of those clouds above the center of the black hole.

  10. Approximating stationary points of stochastic optimization problems in Banach space

    Science.gov (United States)

    Balaji, Ramamurthy; Xu, Huifu

    2008-11-01

    In this paper, we present a uniform strong law of large numbers for random set-valued mappings in separable Banach space and apply it to analyze the sample average approximation of Clarke stationary points of a nonsmooth one stage stochastic minimization problem in separable Banach space. Moreover, under Hausdorff continuity, we show that with probability approaching one exponentially fast with the increase of sample size, the sample average of a convex compact set-valued mapping converges to its expected value uniformly. The result is used to establish exponential convergence of stationary sequence under some metric regularity conditions.

  11. Limit Cycles near Stationary Points in the Lorenz System

    Institute of Scientific and Technical Information of China (English)

    YANG Shi-Pu; ZHU Ke-Qin; ZHOU Xiao-Zhou

    2005-01-01

    @@ The limit cycles in the Lorenz system near the stationary points are analysed numerically. A plane in phase space of the linear Lorenz system is used to locate suitable initial points of trajectories near the limit cycles. The numerical results show a stable and an unstable limit cycle near the stationary point. The stable limit cycle is smaller than the unstable one and has not been previously reported in the literature. In addition, all the limit cycles in the Lorenz system are theoretically proven not to be planar.

  12. Simulation of dust streaming in toroidal traps: Stationary flows

    Energy Technology Data Exchange (ETDEWEB)

    Reichstein, Torben; Piel, Alexander [IEAP, Christian-Albrechts-Universitaet, D-24098 Kiel (Germany)

    2011-08-15

    Molecular-dynamic simulations were performed to study dust motion in a toroidal trap under the influence of the ion drag force driven by a Hall motion of the ions in E x B direction, gravity, inter-particle forces, and friction with the neutral gas. This article is focused on the inhomogeneous stationary streaming motion. Depending on the strength of friction, the spontaneous formation of a stationary shock or a spatial bifurcation into a fast flow and a slow vortex flow is observed. In the quiescent streaming region, the particle flow features a shell structure which undergoes a structural phase transition along the flow direction.

  13. An entropic characterization of long memory stationary process

    OpenAIRE

    Ding, Yiming; Xiang, Xuyan

    2016-01-01

    Long memory or long range dependency is an important phenomenon that may arise in the analysis of time series or spatial data. Most of the definitions of long memory of a stationary process $X=\\{X_1, X_2,\\cdots,\\}$ are based on the second-order properties of the process. The excess entropy of a stationary process is the summation of redundancies which relates to the rate of convergence of the conditional entropy $H(X_n|X_{n-1},\\cdots, X_1)$ to the entropy rate. It is proved that the excess en...

  14. Advances in nonlinear optics

    CERN Document Server

    Chen, Xianfeng; Zeng, Heping; Guo, Qi; She, Weilong

    2015-01-01

    This book presents an overview of the state of the art of nonlinear optics from weak light nonlinear optics, ultrafast nonlinear optics to electro-optical theory and applications. Topics range from the fundamental studies of the interaction between matter and radiation to the development of devices, components, and systems of tremendous commercial interest for widespread applications in optical telecommunications, medicine, and biotechnology.

  15. Distributed nonlinear optical response

    DEFF Research Database (Denmark)

    Nikolov, Nikola Ivanov

    2005-01-01

    The purpose of the research presented here is to investigate basic physical properties in nonlinear optical materials with delayed or nonlocal nonlinearity. Soliton propagation, spectral broadening and the influence of the nonlocality or delay of the nonlinearity are the main focusses in the work...

  16. Noncommutative Nonlinear Supersymmetry

    CERN Document Server

    Nishino, H; Nishino, Hitoshi; Rajpoot, Subhash

    2002-01-01

    We present noncommutative nonlinear supersymmetric theories. The first example is a non-polynomial Akulov-Volkov-type lagrangian with noncommutative nonlinear global supersymmetry in arbitrary space-time dimensions. The second example is the generalization of this lagrangian to Dirac-Born-Infeld lagrangian with nonlinear supersymmetry realized in dimensions D=2,3,4 and 6 (mod 8).

  17. Fiber Nonlinearities: A Tutorial

    Institute of Scientific and Technical Information of China (English)

    Govind P. Agrawal

    2003-01-01

    Fiber nonlinearities have long been regarded as being mostly harmful for fiber-optic communication systems. Over the last few years, however, the nonlinear effects are increasingly being used for practical telecommunications applications,the Raman amplification being only one of the recent examples. In this tutorial I review the vario us nonlinear effects occurring in optical fibers from both standpoints..

  18. Fiber Nonlinearities: A Tutorial

    Institute of Scientific and Technical Information of China (English)

    Govind; P.; Agrawal

    2003-01-01

    Fiber nonlinearities have long been regarded as being mostly harmful for fiber-optic communication systems. Over the last few years, however, the nonlinear effects are increasingly being used for practical telecommunications applications, the Raman amplification being only one of the recent examples. In this tutorial I review the various nonlinear effects occurring in optical fibers from both standpoints..

  19. Spinning Janus doublets driven in uniform AC electric fields

    CERN Document Server

    Boymelgreen, Alicia; Park, Sinwook; Miloh, Touvia

    2013-01-01

    We provide an experimental proof-of-concept for a robust, continuously rotating microstructure - consisting of two metallodielectric (gold-polystyrene)Janus particles rigidly attached to each other - which is driven in uniform ac fields by asymmetric induced-charge electroosmosis. The pairs (doublets) are stabilized on the substrate surface which is parallel to the plane of view and normal to the direction of the applied electric field. We find that the radius of orbit and angular velocity of the pair are predominantly dependent on the relative orientations of the interfaces between the metallic and dielectric hemispheres and that the electrohydrodynamic particle-particle interactions are small. Additionally, we verify that both the angular and linear velocities of the pair are proportional to the square of the applied field which is consistent with the theory for non-linear electrokinetics. A simple kinematic rigid body model is used to predict the paths and double velocities (angular and linear) based on th...

  20. Application for Single Price Auction Model (SPA) in AC Network

    Science.gov (United States)

    Wachi, Tsunehisa; Fukutome, Suguru; Chen, Luonan; Makino, Yoshinori; Koshimizu, Gentarou

    This paper aims to develop a single price auction model with AC transmission network, based on the principle of maximizing social surplus of electricity market. Specifically, we first formulate the auction market as a nonlinear optimization problem, which has almost the same form as the conventional optimal power flow problem, and then propose an algorithm to derive both market clearing price and trade volume of each player even for the case of market-splitting. As indicated in the paper, the proposed approach can be used not only for the price evaluation of auction or bidding market but also for analysis of bidding strategy, congestion effect and other constraints or factors. Several numerical examples are used to demonstrate effectiveness of our method.

  1. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  2. PBH tests for nonlinear systems

    NARCIS (Netherlands)

    Kawano, Yu; Ohtsuka, Toshiyuki

    2017-01-01

    Recently, concepts of nonlinear eigenvalues and eigenvectors are introduced. In this paper, we establish connections between the nonlinear eigenvalues and nonlinear accessibility/observability. In particular, we provide a generalization of Popov- Belevitch-Hautus (PBH) test to nonlinear accessibilit

  3. Synthesis and experimental-computational characterization of nonlinear optical properties of triazacyclopentafluorene-coumarin derivatives

    Science.gov (United States)

    García, Santiago; Vázquez, Juan L.; Rentería, Marvin; Aguilar-Garduño, Isis G.; Delgado, Francisco; Trejo-Durán, Mónica; García-Revilla, Marco A.; Alvarado-Méndez, Edgar; Vázquez, Miguel A.

    2016-12-01

    A series of novel 3-(2,2a,3-triazacyclopenta[jk]fluoren-1-yl)-2H-chromen-2-one derivatives 5a-c have been synthesized by [8 + 2] cycloaddition reaction between the corresponding 3-(imidazo[1,2-a]pyrimidines)-2-yl)-2H-chromen-2-one 4a-c with 2-(trimethylsilyl)phenyl triflates as benzyne precursor in 65-80% yields. The strategic incorporation of triazacyclopentafluorene group at the 3-position of the coumarin molecules resulted in dyes with excellent nonlinear optical properties. The nonlinear optical properties of third order (compounds 5a-c) were studied using Z-scan technique. The high nonlinear response is of 10-7 cm2/W order. The nonlinearity of the compounds is an indication of a promising material for applications at low power, such as optical switching, waveguides, nonlinear contrast phase, among others. Theoretical results of HOMO-LUMO gaps and oscillator strengths are used to rationalize the high efficiency of the novel compound in the nonlinear optical behavior. In particular, 5b displays the best nonlinear optical properties and at the same time the smaller HOMO-LUMO gap and the highest oscillator strength.

  4. Homogeneous solutions for elliptically polarized light in a cavity containing materials with electric and magnetic nonlinearities

    CERN Document Server

    Martin, D A

    2015-01-01

    We study evolution equations and stationary homogeneous solutions for electric and magnetic field amplitudes in a ring cavity with flat mirrors. The cavity is filled with a positive or negative refraction index material with third order Kerr-like electric nonlinearities and also magnetic nonlinearities, which can be relevant in metamaterials. We consider the degree of freedom of polarization in the incident beam. It is found that considering a magnetic nonlinearity increases the variety of possible qualitatively different solutions. A classification of solutions is proposed in terms of the number of bifurcations. The analysis can be useful for the implementation of optical switching or memory storage using ring cavities with non linear materials.

  5. Nonlinear behavior of electron acoustic waves in an un-magnetized plasma

    Energy Technology Data Exchange (ETDEWEB)

    Dutta, Manjistha; Khan, Manoranjan [Department of Instrumentation Science, Jadavpur University, Kolkata 700 032 (India); Chakrabarti, Nikhil [Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Roychoudhury, Rajkumar [Indian Statistical Institute, Kolkata 700 108 (India)

    2011-10-15

    The nonlinear electron acoustic wave, which is found in the earth's magnetosphere by satellite observations, is studied analytically by Lagrangian fluid description. The basic linear mode is observed in a two temperature electron species plasma where ions form stationary charge neutral background. We have obtained nonlinear description of this mode, which depends on both time and space. A possible solution shows a soliton like structure, which is localized in space, and the amplitude increases with time in the absence of dispersion. Small dispersive correction, however, shows spread of the solution in space. This method can be generalized to study the nonlinear behavior of a general class of multispecies plasma.

  6. Strong correlations in model of the scale-invariance (2+1) dimensional nonlinear Schroedinger equation

    CERN Document Server

    Protogenov, A P

    2001-01-01

    The brief review of events, conditioned by the nonlinear modes strong correlations in the planar systems is presented. The analysis is limited by the Schroedinger nonlinear equation model. The fields stationary distributions are determined. The dependence of the particles number on the parameter characterizing the degree of looking, of the universal oscillation lines, is obtained. It is shown that by small values of this parameter there exists on the two-dimensional lattice the universal gravitation, which may be the dynamic cause of transition to the coherent state. The connection of the chiral nonlinear boundary modes with the violations of the Galilean-invariance of the considered system is discussed

  7. Discrete Localized States and Localization Dynamics in Discrete Nonlinear Schrödinger Equations

    DEFF Research Database (Denmark)

    Christiansen, Peter Leth; Gaididei, Yu.B.; Mezentsev, V.K.

    1996-01-01

    Dynamics of two-dimensional discrete structures is studied in the framework of the generalized two-dimensional discrete nonlinear Schrodinger equation. The nonlinear coupling in the form of the Ablowitz-Ladik nonlinearity is taken into account. Stability properties of the stationary solutions...... are examined. The importance of the existence of stable immobile solitons in the two-dimensional dynamics of the travelling pulses is demonstrated. The process of forming narrow states from initially broad standing or moving excitations through the quasi-collapse mechanism is analyzed. The typical scenario...

  8. AC losses in superconductors with a power-law constitutive relation

    Energy Technology Data Exchange (ETDEWEB)

    Agassi, Y.D., E-mail: yehoshua.agassi@navy.mil

    2015-10-15

    Highlights: • Derivation of power-law constitutive-relation from distributed Anderson–Kim theory. • The electric-field for HTS constitutive-relation satisfies nonlinear heat-equation. • For slab, AC losses scale as B{sub 0}{sup m}, m = 3–4 and I{sup 3} with field-amplitude and current, respectively. • Calculated pinning potential, AC-losses scaling is consistent with BSCCO data. - Abstract: The observed constitutive relation between the electrical field and current density in cuprates high temperature superconductors is a power-law of the current. This functional dependence is presumably related to the giant flux-creep domain. It is shown that this constitutive relation reflects the statistical spread of the pinning potential associated with creep motion of vortex bundles. The AC losses emanating from a power-law constitutive relation are calculated in an approach focused on the superconductor’s electric field. For a slab geometry in the presence of a parallel AC magnetic field or transport current, the calculated AC-loss scaling laws are consistent with BSCCO data and the critical state model. Extensions of the approach are briefly discussed.

  9. Nonlinear dynamics and complexity

    CERN Document Server

    Luo, Albert; Fu, Xilin

    2014-01-01

    This important collection presents recent advances in nonlinear dynamics including analytical solutions, chaos in Hamiltonian systems, time-delay, uncertainty, and bio-network dynamics. Nonlinear Dynamics and Complexity equips readers to appreciate this increasingly main-stream approach to understanding complex phenomena in nonlinear systems as they are examined in a broad array of disciplines. The book facilitates a better understanding of the mechanisms and phenomena in nonlinear dynamics and develops the corresponding mathematical theory to apply nonlinear design to practical engineering.

  10. Stabilization of vortex beams in Kerr media by nonlinear absorption

    Science.gov (United States)

    Porras, Miguel A.; Carvalho, Márcio; Leblond, Hervé; Malomed, Boris A.

    2016-11-01

    We elaborate a solution for the problem of stable propagation of transversely localized vortex beams in homogeneous optical media with self-focusing Kerr nonlinearity. Stationary nonlinear Bessel-vortex states are stabilized against azimuthal breakup and collapse by multiphoton absorption, while the respective power loss is offset by the radial influx of the power from an intrinsic reservoir. A linear stability analysis and direct numerical simulations reveal a region of stability of these vortices. Beams with multiple vorticities have their stability regions too. These beams can then form robust tubular filaments in transparent dielectrics as common as air, water, and optical glasses at sufficiently high intensities. We also show that the tubular, rotating, and specklelike filamentation regimes, previously observed in experiments with axicon-generated Bessel beams, can be explained as manifestations of the stability or instability of a specific nonlinear Bessel-vortex state, which is fully identified.

  11. Experimental Dynamic Analysis of Nonlinear Beams under Moving Loads

    Directory of Open Access Journals (Sweden)

    A. Bellino

    2012-01-01

    Full Text Available It is well known that nonlinear systems, as well as linear time-varying systems, are characterized by non-stationary response signals. In this sense, they both show natural frequencies that are not constant over time; this variation has however different origins: for a time-varying system the mass, and possibly the stiffness distributions, are changing over time, while for a nonlinear system the natural frequencies are amplitude-dependent. An interesting case of time-varying system occurs when analyzing the transit of a train over a railway bridge, easily simulated by the crossing of a moving load over a beam. In this case, the presence of a nonlinearity in the beam behaviour can cause a significant alteration of the modal parameters extracted from the linearized model, such that the contributions of the two effects are no more distinguishable.

  12. Nonlinear electron acoustic waves in presence of shear magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Dutta, Manjistha; Khan, Manoranjan [Department of Instrumentation Science, Jadavpur University, Kolkata 700 032 (India); Ghosh, Samiran [Department of Applied Mathematics, University of Calcutta 92, Acharya Prafulla Chandra Road, Kolkata 700 009 (India); Chakrabarti, Nikhil [Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)

    2013-12-15

    Nonlinear electron acoustic waves are studied in a quasineutral plasma in the presence of a variable magnetic field. The fluid model is used to describe the dynamics of two temperature electron species in a stationary positively charged ion background. Linear analysis of the governing equations manifests dispersion relation of electron magneto sonic wave. Whereas, nonlinear wave dynamics is being investigated by introducing Lagrangian variable method in long wavelength limit. It is shown from finite amplitude analysis that the nonlinear wave characteristics are well depicted by KdV equation. The wave dispersion arising in quasineutral plasma is induced by transverse magnetic field component. The results are discussed in the context of plasma of Earth's magnetosphere.

  13. Stabilization of vortex beams in Kerr media by nonlinear absorption

    CERN Document Server

    Porras, Miguel A; Leblond, Hervé; Malomed, Boris A

    2016-01-01

    We elaborate a new solution for the problem of stable propagation of transversely localized vortex beams in homogeneous optical media with self-focusing Kerr nonlinearity. Stationary nonlinear Bessel-vortex states are stabilized against azimuthal breakup and collapse by multiphoton absorption, while the respective power loss is offset by the radial influx of the power from an intrinsic reservoir. A linear stability analysis and direct numerical simulations reveal a region of stability of these vortices. Beams with multiple vorticities have their stability regions too. These beams can then form robust tubular filaments in transparent dielectrics as common as air, water and optical glasses at sufficiently high intensities. We also show that the tubular, rotating and speckle-like filamentation regimes, previously observed in experiments with axicon-generated Bessel beams, can be explained as manifestations of the stability or instability of a specific nonlinear Bessel-vortex state, which is fully identified.

  14. Free-vibration acoustic resonance of a nonlinear elastic bar

    Science.gov (United States)

    Tarumi, Ryuichi; Oshita, Yoshihito

    2011-02-01

    Free-vibration acoustic resonance of a one-dimensional nonlinear elastic bar was investigated by direct analysis in the calculus of variations. The Lagrangian density of the bar includes a cubic term of the deformation gradient, which is responsible for both geometric and constitutive nonlinearities. By expanding the deformation function into a complex Fourier series, we derived the action integral in an analytic form and evaluated its stationary conditions numerically with the Ritz method for the first three resonant vibration modes. This revealed that the bar shows the following prominent nonlinear features: (i) amplitude dependence of the resonance frequency; (ii) symmetry breaking in the vibration pattern; and (iii) excitation of the high-frequency mode around nodal-like points. Stability of the resonant vibrations was also addressed in terms of a convex condition on the strain energy density.

  15. Nonlinear Kramers equation associated with nonextensive statistical mechanics.

    Science.gov (United States)

    Mendes, G A; Ribeiro, M S; Mendes, R S; Lenzi, E K; Nobre, F D

    2015-05-01

    Stationary and time-dependent solutions of a nonlinear Kramers equation, as well as its associated nonlinear Fokker-Planck equations, are investigated within the context of Tsallis nonextensive statistical mechanics. Since no general analytical time-dependent solutions are found for such a nonlinear Kramers equation, an ansatz is considered and the corresponding asymptotic behavior is studied and compared with those known for the standard linear Kramers equation. The H-theorem is analyzed for this equation and its connection with Tsallis entropy is investigated. An application is discussed, namely the motion of Hydra cells in two-dimensional cellular aggregates, for which previous measurements have verified q-Gaussian distributions for velocity components and superdiffusion. The present analysis is in quantitative agreement with these experimental results.

  16. Testing and Inference in Nonlinear Cointegrating Vector Error Correction Models

    DEFF Research Database (Denmark)

    Kristensen, Dennis; Rahbek, Anders

    In this paper, we consider a general class of vector error correction models which allow for asymmetric and non-linear error correction. We provide asymptotic results for (quasi-)maximum likelihood (QML) based estimators and tests. General hypothesis testing is considered, where testing...... for linearity is of particular interest as parameters of non-linear components vanish under the null. To solve the latter type of testing, we use the so-called sup tests, which here requires development of new (uniform) weak convergence results. These results are potentially useful in general for analysis...... of non-stationary non-linear time series models. Thus the paper provides a full asymptotic theory for estimators as well as standard and non-standard test statistics. The derived asymptotic results prove to be new compared to results found elsewhere in the literature due to the impact of the estimated...

  17. Nonlinear transformation on the transfer entropy of financial time series

    Science.gov (United States)

    Wu, Zhenyu; Shang, Pengjian

    2017-09-01

    Transfer entropy (TE) now is widely used in the data mining and economic field. However, TE itself demands that time series intend to be stationary and meet Markov condition. Naturally, we are interested in investigating the effect of the nonlinear transformation of the two series on the TE. Therefore, the paper is designed to study the TE of five nonlinear ;volatile; transformations based on the data which are generated by the linear modeling and the logistic maps modeling, as well as the dataset that come from financial markets. With only one of the TE of nonlinear transformations fluctuating around the TE of original series, the TE of others all have increased with different degrees.

  18. An Analytical Approximation Method for Strongly Nonlinear Oscillators

    Directory of Open Access Journals (Sweden)

    Wang Shimin

    2012-01-01

    Full Text Available An analytical method is proposed to get the amplitude-frequency and the phase-frequency characteristics of free/forced oscillators with nonlinear restoring force. The nonlinear restoring force is expressed as a spring with varying stiffness that depends on the vibration amplitude. That is, for stationary vibration, the restoring force linearly depends on the displacement, but the stiffness of the spring varies with the vibration amplitude for nonstationary oscillations. The varied stiffness is constructed by means of the first and second averaged derivatives of the restoring force with respect to the displacement. Then, this stiffness gives the amplitude frequency and the phase frequency characteristics of the oscillator. Various examples show that this method can be applied extensively to oscillators with nonlinear restoring force, and that the solving process is extremely simple.

  19. AcEST: BP916793 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SC complexes subunit ssr2 OS=S... 66 6e-14 sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidops...... 65 1e-12 sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidops... 66 2e-12 sp|P97496|SMRC1_MOU...2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidops... 59 9e-09 sp|Q8W475|SWI3A_ARATH SWI/SNF complex s...ional adapter ADA2 OS=Oryza sati... 47 3e-05 sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidops...... 45 2e-04 sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidops... 44 3e-04 sp|Q5ZJF3|TAD2A_C

  20. Modeling AC ripple currents in HTS coated conductors by integral equations

    Science.gov (United States)

    Grilli, Francesco; Xu, Zhihan

    2016-12-01

    In several HTS applications, the superconducting tapes experience the simultaneous presence of DC and AC excitations. For example in high-current DC cables, where the transport current is not perfectly constant, but it exhibits some ripples at different frequencies introduced by the rectification process (AC-DC conversion). These ripples give rise to dissipation, whose magnitude and possible influence on the device's cooling requirements need to be evaluated. Here we report a study of the AC losses in a HTS coated conductor subjected to DC currents and AC ripples simultaneously. The modeling approach is based on an integral equation method for thin superconductors: the superconducting tape is modeled as a 1-D object with a non-linear resistivity, which includes the dependence of the critical current density Jc on the magnetic field. The model, implemented in a commercial finite-element program, runs very fast (the simulation of one AC cycle typically takes a few seconds on standard desktop workstation): this allows simulating a large number of cycles and estimating when the AC ripple losses stabilize to a constant value. The model is used to study the influence of the flux creep power index n on the stabilization speed and on the AC loss values, as well as the effect of using a field-dependent Jc instead of a constant one. The simulations confirm that the dissipation level should not be a practical concern in HTS DC cables. At the same time, however, they reveal a strong dependence of the results upon the power index n and the form of Jc , which spurs the question whether the power-law is the most suitable description of the superconductor's electrical behavior for this kind of analysis.

  1. Study of plasmonic slot waveguides with a nonlinear metamaterial core: semi-analytical and numerical methods

    Science.gov (United States)

    Elsawy, Mahmoud M. R.; Renversez, Gilles

    2017-07-01

    Two distinct models are developed to investigate the transverse magnetic stationary solutions propagating in one-dimensional anisotropic nonlinear plasmonic structures made from a Kerr-type nonlinear metamaterial core embedded between two semi-infinite metal claddings. The first model is semi-analytical, in which we assume that the anisotropic nonlinearity depends only on the transverse component of the electric field and that the nonlinear refractive index modification is small compared to the linear one. This method allows us to derive analytically the field profiles and nonlinear dispersion relations in terms of the Jacobi elliptical functions. The second model is fully numerical and is based on the finite element method in which all the components of the electric field are considered in the Kerr-type nonlinearity, with no presumptions as to the nonlinear refractive index change. Our finite-element-based model is valid beyond the weak nonlinearity regime and generalizes the well-known single-component fixed power algorithm that is usually used. Examples of the main cases are investigated, including those with strong spatial nonlinear effects at low power. Loss issues are reduced through the use of a gain medium in the nonlinear metamaterial core. Using anisotropic nonlinear FDTD simulations, we provide some results for the properties of the main solution.

  2. Power Spectral Density Conversions and Nonlinear Dynamics

    Directory of Open Access Journals (Sweden)

    Mostafa Rassaian

    1994-01-01

    Full Text Available To predict the vibration environment of a payload carried by a ground or air transporter, mathematical models are required from which a transfer function to a prescribed input can be calculated. For sensitive payloads these models typically include linear shock isolation system stiffness and damping elements relying on the assumption that the isolation system has a predetermined characteristic frequency and damping ratio independent of excitation magnitude. In order to achieve a practical spectral analysis method, the nonlinear system has to be linearized when the input transportation and handling vibration environment is in the form of an acceleration power spectral density. Test data from commercial isolators show that when nonlinear stiffness and damping effects exist the level of vibration input causes a variation in isolator resonant frequency. This phenomenon, described by the stationary response of the Duffing oscillator to narrow-band Gaussian random excitation, requires an alternative approach for calculation of power spectral density acceleration response at a shock isolated payload under random vibration. This article details the development of a plausible alternative approach for analyzing the spectral response of a nonlinear system subject to random Gaussian excitations.

  3. Stationary and oscillatory flow through coarse porous media

    NARCIS (Netherlands)

    Van Gent, M.R.A.

    1993-01-01

    Measurements in a U-tube tunnel were carried out to study flow through coarse granular material. Tests with stationary flow and tests with oscillatory flow were done to study the differences between both. The coefficients from the extended Forchheimer equation, which is supposed to describe non-stat

  4. 49 CFR 325.59 - Measurement procedure; stationary test.

    Science.gov (United States)

    2010-10-01

    ... made of the sound level generated by a stationary motor vehicle as follows: (a) Park the motor vehicle on the test site as specified in § 325.53 of this subpart. If the motor vehicle is a combination (articulated) vehicle, park the combination so that the longitudinal centerlines of the towing vehicle and...

  5. Global equilibrium and local thermodynamics in stationary spacetimes

    CERN Document Server

    Panerai, R

    2015-01-01

    In stationary spacetimes global equilibrium states can be defined, applying the maximum entropy principle, by the introduction of local thermodynamic fields determined solely by geometry. As an example, we study a class of equilibrium states for a scalar field in the Einstein's static universe, characterized by inhomogeneous thermodynamic properties and non-vanishing angular momentum.

  6. Fusing Heterogeneous Data for Detection Under Non-stationary Dependence

    Science.gov (United States)

    2012-07-01

    In this paper, we consider the problem of detection for dependent, non-stationary signals where the non-stationarity is encoded in the dependence ...allows for a more general description of inter-sensor dependence . We design a copula-based detector using the Neyman-Pearson framework. Our approach

  7. On the generation techniques of axially symmetric stationary metrics

    Indian Academy of Sciences (India)

    S Chaudhuri

    2002-03-01

    In the present paper, a relationship between the method of Gutsunaev–Manko and the soliton technique (for two-soliton solutions) of Belinskii–Zakharov, for generating solutions of axially symmetric stationary space-times in general relativity is discussed.

  8. Convective heat transfer measurement involving flow past stationary circular disks

    Energy Technology Data Exchange (ETDEWEB)

    Wedekind, G.L. (Oakland Univ., Rochester, MI (United States))

    1989-11-01

    Considerable empirical data exist in the literature for forced convection heat transfer involving external flow over a variety of geometries, and for various ranges of Reynolds number. This author is not aware of any published empirical data for forced convection heat transfer involving flow past a simple stationary circular disk, whose axis is perpendicular to the flow. Such is the purpose of this paper.

  9. Slow Sphering to Suppress Non-Stationaries in the EEG

    NARCIS (Netherlands)

    Reuderink, Boris; Farquhar, Jason; Poel, Mannes

    2011-01-01

    Non-stationary signals are ubiquitous in electroencephalogram (EEG) signals and pose a problem for robust application of brain-computer interfaces (BCIs). These non-stationarities can be caused by changes in neural background activity. We present a dynamic spatial filter based on time local whitenin

  10. Stationary space-periodic structures with equal diffusion coefficients

    DEFF Research Database (Denmark)

    Andresen, Peter Ragnar; Bache, Morten; Mosekilde, Erik;

    1999-01-01

    The paper investigates a chemical reaction-diffusion model in an open flow system. It is shown that such a system may, with particular boundary conditions, exhibit stationary space-periodic structures even in the case of equal diffusion coefficients. This is confirmed through numerical simulations....

  11. Ceramic stationary gas turbine development. Final report, Phase 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-09-01

    This report summarizes work performed by Solar Turbines Inc. and its subcontractors during the period September 25, 1992 through April 30, 1993. The objective of the work is to improve the performance of stationary gas turbines in cogeneration through implementation of selected ceramic components.

  12. Detection of Multiple Stationary Humans Using UWB MIMO Radar

    Directory of Open Access Journals (Sweden)

    Fulai Liang

    2016-11-01

    Full Text Available Remarkable progress has been achieved in the detection of single stationary human. However, restricted by the mutual interference of multiple humans (e.g., strong sidelobes of the torsos and the shadow effect, detection and localization of the multiple stationary humans remains a huge challenge. In this paper, ultra-wideband (UWB multiple-input and multiple-output (MIMO radar is exploited to improve the detection performance of multiple stationary humans for its multiple sight angles and high-resolution two-dimensional imaging capacity. A signal model of the vital sign considering both bi-static angles and attitude angle of the human body is firstly developed, and then a novel detection method is proposed to detect and localize multiple stationary humans. In this method, preprocessing is firstly implemented to improve the signal-to-noise ratio (SNR of the vital signs, and then a vital-sign-enhanced imaging algorithm is presented to suppress the environmental clutters and mutual affection of multiple humans. Finally, an automatic detection algorithm including constant false alarm rate (CFAR, morphological filtering and clustering is implemented to improve the detection performance of weak human targets affected by heavy clutters and shadow effect. The simulation and experimental results show that the proposed method can get a high-quality image of multiple humans and we can use it to discriminate and localize multiple adjacent human targets behind brick walls.

  13. Robust Forecasting of Non-Stationary Time Series

    NARCIS (Netherlands)

    Croux, C.; Fried, R.; Gijbels, I.; Mahieu, K.

    2010-01-01

    This paper proposes a robust forecasting method for non-stationary time series. The time series is modelled using non-parametric heteroscedastic regression, and fitted by a localized MM-estimator, combining high robustness and large efficiency. The proposed method is shown to produce reliable foreca

  14. Non-stationary condition monitoring through event alignment

    DEFF Research Database (Denmark)

    Pontoppidan, Niels Henrik; Larsen, Jan

    2004-01-01

    . In this paper we apply the technique for non-stationary condition monitoring of large diesel engines based on acoustical emission sensor signals. The performance of the event alignment is analyzed in an unsupervised probabilistic detection framework based on outlier detection with either Principal Component...

  15. Hawking radiation via tunnelling from general stationary axisymmetric black holes

    Institute of Scientific and Technical Information of China (English)

    Zhang Jing-Yi; Fan Jun-Hui

    2007-01-01

    Hawking radiation is viewed as a tunnelling process. In this way the emission rates of massless particles and massive particles tunnelling across the event horizon of general stationary axisymmetric black holes are calculated,separately. The emission spectra of these two different kinds of outgoing particles have the same functional form and both are consistent with an underlying unitary theory.

  16. Bipower variation for Gaussian processes with stationary increments

    DEFF Research Database (Denmark)

    Barndorff-Nielsen, Ole Eiler; Corcuera, José Manuel; Podolskij, Mark

    2009-01-01

    Convergence in probability and central limit laws of bipower variation for Gaussian processes with stationary increments and for integrals with respect to such processes are derived. The main tools of the proofs are some recent powerful techniques of Wiener/Itô/Malliavin calculus for establishing...

  17. Stationary Engineering, Environmental Control, Refrigeration. Science Manual I.

    Science.gov (United States)

    Steingress, Frederick M.; And Others

    The student materials present lessons about occupations related to environmental control, stationary engineering, and refrigeration. Included are 18 units organized by objective, information, reference, procedure, and assignment. Each lesson involves concrete trade experience where science is applied. Unit titles are: safety and housekeeping,…

  18. Interdecadal change of atmospheric stationary waves and North China drought

    Institute of Scientific and Technical Information of China (English)

    Dai Xin-Gang; Fu Cong-Bin; Wang Ping

    2005-01-01

    The inderdecadal change of atmospheric stationary waves (ATW) has been investigated for the two periods 1956-77 and 1978-99. The trough of ATW in the middle and low layer of the troposphere over the Asian continent has experienced a significant weakening during the past two decades, which exerts a great influence on the North China climate. The ATW in 200 hPa has also exhibited some changes since 1977, as a stationary ridge appeared over the northwestern China while a stationary trough appeared above North China. This leads to an increasing of the upward motion above northwestern China and a decreasing above North China. A west-east section of the stationary waves at 40°N shows that the ATW above North China tilted westward for the period 1956-77, but was almost upright during 1978-99. The composite analysis confirms that the climate mean ATW pattern after 1977 is similar to the dry pattern for North China, while the rainy pattern is similar to that before 1977. In consequence, the North China drought is partly due to the interdecadal change of the ATW over boreal Asia in the recent two decades.

  19. Scaling in Non-stationary time series I

    CERN Document Server

    Ignaccolo, M; Grigolini, P; Hamilton, P; West, B J

    2003-01-01

    Most data processing techniques, applied to biomedical and sociological time series, are only valid for random fluctuations that are stationary in time. Unfortunately, these data are often non stationary and the use of techniques of analysis resting on the stationary assumption can produce a wrong information on the scaling, and so on the complexity of the process under study. Herein, we test and compare two techniques for removing the non-stationary influences from computer generated time series, consisting of the superposition of a slow signal and a random fluctuation. The former is based on the method of wavelet decomposition, and the latter is a proposal of this paper, denoted by us as step detrending technique. We focus our attention on two cases, when the slow signal is a periodic function mimicking the influence of seasons, and when it is an aperiodic signal mimicking the influence of a population change (increase or decrease). For the purpose of computational simplicity the random fluctuation is taken...

  20. Luciferase detection during stationary phase in Lactococcus lactis

    NARCIS (Netherlands)

    Bachmann, H.; Santos, dos F.; Kleerebezem, M.; Hylckama Vlieg, van J.E.T.

    2007-01-01

    The luminescence signal of luxAB-encoded bacterial luciferase strongly depends on the metabolic state of the host cell, which restricts the use of this reporter system to metabolically active bacteria. Here we show that in stationary-phase cells of Lactococcus lactis, detection of luciferase is sign

  1. No hair theorems for a static and stationary reflecting star

    Science.gov (United States)

    Bhattacharjee, Srijit; Sarkar, Sudipta

    2017-04-01

    We prove the nonexistence of massive scalar, vector and tensor hairs outside the surface of a static and stationary compact reflecting star. Our result is the extension of the no-hair theorem for black holes to horizonless compact configurations with reflecting boundary condition at the surface. We also generalize the proof for spacetimes with a positive cosmological constant.

  2. Stationary axisymmetric spacetimes with a conformally coupled scalar field

    CERN Document Server

    Astorino, Marco

    2014-01-01

    Solution generating techniques for general relativity with a conformally (and minimally) coupled scalar field are pushed forward to build a wide class of asymptotically flat, axisymmetric and stationary spacetimes continuously connected to Kerr. This family contains, amongst other things, rotating extensions of the BBMB black hole and also its angular and mass multipolar generalisations. Further addition of NUT charge is also discussed.

  3. Non-linear dynamo waves in an incompressible medium when the turbulence dissipative coefficients depend on temperature

    Directory of Open Access Journals (Sweden)

    A. D. Pataraya

    Full Text Available Non-linear α-ω; dynamo waves existing in an incompressible medium with the turbulence dissipative coefficients depending on temperature are studied in this paper. We investigate of α-ω solar non-linear dynamo waves when only the first harmonics of magnetic induction components are included. If we ignore the second harmonics in the non-linear equation, the turbulent magnetic diffusion coefficient increases together with the temperature, the coefficient of turbulent viscosity decreases, and for an interval of time the value of dynamo number is greater than 1. In these conditions a stationary solution of the non-linear equation for the dynamo wave's amplitude exists; meaning that the magnetic field is sufficiently excited. The amplitude of the dynamo waves oscillates and becomes stationary. Using these results we can explain the existence of Maunder's minimum.

  4. Validity of purchasing power parity for selected Latin American countries: Linear and non-linear unit root tests

    Directory of Open Access Journals (Sweden)

    Claudio Roberto Fóffano Vasconcelos

    2016-01-01

    Full Text Available The aim of this study is to examine empirically the validity of PPP in the context of unit root tests based on linear and non-linear models of the real effective exchange rate of Argentina, Brazil, Chile, Colombia, Mexico, Peru and Venezuela. For this purpose, we apply the Harvey et al. (2008 linearity test and the non-linear unit root test (Kruse, 2011. The results show that the series with linear characteristics are Argentina, Brazil, Chile, Colombia and Peru and those with non-linear characteristics are Mexico and Venezuela. The linear unit root tests indicate that the real effective exchange rate is stationary for Chile and Peru, and the non-linear unit root tests evidence that Mexico is stationary. In the period analyzed, the results show support for the validity of PPP in only three of the seven countries.

  5. Nonlinear Elliptic Differential Equations with Multivalued Nonlinearities

    Indian Academy of Sciences (India)

    Antonella Fiacca; Nikolaos Matzakos; Nikolaos S Papageorgiou; Raffaella Servadei

    2001-11-01

    In this paper we study nonlinear elliptic boundary value problems with monotone and nonmonotone multivalued nonlinearities. First we consider the case of monotone nonlinearities. In the first result we assume that the multivalued nonlinearity is defined on all $\\mathbb{R}$. Assuming the existence of an upper and of a lower solution, we prove the existence of a solution between them. Also for a special version of the problem, we prove the existence of extremal solutions in the order interval formed by the upper and lower solutions. Then we drop the requirement that the monotone nonlinearity is defined on all of $\\mathbb{R}$. This case is important because it covers variational inequalities. Using the theory of operators of monotone type we show that the problem has a solution. Finally in the last part we consider an eigenvalue problem with a nonmonotone multivalued nonlinearity. Using the critical point theory for nonsmooth locally Lipschitz functionals we prove the existence of at least two nontrivial solutions (multiplicity theorem).

  6. A method of adaptive wavelet filtering of the peripheral blood flow oscillations under stationary and non-stationary conditions.

    Science.gov (United States)

    Tankanag, Arina V; Chemeris, Nikolay K

    2009-10-01

    The paper describes an original method for analysis of the peripheral blood flow oscillations measured with the laser Doppler flowmetry (LDF) technique. The method is based on the continuous wavelet transform and adaptive wavelet theory and applies an adaptive wavelet filtering to the LDF data. The method developed allows one to examine the dynamics of amplitude oscillations in a wide frequency range (from 0.007 to 2 Hz) and to process both stationary and non-stationary short (6 min) signals. The capabilities of the method have been demonstrated by analyzing LDF signals registered in the state of rest and upon humeral occlusion. The paper shows the main advantage of the method proposed, which is the significant reduction of 'border effects', as compared to the traditional wavelet analysis. It was found that the low-frequency amplitudes obtained by adaptive wavelets are significantly higher than those obtained by non-adaptive ones. The method suggested would be useful for the analysis of low-frequency components of the short-living transitional processes under the conditions of functional tests. The method of adaptive wavelet filtering can be used to process stationary and non-stationary biomedical signals (cardiograms, encephalograms, myograms, etc), as well as signals studied in the other fields of science and engineering.

  7. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  8. Nonlinear Magneto-optical Rotation via Alignment-to-Orientation Conversion

    Energy Technology Data Exchange (ETDEWEB)

    Budker, D.; Kimball, D.F.; Rochester, S.M.; Yashchuk, V.V.

    2000-03-10

    Nonlinear magneto-optical rotation (NMOR) is investigated at highlight powers where the rotation is significantly modified by AC Stark shifts. These shifts are shown to change the overall sign of rotation for closed F-->F+1 transitions as light power is increased. The effect is demonstrated by measurements in rubidium and density matrix calculations. The results are important for applications of nonlinear optical rotation such as sensitive magnetometry.

  9. Relation between current sheets and vortex sheets in stationary incompressible MHD

    Directory of Open Access Journals (Sweden)

    D. H. Nickeler

    2012-03-01

    Full Text Available Magnetohydrodynamic configurations with strong localized current concentrations and vortices play an important role in the dissipation of energy in space and astrophysical plasma. Within this work we investigate the relation between current sheets and vortex sheets in incompressible, stationary equilibria. For this approach it is helpful that the similar mathematical structure of magnetohydrostatics and stationary incompressible hydrodynamics allows us to transform static equilibria into stationary ones. The main control function for such a transformation is the profile of the Alfvén-Mach number MA, which is always constant along magnetic field lines, but can change from one field line to another. In the case of a global constant MA, vortices and electric current concentrations are parallel. More interesting is the nonlinear case, where MA varies perpendicular to the field lines. This is a typical situation at boundary layers like the magnetopause, heliopause, the solar wind flowing around helmet streamers and at the boundary of solar coronal holes. The corresponding current and vortex sheets show in some cases also an alignment, but not in every case. For special density distributions in 2-D, it is possible to have current but no vortex sheets. In 2-D, vortex sheets of field aligned-flows can also exist without strong current sheets, taking the limit of small Alfvén Mach numbers into account. The current sheet can vanish if the Alfvén Mach number is (almost constant and the density gradient is large across some boundary layer. It should be emphasized that the used theory is not only valid for small Alfvén Mach numbers MA << 1, but also for MA ≲ 1. Connection to other theoretical approaches and observations and physical effects in space plasmas are presented. Differences in the various aspects of theoretical investigations of current sheets and vortex

  10. Nonlinear regimes on polygonal hydraulic jumps

    Science.gov (United States)

    Rojas, Nicolas

    2016-11-01

    This work extends previous leading and higher order results on the polygonal hydraulic jump in the framework of inertial lubrication theory. The rotation of steady polygonal jumps is observed in the transition from one wavenumber to the next one, induced by a change in height of an external obstacle near the outer edge. In a previous publication, the study of stationary polygons is considered under the assumption that the reference frame rotates with the polygons when the number of corners change, in order to preserve their orientation. In this research work I provide a Hamiltonian approach and the stability analysis of the nonlinear oscillator that describe the polygonal structures at the jump interface, in addition to a perturbation method that enables to explain, for instance, the diversity of patterns found in experiments. GRASP, Institute of Physics, University of Liege, Belgium.

  11. Wave-kinetic description of nonlinear photons

    CERN Document Server

    Marklund, M; Brodin, G; Stenflo, L

    2004-01-01

    The nonlinear interaction, due to quantum electrodynamical (QED) effects, between photons is investigated using a wave-kinetic description. Starting from a coherent wave description, we use the Wigner transform technique to obtain a set of wave-kinetic equations, the so called Wigner-Moyal equations. These equations are coupled to a background radiation fluid, whose dynamics is determined by an acoustic wave equation. In the slowly varying acoustic limit, we analyse the resulting system of kinetic equations, and show that they describe instabilities, as well as Landau-like damping. The instabilities may lead to break-up and focusing of ultra-high intensity multi-beam systems, which in conjunction with the damping may result in stationary strong field structures. The results could be of relevance for the next generation of laser-plasma systems.

  12. Nonlinear dynamics of electron-positron clusters

    CERN Document Server

    Manfredi, Giovanni; Haas, Fernando; 10.1088/1367-2630/14/7/075012

    2012-01-01

    Electron-positron clusters are studied using a quantum hydrodynamic model that includes Coulomb and exchange interactions. A variational Lagrangian method is used to determine their stationary and dynamical properties. The cluster static features are validated against existing Hartree-Fock calculations. In the linear response regime, we investigate both dipole and monopole (breathing) modes. The dipole mode is reminiscent of the surface plasmon mode usually observed in metal clusters. The nonlinear regime is explored by means of numerical simulations. We show that, by exciting the cluster with a chirped laser pulse with slowly varying frequency (autoresonance), it is possible to efficiently separate the electron and positron populations on a timescale of a few tens of femtoseconds.

  13. Online prediction and control in nonlinear stochastic systems

    DEFF Research Database (Denmark)

    Nielsen, Torben Skov

    2002-01-01

    of systems which are inherently non-stationary. The third part concerns the issue of predicting the power production from wind turbines in the presence of Numerical Weather Predictions (NWP) of selected climatical variables. Here the transformation through the wind turbines from (primarily) wind speed....... The papers G , H and J investigate models and methods for predicting wind power from a wind farm on basis of observations and numerical weather predictions. All three papers consider multistep prediction models, but uses di erent estimation methods as well as dierent models for the diurnal variation of wind......The present thesis consists of a summary report and ten research papers. The subject of the thesis is on-line prediction and control of non-linear and non-stationary systems based on stochastic modelling. The thesis consists of three parts where the rst part deals with on-line estimation in linear...

  14. Nonlinear Dirac Equations

    Directory of Open Access Journals (Sweden)

    Wei Khim Ng

    2009-02-01

    Full Text Available We construct nonlinear extensions of Dirac's relativistic electron equation that preserve its other desirable properties such as locality, separability, conservation of probability and Poincaré invariance. We determine the constraints that the nonlinear term must obey and classify the resultant non-polynomial nonlinearities in a double expansion in the degree of nonlinearity and number of derivatives. We give explicit examples of such nonlinear equations, studying their discrete symmetries and other properties. Motivated by some previously suggested applications we then consider nonlinear terms that simultaneously violate Lorentz covariance and again study various explicit examples. We contrast our equations and construction procedure with others in the literature and also show that our equations are not gauge equivalent to the linear Dirac equation. Finally we outline various physical applications for these equations.

  15. Approximation of the solution of certain nonlinear ODEs with linear complexity

    Science.gov (United States)

    Dratman, Ezequiel

    2010-03-01

    We study the positive stationary solutions of a standard finite-difference discretization of the semilinear heat equation with nonlinear Neumann boundary conditions. We prove that there exists a unique solution of such a discretization, which approximates the unique positive stationary solution of the "continuous" equation. Furthermore, we exhibit an algorithm computing an [epsilon]-approximation of such a solution by means of a homotopy continuation method. The cost of our algorithm is linear in the number of nodes involved in the discretization and the logarithm of the number of digits of approximation required.

  16. Modeling and Backstepping-based Nonlinear Control Strategy for a 6 DOF Quadrotor Helicopter

    Institute of Scientific and Technical Information of China (English)

    Ashfaq Ahmad Mian; Wang Daobo

    2008-01-01

    In this article,a nonlinear model of an underactuated six degrees of freedom (6 DOF) quadrotor helicopter is derived on the basis of the Newton-Euler formalism.The derivation comprises determining equations of the motion of the quadrotor in three dimensions andapproximating the actuation forces through the modeling of aerodynamic coefficients and electric motor dynamics.The derived modelcomposed of translatioual and rotational subsystems is dynamically unstable,so a sequential nonlinear control strategy is used.The con-trol strategy includes feedback linearization coupled with a PD controller for the translational subsystem and a backstepping-based PID nonlinear controller for the rotational subsystem of the quadrotor.The performances of the nonlinear control method are evaluated by nonlinear simulation and the results demonstrate the effectiveness of the proposed control strategy for the quadrotor helicopter inquasi-stationary flights.

  17. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  18. Nonlinear Cross Gramians

    Science.gov (United States)

    Ionescu, Tudor C.; Scherpen, Jacquelien M. A.

    We study the notion of cross Gramians for nonlinear gradient systems, using the characterization in terms of prolongation and gradient extension associated to the system. The cross Gramian is given for the variational system associated to the original nonlinear gradient system. We obtain linearization results that correspond to the notion of a cross Gramian for symmetric linear systems. Furthermore, first steps towards relations with the singular value functions of the nonlinear Hankel operator are studied and yield promising results.

  19. Nonlinear functional analysis

    Directory of Open Access Journals (Sweden)

    W. L. Fouché

    1983-03-01

    Full Text Available In this article we discuss some aspects of nonlinear functional analysis. It included reviews of Banach’s contraction theorem, Schauder’s fixed point theorem, globalising techniques and applications of homotopy theory to nonlinear functional analysis. The author emphasises that fundamentally new ideas are required in order to achieve a better understanding of phenomena which contain both nonlinear and definite infinite dimensional features.

  20. Nonlinear Electrodynamics and QED

    OpenAIRE

    2003-01-01

    The limits of linear electrodynamics are reviewed, and possible directions of nonlinear extension are explored. The central theme is that the qualitative character of the empirical successes of quantum electrodynamics must be used as a guide for understanding the nature of the nonlinearity of electrodynamics at the subatomic level. Some established theories of nonlinear electrodynamics, namely, those of Mie, Born, and Infeld are presented in the language of the modern geometrical and topologi...

  1. Heat-transfer characteristics of flowing and stationary particle-bed-type fusion-reactor blankets

    Energy Technology Data Exchange (ETDEWEB)

    Nietert, R.E.

    1983-02-01

    The following five appendices are included: (1) physical properties of materials, (2) thermal entrance length Nusselt number variations, (3) stationary particle bed temperature variations, (4) falling bed experimental data and calculations, and (5) stationary bed experimental data and calculations. (MOW)

  2. Gas chromatography on wall-coated open-tubular columns with ionic liquid stationary phases.

    Science.gov (United States)

    Poole, Colin F; Lenca, Nicole

    2014-08-29

    Ionic liquids have moved from novel to practical stationary phases for gas chromatography with an increasing portfolio of applications. Ionic liquids complement conventional stationary phases because of a combination of thermophysical and solvation properties that only exist for ionic solvents. Their high thermal stability and low vapor pressure makes them suitable as polar stationary phases for separations requiring high temperatures. Ionic liquids are good solvents and can be used to expand the chemical space for separations. They are the only stationary phases with significant hydrogen-bond acidity in common use; they extend the hydrogen-bond basicity of conventional stationary phases; they are as dipolar/polarizable as the most polar conventional stationary phases; and some ionic liquids are significantly less cohesive than conventional polar stationary phases. Problems in column coating techniques and related low column performance, column activity, and stationary phase reactivity require further exploration as the reasons for these features are poorly understood at present.

  3. Nonlinear Physics of Plasmas

    CERN Document Server

    Kono, Mitsuo

    2010-01-01

    A nonlinearity is one of the most important notions in modern physics. A plasma is rich in nonlinearities and provides a variety of behaviors inherent to instabilities, coherent wave structures and turbulence. The book covers the basic concepts and mathematical methods, necessary to comprehend nonlinear problems widely encountered in contemporary plasmas, but also in other fields of physics and current research on self-organized structures and magnetized plasma turbulence. The analyses make use of strongly nonlinear models solved by analytical techniques backed by extensive simulations and available experiments. The text is written for senior undergraduates, graduate students, lecturers and researchers in laboratory, space and fusion plasmas.

  4. Nonlinear magnetic metamaterials.

    Science.gov (United States)

    Shadrivov, Ilya V; Kozyrev, Alexander B; van der Weide, Daniel W; Kivshar, Yuri S

    2008-12-08

    We study experimentally nonlinear tunable magnetic metamaterials operating at microwave frequencies. We fabricate the nonlinear metamaterial composed of double split-ring resonators where a varactor diode is introduced into each resonator so that the magnetic resonance can be tuned dynamically by varying the input power. We demonstrate that at higher powers the transmission of the metamaterial becomes power-dependent and, as a result, such metamaterial can demonstrate various nonlinear properties. In particular, we study experimentally the power-dependent shift of the transmission band and demonstrate nonlinearity-induced enhancement (or suppression) of wave transmission. (c) 2008 Optical Society of America

  5. Organic nonlinear optical materials

    Science.gov (United States)

    Umegaki, S.

    1987-01-01

    Recently, it became clear that organic compounds with delocalized pi electrons show a great nonlinear optical response. Especially, secondary nonlinear optical constants of more than 2 digits were often seen in the molecular level compared to the existing inorganic crystals such as LiNbO3. The crystallization was continuously tried. Organic nonlinear optical crystals have a new future as materials for use in the applied physics such as photomodulation, optical frequency transformation, opto-bistabilization, and phase conjugation optics. Organic nonlinear optical materials, e.g., urea, O2NC6H4NH2, I, II, are reviewed with 50 references.

  6. Nonlinearity-reduced interferometer

    Science.gov (United States)

    Wu, Chien-ming

    2007-12-01

    Periodic nonlinearity is a systematic error limiting the accuracy of displacement measurements at the nanometer level. It results from many causes such as the frequency mixing, polarization mixing, polarization-frequency mixing, and the ghost reflections. An interferometer having accuracy in displacement measurement of less than one-nanometer is necessary in nanometrology. To meet the requirement, the periodic nonlinearity should be less than deep sub-nanometer. In this paper, a nonlinearity-reduced interferometry has been proposed. Both the linear- and straightness-interferometer were tested. The developed interferometer demonstrated of a residual nonlinearity less than 25 pm.

  7. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  8. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  9. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  10. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  11. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  12. Electronic and structural effects on the nonlinear optical behavior in push-pull TTF/tricarbonyl chromiun arene complexes.

    Science.gov (United States)

    Insuasty, Braulio; Atienza, Carmen; Seoane, Carlos; Martín, Nazario; Garín, Javier; Orduna, Jesús; Alcalá, Rafael; Villacampa, Belén

    2004-10-15

    A novel D-pi-A system in which tetrathiafulvalene (TTF) and pi-extended TTFs as strong electron donors are covalently connected to a tricarbonyl (eta(6)-arene)chromium complex as the acceptor moiety through a systematically increased conjugated bridge of vinylene units (12a-c, 16a-c) have been synthesized by Wittig-Horner olefination reaction. The electronic spectra as well as the electrochemical data reveal a different behavior of TTF derivatives (12a-c) and of exTTF derivatives (16a-c). Cyclic voltammetry shows the influence of the tricarbonylchromium arene on the oxidation potentials in compounds 12a-c, and no remarkable effect is observed for exTTFs (16a-c). The nonlinear optical properties of 12a-c and 16a-c have been calculated by using the ab initio CPHF/6-31G//B3P86/6-31G model, and the time-dependent density functional theory (TD-DFT) method has been used for the calculation of the electronic transitions. The calculations reveal that an intraligand charge-transfer transition (ILCT) and the metal to ligand charge-transfer transition (MLCT) are responsible for the nonlinear response. In addition, the large angles formed by the ground-state dipole moment and the vectorial hyperpolarizability are responsible for the mubeta values determined experimentally by the EFISH technique.

  13. Climate variance influence on the non-stationary plankton dynamics.

    Science.gov (United States)

    Molinero, Juan Carlos; Reygondeau, Gabriel; Bonnet, Delphine

    2013-08-01

    We examined plankton responses to climate variance by using high temporal resolution data from 1988 to 2007 in the Western English Channel. Climate variability modified both the magnitude and length of the seasonal signal of sea surface temperature, as well as the timing and depth of the thermocline. These changes permeated the pelagic system yielding conspicuous modifications in the phenology of autotroph communities and zooplankton. The climate variance envelope, thus far little considered in climate-plankton studies, is closely coupled with the non-stationary dynamics of plankton, and sheds light on impending ecological shifts and plankton structural changes. Our study calls for the integration of the non-stationary relationship between climate and plankton in prognostic models on the productivity of marine ecosystems.

  14. Stable photon orbits in stationary axisymmetric electrovacuum spacetimes

    Science.gov (United States)

    Dolan, Sam R.; Shipley, Jake O.

    2016-08-01

    We investigate the existence and phenomenology of stable photon orbits (SPOs) in stationary axisymmetric electrovacuum spacetimes in four dimensions. First, we review the classification of equatorial circular photon orbits on Kerr-Newman spacetimes in the charge-spin plane. Second, using a Hamiltonian formulation, we show that Reissner-Nordström diholes (a family encompassing the Majumdar-Papapetrou and Weyl-Bach special cases) admit SPOs, in a certain parameter regime that we investigate. Third, we explore the transition from order to chaos for typical SPOs bounded within a toroidal region around a dihole, via a selection of Poincaré sections. Finally, for general axisymmetric stationary spacetimes, we show that the Einstein-Maxwell field equations allow for the existence of SPOs in electro vacuum, but not in pure vacuum.

  15. Dynamical observations of self-stabilizing stationary light

    Science.gov (United States)

    Everett, J. L.; Campbell, G. T.; Cho, Y.-W.; Vernaz-Gris, P.; Higginbottom, D. B.; Pinel, O.; Robins, N. P.; Lam, P. K.; Buchler, B. C.

    2017-01-01

    The precise control of atom-light interactions is vital to many quantum technologies. For instance, atomic systems can be used to slow and store light, acting as a quantum memory. Optical storage can be achieved via stopped light, where no optical energy continues to exist in the atomic system, or as stationary light, where some optical energy remains present during storage. Here, we demonstrate a form of self-stabilizing stationary light. From any initial state, our atom-light system evolves to a stable configuration that may contain bright optical excitations trapped within the atomic ensemble. This phenomenon is verified experimentally in a cloud of cold Rb87 atoms. The spinwave in our atomic cloud is imaged from the side, allowing direct comparison with theoretical predictions.

  16. Gravitational and mass distribution effects on stationary superwinds

    CERN Document Server

    Añorve-Zeferino, Gabriel Alejandro

    2016-01-01

    Here, we model the effect of non-uniform dynamical mass distributions and their associated gravitational fields on the stationary galactic superwind solution. We do this by considering an analogue injection of mass and energy from stellar winds and SNe. We consider both compact dark-matter and baryonic haloes that does not extend further from the galaxies optical radii $R_{\\rm opt}$ as well as extended gravitationally-interacting ones. We consider halo profiles that emulate the results of recent cosmological simulations and coincide also with observational estimations from galaxy surveys. This allows to compare the analytical superwind solution with outflows from different kinds of galaxies. We give analytical formulae that establish when an outflow is possible and also characterize distinct flow regimes and enrichment scenarios. We also constraint the parameter space by giving approximate limits above which gravitation, self-gravitation and radiative cooling can inhibit the stationary flow. We obtain analyti...

  17. Stationary properties of maximum-entropy random walks.

    Science.gov (United States)

    Dixit, Purushottam D

    2015-10-01

    Maximum-entropy (ME) inference of state probabilities using state-dependent constraints is popular in the study of complex systems. In stochastic systems, how state space topology and path-dependent constraints affect ME-inferred state probabilities remains unknown. To that end, we derive the transition probabilities and the stationary distribution of a maximum path entropy Markov process subject to state- and path-dependent constraints. A main finding is that the stationary distribution over states differs significantly from the Boltzmann distribution and reflects a competition between path multiplicity and imposed constraints. We illustrate our results with particle diffusion on a two-dimensional landscape. Connections with the path integral approach to diffusion are discussed.

  18. Method of Infrared Image Enhancement Based on Stationary Wavelet Transform

    Institute of Scientific and Technical Information of China (English)

    QI Fei; LI Yan-jun; ZHANG Ke

    2008-01-01

    Aiming at the problem, i.e. infrared images own the characters of bad contrast ratio and fuzzy edges, a method to enhance the contrast of infrared image is given, which is based on stationary wavelet transform. After making stationary wavelet transform to an infrared image, denoising is done by the proposed method of double-threshold shrinkage in detail coefficient matrixes that have high noisy intensity. For the approximation coefficient matrix with low noisy intensity, enhancement is done by the proposed method based on histogram. The enhanced image can be got by wavelet coefficient reconstruction. Furthermore, an evaluation criterion of enhancement performance is introduced. The results show that this algorithm ensures target enhancement and restrains additive Gauss white noise effectively. At the same time, its amount of calculation is small and operation speed is fast.

  19. Learning in Non-Stationary Environments Methods and Applications

    CERN Document Server

    Lughofer, Edwin

    2012-01-01

    Recent decades have seen rapid advances in automatization processes, supported by modern machines and computers. The result is significant increases in system complexity and state changes, information sources, the need for faster data handling and the integration of environmental influences. Intelligent systems, equipped with a taxonomy of data-driven system identification and machine learning algorithms, can handle these problems partially. Conventional learning algorithms in a batch off-line setting fail whenever dynamic changes of the process appear due to non-stationary environments and external influences.   Learning in Non-Stationary Environments: Methods and Applications offers a wide-ranging, comprehensive review of recent developments and important methodologies in the field. The coverage focuses on dynamic learning in unsupervised problems, dynamic learning in supervised classification and dynamic learning in supervised regression problems. A later section is dedicated to applications in which dyna...

  20. Experimental and theoretical strain distributions for stationary and growing cracks

    Science.gov (United States)

    Gerberich, W. W.; Davidson, D. L.; Kaczorowski, M.

    E XPERIMENTAL strain distributions are determined very near the crack tip in Fe-3wt.%Si single crystals. Both in situ stereoimaging and electron channeling techniques give reasonably reproducible distributions. By growing fatigue cracks on a {100} cleavage plane, the singularity strengths have been determined for both growing and stationary cracks under relatively plane stress and plane strain conditions. This has allowed a comparison to existing theoretical models. It is shown that the HRR singularity (Hutchinson, Rice and Rosengren, 1968) for stationary cracks is very good to within I μm of the crack tip and a hardening model for the growing crack (gao and hwang, Advances in Fracture Research, edited by D. Francois. 5th Int. Conf. on Fracture, Cannes, France, 2, 669, 1981) is surprisingly good. Other issues such as fracture criteria are discussed since strains greater than unity were measured at the crack tip in this relatively brittle material.