Stationary nonlinear Airy beams
International Nuclear Information System (INIS)
Lotti, A.; Faccio, D.; Couairon, A.; Papazoglou, D. G.; Panagiotopoulos, P.; Tzortzakis, S.; Abdollahpour, D.
2011-01-01
We demonstrate the existence of an additional class of stationary accelerating Airy wave forms that exist in the presence of third-order (Kerr) nonlinearity and nonlinear losses. Numerical simulations and experiments, in agreement with the analytical model, highlight how these stationary solutions sustain the nonlinear evolution of Airy beams. The generic nature of the Airy solution allows extension of these results to other settings, and a variety of applications are suggested.
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
A nonlinear model for AC induced corrosion
Directory of Open Access Journals (Sweden)
N. Ida
2012-09-01
Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.
The Fourier decomposition method for nonlinear and non-stationary time series analysis.
Singh, Pushpendra; Joshi, Shiv Dutt; Patney, Rakesh Kumar; Saha, Kaushik
2017-03-01
for many decades, there has been a general perception in the literature that Fourier methods are not suitable for the analysis of nonlinear and non-stationary data. In this paper, we propose a novel and adaptive Fourier decomposition method (FDM), based on the Fourier theory, and demonstrate its efficacy for the analysis of nonlinear and non-stationary time series. The proposed FDM decomposes any data into a small number of 'Fourier intrinsic band functions' (FIBFs). The FDM presents a generalized Fourier expansion with variable amplitudes and variable frequencies of a time series by the Fourier method itself. We propose an idea of zero-phase filter bank-based multivariate FDM (MFDM), for the analysis of multivariate nonlinear and non-stationary time series, using the FDM. We also present an algorithm to obtain cut-off frequencies for MFDM. The proposed MFDM generates a finite number of band-limited multivariate FIBFs (MFIBFs). The MFDM preserves some intrinsic physical properties of the multivariate data, such as scale alignment, trend and instantaneous frequency. The proposed methods provide a time-frequency-energy (TFE) distribution that reveals the intrinsic structure of a data. Numerical computations and simulations have been carried out and comparison is made with the empirical mode decomposition algorithms.
DEFF Research Database (Denmark)
Péguin-Feissolle, Anne; Strikholm, Birgit; Teräsvirta, Timo
In this paper we propose a general method for testing the Granger noncausality hypothesis in stationary nonlinear models of unknown functional form. These tests are based on a Taylor expansion of the nonlinear model around a given point in the sample space. We study the performance of our tests b...
Stationary walking solitons in bulk quadratic nonlinear media
Mihalache, Dumitru; Mazilu, D; Crasonavn, L C; Torner Sabata, Lluís
1997-01-01
We study the mutual trapping of fundamental and second-harmonic light beams propagating in bulk quadratic nonlinear media in the presence of Poynting vector beam walk-off. We show numerically the existence of a two-parameter family of (2 + 1)-dimensional stationary, spatial walking solitons. We have found that the solitons exist at various values of material parameters with different wave intensities and soliton velocities. We discuss the differences between (2 + 1) and (1 + 1)-dimensional wa...
Stationary solutions and self-trapping in discrete quadratic nonlinear systems
DEFF Research Database (Denmark)
Bang, Ole; Christiansen, Peter Leth; Clausen, Carl A. Balslev
1998-01-01
We consider the simplest equations describing coupled quadratic nonlinear (chi((2))) systems, which each consists of a fundamental mode resonantly interacting with its second harmonic. Such discrete equations apply, e.g., to optics, where they can describe arrays of chi((2)) waveguides...... the nonintegrable dimer reduce to the discrete nonlinear Schrodinger (DNLS) equation with two degrees of freedom, which is integrable. We show how the stationary solutions to the two systems correspond to each other and how the self-trapped DNLS solutions gradually develop chaotic dynamics in the chi((2)) system...
Lan, Chunbo; Tang, Lihua; Harne, Ryan L.
2018-05-01
Nonlinear piezoelectric energy harvester (PEH) has been widely investigated during the past few years. Among the majority of these researches, a pure resistive load is used to evaluate power output. To power conventional electronics in practical application, the alternating current (AC) generated by nonlinear PEH needs to be transformed into a direct current (DC) and rectifying circuits are required to interface the device and electronic load. This paper aims at exploring the critical influences of AC and DC interface circuits on nonlinear PEH. As a representative nonlinear PEH, we fabricate and evaluate a monostable PEH in terms of generated power and useful operating bandwidth when it is connected to AC and DC interface circuits. Firstly, the harmonic balance analysis and equivalent circuit representation method are utilized to tackle the modeling of nonlinear energy harvesters connected to AC and DC interface circuits. The performances of the monostable PEH connected to these interface circuits are then analyzed and compared, focusing on the influences of the varying load, excitation and electromechanical coupling strength on the nonlinear dynamics, bandwidth and harvested power. Subsequently, the behaviors of the monostable PEH with AC and DC interface circuits are verified by experiment. Results indicate that both AC and DC interface circuits have a peculiar influence on the power peak shifting and operational bandwidth of the monostable PEH, which is quite different from that on the linear PEH.
DEFF Research Database (Denmark)
Köylüoglu, H. U.; Nielsen, Søren R. K.; Cakmak, A. S.
Geometrically non-linear multi-degree-of-freedom (MDOF) systems subject to random excitation are considered. New semi-analytical approximate forward difference equations for the lower order non-stationary statistical moments of the response are derived from the stochastic differential equations...... of motion, and, the accuracy of these equations is numerically investigated. For stationary excitations, the proposed method computes the stationary statistical moments of the response from the solution of non-linear algebraic equations....
DEFF Research Database (Denmark)
Lu, Xiaonan; Guerrero, Josep M.; Teodorescu, Remus
2011-01-01
With the penetration of renewable energy in modern power system, microgrid has become a popular application worldwide. In this paper, parallel-connected bidirectional converters for AC and DC hybrid microgrid application are proposed as an efficient interface. To reach the goal of bidirectional...... power conversion, both rectifier and inverter modes are analyzed. In order to achieve high performance operation, hierarchical control system is accomplished. The control system is designed in stationary frame, with harmonic compensation in parallel and no coupled terms between axes. In this control...
A review on prognostic techniques for non-stationary and non-linear rotating systems
Kan, Man Shan; Tan, Andy C. C.; Mathew, Joseph
2015-10-01
The field of prognostics has attracted significant interest from the research community in recent times. Prognostics enables the prediction of failures in machines resulting in benefits to plant operators such as shorter downtimes, higher operation reliability, reduced operations and maintenance cost, and more effective maintenance and logistics planning. Prognostic systems have been successfully deployed for the monitoring of relatively simple rotating machines. However, machines and associated systems today are increasingly complex. As such, there is an urgent need to develop prognostic techniques for such complex systems operating in the real world. This review paper focuses on prognostic techniques that can be applied to rotating machinery operating under non-linear and non-stationary conditions. The general concept of these techniques, the pros and cons of applying these methods, as well as their applications in the research field are discussed. Finally, the opportunities and challenges in implementing prognostic systems and developing effective techniques for monitoring machines operating under non-stationary and non-linear conditions are also discussed.
Nonlinear stationary solutions of the Wigner and Wigner-Poisson equations
Haas, F.; Shukla, P. K.
2008-01-01
Exact nonlinear stationary solutions of the one-dimensional Wigner and Wigner-Poisson equations in the terms of the Wigner functions that depend not only on the energy but also on position are presented. In this way, the Bernstein-Greene-Kruskal modes of the classical plasma are adapted for the quantum formalism in the phase space. The solutions are constructed for the case of a quartic oscillator potential, as well as for the self-consistent Wigner-Poisson case. Conditions for well-behaved p...
DEFF Research Database (Denmark)
Denisov, S.; Flach, S.; Ovchinnikov, A. A.
2002-01-01
We consider low-dimensional dynamical systems exposed to a heat bath and to additional ac fields. The presence of these ac fields may lead to a breaking of certain spatial or temporal symmetries, which in turn cause nonzero averages of relevant observables. Nonlinear (non)adiabatic response is em...... is employed to explain the effect. We consider a case of a particle in a periodic potential as an example and discuss the relevant symmetry breakings and the mechanisms of rectification of the current in such a system.......We consider low-dimensional dynamical systems exposed to a heat bath and to additional ac fields. The presence of these ac fields may lead to a breaking of certain spatial or temporal symmetries, which in turn cause nonzero averages of relevant observables. Nonlinear (non)adiabatic response...
Nonlinear stationary solutions of the Wigner and Wigner-Poisson equations
International Nuclear Information System (INIS)
Haas, F.; Shukla, P. K.
2008-01-01
Exact nonlinear stationary solutions of the one-dimensional Wigner and Wigner-Poisson equations in the terms of the Wigner functions that depend not only on the energy but also on position are presented. In this way, the Bernstein-Greene-Kruskal modes of the classical plasma are adapted for the quantum formalism in the phase space. The solutions are constructed for the case of a quartic oscillator potential, as well as for the self-consistent Wigner-Poisson case. Conditions for well-behaved physically meaningful equilibrium Wigner functions are discussed.
Huang, Norden E.; Hu, Kun; Yang, Albert C. C.; Chang, Hsing-Chih; Jia, Deng; Liang, Wei-Kuang; Yeh, Jia Rong; Kao, Chu-Lan; Juan, Chi-Hung; Peng, Chung Kang; Meijer, Johanna H.; Wang, Yung-Hung; Long, Steven R.; Wu, Zhauhua
2016-01-01
The Holo-Hilbert spectral analysis (HHSA) method is introduced to cure the deficiencies of traditional spectral analysis and to give a full informational representation of nonlinear and non-stationary data. It uses a nested empirical mode decomposition and Hilbert–Huang transform (HHT) approach to identify intrinsic amplitude and frequency modulations often present in nonlinear systems. Comparisons are first made with traditional spectrum analysis, which usually achieved its results through c...
International Nuclear Information System (INIS)
Yu-Yan, Shen; Xiao-Gang, Chen; Wei, Cui; Yan-Hua, Hao; Qian-Qian, Li
2009-01-01
This paper uses the perturbation method to study effective response of nonlinear cylindrical coated composites. Under the external AC and DC electric field E a (1 + sin ωt), the local potentials of composites at all harmonic frequencies are induced. An effective nonlinear response to composite is given for the cylindrical coated inclusions in the dilute limit. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
Moderately nonlinear diffuse-charge dynamics under an ac voltage.
Stout, Robert F; Khair, Aditya S
2015-09-01
The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of V_{o}/(k_{B}T/e), where V_{o} is the amplitude of the driving voltage and k_{B}T/e is the thermal voltage with k_{B} as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D/λ_{D}L, where D is the ion diffusivity, λ_{D} is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O(V_{o}^{3}) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in V_{o}. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing V_{o}. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.
Moderately nonlinear diffuse-charge dynamics under an ac voltage
Stout, Robert F.; Khair, Aditya S.
2015-09-01
The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of Vo/(kBT /e ) , where Vo is the amplitude of the driving voltage and kBT /e is the thermal voltage with kB as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D /λDL , where D is the ion diffusivity, λD is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O (Vo3) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in Vo. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing Vo. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.
Directory of Open Access Journals (Sweden)
Alexander N. Kvitko
2017-01-01
Full Text Available An algorithm for constructing a control function that transfers a wide class of stationary nonlinear systems of ordinary differential equations from an initial state to a final state under certain control restrictions is proposed. The algorithm is designed to be convenient for numerical implementation. A constructive criterion of the desired transfer possibility is presented. The problem of an interorbital flight is considered as a test example and it is simulated numerically with the presented method.
A New Method for Non-linear and Non-stationary Time Series Analysis:
The Hilbert Spectral Analysis
CERN. Geneva
2000-01-01
A new method for analysing non-linear and non-stationary data has been developed. The key part of the method is the Empirical Mode Decomposition method with which any complicated data set can be decomposed into a finite and often small number of Intrinsic Mode Functions (IMF). An IMF is defined as any function having the same numbers of zero crossing and extreme, and also having symmetric envelopes defined by the local maximal and minima respectively. The IMF also admits well-behaved Hilbert transform. This decomposition method is adaptive, and, therefore, highly efficient. Since the decomposition is based on the local characteristic time scale of the data, it is applicable to non-linear and non-stationary processes. With the Hilbert transform, the Intrinsic Mode Functions yield instantaneous frequencies as functions of time that give sharp identifications of imbedded structures. The final presentation of the results is an energy-frequency-time distribution, designated as the Hilbert Spectrum. Classical non-l...
International Nuclear Information System (INIS)
Ganapathy, S.; Velusami, S.
2010-01-01
A new design of Multi-Objective Evolutionary Algorithm based decentralized controllers for load-frequency control of interconnected power systems with Governor Dead Band and Generation Rate Constraint nonlinearities, AC-DC parallel tie-lines and Superconducting Magnetic Energy Storage (SMES) units, is proposed in this paper. The HVDC link is used as system interconnection in parallel with AC tie-line to effectively damp the frequency oscillations of AC system while the SMES unit provides bulk energy storage and release, thereby achieving combined benefits. The proposed controller satisfies two main objectives, namely, minimum Integral Squared Error of the system output and maximum closed-loop stability of the system. Simulation studies are conducted on a two area interconnected power system with nonlinearities, AC-DC tie-lines and SMES units. Results indicate that the proposed controller improves the transient responses and guarantees the closed-loop stability of the overall system even in the presence of system nonlinearities and with parameter changes.
Nonlinear control of voltage source converters in AC-DC power system.
Dash, P K; Nayak, N
2014-07-01
This paper presents the design of a robust nonlinear controller for a parallel AC-DC power system using a Lyapunov function-based sliding mode control (LYPSMC) strategy. The inputs for the proposed control scheme are the DC voltage and reactive power errors at the converter station and the active and reactive power errors at the inverter station of the voltage-source converter-based high voltage direct current transmission (VSC-HVDC) link. The stability and robust tracking of the system parameters are ensured by applying the Lyapunov direct method. Also the gains of the sliding mode control (SMC) are made adaptive using the stability conditions of the Lyapunov function. The proposed control strategy offers invariant stability to a class of systems having modeling uncertainties due to parameter changes and exogenous inputs. Comprehensive computer simulations are carried out to verify the proposed control scheme under several system disturbances like changes in short-circuit ratio, converter parametric changes, and faults on the converter and inverter buses for single generating system connected to the power grid in a single machine infinite-bus AC-DC network and also for a 3-machine two-area power system. Furthermore, a second order super twisting sliding mode control scheme has been presented in this paper that provides a higher degree of nonlinearity than the LYPSMC and damps faster the converter and inverter voltage and power oscillations. Copyright © 2014 ISA. Published by Elsevier Ltd. All rights reserved.
Stationary localized modes of the quintic nonlinear Schroedinger equation with a periodic potential
International Nuclear Information System (INIS)
Alfimov, G. L.; Konotop, V. V.; Pacciani, P.
2007-01-01
We consider localized modes (bright solitons) of the one-dimensional quintic nonlinear Schroedinger equation with a periodic potential, describing several mean-field models of low-dimensional condensed gases. In the case of attractive nonlinearity we deduce sufficient conditions for collapse. We show that there exist spatially localized modes with arbitrarily large numbers of particles. We study such solutions in the semi-infinite gap (attractive case) and in the first gap (attractive and repulsive cases), and show that a nonzero minimum value of the number of particles is necessary for a localized mode to be created. In the limit of large negative frequencies (attractive case) we observe quantization of the number of particles of the stationary modes. Such solutions can be interpreted as coupled Townes solitons and appear to be stable. The modes in the first gap have numbers of particles infinitely growing with frequencies approaching one of the gap edges, which is explained by the power decay of the modes. Stability of the localized modes is discussed
Exponentially Stable Stationary Solutions for Stochastic Evolution Equations and Their Perturbation
International Nuclear Information System (INIS)
Caraballo, Tomas; Kloeden, Peter E.; Schmalfuss, Bjoern
2004-01-01
We consider the exponential stability of stochastic evolution equations with Lipschitz continuous non-linearities when zero is not a solution for these equations. We prove the existence of anon-trivial stationary solution which is exponentially stable, where the stationary solution is generated by the composition of a random variable and the Wiener shift. We also construct stationary solutions with the stronger property of attracting bounded sets uniformly. The existence of these stationary solutions follows from the theory of random dynamical systems and their attractors. In addition, we prove some perturbation results and formulate conditions for the existence of stationary solutions for semilinear stochastic partial differential equations with Lipschitz continuous non-linearities
Synthesis of state observer and nonlinear output feedback controller design of AC machines
International Nuclear Information System (INIS)
Al-Tahir, Ali Abdul Razzaq
2016-01-01
The research work developed in this thesis has been mainly devoted to the observation and sensor-less control problems of electrical systems. Three major contributions have been carried out using the high - gain concept and output feedback adaptive nonlinear control for online UPS. In this thesis, we dealt with synthesis of sampled high - gain observers for nonlinear systems application to PMSMs and DFIGs. We particularly focus on two constraints: sampling effect and tracking unmeasured mechanical and magnetic state variables. The first contribution consists in a high gain observer design that performs a relatively accurate estimation of both mechanical and magnetic state variable using the available measurements on stator currents and voltages of PMSM. We propose a global exponential observer having state predictor for a class of nonlinear globally Lipschitz system. In second contribution, we proposed a novel non - standard HGO design for non-injective feedback relation application to variable speed DFIG based WPGS. Meanwhile, a reduced system model is analyzed, provided by observability test to check is it possible synthesis state observer for sensor-less control. In last contribution, an adaptive observer for states and parameters estimation are designed for a class of state - affine systems application to output feedback adaptive nonlinear control of three-phase AC/DC boost power converter for online UPS systems. Basically, the problem focused on cascade nonlinear adaptive controller that is developed making use Lyapunov theory. The parameters uncertainties are processed by the practical control laws under back-stepping design techniques with capacity of adaptation. (author)
DEFF Research Database (Denmark)
Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.
2006-01-01
therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects......Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...
Normal form of particle motion under the influence of an ac dipole
Directory of Open Access Journals (Sweden)
R. Tomás
2002-05-01
Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.
Nonlinear Markov processes: Deterministic case
International Nuclear Information System (INIS)
Frank, T.D.
2008-01-01
Deterministic Markov processes that exhibit nonlinear transition mechanisms for probability densities are studied. In this context, the following issues are addressed: Markov property, conditional probability densities, propagation of probability densities, multistability in terms of multiple stationary distributions, stability analysis of stationary distributions, and basin of attraction of stationary distribution
International Nuclear Information System (INIS)
Dubrovsky, V.G.; Formusatik, I.B.
2003-01-01
The scheme for calculating via Zakharov-Manakov ∂-macron-dressing method of new rational solutions with constant asymptotic values at infinity of the famous two-dimensional Veselov-Novikov (VN) integrable nonlinear evolution equation and new exact rational potentials of two-dimensional stationary Schroedinger (2DSchr) equation with multiple pole wave functions is developed. As examples new lumps of VN nonlinear equation and new exact rational potentials of 2DSchr equation with multiple pole of order two wave functions are calculated. Among the constructed rational solutions are as nonsingular and also singular
Curvature-induced symmetry breaking in nonlinear Schrodinger models
DEFF Research Database (Denmark)
Gaididei, Yuri Borisovich; Mingaleev, S. F.; Christiansen, Peter Leth
2000-01-01
We consider a curved chain of nonlinear oscillators and show that the interplay of curvature and nonlinearity leads to a symmetry breaking when an asymmetric stationary state becomes energetically more favorable than a symmetric stationary state. We show that the energy of localized states...
International Nuclear Information System (INIS)
Rao, N.N.
1998-01-01
A systematic analysis of the stationary propagation of nonlinearly coupled electromagnetic and ion-acoustic waves in an unmagnetized plasma via the ponderomotive force is carried out. For small but finite amplitudes, the governing equations have a Hamiltonian structure, but with a kinetic energy term that is not positive definite. The Hamiltonian is similar to the well-known Hacute enon endash Heiles Hamiltonian of nonlinear dynamics, and is completely integrable in three regimes of the allowed parameter space. The corresponding second invariants of motion are also explicitly obtained. The integrable parameter regimes correspond to supersonic values of the Mach number, which characterizes the propagation speed of the coupled waves. On the other hand, in the sub- as well as near-sonic regimes, the coupled mode equations admit different types of exact analytical solutions, which represent nonlinear localized eigenstates of the electromagnetic field trapped in the density cavity due to the ponderomotive potential. While the density cavity has always a single-dip structure, for larger amplitudes it can support higher-order modes having a larger number of nodes in the electromagnetic field. In particular, we show the existence of a new type of localized electromagnetic wave whose field intensity has a triple-hump structure. For typical parameter values, the triple-hump solitons propagate with larger Mach numbers that are closer to the sonic limit than the single- as well as the double-hump solitons, but carry a lesser amount of the electromagnetic field energy. A comparison between the different types of solutions is carried out. The possibility of the existence of trapped electromagnetic modes having a larger number of humps is also discussed. copyright 1998 American Institute of Physics
Large Signal Stabilization of Hybrid AC/DC Micro-Grids Using Nonlinear Robust Controller
Directory of Open Access Journals (Sweden)
Reza Pejmanfar
2017-12-01
Full Text Available This paper presents a robust nonlinear integrated controller to improve stability of hybrid AC/DC micro-grids under islanding mode. The proposed controller includes two independent controllers where each one is responsible to control one part of the system. First controller will improve the stability of input DC/DC converter. Using this controller, the voltage of DC bus is fully stabilized such that when a large disturbance occurs, its voltage will become constant without any significant dynamic. The necessity of DC bus regulation which has not been considered in previous studies, is imminent as it not only improves voltage stability of the micro-grid but also protects consumers which are directly connected to the DC bus, against voltage variations. Frequency stability of the micro-grid is provided by the second proposed controller which is applied to output DC/AC converter of the micro-grid. Adaptive method is used to make the controllers proposed in this paper, robust. Duty cycle of converters switches are adjusted such that voltage and frequency of the micro-grid are set on the desired value in minimum possible time under transient disturbances and uncertainty of the loads as well as micro-sources characteristics.
A simple stationary semi-analytical wake model
DEFF Research Database (Denmark)
Larsen, Gunner Chr.
We present an idealized simple, but fast, semi-analytical algorithm for computation of stationary wind farm wind fields with a possible potential within a multi-fidelity strategy for wind farm topology optimization. Basically, the model considers wakes as linear perturbations on the ambient non......-linear. With each of these approached, a parabolic system are described, which is initiated by first considering the most upwind located turbines and subsequently successively solved in the downstream direction. Algorithms for the resulting wind farm flow fields are proposed, and it is shown that in the limit......-uniform mean wind field, although the modelling of the individual stationary wake flow fields includes non-linear terms. The simulation of the individual wake contributions are based on an analytical solution of the thin shear layer approximation of the NS equations. The wake flow fields are assumed...
Discrete nonlinear Schrodinger equations with arbitrarily high-order nonlinearities
DEFF Research Database (Denmark)
Khare, A.; Rasmussen, Kim Ø; Salerno, M.
2006-01-01
-Ladik equation. As a common property, these equations possess three kinds of exact analytical stationary solutions for which the Peierls-Nabarro barrier is zero. Several properties of these solutions, including stability, discrete breathers, and moving solutions, are investigated.......A class of discrete nonlinear Schrodinger equations with arbitrarily high-order nonlinearities is introduced. These equations are derived from the same Hamiltonian using different Poisson brackets and include as particular cases the saturable discrete nonlinear Schrodinger equation and the Ablowitz...
Dynamics of breathers in discrete nonlinear Schrodinger models
DEFF Research Database (Denmark)
Christiansen, Peter Leth; Johansson, Magnus; Aubry, Serge
1998-01-01
We review some recent results concerning the existence and stability of spatially localized and temporally quasiperiodic (non-stationary) excitations in discrete nonlinear Schrodinger (DNLS) models. In two dimensions, we show the existence of linearly stable, stationary and non-stationary localized...
Analytical solution of the PNP equations at AC applied voltage
International Nuclear Information System (INIS)
Golovnev, Anatoly; Trimper, Steffen
2012-01-01
A symmetric binary polymer electrolyte subjected to an AC voltage is considered. The analytical solution of the Poisson–Nernst–Planck equations (PNP) is found and analyzed for small applied voltages. Three distinct time regimes offering different behavior can be discriminated. The experimentally realized stationary behavior is discussed in detail. An expression for the external current is derived. Based on the theoretical result a simple method is suggested of measuring the ion mobility and their concentration separately. -- Highlights: ► Analytical solution of Poisson–Nernst–Planck equations. ► Binary polymer electrolyte subjected to an external AC voltage. ► Three well separated time scales exhibiting different behavior. ► The experimentally realized stationary behavior is discussed in detail. ► A method is proposed measuring the mobility and the concentration separately.
AUTOMATIC CONTROL OF PARAMETERS OF A NON-STATIONARY OBJECT WITH CROSS LINKS
Directory of Open Access Journals (Sweden)
A. Pavlov
2018-04-01
Full Text Available Many objects automatic control unsteady. This is manifested in the change of their parameters. Therefore, periodically adjust the required parameters of the controller. This work is usually carried out rarely. For a long time, regulators are working with is not the optimal settings. The consequence of this is the low quality of many industrial control systems. The solution problem is the use of robust controllers. ACS with traditional PI and PID controllers have a very limited range of normal operation modes due to the appearance of parametric disturbances due to changes in the characteristics of the automated unit and changes in the load on it. The situation is different when using in the architecture of artificial neural network controllers. It is known that when training a neural network, the adaptation procedure is often used. This makes it possible to greatly expand the area of normal operating modes of ACS with neural automatic regulators in comparison with traditional linear regulators. It is also possible to significantly improve the quality of control (especially for a non-stationary multidimensional object, provided that when designing the ACS at the stage of its simulation in the model of the regulatory object model, an adequate simulation model of the executive device. It is also possible to significantly improve the quality of control (especially for a non-stationary multidimensional regulatory object model, an adequate simulation model of the executive device. Especially actual implementation of all these requirements in the application of electric actuators. This article fully complies with these requirements. This is what makes it possible to provide a guaranteed quality of control in non-stationary ACS with multidimensional objects and cross-links between control channels. The possibility of using a known hybrid automatic regulator to stabilize the parameters of a two-channel non-stationary object with two cross-linked. A
Ma, Li-Yuan; Ji, Jia-Liang; Xu, Zong-Wei; Zhu, Zuo-Nong
2018-03-01
We study a nonintegrable discrete nonlinear Schrödinger (dNLS) equation with the term of nonlinear nearest-neighbor interaction occurred in nonlinear optical waveguide arrays. By using discrete Fourier transformation, we obtain numerical approximations of stationary and travelling solitary wave solutions of the nonintegrable dNLS equation. The analysis of stability of stationary solitary waves is performed. It is shown that the nonlinear nearest-neighbor interaction term has great influence on the form of solitary wave. The shape of solitary wave is important in the electric field propagating. If we neglect the nonlinear nearest-neighbor interaction term, much important information in the electric field propagating may be missed. Our numerical simulation also demonstrates the difference of chaos phenomenon between the nonintegrable dNLS equation with nonlinear nearest-neighbor interaction and another nonintegrable dNLS equation without the term. Project supported by the National Natural Science Foundation of China (Grant Nos. 11671255 and 11701510), the Ministry of Economy and Competitiveness of Spain (Grant No. MTM2016-80276-P (AEI/FEDER, EU)), and the China Postdoctoral Science Foundation (Grant No. 2017M621964).
Bierens, H.J.
1996-01-01
Given the assumption that the components of a vector time series are stationary about nonlinear deterministic time trends, nonlinear co-trending is the phenomenon that one or more linear combinations of the time series are stationary about a linear trend, hence the series have common nonlinear
STABLE STATIONARY STATES OF NON-LOCAL INTERACTION EQUATIONS
FELLNER, KLEMENS
2010-12-01
In this paper, we are interested in the large-time behaviour of a solution to a non-local interaction equation, where a density of particles/individuals evolves subject to an interaction potential and an external potential. It is known that for regular interaction potentials, stable stationary states of these equations are generically finite sums of Dirac masses. For a finite sum of Dirac masses, we give (i) a condition to be a stationary state, (ii) two necessary conditions of linear stability w.r.t. shifts and reallocations of individual Dirac masses, and (iii) show that these linear stability conditions imply local non-linear stability. Finally, we show that for regular repulsive interaction potential Wε converging to a singular repulsive interaction potential W, the Dirac-type stationary states ρ̄ ε approximate weakly a unique stationary state ρ̄ ∈ L∞. We illustrate our results with numerical examples. © 2010 World Scientific Publishing Company.
DEVELOPMENT OF AN ARMY STATIONARY AXLE TEST STAND FOR LUBRICANT EFFICIENCY EVALUATION-PART II
2017-01-13
electric AC motor , and the two outputs of the axle are coupled using speed increasing gear boxes and absorbed by an identically sized AC motor ...work using the stationary axle efficiency test stand was completed using hardware representative of light and medium duty tactical wheeled vehicles ... vehicle results. However for the results to be applicable to real world field use , the driving cycle being replicated should be representative of real
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Stationary solutions of multicomponent chiral and gauge models
International Nuclear Information System (INIS)
Chudnovsky, D.V.; Chudnovsky, G.V.
1979-01-01
The authors examine stationary solutions of completely integrable systems in (x, t) dimensions having infinitely many components. Among the cases under investigation are: (1) the infinite-component non-linear Schroedinger equation; (2) infinite component CPsup(Ω) or SU(N) sigma-models; (3) general gauge and chiral completely integrable systems. (Auth.)
Stationary striations due to interaction of two ionization waves in xenon glow discharge
International Nuclear Information System (INIS)
Maruyama, T.; Nishina, S.; Kitamura, H.; Itagaki, K.; Mizuochi, H.
1990-01-01
Experimental observations on stationary striations in the positive column of xenon discharge are reported. Stationary striations are observed when two ionization waves exist simultaneously in the positive column at low pressure and high current region. These stationary striations are caused by nonlinear interference of two backward ionization waves of which frequencies are either equal or are in the ratio 1:2. The spatial intervals for the striated pattern are equal to the reciprocal of the difference between the wave-numbers of two ionization waves. (orig.)
Hybrid AC-High Voltage DC Grid Stability and Controls
Yu, Jicheng
The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient
NONLINEAR DYNAMO IN A ROTATING ELECTRICALLY CONDUCTING FLUID
Directory of Open Access Journals (Sweden)
M. I. Kopp
2017-05-01
Full Text Available We found a new large-scale instability, which arises in the rotating conductive fluid with small-scale turbulence. Turbulence is generated by small-scale external force with a low Reynolds number. The theory is built simply by the method of multiscale asymptotic expansions. Nonlinear equations for vortex and magnetic perturbations obtained in the third order for small Reynolds number. It is shown that the combined effects of the Coriolis force and the small external forces in a rotating conducting fluid possible large-scale instability. The large-scale increments of the instability, correspond to generation as the vortex and magnetic disturbances. This type of instability is classified as hydrodynamic and MHD alpha-effect. We studied the stationary regimes of nonlinear equations of magneto-vortex dynamo. In the limit of weakly conducting fluid found stationary solutions in the form of helical kinks. In the limit of high conductivity fluid was obtained stationary solutions in the form of nonlinear periodic waves and kinks.
Reichhardt, Charles; Reichhardt, Cynthia J. Olson
We numerically examine skyrmions interacting with a periodic quasi-one-dimensional substrate. When we drive the skyrmions perpendicular to the substrate periodicity direction, a rich variety of nonlinear Magnus-induced effects arise, in contrast to an overdamped system that shows only a linear velocity-force curve for this geometry. The skyrmion velocity-force curve is strongly nonlinear and we observe a Magnus-induced speed-up effect when the pinning causes the Magnus velocity response to align with the dissipative response. At higher applied drives these components decouple, resulting in strong negative differential conductivity. For skyrmions under combined ac and dc driving, we find a new class of phase locking phenomena in which the velocity-force curves contain a series of what we call Shapiro spikes, distinct from the Shapiro steps observed in overdamped systems. There are also regimes in which the skyrmion moves in the direction opposite to the applied dc drive to give negative mobility.
Nonlinear Dynamics of a Diffusing Interface
Duval, Walter M. B.
2001-01-01
Excitation of two miscible-viscous liquids inside a bounded enclosure in a microgravity environment has shown the evolution of quasi-stationary waves of various modes for a range of parameters. We examine computationally the nonlinear dynamics of the system as the interface breakup and bifurcates to resonance structures typified by the Rayleigh-Taylor instability mechanism. Results show that when the mean steady field is much smaller than the amplitude of the sinusoidal excitation, the system behaves linearly, and growth of quasi-stationary waves occurs through the Kelvin-Helmholtz instability mechanism. However, as the amplitude of excitation increases, nonlinearity occurs through subharmonic bifurcation prior to broadband chaos.
Nonlinear temporal modulation of pulsar radioemission
International Nuclear Information System (INIS)
Chian, A.C.-L.
1984-01-01
A nonlinear theory is discussed for self-modulation of pulsar radio pulses. A nonlinear Schroedinger equation is derived for strong electromagnetic waves propagating in an electron-positron plasma. The nonlinearities arising from wave intensity induced relativistic particle mass variation may excite the modulational instability of circularly and linearly polarized pulsar radiation. The resulting wave envelopes can take the form of periodic wave trains or solitons. These nonlinear stationary wave forms may account for the formation of pulsar microstructures. (Author) [pt
Nonlinear Fokker-Planck Equations Fundamentals and Applications
Frank, Till Daniel
2005-01-01
Providing an introduction to the theory of nonlinear Fokker-Planck equations, this book discusses fundamental properties of transient and stationary solutions, emphasizing the stability analysis of stationary solutions by means of self-consistency equations, linear stability analysis, and Lyapunov's direct method. Also treated are Langevin equations and correlation functions. Nonlinear Fokker-Planck Equations addresses various phenomena such as phase transitions, multistability of systems, synchronization, anomalous diffusion, cut-off solutions, travelling-wave solutions and the emergence of power law solutions. A nonlinear Fokker-Planck perspective to quantum statistics, generalized thermodynamics, and linear nonequilibrium thermodynamics is given. Theoretical concepts are illustrated where possible by simple examples. The book also reviews several applications in the fields of condensed matter physics, the physics of porous media and liquid crystals, accelerator physics, neurophysics, social sciences, popul...
Existence of stationary solutions in the coronal loop problem
Energy Technology Data Exchange (ETDEWEB)
Hulshof, J; Terman, D; Verhulst, F
1988-01-01
The study of a hot plasma confined to a magnetic loop in the sun's corona leads to a singularly perturbed nonlinear reaction-diffusion equation with rather unusual side conditions. Monotone solutions of the stationary problem appear as fixed points of an iteration map which is contractive if the perturbation parameter is sufficiently small.
Current Control of Grid Converters Connected with Series AC Capacitor
DEFF Research Database (Denmark)
Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang
2015-01-01
The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...... this paper proposes a fourth-order resonant controller in the stationary frame, which guarantees a zero steady-state current tracking error for the grid converters with series LC filter. This method is then implemented in a three-phase experimental system for verification, where the current harmonics below...... the LC filter resonance frequency are effectively eliminated. Experimental results confirm the validity of the proposed current control scheme....
Effect of ac electric fields on counterflow diffusion flame of methane
Chul Choi, Byung
2012-08-01
The effect of electric fields on the response of diffusion flames in a counterflow has been investigated experimentally by varying the AC voltage and frequency. The result showed that the flame was stationary with high AC frequency above the threshold frequency, and it increased with the applied voltage and then leveled off at 35 Hz. Below the threshold frequency, however, the flame oscillated with a frequency that was synchronized with the applied AC frequency. This oscillation can be attributed to the ionic wind effect due to the generation of bulk flow, which arises from the momentum transfer by molecular collisions between neutral molecules and ions, where the ions in the reaction zone were accelerated by the Lorentz force. © 2012 The Korean Society of Mechanical Engineers.
Effect of ac electric fields on counterflow diffusion flame of methane
Chul Choi, Byung; Kuk Kim, Hyung; Chung, Suk-Ho
2012-01-01
The effect of electric fields on the response of diffusion flames in a counterflow has been investigated experimentally by varying the AC voltage and frequency. The result showed that the flame was stationary with high AC frequency above the threshold frequency, and it increased with the applied voltage and then leveled off at 35 Hz. Below the threshold frequency, however, the flame oscillated with a frequency that was synchronized with the applied AC frequency. This oscillation can be attributed to the ionic wind effect due to the generation of bulk flow, which arises from the momentum transfer by molecular collisions between neutral molecules and ions, where the ions in the reaction zone were accelerated by the Lorentz force. © 2012 The Korean Society of Mechanical Engineers.
Energy Technology Data Exchange (ETDEWEB)
Ruiz, Jordi-Roger Riba [EUETII, Dept. d' Enginyeria Electrica, Universitat Politecnica de Catalunya, Placa del Rei 15, 08700 Igualada, Barcelona (Spain); Garcia Espinosa, Antonio [Dept. d' Enginyeria Electrica, Universitat Politecnica de Catalunya C/Colom 1, 08222 Terrassa (Spain); Romeral, Luis; Cusido, Jordi [Dept. d' Enginyeria Electronica, Universitat Politecnica de Catalunya C/Colom 1, 08222 Terrassa (Spain)
2010-10-15
Permanent magnet synchronous motors (PMSMs) are applied in high performance positioning and variable speed applications because of their enhanced features with respect to other AC motor types. Fault detection and diagnosis of electrical motors for critical applications is an active field of research. However, much research remains to be done in the field of PMSM demagnetization faults, especially when running under non-stationary conditions. This paper presents a time-frequency method specifically focused to detect and diagnose demagnetization faults in PMSMs running under non-stationary speed conditions, based on the Hilbert Huang transform. The effectiveness of the proposed method is proven by means of experimental results. (author)
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Padhi, Radhakant; Unnikrishnan, Nishant; Wang, Xiaohua; Balakrishnan, S N
2006-12-01
Even though dynamic programming offers an optimal control solution in a state feedback form, the method is overwhelmed by computational and storage requirements. Approximate dynamic programming implemented with an Adaptive Critic (AC) neural network structure has evolved as a powerful alternative technique that obviates the need for excessive computations and storage requirements in solving optimal control problems. In this paper, an improvement to the AC architecture, called the "Single Network Adaptive Critic (SNAC)" is presented. This approach is applicable to a wide class of nonlinear systems where the optimal control (stationary) equation can be explicitly expressed in terms of the state and costate variables. The selection of this terminology is guided by the fact that it eliminates the use of one neural network (namely the action network) that is part of a typical dual network AC setup. As a consequence, the SNAC architecture offers three potential advantages: a simpler architecture, lesser computational load and elimination of the approximation error associated with the eliminated network. In order to demonstrate these benefits and the control synthesis technique using SNAC, two problems have been solved with the AC and SNAC approaches and their computational performances are compared. One of these problems is a real-life Micro-Electro-Mechanical-system (MEMS) problem, which demonstrates that the SNAC technique is applicable to complex engineering systems.
Robust Forecasting of Non-Stationary Time Series
Croux, C.; Fried, R.; Gijbels, I.; Mahieu, K.
2010-01-01
This paper proposes a robust forecasting method for non-stationary time series. The time series is modelled using non-parametric heteroscedastic regression, and fitted by a localized MM-estimator, combining high robustness and large efficiency. The proposed method is shown to produce reliable forecasts in the presence of outliers, non-linearity, and heteroscedasticity. In the absence of outliers, the forecasts are only slightly less precise than those based on a localized Least Squares estima...
Influence of Stationary Crossflow Modulation on Secondary Instability
Choudhari, Meelan M.; Li, Fei; Paredes, Pedro
2016-01-01
A likely scenario for swept wing transition on subsonic aircraft with natural laminar flow involves the breakdown of stationary crossflow vortices via high frequency secondary instability. A majority of the prior research on this secondary instability has focused on crossflow vortices with a single dominant spanwise wavelength. This paper investigates the effects of the spanwise modulation of stationary crossflow vortices at a specified wavelength by a subharmonic stationary mode. Secondary instability of the modulated crossflow pattern is studied using planar, partial-differential-equation based eigenvalue analysis. Computations reveal that weak modulation by the first subharmonic of the input stationary mode leads to mode splitting that is particularly obvious for Y-type secondary modes that are driven by the wall-normal shear of the basic state. Thus, for each Y mode corresponding to the fundamental wavelength of results in unmodulated train of crossflow vortices, the modulated flow supports a pair of secondary modes with somewhat different amplification rates. The mode splitting phenomenon suggests that a more complex stationary modulation such as that induced by natural surface roughness would yield a considerably richer spectrum of secondary instability modes. Even modest levels of subharmonic modulation are shown to have a strong effect on the overall amplification of secondary disturbances, particularly the Z-modes driven by the spanwise shear of the basic state. Preliminary computations related to the nonlinear breakdown of these secondary disturbances provide interesting insights into the process of crossflow transition in the presence of the first subharmonic of the dominant stationary vortex.
On the dynamics of Airy beams in nonlinear media with nonlinear losses.
Ruiz-Jiménez, Carlos; Nóbrega, K Z; Porras, Miguel A
2015-04-06
We investigate on the nonlinear dynamics of Airy beams in a regime where nonlinear losses due to multi-photon absorption are significant. We identify the nonlinear Airy beam (NAB) that preserves the amplitude of the inward Hänkel component as an attractor of the dynamics. This attractor governs also the dynamics of finite-power (apodized) Airy beams, irrespective of the location of the entrance plane in the medium with respect to the Airy waist plane. A soft (linear) input long before the waist, however, strongly speeds up NAB formation and its persistence as a quasi-stationary beam in comparison to an abrupt input at the Airy waist plane, and promotes the formation of a new type of highly dissipative, fully nonlinear Airy beam not described so far.
Randomly forced CGL equation stationary measures and the inviscid limit
Kuksin, S
2003-01-01
We study a complex Ginzburg-Landau (CGL) equation perturbed by a random force which is white in time and smooth in the space variable~$x$. Assuming that $\\dim x\\le4$, we prove that this equation has a unique solution and discuss its asymptotic in time properties. Next we consider the case when the random force is proportional to the square root of the viscosity and study the behaviour of stationary solutions as the viscosity goes to zero. We show that, under this limit, a subsequence of solutions in question converges to a nontrivial stationary process formed by global strong solutions of the nonlinear Schr\\"odinger equation.
International Nuclear Information System (INIS)
Smetanin, Igor V; Vasil'ev, Petr P
2009-01-01
Parameters of external-cavity semiconductor lasers, when the stationary lasing becomes unstable, were analysed within the framework of a theoretical model of self-starting mode locking. In this case, a train of ultrashort pulses can be generated due to intrinsic nonlinearities of the laser medium. A decisive role of the transverse optical field nonuniformity, pump rate, and gain spectral bandwidth in the development of the instability of stationary lasing was demonstrated. (control of laser radiation parameters)
Discrete Localized States and Localization Dynamics in Discrete Nonlinear Schrödinger Equations
DEFF Research Database (Denmark)
Christiansen, Peter Leth; Gaididei, Yu.B.; Mezentsev, V.K.
1996-01-01
Dynamics of two-dimensional discrete structures is studied in the framework of the generalized two-dimensional discrete nonlinear Schrodinger equation. The nonlinear coupling in the form of the Ablowitz-Ladik nonlinearity is taken into account. Stability properties of the stationary solutions...
Inferential framework for non-stationary dynamics: theory and applications
International Nuclear Information System (INIS)
Duggento, Andrea; Luchinsky, Dmitri G; McClintock, Peter V E; Smelyanskiy, Vadim N
2009-01-01
An extended Bayesian inference framework is presented, aiming to infer time-varying parameters in non-stationary nonlinear stochastic dynamical systems. The convergence of the method is discussed. The performance of the technique is studied using, as an example, signal reconstruction for a system of neurons modeled by FitzHugh–Nagumo oscillators: it is applied to reconstruction of the model parameters and elements of the measurement matrix, as well as to inference of the time-varying parameters of the non-stationary system. It is shown that the proposed approach is able to reconstruct unmeasured (hidden) variables of the system, to determine the model parameters, to detect stepwise changes of control parameters for each oscillator and to track the continuous evolution of the control parameters in the adiabatic limit
International Nuclear Information System (INIS)
Andrienko, A.V.; Safonov, V.L.; Yakubovskij, A.Yu.
1987-01-01
The response of parametric electron and nuclear spin waves to weak modulation of a stationary magnetic field is investigated in the antiferromagnetics MnCO 3 and CsMnF 3 . The modulation response is calculated by taking into accout the phase mechanism of restriction of the parametric wave amplitude and positive nonlinear attenuation of the waves. Some characteristics of the stationary state of parametric electron and nuclear magnons are determined within the framework of the model by analysis of the experimental results: the nonlinear magnon interaction coefficient S k and the parameter κ which characterizes the relative contribution from positive nonlinear attenuation and the phase mechanism to the restriction of the number of parametric magnons. An anomaly in the behavior of the modulation response of the parametric nuclear magnons is observed in CsMnF 3 ; this is manifest in asubstantial decrease of the modulation response in a narrow supercriticality and modulation frequency range. A giant hexagonal anisotropy of the modulation response and nonlinear dynamic susceptibility of the nuclear magnons is observed in the same crystal. This may indicate a nonisotropic distribution of the magnons in k-space
Special discontinuities in nonlinearly elastic media
Chugainova, A. P.
2017-06-01
Solutions of a nonlinear hyperbolic system of equations describing weakly nonlinear quasitransverse waves in a weakly anisotropic elastic medium are studied. The influence of small-scale processes of dissipation and dispersion is investigated. The small-scale processes determine the structure of discontinuities (shocks) and a set of discontinuities with a stationary structure. Among the discontinuities with a stationary structure, there are special ones that, in addition to relations following from conservation laws, satisfy additional relations required for the existence of their structure. In the phase plane, the structure of such discontinuities is represented by an integral curve joining two saddles. Special discontinuities lead to nonunique self-similar solutions of the Riemann problem. Asymptotics of non-self-similar problems for equations with dissipation and dispersion are found numerically. These asymptotics correspond to self-similar solutions of the problems.
Variation principle for nonlinear wave propagation
International Nuclear Information System (INIS)
Watanabe, T.; Lee, Y.C.; Nishikawa, Kyoji; Hojo, H.; Yoshida, Y.
1976-01-01
Variation principle is derived which determines stationary nonlinear propagation of electrostatic waves in the self-consistent density profile. Example is given for lower-hybrid waves and the relation to the variation principle for the Lagrangian density of electromagnetic fluids is discussed
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-04-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the
Nonlinearly perturbed semi-Markov processes
Silvestrov, Dmitrii
2017-01-01
The book presents new methods of asymptotic analysis for nonlinearly perturbed semi-Markov processes with a finite phase space. These methods are based on special time-space screening procedures for sequential phase space reduction of semi-Markov processes combined with the systematical use of operational calculus for Laurent asymptotic expansions. Effective recurrent algorithms are composed for getting asymptotic expansions, without and with explicit upper bounds for remainders, for power moments of hitting times, stationary and conditional quasi-stationary distributions for nonlinearly perturbed semi-Markov processes. These results are illustrated by asymptotic expansions for birth-death-type semi-Markov processes, which play an important role in various applications. The book will be a useful contribution to the continuing intensive studies in the area. It is an essential reference for theoretical and applied researchers in the field of stochastic processes and their applications that will cont...
Stationary Black Holes: Uniqueness and Beyond
Directory of Open Access Journals (Sweden)
Heusler Markus
1998-01-01
Full Text Available The spectrum of known black hole solutions to the stationary Einstein equations has increased in an unexpected way during the last decade. In particular, it has turned out that not all black hole equilibrium configurations are characterized by their mass, angular momentum and global charges. Moreover, the high degree of symmetry displayed by vacuum and electro-vacuum black hole space-times ceases to exist in self-gravitating non-linear field theories. This text aims to review some of the recent developments and to discuss them in the light of the uniqueness theorem for the Einstein-Maxwell system.
Stationary Black Holes: Uniqueness and Beyond
Directory of Open Access Journals (Sweden)
Piotr T. Chruściel
2012-05-01
Full Text Available The spectrum of known black-hole solutions to the stationary Einstein equations has been steadily increasing, sometimes in unexpected ways. In particular, it has turned out that not all black-hole-equilibrium configurations are characterized by their mass, angular momentum and global charges. Moreover, the high degree of symmetry displayed by vacuum and electro vacuum black-hole spacetimes ceases to exist in self-gravitating non-linear field theories. This text aims to review some developments in the subject and to discuss them in light of the uniqueness theorem for the Einstein-Maxwell system.
Is the Labour Force Participation Rate Non-Stationary in Romania?
Directory of Open Access Journals (Sweden)
Tiwari Aviral Kumar
2015-01-01
Full Text Available The purpose of this paper is to test hysteresis of the Romanian labour force participation rate, by using time series data, with quarterly frequency, covering the period 1999Q1-2013Q4. The main results reveal that the Romanian labour force participation rate is a nonlinear process and has a partial unit root (i.e. it is stationary in the first regime and non-stationary in the second one, the main breaking point being registered around year 2005. In this context, the value of using unemployment rate as an indicator for capturing joblessness in this country is debatable. Starting from 2005, the participation rate has not followed long-term changes in unemployment rate, the disturbances having permanent effects on labour force participation rate.
On Optimal Feedback Control for Stationary Linear Systems
International Nuclear Information System (INIS)
Russell, David L.
2010-01-01
We study linear-quadratic optimal control problems for finite dimensional stationary linear systems AX+BU=Z with output Y=CX+DU from the viewpoint of linear feedback solution. We interpret solutions in relation to system robustness with respect to disturbances Z and relate them to nonlinear matrix equations of Riccati type and eigenvalue-eigenvector problems for the corresponding Hamiltonian system. Examples are included along with an indication of extensions to continuous, i.e., infinite dimensional, systems, primarily of elliptic type.
Self-sustained solitons in systems with nonlinear damping
International Nuclear Information System (INIS)
Gonzalez, J.A.
1993-05-01
The existence and stability of kinks in systems with nonlinear damping are investigated. We discuss the mechanism of a bifurcation after which the kink becomes a non-stationary state. (author). 9 refs
On the Gross–Pitaevskii Equation with Pumping and Decay: Stationary States and Their Stability
Sierra Nunez, Jesus Alfredo; Kasimov, Aslan R.; Markowich, Peter A.; Weishä upl, Rada Maria
2015-01-01
We investigate the behavior of solutions of the complex Gross–Pitaevskii equation, a model that describes the dynamics of pumped decaying Bose–Einstein condensates. The stationary radially symmetric solutions of the equation are studied, and their linear stability with respect to two-dimensional perturbations is analyzed. Using numerical continuation, we calculate not only the ground state of the system, but also a number of excited states. Accurate numerical integration is employed to study the general nonlinear evolution of the system from the unstable stationary solutions to the formation of stable vortex patterns.
On the Gross–Pitaevskii Equation with Pumping and Decay: Stationary States and Their Stability
Sierra Nunez, Jesus Alfredo
2015-02-11
We investigate the behavior of solutions of the complex Gross–Pitaevskii equation, a model that describes the dynamics of pumped decaying Bose–Einstein condensates. The stationary radially symmetric solutions of the equation are studied, and their linear stability with respect to two-dimensional perturbations is analyzed. Using numerical continuation, we calculate not only the ground state of the system, but also a number of excited states. Accurate numerical integration is employed to study the general nonlinear evolution of the system from the unstable stationary solutions to the formation of stable vortex patterns.
Non-linear effects in transition edge sensors for X-ray detection
International Nuclear Information System (INIS)
Bandler, S.R.; Figueroa-Feliciano, E.; Iyomoto, N.; Kelley, R.L.; Kilbourne, C.A.; Murphy, K.D.; Porter, F.S.; Saab, T.; Sadleir, J.
2006-01-01
In a microcalorimeter that uses a transition-edge sensor to detect energy depositions, the small signal energy resolution improves with decreasing heat capacity. This improvement remains true up to the point where non-linear and saturation effects become significant. This happens when the energy deposition causes a significant change in the sensor resistance. Not only does the signal size become a non-linear function of the energy deposited, but also the noise becomes non-stationary over the duration of the pulse. Algorithms have been developed that can calculate the optimal performance given this non-linear behavior that typically requires significant processing and calibration work-both of which are impractical for space missions. We have investigated the relative importance of the various non-linear effects, with the hope that a computationally simple transformation can overcome the largest of the non-linear and non-stationary effects, producing a highly linear 'gain' for pulse-height versus energy, and close to the best energy resolution at all energies when using a Wiener filter
Stability of stationary states of non-local equations with singular interaction potentials
Fellner, Klemens
2011-04-01
We study the large-time behaviour of a non-local evolution equation for the density of particles or individuals subject to an external and an interaction potential. In particular, we consider interaction potentials which are singular in the sense that their first derivative is discontinuous at the origin.For locally attractive singular interaction potentials we prove under a linear stability condition local non-linear stability of stationary states consisting of a finite sum of Dirac masses. For singular repulsive interaction potentials we show the stability of stationary states of uniformly bounded solutions under a convexity condition.Finally, we present numerical simulations to illustrate our results. © 2010 Elsevier Ltd.
Chapter 5: Modeling and Control of Three-Phase AC/DC Converter Including Phase-Locked Loop
DEFF Research Database (Denmark)
Zhou, Dao; Song, Yipeng; Blaabjerg, Frede
2018-01-01
In this chapter, a mathematical model of the power circuit of a three-phase AC/DC converter is developed in the stationary and synchronous reference frames. Then, the operation principle of the phasor locked loop is addressed to exact the angle information of the power grid to realize the accurat...
Nonlinearity exponent of ac conductivity in disordered systems
International Nuclear Information System (INIS)
Nandi, U N; Sircar, S; Karmakar, A; Giri, S
2012-01-01
We measured the real part of ac conductance Σ(x,f) or Σ(T,f) of iron-doped mixed-valent polycrystalline manganite oxides LaMn 1-x Fe x O 3 as a function of frequency f by varying initial conductance Σ 0 by quenched disorder x at a fixed temperature T (room) and by temperature T at a fixed quenched disorder x. At a fixed temperature T, Σ(x,f) of a sample with fixed x remains almost constant at its zero-frequency dc value Σ 0 at lower frequency. With increase in f, Σ(x,f) increases slowly from Σ 0 and finally increases rapidly following a power law with an exponent s at high frequency. Scaled appropriately, the data for Σ(T,f) and Σ(x,f) fall on the same universal curve, indicating the existence of a general scaling formalism for the ac conductivity in disordered systems. The characteristic frequency f c at which Σ(x,f) or Σ(T,f) increases for the first time from Σ 0 scales with initial conductance Σ 0 as f c ∼ Σ 0 x f , where x f is the onset exponent. The value of x f is nearly equal to one and is found to be independent of x and T. Further, an inverse relationship between x f and s provides a self-consistency check of the systematic description of Σ(x,f) or Σ(T,f). This apparent universal value of x f is discussed within the framework of existing theoretical models and scaling theories. The relevance to other similar disordered systems is also highlighted. (paper)
Nonlinear system theory: another look at dependence.
Wu, Wei Biao
2005-10-04
Based on the nonlinear system theory, we introduce previously undescribed dependence measures for stationary causal processes. Our physical and predictive dependence measures quantify the degree of dependence of outputs on inputs in physical systems. The proposed dependence measures provide a natural framework for a limit theory for stationary processes. In particular, under conditions with quite simple forms, we present limit theorems for partial sums, empirical processes, and kernel density estimates. The conditions are mild and easily verifiable because they are directly related to the data-generating mechanisms.
Nonlinear dynamics of a coherent polariton-biexciton system
International Nuclear Information System (INIS)
Nguyen Trung Dan; Vo Tinh
1994-08-01
The nonlinear dynamics of a coherent interacting polariton-biexciton system in optically excited semiconductors is investigated. We consider the case when two macroscopically coherent modes - a lower branch polariton and a biexciton existing simultaneously in a direct-gap semiconductor. The conditions for exhibiting optical bistability in stationary regime are obtained. Numerical simulation for the nonlinear dynamics equations of the system is also carried out. (author). 16 refs, 4 figs
Direct amplitude detuning measurement with ac dipole
Directory of Open Access Journals (Sweden)
S. White
2013-07-01
Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.
Wave transmission in nonlinear lattices
International Nuclear Information System (INIS)
Hennig, D.; Tsironis, G.P.
1999-01-01
The interplay of nonlinearity with lattice discreteness leads to phenomena and propagation properties quite distinct from those appearing in continuous nonlinear systems. For a large variety of condensed matter and optics applications the continuous wave approximation is not appropriate. In the present review we discuss wave transmission properties in one dimensional nonlinear lattices. Our paradigmatic equations are discrete nonlinear Schroedinger equations and their study is done through a dynamical systems approach. We focus on stationary wave properties and utilize well known results from the theory of dynamical systems to investigate various aspects of wave transmission and wave localization. We analyze in detail the more general dynamical system corresponding to the equation that interpolates between the non-integrable discrete nonlinear Schroedinger equation and the integrable Albowitz-Ladik equation. We utilize this analysis in a nonlinear Kronig-Penney model and investigate transmission and band modification properties. We discuss the modifications that are effected through an electric field and the nonlinear Wannier-Stark localization effects that are induced. Several applications are described, such as polarons in one dimensional lattices, semiconductor superlattices and one dimensional nonlinear photonic band gap systems. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)
Detection of Unusual Events and Trends in Complex Non-Stationary Data Streams
International Nuclear Information System (INIS)
Perez, Rafael B.; Protopopescu, Vladimir A.; Worley, Brian Addison; Perez, Cristina
2006-01-01
The search for unusual events and trends hidden in multi-component, nonlinear, non-stationary, noisy signals is extremely important for a host of different applications, ranging from nuclear power plant and electric grid operation to internet traffic and implementation of non-proliferation protocols. In the context of this work, we define an unusual event as a local signal disturbance and a trend as a continuous carrier of information added to and different from the underlying baseline dynamics. The goal of this paper is to investigate the feasibility of detecting hidden intermittent events inside non-stationary signal data sets corrupted by high levels of noise, by using the Hilbert-Huang empirical mode decomposition method
Stationary drift-Rossby vortices in shear flows
International Nuclear Information System (INIS)
Horihata, Satoshi; Irie, Haruyuki; Sato, Masatomo
1990-01-01
Starting from Hasegawa-Mima equation with the generalized vorticity q which describes both electrostatic drift waves in plasmas and Rossby waves in the atmosphere of rotating planets, the stationary solutions of this equation in the (x, y) plane were considered assuming that the equilibrium density no depends on x and the electron temperature T 0 is constant. The arbitrary function F(φ) yielded from integration of transformed Hasegawa-Mima equation was taken either linear or nonlinear in φ, where φ is the stream function. When F is linear, vortex solutions were obtained by dividing the entire plane into internal and external regions by a closed boundary curve. Imposing the boundary conditions at the boundary curve, the constants in the solutions φ ex and φ in were determined. 4 examples are figured. When F is nonlinear, isolated (localized) vortex was considered. Deriving the equation to determine F, the equation for ψ, the internal vortical motion beyond the boundary was given. 2 examples are shown. (M.T.)
Nonlinear Transient Growth and Boundary Layer Transition
Paredes, Pedro; Choudhari, Meelan M.; Li, Fei
2016-01-01
Parabolized stability equations (PSE) are used in a variational approach to study the optimal, non-modal disturbance growth in a Mach 3 at plate boundary layer and a Mach 6 circular cone boundary layer. As noted in previous works, the optimal initial disturbances correspond to steady counter-rotating streamwise vortices, which subsequently lead to the formation of streamwise-elongated structures, i.e., streaks, via a lift-up effect. The nonlinear evolution of the linearly optimal stationary perturbations is computed using the nonlinear plane-marching PSE for stationary perturbations. A fully implicit marching technique is used to facilitate the computation of nonlinear streaks with large amplitudes. To assess the effect of the finite-amplitude streaks on transition, the linear form of plane- marching PSE is used to investigate the instability of the boundary layer flow modified by spanwise periodic streaks. The onset of bypass transition is estimated by using an N- factor criterion based on the amplification of the streak instabilities. Results show that, for both flow configurations of interest, streaks of sufficiently large amplitude can lead to significantly earlier onset of transition than that in an unperturbed boundary layer without any streaks.
Handbook of differential equations stationary partial differential equations
Chipot, Michel
2006-01-01
This handbook is volume III in a series devoted to stationary partial differential quations. Similarly as volumes I and II, it is a collection of self contained state-of-the-art surveys written by well known experts in the field. The topics covered by this handbook include singular and higher order equations, problems near critically, problems with anisotropic nonlinearities, dam problem, T-convergence and Schauder-type estimates. These surveys will be useful for both beginners and experts and speed up the progress of corresponding (rapidly developing and fascinating) areas of mathematics. Ke
Localized solutions of non-linear Klein--Gordon equations
International Nuclear Information System (INIS)
Werle, J.
1977-05-01
Nondissipative, stationary solutions for a class of nonlinear Klein-Gordon equations for a scalar field were found explicitly. Since the field is different from zero only inside a sphere of definite radius, the solutions are called quantum droplets
AC susceptibility of thin Pb films in intermediate and mixed state
Energy Technology Data Exchange (ETDEWEB)
Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)
2011-12-15
Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.
Rehabilitation of patients with rheumatoid arthritis treated in stationary spa treatment
Directory of Open Access Journals (Sweden)
Amila Jaganjac
2015-04-01
Full Text Available Introduction: Rheumatic diseases are nonsurgical diseases of the locomotor system and connective tissue. Rheumatoid arthritis (RA is a systemic inflammatory disease of connective tissue of unknown cause, with progressive chronic or subacute course. The aim of the research is to determine whether stationary spa treatment leads to improvement of the functional status in patients with rheumatoid arthritis. Methods: We included 35 patients with diagnosis of rheumatoid arthritis, referred for treatment at the spa " Ilidža " Gradačac from February to April 2014. Patients not adhering to treatment protocols were excluded. We used Visual analogue pain scale (VAS, HAQ questionnaire and assessment of the clinical condition before and after the treatment based on the scores 1-5.Results: There were 32 female and 3 male patients. The average age was 62.28±8.31 years. Based on the HAQ, 12 patients had no difficulties, 9 of them perform activities with little difficulties, 10 with many difficulties, and 4 patients cannot perform certain activities. Before treatment VAS was 6.63±2.36, and after treatment the 2.51±2.27. Ratings of clinical condition before treatment was 2.38±0.74, and after the treatment 3.64±0.98. The most frequently used therapies were kinesitherapy, magnetotherapy and interferential electricity. Conclusions: Stationary treatment at the spa „Ilidža“ Gradačac leads to an improvement of the functional status in patients with rheumatoid arthritis.
Bifurcation of plasma cylinder equilibrium into a stationary helical flow with magnetic islands
International Nuclear Information System (INIS)
Gubarev, V.F.; Dmitrenko, A.G.; Fesenko, A.I.
1985-01-01
Introduction of the low-hydrodynamic viscosity into the system of nonlinear MHD-equations enabled to use the bifurcation theory for the investigation into nonlinear phenomena connected with a tearing mode. The existance of a stable stationary helical flow with magnetic islands in the vicinity of a neutral curve is established. Fransfer from an axisymmetric equilibrium of a plasma cylinder to a helical one takes place only under soft conditions at both sides of the neutral curve. This result confirms the fact that the tearing mode, actually, is not an instability and may be con sidered only as a reason of formation of equilibrium with splitted magnetic surfaces. Really, changing the q 0 parameter (q 0 is the value proportional to a value of stability margin) at the plasma filament boundary a plasma equilibrium is attained corresponding to a stable branch of the bifurcation curve. In this case, a stable branch of the bifurcation curve corresponds to a helical stationary flow with magnetic islands in the instabwility region determined from the linear theory
Strongly nonlinear dynamics of electrolytes in large ac voltages
DEFF Research Database (Denmark)
Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik
2010-01-01
to suppress the strongly nonlinear regime in the limit of concentrated electrolytes, ionic liquids, and molten salts. Beyond the model problem, our reduced equations for thin double layers, based on uniformly valid matched asymptotic expansions, provide a useful mathematical framework to describe additional...
Projection-iteration methods for solving nonlinear operator equations
International Nuclear Information System (INIS)
Nguyen Minh Chuong; Tran thi Lan Anh; Tran Quoc Binh
1989-09-01
In this paper, the authors investigate a nonlinear operator equation in uniformly convex Banach spaces as in metric spaces by using stationary and nonstationary generalized projection-iteration methods. Convergence theorems in the strong and weak sense were established. (author). 7 refs
Generation of an intense stationary wave in modulated beam-plasma systems
International Nuclear Information System (INIS)
Jungwirth, K.; Krlin, L.
1974-03-01
Basic equations and numerical results describing nonlinear interaction of a weakly modulated electron beam with a single stationary one-dimensional wave excited in a cold plasma without the magnetic field, are presented and discussed. The effect of all possible irreversible processes (e.g., plasma turbulence) accompanying this interaction is simulated by the constant effective collision frequency νsub(eff) of plasma electrons. Starting from the nonlinear Poisson equation, the expression for the amplitude and the phase of the beam-excited wave are derived and solved numerically together with the equations of the beam electron motion. The results are compared with those of a time model. Significant, experimentally detectable differences are established. (author)
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Exact bright and dark spatial soliton solutions in saturable nonlinear media
International Nuclear Information System (INIS)
Calvo, Gabriel F.; Belmonte-Beitia, Juan; Perez-Garcia, Victor M.
2009-01-01
We present exact analytical bright and dark (black and grey) solitary wave solutions of a nonlinear Schroedinger-type equation describing the propagation of spatial beams in media exhibiting a saturable nonlinearity (such as centrosymmetric photorefractive materials). A qualitative study of the stationary equation is carried out together with a discussion of the stability of the solutions.
Nonlinear relativistic plasma resonance: Renormalization group approach
Energy Technology Data Exchange (ETDEWEB)
Metelskii, I. I., E-mail: metelski@lebedev.ru [Russian Academy of Sciences, Lebedev Physical Institute (Russian Federation); Kovalev, V. F., E-mail: vfkvvfkv@gmail.com [Dukhov All-Russian Research Institute of Automatics (Russian Federation); Bychenkov, V. Yu., E-mail: bychenk@lebedev.ru [Russian Academy of Sciences, Lebedev Physical Institute (Russian Federation)
2017-02-15
An analytical solution to the nonlinear set of equations describing the electron dynamics and electric field structure in the vicinity of the critical density in a nonuniform plasma is constructed using the renormalization group approach with allowance for relativistic effects of electron motion. It is demonstrated that the obtained solution describes two regimes of plasma oscillations in the vicinity of the plasma resonance— stationary and nonstationary. For the stationary regime, the spatiotemporal and spectral characteristics of the resonantly enhanced electric field are investigated in detail and the effect of the relativistic nonlinearity on the spatial localization of the energy of the plasma relativistic field is considered. The applicability limits of the obtained solution, which are determined by the conditions of plasma wave breaking in the vicinity of the resonance, are established and analyzed in detail for typical laser and plasma parameters. The applicability limits of the earlier developed nonrelativistic theories are refined.
Solitons in PT-symmetric potential with competing nonlinearity
International Nuclear Information System (INIS)
Khare, Avinash; Al-Marzoug, S.M.; Bahlouli, Hocine
2012-01-01
We investigate the effect of competing nonlinearities on beam dynamics in PT-symmetric potentials. In particular, we consider the stationary nonlinear Schrödinger equation (NLSE) in one dimension with competing cubic and generalized nonlinearity in the presence of a PT-symmetric potential. Closed form solutions for localized states are obtained. These solitons are shown to be stable over a wide range of potential parameters. The transverse power flow associated with these complex solitons is also examined. -- Highlights: ► Effect of competing nonlinearities on beam dynamics in PT-symmetric potentials. ► Closed form solutions for localized states are. ► The transverse power flow associated with these complex solitons is also examined.
Anjos, Pedro H. A.; Lira, Sérgio A.; Miranda, José A.
2018-04-01
We examine the formation of interfacial patterns when a magnetic liquid droplet (ferrofluid, or a magnetorheological fluid), surrounded by a nonmagnetic fluid, is subjected to a radial magnetic field in a Hele-Shaw cell. By using a vortex-sheet formalism, we find exact stationary solutions for the fluid-fluid interface in the form of n -fold polygonal shapes. A weakly nonlinear, mode-coupling method is then utilized to find time-evolving perturbative solutions for the interfacial patterns. The stability of such nonzero surface tension exact solutions is checked and discussed, by trying to systematically approach the exact stationary shapes through perturbative solutions containing an increasingly larger number of participating Fourier modes. Our results indicate that the exact stationary solutions of the problem are stable, and that a good matching between exact and perturbative shape solutions is achieved just by using a few Fourier modes. The stability of such solutions is substantiated by a linearization process close to the stationary shape, where a system of mode-coupling equations is diagonalized, determining the eigenvalues which dictate the stability of a fixed point.
Cappell, M S; Spray, D C; Bennett, M V
1988-06-28
Protractor muscles in the gastropod mollusc Navanax inermis exhibit typical spontaneous miniature end plate potentials with mean amplitude 1.71 +/- 1.19 (standard deviation) mV. The evoked end plate potential is quantized, with a quantum equal to the miniature end plate potential amplitude. When their rate is stationary, occurrence of miniature end plate potentials is a random, Poisson process. When non-stationary, spontaneous miniature end plate potential occurrence is a non-stationary Poisson process, a Poisson process with the mean frequency changing with time. This extends the random Poisson model for miniature end plate potentials to the frequently observed non-stationary occurrence. Reported deviations from a Poisson process can sometimes be accounted for by the non-stationary Poisson process and more complex models, such as clustered release, are not always needed.
Nonlinear scalar field equations. Pt. 1
International Nuclear Information System (INIS)
Berestycki, H.; Lions, P.L.
1983-01-01
This paper as well as a subsequent one is concerned with the existence of nontrivial solutions for some semi-linear elliptic equations in Rsup(N). Such problems are motivated in particular by the search for certain kinds of solitary waves (stationary states) in nonlinear equations of the Klein-Gordon or Schroedinger type. (orig./HSI)
An introduction to geometric theory of fully nonlinear parabolic equations
International Nuclear Information System (INIS)
Lunardi, A.
1991-01-01
We study a class of nonlinear evolution equations in general Banach space being an abstract version of fully nonlinear parabolic equations. In addition to results of existence, uniqueness and continuous dependence on the data, we give some qualitative results about stability of the stationary solutions, existence and stability of the periodic orbits. We apply such results to some parabolic problems arising from combustion theory. (author). 24 refs
Dynamics of Inhomogeneous Shell Systems Under Non-Stationary Loading (Survey)
Lugovoi, P. Z.; Meish, V. F.
2017-09-01
Experimental works on the determination of dynamics of smooth and stiffened cylindrical shells contacting with a soil medium under various non-stationary loading are reviewed. The results of studying three-layer shells of revolution whose motion equations are obtained within the framework of the hypotheses of the Timoshenko geometrically nonlinear theory are stated. The numerical results for shells with a piecewise or discrete filler enable the analysis of estimation of the influence of geometrical and physical-mechanical parameters of structures on their dynamics and reveal new mechanical effects. Basing on the classical theory of shells and rods, the effect of the discrete arrangement of ribs and coefficients of the Winkler or Pasternak elastic foundation on the normal frequencies and modes of rectangular planar cylindrical and spherical shells is studied. The number and shape of dispersion curves for longitudinal harmonic waves in a stiffened cylindrical shell are determined. The equations of vibrations of ribbed shells of revolution on Winkler or Pasternak elastic foundation are obtained using the geometrically nonlinear theory and the Timoshenko hypotheses. On applying the integral-interpolational method, numerical algorithms are developed and the corresponding non-stationary problems are solved. The special attention is paid to the statement and solution of coupled problems on the dynamical interaction of cylindrical or spherical shells with the soil water-saturated medium of different structure.
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Observation of Nonlinear Self-Trapping of Broad Beams in Defocusing Waveguide Arrays
International Nuclear Information System (INIS)
Bennet, Francis H.; Haslinger, Franz; Neshev, Dragomir N.; Kivshar, Yuri S.; Alexander, Tristram J.; Mitchell, Arnan
2011-01-01
We demonstrate experimentally the localization of broad optical beams in periodic arrays of optical waveguides with defocusing nonlinearity. This observation in optics is linked to nonlinear self-trapping of Bose-Einstein-condensed atoms in stationary periodic potentials being associated with the generation of truncated nonlinear Bloch states, existing in the gaps of the linear transmission spectrum. We reveal that unlike gap solitons, these novel localized states can have an arbitrary width defined solely by the size of the input beam while independent of nonlinearity.
Collective states of externally driven, damped nonlinear Schroedinger solitons
International Nuclear Information System (INIS)
Barashenkov, I.V.; Smirnov, Yu.S.
1997-01-01
We study bifurcations of localized stationary solitons of the externally driven, damped nonlinear Schroedinger equation iΨ t + Ψ xx + 2|Ψ| 2 Ψ=-iγΨ-h e iΩt , in the region of large γ (γ>1/2). For each pair of h and γ, there are two coexisting solitons, Ψ + and Ψ - . As the driver's strength h increases for the fixed γ, the Ψ + soliton merges with the flat background while the Ψ - forms a stationary collective state with two 'psi-pluses': Ψ - → Ψ (+ - +) . We obtain other stationary solutions and identify them as multisoliton complexes Ψ (++) , Ψ (--) , Ψ (-+) , Ψ (---) , Ψ (-+- ) etc. The corresponding intersoliton separations are compared to predictions of a variational approximation
Directory of Open Access Journals (Sweden)
A. D. Pataraya
1997-01-01
Full Text Available Non-linear α-ω; dynamo waves existing in an incompressible medium with the turbulence dissipative coefficients depending on temperature are studied in this paper. We investigate of α-ω solar non-linear dynamo waves when only the first harmonics of magnetic induction components are included. If we ignore the second harmonics in the non-linear equation, the turbulent magnetic diffusion coefficient increases together with the temperature, the coefficient of turbulent viscosity decreases, and for an interval of time the value of dynamo number is greater than 1. In these conditions a stationary solution of the non-linear equation for the dynamo wave's amplitude exists; meaning that the magnetic field is sufficiently excited. The amplitude of the dynamo waves oscillates and becomes stationary. Using these results we can explain the existence of Maunder's minimum.
International Nuclear Information System (INIS)
Wang, C.-C.
2007-01-01
This paper investigates the bifurcation and nonlinear behavior of an aerodynamic journal bearing system taking into account the effect of stationary herringbone grooves. A finite difference method based on the successive over relation approach is employed to solve the Reynolds' equation. The analysis reveals a complex dynamical behavior comprising periodic and quasi-periodic responses of the rotor center. The dynamic behavior of the bearing system varies with changes in the bearing number and rotor mass. The results of this study provide a better understanding of the nonlinear dynamics of aerodynamic grooved journal bearing systems
The matrix nonlinear Schrodinger equation in dimension 2
DEFF Research Database (Denmark)
Zuhan, L; Pedersen, Michael
2001-01-01
In this paper we study the existence of global solutions to the Cauchy problem for the matrix nonlinear Schrodinger equation (MNLS) in 2 space dimensions. A sharp condition for the global existence is obtained for this equation. This condition is in terms of an exact stationary solution...... of a semilinear elliptic equation. In the scalar case, the MNLS reduces to the well-known cubic nonlinear Schrodinger equation for which existence of solutions has been studied by many authors. (C) 2001 Academic Press....
International Nuclear Information System (INIS)
Vakulenko, M.O.
1992-01-01
Within the general renormalized statistical approach, the low-frequency short-wave stationary spectra of potential and magnetic perturbations in a finite-pressure plasma, are obtained. Anomalous heat conductivity considerably enhances due to non-linear interaction between magnetic excitations. 11 refs. (author)
International Nuclear Information System (INIS)
Dubrovsky, V. G.; Topovsky, A. V.
2013-01-01
New exact solutions, nonstationary and stationary, of Veselov-Novikov (VN) equation in the forms of simple nonlinear and linear superpositions of arbitrary number N of exact special solutions u (n) , n= 1, …, N are constructed via Zakharov and Manakov ∂-dressing method. Simple nonlinear superpositions are represented up to a constant by the sums of solutions u (n) and calculated by ∂-dressing on nonzero energy level of the first auxiliary linear problem, i.e., 2D stationary Schrödinger equation. It is remarkable that in the zero energy limit simple nonlinear superpositions convert to linear ones in the form of the sums of special solutions u (n) . It is shown that the sums u=u (k 1 ) +...+u (k m ) , 1 ⩽k 1 2 m ⩽N of arbitrary subsets of these solutions are also exact solutions of VN equation. The presented exact solutions include as superpositions of special line solitons and also superpositions of plane wave type singular periodic solutions. By construction these exact solutions represent also new exact transparent potentials of 2D stationary Schrödinger equation and can serve as model potentials for electrons in planar structures of modern electronics.
Network-constrained AC unit commitment under uncertainty: A Benders' decomposition approach
DEFF Research Database (Denmark)
Nasri, Amin; Kazempour, Seyyedjalal; Conejo, Antonio J.
2015-01-01
. The proposed model is formulated as a two-stage stochastic programming problem, whose first-stage refers to the day-ahead market, and whose second-stage represents real-time operation. The proposed Benders’ approach allows decomposing the original problem, which is mixed-integer nonlinear and generally...... intractable, into a mixed-integer linear master problem and a set of nonlinear, but continuous subproblems, one per scenario. In addition, to temporally decompose the proposed ac unit commitment problem, a heuristic technique is used to relax the inter-temporal ramping constraints of the generating units...
Directory of Open Access Journals (Sweden)
Claudio Roberto Fóffano Vasconcelos
2016-01-01
Full Text Available The aim of this study is to examine empirically the validity of PPP in the context of unit root tests based on linear and non-linear models of the real effective exchange rate of Argentina, Brazil, Chile, Colombia, Mexico, Peru and Venezuela. For this purpose, we apply the Harvey et al. (2008 linearity test and the non-linear unit root test (Kruse, 2011. The results show that the series with linear characteristics are Argentina, Brazil, Chile, Colombia and Peru and those with non-linear characteristics are Mexico and Venezuela. The linear unit root tests indicate that the real effective exchange rate is stationary for Chile and Peru, and the non-linear unit root tests evidence that Mexico is stationary. In the period analyzed, the results show support for the validity of PPP in only three of the seven countries.
Kamble, Saurabh Prakash; Thawkar, Shashank; Gaikwad, Vinayak G.; Kothari, D. P.
2017-12-01
Detection of disturbances is the first step of mitigation. Power electronics plays a crucial role in modern power system which makes system operation efficient but it also bring stationary disturbances in the power system and added impurities to the supply. It happens because of the non-linear loads used in modern day power system which inject disturbances like harmonic disturbances, flickers, sag etc. in power grid. These impurities can damage equipments so it is necessary to mitigate these impurities present in the supply very quickly. So, digital signal processing techniques are incorporated for detection purpose. Signal processing techniques like fast Fourier transform, short-time Fourier transform, Wavelet transform etc. are widely used for the detection of disturbances. Among all, wavelet transform is widely used because of its better detection capabilities. But, which mother wavelet has to use for detection is still a mystery. Depending upon the periodicity, the disturbances are classified as stationary and non-stationary disturbances. This paper presents the importance of selection of mother wavelet for analyzing stationary disturbances using discrete wavelet transform. Signals with stationary disturbances of various frequencies are generated using MATLAB. The analysis of these signals is done using various mother wavelets like Daubechies and bi-orthogonal wavelets and the measured root mean square value of stationary disturbance is obtained. The measured value obtained by discrete wavelet transform is compared with the exact RMS value of the frequency component and the percentage differences are presented which helps to select optimum mother wavelet.
Combined operation of AC and DC distribution system with distributed generation units
International Nuclear Information System (INIS)
Noroozian, R.; Abedi, M.; Gharehpetian, G.
2010-01-01
This paper presents a DC distribution system which has been supplied by external AC systems as well as local DG units in order to demonstrate an overall solution to power quality issue. In this paper, the proposed operation method is demonstrated by simulation of power transfer between external AC systems, DG units, AC and DC loads. The power flow control in DC distribution system has been achieved by network converters and DG converters. Also, the mathematical model of the network, DG and load converters are obtained by using the average technique, which allows converter systems accurately simulated and control strategies for this converters is achieved. A suitable control strategy for network converters has been proposed that involves DC voltage droop regulator and novel instantaneous power regulation scheme. Also, a novel control technique has been proposed for DG converters. In this paper, a novel control system based on stationary and synchronously rotating reference frame has been proposed for load converters for supplying AC loads connected to the DC bus by balanced voltages. The several case studies have been studied based on proposed methods. The simulation results show that DC distribution systems including DG units can improve the power quality at the point of common coupling (PCC) in the power distribution system or industrial power system. (authors)
Energy Technology Data Exchange (ETDEWEB)
Saha Ray, S., E-mail: santanusaharay@yahoo.com; Patra, A.
2014-10-15
Highlights: • A stationary transport equation has been solved using the technique of Haar wavelet collocation method. • This paper intends to provide the great utility of Haar wavelets to nuclear science problem. • In the present paper, two-dimensional Haar wavelets are applied. • The proposed method is mathematically very simple, easy and fast. - Abstract: In this paper the numerical solution for the fractional order stationary neutron transport equation is presented using Haar wavelet Collocation Method (HWCM). Haar wavelet collocation method is efficient and powerful in solving wide class of linear and nonlinear differential equations. This paper intends to provide an application of Haar wavelets to nuclear science problems. This paper describes the application of Haar wavelets for the numerical solution of fractional order stationary neutron transport equation in homogeneous medium with isotropic scattering. The proposed method is mathematically very simple, easy and fast. To demonstrate about the efficiency and applicability of the method, two test problems are discussed.
Two-dimensional effects in nonlinear Kronig-Penney models
DEFF Research Database (Denmark)
Gaididei, Yuri Borisovich; Christiansen, Peter Leth; Rasmussen, Kim
1997-01-01
An analysis of two-dimensional (2D) effects in the nonlinear Kronig-Penney model is presented. We establish an effective one-dimensional description of the 2D effects, resulting in a set of pseudodifferential equations. The stationary states of the 2D system and their stability is studied...
Characterizing nonlinearity in invasive EEG recordings from temporal lobe epilepsy
Casdagli, M. C.; Iasemidis, L. D.; Sackellares, J. C.; Roper, S. N.; Gilmore, R. L.; Savit, R. S.
Invasive electroencephalographic (EEG) recordings from depth and subdural electrodes, performed in eight patients with temporal lobe epilepsy, are analyzed using a variety of nonlinear techniques. A surrogate data technique is used to find strong evidence for nonlinearities in epileptogenic regions of the brain. Most of these nonlinearities are characterized as “spiking” by a wavelet analysis. A small fraction of the nonlinearities are characterized as “recurrent” by a nonlinear prediction algorithm. Recurrent activity is found to occur in spatio-temporal patterns related to the location of the epileptogenic focus. Residual delay maps, used to characterize “lag-one nonlinearity”, are remarkably stationary for a given electrode, and exhibit striking variations among electrodes. The clinical and theoretical implications of these results are discussed.
Likelihood-Based Inference in Nonlinear Error-Correction Models
DEFF Research Database (Denmark)
Kristensen, Dennis; Rahbæk, Anders
We consider a class of vector nonlinear error correction models where the transfer function (or loadings) of the stationary relation- ships is nonlinear. This includes in particular the smooth transition models. A general representation theorem is given which establishes the dynamic properties...... and a linear trend in general. Gaussian likelihood-based estimators are considered for the long- run cointegration parameters, and the short-run parameters. Asymp- totic theory is provided for these and it is discussed to what extend asymptotic normality and mixed normaity can be found. A simulation study...
Effect of AC electric fields on the stabilization of premixed bunsen flames
Kim, Minkuk
2011-01-01
The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.
A Nonlinear Fuel Optimal Reaction Jet Control Law
National Research Council Canada - National Science Library
Breitfeller, Eric
2002-01-01
We derive a nonlinear fuel optimal attitude control system (ACS) that drives the final state to the desired state according to a cost function that weights the final state angular error relative to the angular rate error...
Farokhi, Hamed; Païdoussis, Michael P.; Misra, Arun K.
2018-04-01
The present study examines the nonlinear behaviour of a cantilevered carbon nanotube (CNT) resonator and its mass detection sensitivity, employing a new nonlinear electrostatic load model. More specifically, a 3D finite element model is developed in order to obtain the electrostatic load distribution on cantilevered CNT resonators. A new nonlinear electrostatic load model is then proposed accounting for the end effects due to finite length. Additionally, a new nonlinear size-dependent continuum model is developed for the cantilevered CNT resonator, employing the modified couple stress theory (to account for size-effects) together with the Kelvin-Voigt model (to account for nonlinear damping); the size-dependent model takes into account all sources of nonlinearity, i.e. geometrical and inertial nonlinearities as well as nonlinearities associated with damping, small-scale, and electrostatic load. The nonlinear equation of motion of the cantilevered CNT resonator is obtained based on the new models developed for the CNT resonator and the electrostatic load. The Galerkin method is then applied to the nonlinear equation of motion, resulting in a set of nonlinear ordinary differential equations, consisting of geometrical, inertial, electrical, damping, and size-dependent nonlinear terms. This high-dimensional nonlinear discretized model is solved numerically utilizing the pseudo-arclength continuation technique. The nonlinear static and dynamic responses of the system are examined for various cases, investigating the effect of DC and AC voltages, length-scale parameter, nonlinear damping, and electrostatic load. Moreover, the mass detection sensitivity of the system is examined for possible application of the CNT resonator as a nanosensor.
Localized excitations in a nonlinearly coupled magnetic drift wave-zonal flow system
International Nuclear Information System (INIS)
Shukla, Nitin; Shukla, P.K.
2010-01-01
We consider the amplitude modulation of the magnetic drift wave (MDW) by zonal flows (ZFs) in a nonuniform magnetoplasma. For this purpose, we use the two-fluid model to derive a nonlinear Schroedinger equation for the amplitude modulated MDWs in the presence of the ZF potential, and an evolution equation for the ZF potential which is reinforced by the nonlinear Lorentz force of the MDWs. Our nonlinearly coupled MDW-ZFs system of equations admits stationary solutions in the form of a localized MDW envelope and a shock-like ZF potential profile.
Complex dynamics and morphogenesis an introduction to nonlinear science
Misbah, Chaouqi
2017-01-01
This book offers an introduction to the physics of nonlinear phenomena through two complementary approaches: bifurcation theory and catastrophe theory. Readers will be gradually introduced to the language and formalisms of nonlinear sciences, which constitute the framework to describe complex systems. The difficulty with complex systems is that their evolution cannot be fully predicted because of the interdependence and interactions between their different components. Starting with simple examples and working toward an increasing level of universalization, the work explores diverse scenarios of bifurcations and elementary catastrophes which characterize the qualitative behavior of nonlinear systems. The study of temporal evolution is undertaken using the equations that characterize stationary or oscillatory solutions, while spatial analysis introduces the fascinating problem of morphogenesis. Accessible to undergraduate university students in any discipline concerned with nonlinear phenomena (physics, mathema...
Grid Converters for Stationary Battery Energy Storage Systems
DEFF Research Database (Denmark)
Trintis, Ionut
The integration of renewable energy sources in the power system, with high percentage, is a well known challenge nowadays. Power sources like wind and solar are highly volatile, with uctuations on various time scales. One long term solution is to build a continentwide or worldwide supergrid....... Another solution is to use distributed energy storage units, and create virtual power plants. Stationary energy storage is a complementary solution, which can postpone the network expansion and can be optimized for dierent kind of grid services. As an energy storage solution with timing for few seconds...... multilevel converter structure with integrated energy storage is introduced. This converter structure is suitable to interface low and medium voltage energy storage units to medium and high voltage grids. It can also interconnect a DC and AC grid with bidirectional power ow, were both can be backed...
Nonlinear Cournot duopoly with implementation delays
International Nuclear Information System (INIS)
Matsumoto, Akio; Szidarovszky, Ferenc
2015-01-01
We study the effects of two delays on the local as well as on global stability of nonlinear Cournot duopoly dynamics. The two major findings are an analytical construction of the stability switching curve on which stability is lost and the numerical confirmation of the birth of aperiodic global dynamics when the stationary state is locally unstable. The delays matters and can generate various dynamics ranging from simple to complicated dynamics.
Nonlinear time series analysis of the human electrocardiogram
International Nuclear Information System (INIS)
Perc, Matjaz
2005-01-01
We analyse the human electrocardiogram with simple nonlinear time series analysis methods that are appropriate for graduate as well as undergraduate courses. In particular, attention is devoted to the notions of determinism and stationarity in physiological data. We emphasize that methods of nonlinear time series analysis can be successfully applied only if the studied data set originates from a deterministic stationary system. After positively establishing the presence of determinism and stationarity in the studied electrocardiogram, we calculate the maximal Lyapunov exponent, thus providing interesting insights into the dynamics of the human heart. Moreover, to facilitate interest and enable the integration of nonlinear time series analysis methods into the curriculum at an early stage of the educational process, we also provide user-friendly programs for each implemented method
Nonlinearity and fractional integration in the US dollar/euro exchange rate
Directory of Open Access Journals (Sweden)
Kiran Burcu
2012-01-01
Full Text Available This paper examines the nonlinear behavior and the fractional integration property of the US dollar/euro exchange rate over the period from January 1999 to August 2010 by extending the procedure of Peter M. Robinson (1994 to the case of nonlinearity. First, using the approach developed by Mehmet Caner and Bruce E. Hansen (2001, we investigate the possible presence of nonlinearity in the series through the estimation of a two-regime threshold autoregressive model. After finding nonlinearity, we also allow for disturbances to be fractionally integrated based on the different versions of Robinson (1994 tests. The findings show that the US dollar/euro exchange rate follows a stationary process with a weak evidence for long memory.
Likelihood-based inference for cointegration with nonlinear error-correction
DEFF Research Database (Denmark)
Kristensen, Dennis; Rahbek, Anders Christian
2010-01-01
We consider a class of nonlinear vector error correction models where the transfer function (or loadings) of the stationary relationships is nonlinear. This includes in particular the smooth transition models. A general representation theorem is given which establishes the dynamic properties...... and a linear trend in general. Gaussian likelihood-based estimators are considered for the long-run cointegration parameters, and the short-run parameters. Asymptotic theory is provided for these and it is discussed to what extend asymptotic normality and mixed normality can be found. A simulation study...
Nonlinear Alfvén Waves in a Vlasov Plasma
DEFF Research Database (Denmark)
Bell, T.F.
1965-01-01
Stationary solutions to the nonlinear Vlasov—Boltzmann equations are considered which represent one-dimensional electromagnetic waves in a hot magnetoplasma. These solutions appear in arbitrary reference frames as circularly polarized, sinusoidal waves of unlimited amplitude, i.e., as nonlinear...... Alfvén waves. Solutions are found implicitly by deriving a set of integral dispersion relations which link the wave characteristics with the particle distribution functions. A physical discussion is given of the way in which the Alfvén waves can trap particles, and it is shown that the presence...
Memory persistency and nonlinearity in daily mean dew point across India
Ray, Rajdeep; Khondekar, Mofazzal Hossain; Ghosh, Koushik; Bhattacharjee, Anup Kumar
2016-04-01
Enterprising endeavour has been taken in this work to realize and estimate the persistence in memory of the daily mean dew point time series obtained from seven different weather stations viz. Kolkata, Chennai (Madras), New Delhi, Mumbai (Bombay), Bhopal, Agartala and Ahmedabad representing different geographical zones in India. Hurst exponent values reveal an anti-persistent behaviour of these dew point series. To affirm the Hurst exponent values, five different scaling methods have been used and the corresponding results are compared to synthesize a finer and reliable conclusion out of it. The present analysis also bespeaks that the variation in daily mean dew point is governed by a non-stationary process with stationary increments. The delay vector variance (DVV) method has been exploited to investigate nonlinearity, and the present calculation confirms the presence of deterministic nonlinear profile in the daily mean dew point time series of the seven stations.
Park, Jeryang; Rao, P Suresh C
2014-11-15
We present here a conceptual model and analysis of complex systems using hypothetical cases of regime shifts resulting from temporal non-stationarity in attractor strengths, and then present selected published cases to illustrate such regime shifts in hydrologic systems (shallow aquatic ecosystems; water table shifts; soil salinization). Complex systems are dynamic and can exist in two or more stable states (or regimes). Temporal variations in state variables occur in response to fluctuations in external forcing, which are modulated by interactions among internal processes. Combined effects of external forcing and non-stationary strengths of alternative attractors can lead to shifts from original to alternate regimes. In systems with bi-stable states, when the strengths of two competing attractors are constant in time, or are non-stationary but change in a linear fashion, regime shifts are found to be temporally stationary and only controlled by the characteristics of the external forcing. However, when attractor strengths change in time non-linearly or vary stochastically, regime shifts in complex systems are characterized by non-stationary probability density functions (pdfs). We briefly discuss implications and challenges to prediction and management of hydrologic complex systems. Copyright © 2014 Elsevier B.V. All rights reserved.
Du, C M; Valko, K; Bevan, C; Reynolds, D; Abraham, M H
2000-11-01
Retention data for a set of 69 compounds using rapid gradient elution are obtained on a wide range of reversed-phase stationary phases and organic modifiers. The chromatographic stationary phases studied are Inertsil (IN)-ODS, pentafluorophenyl, fluoro-octyl, n-propylcyano, Polymer (PLRP-S 100), and hexylphenyl. The organic solvent modifiers are 2,2,2-trifluoroethanol (TFE); 1,1,1,3,3,3-hexafluoropropan-2-ol (HFIP); isopropanol; methanol (MeOH); acetonitrile (AcN); tetrahydrofuran; 1,4-dioxane; N,N-dimethylformamide; and mixed solvents of dimethylsulfoxide (DMSO) with AcN and DMSO with MeOH (1:1). A total of 25 chromatographic systems are analyzed using a solvation equation. In general, most of the systems give reasonable statistics. The selectivity of the reversed phase-high-performance liquid chromatographic (HPLC) systems with respect to the solute's dipolarity-polarity, hydrogen-bond acidity, and basicity are reflected in correspondingly large coefficients in the solvation equation. We wanted to find the most orthogonal HPLC systems, showing the highest possible selectivity difference in order to derive molecular descriptors using the gradient retention times of a compound. We selected eight chromatographic systems that have a large range of coefficients of interest (s, a, and b) similar to those found in water-solvent partitions used previously to derive molecular descriptors. The systems selected are IN-ODS phases with AcN, MeOH, TFE, and HFIP as mobile phase, PLRP-S 100 phase with AcN, propylcyano phase with AcN and MeOH, and fluorooctyl phase with TFE. Using the retention data obtained for a compound in the selected chromatographic systems, we can estimate the molecular descriptors with the faster and simpler gradient elution method.
Nonlinear evolution equations having a physical meaning
International Nuclear Information System (INIS)
Nakach, R.
1976-06-01
The non stationary self-similar solutions of the nonlinear evolution equations which can be solved by the inverse scattering method are studied. It turns out, as shown by means of several examples, that when the L linear operator associated with these equations, is of second order and only then, the self-similar solutions can be expressed in terms of the various Painleve's transcendents [fr
Energy Technology Data Exchange (ETDEWEB)
Dubrovsky, V. G.; Topovsky, A. V. [Novosibirsk State Technical University, Karl Marx prosp. 20, Novosibirsk 630092 (Russian Federation)
2013-03-15
New exact solutions, nonstationary and stationary, of Veselov-Novikov (VN) equation in the forms of simple nonlinear and linear superpositions of arbitrary number N of exact special solutions u{sup (n)}, n= 1, Horizontal-Ellipsis , N are constructed via Zakharov and Manakov {partial_derivative}-dressing method. Simple nonlinear superpositions are represented up to a constant by the sums of solutions u{sup (n)} and calculated by {partial_derivative}-dressing on nonzero energy level of the first auxiliary linear problem, i.e., 2D stationary Schroedinger equation. It is remarkable that in the zero energy limit simple nonlinear superpositions convert to linear ones in the form of the sums of special solutions u{sup (n)}. It is shown that the sums u=u{sup (k{sub 1})}+...+u{sup (k{sub m})}, 1 Less-Than-Or-Slanted-Equal-To k{sub 1} < k{sub 2} < Horizontal-Ellipsis < k{sub m} Less-Than-Or-Slanted-Equal-To N of arbitrary subsets of these solutions are also exact solutions of VN equation. The presented exact solutions include as superpositions of special line solitons and also superpositions of plane wave type singular periodic solutions. By construction these exact solutions represent also new exact transparent potentials of 2D stationary Schroedinger equation and can serve as model potentials for electrons in planar structures of modern electronics.
Energy Technology Data Exchange (ETDEWEB)
Dey, Pinkee; Suslov, Sergey A, E-mail: ssuslov@swin.edu.au [Department of Mathematics H38, Swinburne University of Technology, Hawthorn, Victoria 3122 (Australia)
2016-12-15
A finite amplitude instability has been analysed to discover the exact mechanism leading to the appearance of stationary magnetoconvection patterns in a vertical layer of a non-conducting ferrofluid heated from the side and placed in an external magnetic field perpendicular to the walls. The physical results have been obtained using a version of a weakly nonlinear analysis that is based on the disturbance amplitude expansion. It enables a low-dimensional reduction of a full nonlinear problem in supercritical regimes away from a bifurcation point. The details of the reduction are given in comparison with traditional small-parameter expansions. It is also demonstrated that Squire’s transformation can be introduced for higher-order nonlinear terms thus reducing the full three-dimensional problem to its equivalent two-dimensional counterpart and enabling significant computational savings. The full three-dimensional instability patterns are subsequently recovered using the inverse transforms The analysed stationary thermomagnetic instability is shown to occur as a result of a supercritical pitchfork bifurcation. (paper)
International Nuclear Information System (INIS)
Dey, Pinkee; Suslov, Sergey A
2016-01-01
A finite amplitude instability has been analysed to discover the exact mechanism leading to the appearance of stationary magnetoconvection patterns in a vertical layer of a non-conducting ferrofluid heated from the side and placed in an external magnetic field perpendicular to the walls. The physical results have been obtained using a version of a weakly nonlinear analysis that is based on the disturbance amplitude expansion. It enables a low-dimensional reduction of a full nonlinear problem in supercritical regimes away from a bifurcation point. The details of the reduction are given in comparison with traditional small-parameter expansions. It is also demonstrated that Squire’s transformation can be introduced for higher-order nonlinear terms thus reducing the full three-dimensional problem to its equivalent two-dimensional counterpart and enabling significant computational savings. The full three-dimensional instability patterns are subsequently recovered using the inverse transforms The analysed stationary thermomagnetic instability is shown to occur as a result of a supercritical pitchfork bifurcation. (paper)
Walking solitons in quadratic nonlinear media
Torner Sabata, Lluís; Mazilu, D; Mihalache, Dumitru
1996-01-01
We study self-action of light in parametric wave interactions in nonlinear quadratic media. We show the existence of stationary solitons in the presence of Poynting vector beam walk-off or different group velocities between the waves. We discover that the new solitons constitute a two-parameter family, and they exist for different wave intensities and transverse velocities. We discuss the properties of the walking solitons and their experimental implications. Peer Reviewed
Tashiro, Shinichi; Tanaka, Manabu
An unified numerical simulation model of AC TIG welding of the aluminum plate considering energy balance among the electrode, the arc and the base metal and employing an analytical model for calculating cleaning rate of the oxide layer has been developed for investigating heat transport properties and weld pool formation process in AC TIG welding of aluminum plate. As a result of this simulation, it was shown that although the heat flux from the arc onto the base metal increases in EN (Electrode Negative) phase due to the electron condensation, that in EP (Electrode Positive) phase conversely decreases because mainly of cooling caused by the electron emission. Furthermore, the validity of the simulation model was confirmed by comparing to experimental results such as the arc voltage, the area of cleaning zone and the shape of weld pool.
Non self-similar collapses described by the non-linear Schroedinger equation
International Nuclear Information System (INIS)
Berge, L.; Pesme, D.
1992-01-01
We develop a rapid method in order to find the contraction rates of the radially symmetric collapsing solutions of the nonlinear Schroedinger equation defined for space dimensions exceeding a threshold value. We explicitly determine the asymptotic behaviour of these latter solutions by solving the non stationary linear problem relative to the nonlinear Schroedinger equation. We show that the self-similar states associated with the collapsing solutions are characterized by a spatial extent which is bounded from the top by a cut-off radius
On a new series of integrable nonlinear evolution equations
International Nuclear Information System (INIS)
Ichikawa, Y.H.; Wadati, Miki; Konno, Kimiaki; Shimizu, Tohru.
1980-10-01
Recent results of our research are surveyed in this report. The derivative nonlinear Schroedinger equation for the circular polarized Alfven wave admits the spiky soliton solutions for the plane wave boundary condition. The nonlinear equation for complex amplitude associated with the carrier wave is shown to be a generalized nonlinear Schroedinger equation, having the ordinary cubic nonlinear term and the derivative of cubic nonlinear term. A generalized scheme of the inverse scattering transformation has confirmed that superposition of the A-K-N-S scheme and the K-N scheme for the component equations valids for the generalized nonlinear Schroedinger equation. Then, two types of new integrable nonlinear evolution equation have been derived from our scheme of the inverse scattering transformation. One is the type of nonlinear Schroedinger equation, while the other is the type of Korteweg-de Vries equation. Brief discussions are presented for physical phenomena, which could be accounted by the second type of the new integrable nonlinear evolution equation. Lastly, the stationary solitary wave solutions have been constructed for the integrable nonlinear evolution equation of the second type. These solutions have peculiar structure that they are singular and discrete. It is a new challenge to construct singular potentials by the inverse scattering transformation. (author)
Quantum hydrodynamics and nonlinear differential equations for degenerate Fermi gas
International Nuclear Information System (INIS)
Bettelheim, Eldad; Abanov, Alexander G; Wiegmann, Paul B
2008-01-01
We present new nonlinear differential equations for spacetime correlation functions of Fermi gas in one spatial dimension. The correlation functions we consider describe non-stationary processes out of equilibrium. The equations we obtain are integrable equations. They generalize known nonlinear differential equations for correlation functions at equilibrium [1-4] and provide vital tools for studying non-equilibrium dynamics of electronic systems. The method we developed is based only on Wick's theorem and the hydrodynamic description of the Fermi gas. Differential equations appear directly in bilinear form. (fast track communication)
Directory of Open Access Journals (Sweden)
Farshad Fathian
2017-02-01
arenot specified. Keenan test has also been proposed for assessing the linearity or nonlinearitybehavior of a time series in time series analysis. Keenan (1985 derived a test for nonlinearity analogous to Tukey’s degree of freedom for nonadditivity test. Keenan’s test is motivated by approximation a nonlinear stationary time series by a second-order Volterra expansion. While Keenan’s test for nonlinearity is designed for detecting quadratic nonlinearity, it may not be sensitive to threshold nonlinearity. Here, we applied the likelihood ratio test (TLRT with the threshold model as the specific alternative.The null hypothesis of the TLRT approach for threshold nonlinearity is the fitted model to the series is an AR (p model, and the alternative hypothesis is the fitted model to the series is a threshold autoregressive (TAR model with autoregressive order p in each regime. Results and Discussion: Because both the ADF and KPSS tests are based on linear regression, which has the normal distribution assumption, logarithmization can convert exponential trend possibly present in the data into a linear trend. In the case of stationary analysis, the results showed the standardized daily streamflow time series of all stations are significantly stationary. According to KPSS stationary test, the daily standardized streamflow time series are stationary around a fixed level, but they are not stationary around a trend stationaryin low lag values. Based on the BDS test, the results showed the daily streamflowseries have strong nonlinear structure, but based on the Keenan test, it can be seen the linear structure in thembyusing logarithmization and deseasonalization operators, and it means the coefficients of the double sum part are zero. It should be considered the Keenan test is used to detect quadratic nonlinearity, and it cannot be adequatelyfor threshold autoregressive models since they are linear in each regime. Conclusion: Streamflow processes of main rivers at 6 stations
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Nonlinear PT-symmetric plaquettes
International Nuclear Information System (INIS)
Li Kai; Kevrekidis, P G; Malomed, Boris A; Günther, Uwe
2012-01-01
We introduce four basic two-dimensional (2D) plaquette configurations with onsite cubic nonlinearities, which may be used as building blocks for 2D PT-symmetric lattices. For each configuration, we develop a dynamical model and examine its PTsymmetry. The corresponding nonlinear modes are analyzed starting from the Hamiltonian limit, with zero value of the gain–loss coefficient, γ. Once the relevant waveforms have been identified (chiefly, in an analytical form), their stability is examined by means of linearization in the vicinity of stationary points. This reveals diverse and, occasionally, fairly complex bifurcations. The evolution of unstable modes is explored by means of direct simulations. In particular, stable localized modes are found in these systems, although the majority of identified solutions are unstable. This article is part of a special issue of Journal of Physics A: Mathematical and Theoretical devoted to ‘Quantum physics with non-Hermitian operators’. (paper)
AC electric field induced droplet deformation in a microfluidic T-junction.
Xi, Heng-Dong; Guo, Wei; Leniart, Michael; Chong, Zhuang Zhi; Tan, Say Hwa
2016-08-02
We present for the first time an experimental study on the droplet deformation induced by an AC electric field in droplet-based microfluidics. It is found that the deformation of the droplets becomes stronger with increasing electric field intensity and frequency. The measured electric field intensity dependence of the droplet deformation is consistent with an early theoretical prediction for stationary droplets. We also proposed a simple equivalent circuit model to account for the frequency dependence of the droplet deformation. The model well explains our experimental observations. In addition, we found that the droplets can be deformed repeatedly by applying an amplitude modulation (AM) signal.
Improved algorithm for solving nonlinear parabolized stability equations
International Nuclear Information System (INIS)
Zhao Lei; Zhang Cun-bo; Liu Jian-xin; Luo Ji-sheng
2016-01-01
Due to its high computational efficiency and ability to consider nonparallel and nonlinear effects, nonlinear parabolized stability equations (NPSE) approach has been widely used to study the stability and transition mechanisms. However, it often diverges in hypersonic boundary layers when the amplitude of disturbance reaches a certain level. In this study, an improved algorithm for solving NPSE is developed. In this algorithm, the mean flow distortion is included into the linear operator instead of into the nonlinear forcing terms in NPSE. An under-relaxation factor for computing the nonlinear terms is introduced during the iteration process to guarantee the robustness of the algorithm. Two case studies, the nonlinear development of stationary crossflow vortices and the fundamental resonance of the second mode disturbance in hypersonic boundary layers, are presented to validate the proposed algorithm for NPSE. Results from direct numerical simulation (DNS) are regarded as the baseline for comparison. Good agreement can be found between the proposed algorithm and DNS, which indicates the great potential of the proposed method on studying the crossflow and streamwise instability in hypersonic boundary layers. (paper)
International Nuclear Information System (INIS)
Higdon, J.C.
1986-01-01
A model of anisotropic, plasma-fluid variations was used to investigate the unknown origin of the power spectra of interstellar electron fluctuations inferred by Armstrong, Cordes, and Rickett (1981). The modeled electron variations are interpreted as density components of an anisotropic stationary mode of nonlinear magnetogasdynamics-tangential pressure balances. It is suggested that the wavenumber spectra of electron variations are identical to the spectra of the convecting velocity fields over a wide range of wavenumbers. 55 references
International Nuclear Information System (INIS)
Kosevich, Y A; Manevitch, L I; Savin, A V
2007-01-01
We consider, both analytically and numerically, the dynamics of stationary and slowly-moving breathers (localized short-wavelength excitations) in two weakly coupled nonlinear oscillator chains (nonlinear phononic waveguides). We show that there are two qualitatively different dynamical regimes of the coupled breathers: the oscillatory exchange of the low-amplitude breather between the phononic waveguides (wandering breather), and one-waveguide-localization (nonlinear self-trapping) of the high-amplitude breather. We also show that phase-coherent dynamics of the coupled breathers in two weakly linked nonlinear phononic waveguides has a profound analogy, and is described by a similar pair of equations, to the tunnelling quantum dynamics of two weakly linked Bose-Einstein condensates in a symmetric double-well potential (single bosonic Josephson junction). The exchange of phonon energy and excitations between the coupled phononic waveguides takes on the role which the exchange of atoms via quantum tunnelling plays in the case of the coupled condensates. On the basis of this analogy, we predict a new tunnelling mode of the coupled Bose-Einstein condensates in a single bosonic Josephson junction in which their relative phase oscillates around π/2. The dynamics of relative phase of two weakly linked Bose-Einstein condensates can be studied by means of interference, while the dynamics of the exchange of lattice excitations in coupled nonlinear phononic waveguides can be observed by means of light scattering
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Nonlinear Dynamics of Electrostatically Actuated MEMS Arches
Al Hennawi, Qais M.
2015-05-01
In this thesis, we present theoretical and experimental investigation into the nonlinear statics and dynamics of clamped-clamped in-plane MEMS arches when excited by an electrostatic force. Theoretically, we first solve the equation of motion using a multi- mode Galarkin Reduced Order Model (ROM). We investigate the static response of the arch experimentally where we show several jumps due to the snap-through instability. Experimentally, a case study of in-plane silicon micromachined arch is studied and its mechanical behavior is measured using optical techniques. We develop an algorithm to extract various parameters that are needed to model the arch, such as the induced axial force, the modulus of elasticity, and the initially induced initial rise. After that, we excite the arch by a DC electrostatic force superimposed to an AC harmonic load. A softening spring behavior is observed when the excitation is close to the first resonance frequency due to the quadratic nonlinearity coming from the arch geometry and the electrostatic force. Also, a hardening spring behavior is observed when the excitation is close to the third (second symmetric) resonance frequency due to the cubic nonlinearity coming from mid-plane stretching. Then, we excite the arch by an electric load of two AC frequency components, where we report a combination resonance of the summed type. Agreement is reported among the theoretical and experimental work.
Das, Subhasish; Sen, Ramkrishna
2011-10-01
A logistic kinetic model was derived and validated to characterize the dynamics of a sporogenous bacterium in stationary phase with respect to sporulation and product formation. The kinetic constants as determined using this model are particularly important for describing intrinsic properties of a sporogenous bacterial culture in stationary phase. Non-linear curve fitting of the experimental data into the mathematical model showed very good correlation with the predicted values for sporulation and lipase production by Bacillus coagulans RK-02 culture in minimal media. Model fitting of literature data of sporulation and product (protease and amylase) formation in the stationary phase by some other Bacilli and comparison of the results of model fitting with those of Bacillus coagulans helped validate the significance and robustness of the developed kinetic model. Copyright © 2011 Elsevier Ltd. All rights reserved.
Modeling and Simulation of Nonlinear Micro-electromechanical Circular Plate
Directory of Open Access Journals (Sweden)
Chin-Chia Liu
2013-09-01
Full Text Available In the present study, the hybrid differential transformation and finite difference method is applied to analyze the dynamic behavior of the nonlinear micro-electromechanical circular plate actuated by combined DC / AC loading schemes. The analysis takes account of the axial residual stress and hydrostatic pressure acting on micro circular plate upper surface. The dynamic response of the plate as a function of the magnitude of the AC driving voltage is explored. Moreover, the effect of the initial gap height on the pull-in voltage of the plate is systematically explored.
Lin, Weilu; Wang, Zejian; Huang, Mingzhi; Zhuang, Yingping; Zhang, Siliang
2018-06-01
The isotopically non-stationary 13C labelling experiments, as an emerging experimental technique, can estimate the intracellular fluxes of the cell culture under an isotopic transient period. However, to the best of our knowledge, the issue of the structural identifiability analysis of non-stationary isotope experiments is not well addressed in the literature. In this work, the local structural identifiability analysis for non-stationary cumomer balance equations is conducted based on the Taylor series approach. The numerical rank of the Jacobian matrices of the finite extended time derivatives of the measured fractions with respect to the free parameters is taken as the criterion. It turns out that only one single time point is necessary to achieve the structural identifiability analysis of the cascaded linear dynamic system of non-stationary isotope experiments. The equivalence between the local structural identifiability of the cascaded linear dynamic systems and the local optimum condition of the nonlinear least squares problem is elucidated in the work. Optimal measurements sets can then be determined for the metabolic network. Two simulated metabolic networks are adopted to demonstrate the utility of the proposed method. Copyright © 2018 Elsevier Inc. All rights reserved.
Nonlinear dynamic of interaction of the relativistic electron beam with plasma
International Nuclear Information System (INIS)
Dorofeenko, V.G.; Krasovitskii, V.B.; Osmolovsky, S.I.
1994-01-01
Quasi-transverse instability of thin relativistic electron beam in a dense plasma is studied numerically and analytically in a broad range of the frequency of the beam modulation and external longitudinal magnetic field. It is shown that the nonlinear stage of solution depends on the increment of the instability. It is permitted to classify possible nonlinear solutions and also to determine optimal regimes of the modulation for transport of beam along magnetic field in a plasma without substantial radial divergence. Numerical calculations show, that injection of the bunches with parameters, corresponding nonlinear regime of the beam's instability, in neutrally-charged plasma permits to output on the stationary regime without loss of particles
Testing and Inference in Nonlinear Cointegrating Vector Error Correction Models
DEFF Research Database (Denmark)
Kristensen, Dennis; Rahbæk, Anders
In this paper, we consider a general class of vector error correction models which allow for asymmetric and non-linear error correction. We provide asymptotic results for (quasi-)maximum likelihood (QML) based estimators and tests. General hypothesis testing is considered, where testing...... of non-stationary non-linear time series models. Thus the paper provides a full asymptotic theory for estimators as well as standard and non-standard test statistics. The derived asymptotic results prove to be new compared to results found elsewhere in the literature due to the impact of the estimated...... symmetric non-linear error correction considered. A simulation study shows that the fi…nite sample properties of the bootstrapped tests are satisfactory with good size and power properties for reasonable sample sizes....
Testing and Inference in Nonlinear Cointegrating Vector Error Correction Models
DEFF Research Database (Denmark)
Kristensen, Dennis; Rahbek, Anders
In this paper, we consider a general class of vector error correction models which allow for asymmetric and non-linear error correction. We provide asymptotic results for (quasi-)maximum likelihood (QML) based estimators and tests. General hypothesis testing is considered, where testing...... of non-stationary non-linear time series models. Thus the paper provides a full asymptotic theory for estimators as well as standard and non-standard test statistics. The derived asymptotic results prove to be new compared to results found elsewhere in the literature due to the impact of the estimated...... symmetric non-linear error correction are considered. A simulation study shows that the finite sample properties of the bootstrapped tests are satisfactory with good size and power properties for reasonable sample sizes....
Waveform control method for mitigating harmonics of inverter systems with nonlinear load
DEFF Research Database (Denmark)
Wang, Haoran; Zhu, Guorong; Fu, Xiaobin
2015-01-01
instability in the DC power system, lower its efficiency, and shorten the lifetime of the DC source. This paper presents a general waveform control method that can mitigate the injection of the low-frequency ripple current by the single-phase DC/AC inverter into the DC source. It also discusses the inhibiting......DC power systems connecting to single-phase DC/AC inverters with nonlinear loads will have their DC sources being injected with AC ripple currents containing a low-frequency component at twice the output voltage frequency of the inverter and also other current harmonics. Such a current may create...
Large-Signal Lyapunov-Based Stability Analysis of DC/AC Inverters and Inverter-Based Microgrids
Kabalan, Mahmoud
Microgrid stability studies have been largely based on small-signal linearization techniques. However, the validity and magnitude of the linearization domain is limited to small perturbations. Thus, there is a need to examine microgrids with large-signal nonlinear techniques to fully understand and examine their stability. Large-signal stability analysis can be accomplished by Lyapunov-based mathematical methods. These Lyapunov methods estimate the domain of asymptotic stability of the studied system. A survey of Lyapunov-based large-signal stability studies showed that few large-signal studies have been completed on either individual systems (dc/ac inverters, dc/dc rectifiers, etc.) or microgrids. The research presented in this thesis addresses the large-signal stability of droop-controlled dc/ac inverters and inverter-based microgrids. Dc/ac power electronic inverters allow microgrids to be technically feasible. Thus, as a prelude to examining the stability of microgrids, the research presented in Chapter 3 analyzes the stability of inverters. First, the 13 th order large-signal nonlinear model of a droop-controlled dc/ac inverter connected to an infinite bus is presented. The singular perturbation method is used to decompose the nonlinear model into 11th, 9th, 7th, 5th, 3rd and 1st order models. Each model ignores certain control or structural components of the full order model. The aim of the study is to understand the accuracy and validity of the reduced order models in replicating the performance of the full order nonlinear model. The performance of each model is studied in three different areas: time domain simulations, Lyapunov's indirect method and domain of attraction estimation. The work aims to present the best model to use in each of the three domains of study. Results show that certain reduced order models are capable of accurately reproducing the performance of the full order model while others can be used to gain insights into those three areas of
Nonlinear transport behavior of low dimensional electron systems
Zhang, Jingqiao
The nonlinear behavior of low-dimensional electron systems attracts a great deal of attention for its fundamental interest as well as for potentially important applications in nanoelectronics. In response to microwave radiation and dc bias, strongly nonlinear electron transport that gives rise to unusual electron states has been reported in two-dimensional systems of electrons in high magnetic fields. There has also been great interest in the nonlinear response of quantum ballistic constrictions, where the effects of quantum interference, spatial dispersion and electron-electron interactions play crucial roles. In this thesis, experimental results of the research of low dimensional electron gas systems are presented. The first nonlinear phenomena were observed in samples of highly mobile two dimensional electrons in GaAs heavily doped quantum wells at different magnitudes of DC and AC (10 KHz to 20 GHz) excitations. We found that in the DC excitation regime the differential resistance oscillates with the DC current and external magnetic field, similar behavior was observed earlier in AlGaAs/GaAs heterostructures [C.L. Yang et al. ]. At external AC excitations the resistance is found to be also oscillating as a function of the magnetic field. However the form of the oscillations is considerably different from the DC case. We show that at frequencies below 100 KHz the difference is a result of a specific average of the DC differential resistance during the period of the external AC excitations. Secondly, in similar samples, strong suppression of the resistance by the electric field is observed in magnetic fields at which the Landau quantization of electron motion occurs. The phenomenon survives at high temperatures at which the Shubnikov de Haas oscillations are absent. The scale of the electric fields essential for the effect, is found to be proportional to temperature in the low temperature limit. We suggest that the strong reduction of the longitudinal resistance
Wang, Deli; Xu, Wei; Zhao, Xiangrong
2016-03-01
This paper aims to deal with the stationary responses of a Rayleigh viscoelastic system with zero barrier impacts under external random excitation. First, the original stochastic viscoelastic system is converted to an equivalent stochastic system without viscoelastic terms by approximately adding the equivalent stiffness and damping. Relying on the means of non-smooth transformation of state variables, the above system is replaced by a new system without an impact term. Then, the stationary probability density functions of the system are observed analytically through stochastic averaging method. By considering the effects of the biquadratic nonlinear damping coefficient and the noise intensity on the system responses, the effectiveness of the theoretical method is tested by comparing the analytical results with those generated from Monte Carlo simulations. Additionally, it does deserve attention that some system parameters can induce the occurrence of stochastic P-bifurcation.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Disrupted bandcount doubling in an AC-DC boost PFC circuit modeled by a time varying map
DEFF Research Database (Denmark)
Avrutin, Viktor; Zhusubaliyev, Zhanybai T.; Aroudi, Abdelali El
2016-01-01
Power factor correction converters are used in many applications as AC-DC power supplies aiming at maintaining a near unity power factor. Systems of this type are known to exhibit nonlinear phenomena such as sub-harmonic oscillations and chaotic regimes that cannot be described by traditional ave...
Energy Technology Data Exchange (ETDEWEB)
Gu, Beom W.; Choi, Su Y.; Rim, Chun T. [Dept. of Nuclear and Quantum Engineering, KAIST, Daejeon (Korea, Republic of); Choi, Young Soo [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Cai, Guowei; Seneviratne, Lakmal [Dept. of Aerospace Engineering, Khalifa University, Abu Dhabi (United Arab Emirates)
2016-08-15
In this paper, new tethered aerial robots including roaming tethered aerial robots (RTARs) for radioactive material sampling and stationary tethered aerial robots (STARs) for environment monitoring are proposed to meet extremely-long-endurance missions of nuclear power plants. The flight of the proposed tethered aerial robots may last for a few days or even a few months as long as the tethered cable provides continuous power. A high voltage AC or DC power system was newly adopted to reduce the mass of the tethered cable. The RTAR uses a tethered cable spooled from the aerial robot and an aerial tension control system. The aerial tension control system provides the appropriate tension to the tethered cable, which is accordingly laid down on the ground as the RTAR roams. The STAR includes a tethered cable spooled from the ground and a ground tension control system, which enables the STAR to reach high altitudes. Prototypes of the RTAR and STAR were designed and successfully demonstrated in outdoor environments, where the load power, power type, operating frequency, and flight attitude of the RTAR and STAR were: 180 W, AC 100 kHz, and 20 m; and 300 W, AC or DC 100 kHz, and 80 m, respectively.
Directory of Open Access Journals (Sweden)
Beom W. Gu
2016-08-01
Full Text Available In this paper, new tethered aerial robots including roaming tethered aerial robots (RTARs for radioactive material sampling and stationary tethered aerial robots (STARs for environment monitoring are proposed to meet extremely-long-endurance missions of nuclear power plants. The flight of the proposed tethered aerial robots may last for a few days or even a few months as long as the tethered cable provides continuous power. A high voltage AC or DC power system was newly adopted to reduce the mass of the tethered cable. The RTAR uses a tethered cable spooled from the aerial robot and an aerial tension control system. The aerial tension control system provides the appropriate tension to the tethered cable, which is accordingly laid down on the ground as the RTAR roams. The STAR includes a tethered cable spooled from the ground and a ground tension control system, which enables the STAR to reach high altitudes. Prototypes of the RTAR and STAR were designed and successfully demonstrated in outdoor environments, where the load power, power type, operating frequency, and flight attitude of the RTAR and STAR were: 180 W, AC 100 kHz, and 20 m; and 300 W, AC or DC 100 kHz, and 80 m, respectively.
A Numerical Simulation Of The Pulse Sequence Reconstruction in AC Biased TESs With a β Source
International Nuclear Information System (INIS)
Ferrari, Lorenza; Vaccarone, Renzo
2009-01-01
We study the response of micro-calorimeters based on Ir/Au TESs biased by an AC voltage in the MHz range to the power input generated by beta emission in a Re source thermally connected to the calorimeter itself. The micro-calorimeter is assumed to work at -80 mK, and the energy pulses corresponding to the beta emission have an energy distributed between zero and 2.58 KeV. In this numerical simulation the TES is inserted in a RLC resonating circuit, with a low quality factor. The thermal conductivities between the source and the calorimeter and that from the calorimeter to the heat sink are non-linear. The superconducting to normal transition of the TES is described by a realistic non-linear model. The AC current at the carrier frequency, modulated by the changing resistance of the TES, is demodulated and the output is filtered. The resulting signal is analyzed to deduce the attainable time resolution and the linearity of the response.
Improving Power Quality in AC Supply Grids
Directory of Open Access Journals (Sweden)
Piotr Fabijański
2015-12-01
Full Text Available This paper describes a digital and actual model of the UPQC (Unified Power Quality Conditioner integrated system for power quality improvement. The UPQC’s design and its connection to an AC supply grid, 1-phase and 3-phase alike, provide effective compensation of unwanted interferences in the waveforms of load supply voltages and non-linear load currents. This article presents an overview of topologies and control strategies. The study of the UPQC confirmed its positive impact on the power quality. The electricity parameters were significantly improved. Total harmonic distortion in supply voltage THDu decreased six-fold to 1.89%, and total harmonic distortion in load current THDi decreased more than ten-fold to 2.38% for a non-linear load (uncontrolled bridge rectifier with load L. Additionally, symmetrisation of supply voltages and reactive power compensation Q of linear load was obtained. The UPQC integrated system for power quality improvement can be used wherever high-quality and PN-EN 50160 standard – compliant electricity is required.
Stationary states of the two-dimensional nonlinear Schrödinger model with disorder
DEFF Research Database (Denmark)
Gaididei, Yuri Borisovich; Hendriksen, D.; Christiansen, Peter Leth
1998-01-01
Solitonlike excitations in the presence of disorder in the two-dimensional cubic nonlinear Schrodinger equation are analyzed. The continuum as well as the discrete problem are analyzed. In the continuum model, otherwise unstable excitations are stabilized in the presence of disorder...
McKenzie, J. F.; Dubinin, E.; Sauer, K.; Doyle, T. B.
2004-08-01
Perturbation reductive procedures, as used to analyse various weakly nonlinear plasma waves (solitons and periodic waves), normally lead to the dynamical system being described by KdV, Burgers' or a nonlinear Schrödinger-type equation, with properties that can be deduced from an array of mathematical techniques. Here we develop a fully nonlinear theory of one-dimensional stationary plasma waves, which elucidates the common nature of various diverse wave phenomena. This is accomplished by adopting an essentially fluid dynamic viewpoint. In this unified treatment the constants of the motion (for mass, momentum and energy) lead naturally to the construction of the wave structure equations. It is shown, for example, that electrostatic, Hall magnetohydrodynamic and ion cyclotron acoustic nonlinear waves all obey first-order differential equations of the same generic type for the longitudinal flow field of the wave. The equilibrium points, which define the soliton amplitude, are given by the compressive and/or rarefactive roots of a total plasma ‘energy’ or ‘momentum’ function characterizing the wave type. This energy function, which is an algebraic combination of the Bernoulli momentum and energy functions for the longitudinal flow field, is the fluid dynamic counterpart of the pseudo-potentials, which are characteristic of system structure equations formulated in other than fluid variables. Another general feature of the structure equation is the phenomenon of choked flow, which occurs when the flow speed becomes sonic. It is this trans-sonic property that limits the soliton amplitudes and defines the critical collective Mach numbers of the waves. These features are also obtained in multi-component plasmas where, for example, in a bi-ion plasma, momentum exchanges between protons and heavier ions are mediated by the Maxwell magnetic stresses. With a suitable generalization of the concept of a sonic point in a bi-ion system and the corresponding choked flow
Detection of unusual events and trends in complex non-stationary data streams
International Nuclear Information System (INIS)
Charlton-Perez, C.; Perez, R.B.; Protopopescu, V.; Worley, B.A.
2011-01-01
The search for unusual events and trends hidden in multi-component, nonlinear, non-stationary, noisy signals is extremely important for diverse applications, ranging from power plant operation to homeland security. In the context of this work, we define an unusual event as a local signal disturbance and a trend as a continuous carrier of information added to and different from the underlying baseline dynamics. The goal of this paper is to investigate the feasibility of detecting hidden events inside intermittent signal data sets corrupted by high levels of noise, by using the Hilbert-Huang empirical mode decomposition method.
Simple relations between mean passage times and Kramers' stationary rate
International Nuclear Information System (INIS)
Boilley, David; Jurado, Beatriz; Schmitt, Christelle
2004-01-01
The classical problem of the escape time of a metastable potential well in a thermal environment is generally studied by various quantities like Kramers' stationary escape rate, mean first passage time, nonlinear relaxation time, or mean last passage time. In addition, numerical simulations lead to the definition of other quantities as the long-time limit escape rate and the transient time. In this paper, we propose some simple analytical relations between all these quantities. In particular, we point out the hypothesis used to evaluate these various times in order to clarify their comparison and applicability, and show how average times include the transient time and the long-time limit of the escape rate
Stationary and non-stationary extreme value modeling of extreme temperature in Malaysia
Hasan, Husna; Salleh, Nur Hanim Mohd; Kassim, Suraiya
2014-09-01
Extreme annual temperature of eighteen stations in Malaysia is fitted to the Generalized Extreme Value distribution. Stationary and non-stationary models with trend are considered for each station and the Likelihood Ratio test is used to determine the best-fitting model. Results show that three out of eighteen stations i.e. Bayan Lepas, Labuan and Subang favor a model which is linear in the location parameter. A hierarchical cluster analysis is employed to investigate the existence of similar behavior among the stations. Three distinct clusters are found in which one of them consists of the stations that favor the non-stationary model. T-year estimated return levels of the extreme temperature are provided based on the chosen models.
Improved algorithm for solving nonlinear parabolized stability equations
Zhao, Lei; Zhang, Cun-bo; Liu, Jian-xin; Luo, Ji-sheng
2016-08-01
Due to its high computational efficiency and ability to consider nonparallel and nonlinear effects, nonlinear parabolized stability equations (NPSE) approach has been widely used to study the stability and transition mechanisms. However, it often diverges in hypersonic boundary layers when the amplitude of disturbance reaches a certain level. In this study, an improved algorithm for solving NPSE is developed. In this algorithm, the mean flow distortion is included into the linear operator instead of into the nonlinear forcing terms in NPSE. An under-relaxation factor for computing the nonlinear terms is introduced during the iteration process to guarantee the robustness of the algorithm. Two case studies, the nonlinear development of stationary crossflow vortices and the fundamental resonance of the second mode disturbance in hypersonic boundary layers, are presented to validate the proposed algorithm for NPSE. Results from direct numerical simulation (DNS) are regarded as the baseline for comparison. Good agreement can be found between the proposed algorithm and DNS, which indicates the great potential of the proposed method on studying the crossflow and streamwise instability in hypersonic boundary layers. Project supported by the National Natural Science Foundation of China (Grant Nos. 11332007 and 11402167).
Communication: Newton homotopies for sampling stationary points of potential energy landscapes
Energy Technology Data Exchange (ETDEWEB)
Mehta, Dhagash, E-mail: dmehta@nd.edu [Department of Applied and Computational Mathematics and Statistics, University of Notre Dame, Notre Dame, Indiana 46556 (United States); University Chemical Laboratory, The University of Cambridge, Cambridge CB2 1EW (United Kingdom); Chen, Tianran, E-mail: chentia1@msu.edu [Department of Mathematics, Michigan State University, East Lansing, Michigan 48823 (United States); Hauenstein, Jonathan D., E-mail: hauenstein@nd.edu [Department of Applied and Computational Mathematics and Statistics, University of Notre Dame, Notre Dame, Indiana 46556 (United States); Wales, David J., E-mail: dw34@cam.ac.uk [University Chemical Laboratory, The University of Cambridge, Cambridge CB2 1EW (United Kingdom)
2014-09-28
One of the most challenging and frequently arising problems in many areas of science is to find solutions of a system of multivariate nonlinear equations. There are several numerical methods that can find many (or all if the system is small enough) solutions but they all exhibit characteristic problems. Moreover, traditional methods can break down if the system contains singular solutions. Here, we propose an efficient implementation of Newton homotopies, which can sample a large number of the stationary points of complicated many-body potentials. We demonstrate how the procedure works by applying it to the nearest-neighbor ϕ{sup 4} model and atomic clusters.
Communication: Newton homotopies for sampling stationary points of potential energy landscapes
International Nuclear Information System (INIS)
Mehta, Dhagash; Chen, Tianran; Hauenstein, Jonathan D.; Wales, David J.
2014-01-01
One of the most challenging and frequently arising problems in many areas of science is to find solutions of a system of multivariate nonlinear equations. There are several numerical methods that can find many (or all if the system is small enough) solutions but they all exhibit characteristic problems. Moreover, traditional methods can break down if the system contains singular solutions. Here, we propose an efficient implementation of Newton homotopies, which can sample a large number of the stationary points of complicated many-body potentials. We demonstrate how the procedure works by applying it to the nearest-neighbor ϕ 4 model and atomic clusters
Global sea surface temperature (SST) anomalies can affect terrestrial precipitation via ocean-atmosphere interaction known as climate teleconnection. Non-stationary and non-linear characteristics of the ocean-atmosphere system make the identification of the teleconnection signals...
Climatic feedbacks between stationary and transient eddies
International Nuclear Information System (INIS)
Branscome, L.E.
1994-01-01
Stationary eddies make a significant contribution to poleward heat transport during Northern Hemisphere winter, equaling the transport by transient eddies. On the other hand, stationary eddy transport during the summer is negligible. The effect of topography on time-mean stationary waves and low-frequency variability has been widely studied. In contrast, little attention has been given to the climatic feedbacks associated with stationary eddies. Furthermore, the relationship between stationary and transient eddies in the context of global and regional climate is not well understood. The response of the climate system to anthropogenic forcing is likely to have some dependence on stationary wave transport and its interaction with transient eddies. Some early GCM simulations and observational analyses indicate a strong feedback between the meridional heat fluxes of stationary and transient eddies
Free-vibration acoustic resonance of a nonlinear elastic bar
Tarumi, Ryuichi; Oshita, Yoshihito
2011-02-01
Free-vibration acoustic resonance of a one-dimensional nonlinear elastic bar was investigated by direct analysis in the calculus of variations. The Lagrangian density of the bar includes a cubic term of the deformation gradient, which is responsible for both geometric and constitutive nonlinearities. By expanding the deformation function into a complex Fourier series, we derived the action integral in an analytic form and evaluated its stationary conditions numerically with the Ritz method for the first three resonant vibration modes. This revealed that the bar shows the following prominent nonlinear features: (i) amplitude dependence of the resonance frequency; (ii) symmetry breaking in the vibration pattern; and (iii) excitation of the high-frequency mode around nodal-like points. Stability of the resonant vibrations was also addressed in terms of a convex condition on the strain energy density.
Nonlinear dynamics of a parametrically driven sine-Gordon system
DEFF Research Database (Denmark)
Grønbech-Jensen, Niels; Kivshar, Yuri S.; Samuelsen, Mogens Rugholm
1993-01-01
We consider a sine-Gordon system, driven by an ac parametric force in the presence of loss. It is demonstrated that a breather can be maintained in a steady state at half of the external frequency. In the small-amplitude limit the effect is described by an effective nonlinear Schrodinger equation...
Enhancement of nonlinear optical properties of compounds of silica ...
Indian Academy of Sciences (India)
Enhancement of nonlinear optical properties of compounds of silica glass and metallic nanoparticle. A GHARAATI1,∗ and A KAMALDAR1,2. 1Department of Physics, Payame Noor University, P.O. Box 19395-3697, Tehran, Iran. 2Department of Education 1, Shiraz, Iran. ∗. Corresponding author. E-mail: agharaati@pnu.ac.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Theory for stationary nonlinear wave propagation in complex magnetic geometry
International Nuclear Information System (INIS)
Watanabe, T.; Hojo, H.; Nishikawa, Kyoji.
1977-08-01
We present our recent efforts to derive a systematic calculation scheme for nonlinear wave propagation in the self-consistent plasma profile in complex magnetic-field geometry. Basic assumptions and/or approximations are i) use of the collisionless two-fluid model with an equation of state; ii) restriction to a steady state propagation and iii) existence of modified magnetic surface, modification due to Coriolis' force. We discuss four situations: i) weak-field propagation without static flow, ii) arbitrary field strength with flow in axisymmetric system, iii) weak field limit of case ii) and iv) arbitrary field strength in nonaxisymmetric torus. Except for case iii), we derive a simple variation principle, similar to that of Seligar and Whitham, by introducing appropriate coordinates. In cases i) and iii), we derive explicit results for quasilinear profile modification. (auth.)
Stationary response of multi-degree-of-freedom vibro-impact systems to Poisson white noises
International Nuclear Information System (INIS)
Wu, Y.; Zhu, W.Q.
2008-01-01
The stationary response of multi-degree-of-freedom (MDOF) vibro-impact (VI) systems to random pulse trains is studied. The system is formulated as a stochastically excited and dissipated Hamiltonian system. The constraints are modeled as non-linear springs according to the Hertz contact law. The random pulse trains are modeled as Poisson white noises. The approximate stationary probability density function (PDF) for the response of MDOF dissipated Hamiltonian systems to Poisson white noises is obtained by solving the fourth-order generalized Fokker-Planck-Kolmogorov (FPK) equation using perturbation approach. As examples, two-degree-of-freedom (2DOF) VI systems under external and parametric Poisson white noise excitations, respectively, are investigated. The validity of the proposed approach is confirmed by using the results obtained from Monte Carlo simulation. It is shown that the non-Gaussian behaviour depends on the product of the mean arrival rate of the impulses and the relaxation time of the oscillator
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Hadri-Hamida, A.; Allag, A.; Hammoudi, M. Y.; Mimoune, S. M.; Zerouali, S.; Ayad, M. Y.; Becherif, M.; Miliani, E.; Miraoui, A.
2009-04-01
This paper presents a new control strategy for a three phase PWM converter, which consists of applying an adaptive nonlinear control. The input-output feedback linearization approach is based on the exact cancellation of the nonlinearity, for this reason, this technique is not efficient, because system parameters can vary. First a nonlinear system modelling is derived with state variables of the input current and the output voltage by using power balance of the input and output, the nonlinear adaptive backstepping control can compensate the nonlinearities in the nominal system and the uncertainties. Simulation results are obtained using Matlab/Simulink. These results show how the adaptive backstepping law updates the system parameters and provide an efficient control design both for tracking and regulation in order to improve the power factor.
International Nuclear Information System (INIS)
Ibrahim, R. S.; El-Kalaawy, O. H.
2006-01-01
The relativistic nonlinear self-consistent equations for a collisionless cold plasma with stationary ions [R. S. Ibrahim, IMA J. Appl. Math. 68, 523 (2003)] are extended to 3 and 3+1 dimensions. The resulting system of equations is reduced to the sine-Poisson equation. The truncated Painleve expansion and reduction of the partial differential equation to a quadrature problem (RQ method) are described and applied to obtain the traveling wave solutions of the sine-Poisson equation for stationary and nonstationary equations in 3 and 3+1 dimensions describing the charge-density equilibrium configuration model
Polarization dynamics in nonlinear anisotropic fibers
International Nuclear Information System (INIS)
Komarov, Andrey; Komarov, Konstantin; Meshcheriakov, Dmitry; Amrani, Foued; Sanchez, Francois
2010-01-01
We give an extensive study of polarization dynamics in anisotropic fibers exhibiting a third-order index nonlinearity. The study is performed in the framework of the Stokes parameters with the help of the Poincare sphere. Stationary states are determined, and their stability is investigated. The number of fixed points and their stability depend on the respective magnitude of the linear and nonlinear birefringence. A conservation relation analogous to the energy conservation in mechanics allows evidencing a close analogy between the movement of the polarization in the Poincare sphere and the motion of a particle in a potential well. Two distinct potentials are found, leading to the existence of two families of solutions, according to the sign of the total energy of the equivalent mechanical system. The mechanical analogy allows us to fully characterize the solutions and also to determine analytically the associated beat lengths. General analytical solutions are given for the two families in terms of Jacobi's functions. The intensity-dependent transmission of a fiber placed between two crossed polarizers is calculated. Optimal conditions for efficient nonlinear switching compatible with mode-locking applications are determined. The general case of a nonlinear fiber ring with an intracavity polarizer placed between two polarization controllers is also considered.
Theory of nonlinear interaction of particles and waves in an inverse plasma maser. Part 1
International Nuclear Information System (INIS)
Krivitsky, V.S.; Vladimirov, S.V.
1991-01-01
An expression is obtained for the collision integral describing the simultaneous interaction of plasma particles with resonant and non-resonant waves. It is shown that this collision integral is determined by two processes: a 'direct' nonlinear interaction of particles and waves, and the influence of the non-stationary of the system. The expression for the nonlinear collision integral is found to be quite different from the expression for a quasi-linear collision integral; in particular, the nonlinear integral contains higher-order derivatives of the distribution function with respect to momentum than the quasi-linear one. (author)
Directory of Open Access Journals (Sweden)
Dilem Yıldırım
2017-06-01
Full Text Available This study explores the empirical validity of the purchasing power parity (PPP hypothesis between Turkey and its four major trading partners, the European Union, Russia, China and the US. Accounting for the nonlinear nature of real exchange rates, we employ a battery of recently developed nonlinear unit root tests. Our empirical results reveal that nonlinear unit root tests deliver stronger evidence in favour of the PPP hypothesis when compared to the conventional unit root tests only if nonlinearities in real exchange rates are correctly specified. Furthermore, it emerges from our findings that the real exchange rates of the countries having a free trade agreement are more likely to behave as linear stationary processes.
Nonlinear stability, bifurcation and resonance in granular plane Couette flow
Shukla, Priyanka; Alam, Meheboob
2010-11-01
A weakly nonlinear stability theory is developed to understand the effect of nonlinearities on various linear instability modes as well as to unveil the underlying bifurcation scenario in a two-dimensional granular plane Couette flow. The relevant order parameter equation, the Landau-Stuart equation, for the most unstable two-dimensional disturbance has been derived using the amplitude expansion method of our previous work on the shear-banding instability.ootnotetextShukla and Alam, Phys. Rev. Lett. 103, 068001 (2009). Shukla and Alam, J. Fluid Mech. (2010, accepted). Two types of bifurcations, Hopf and pitchfork, that result from travelling and stationary linear instabilities, respectively, are analysed using the first Landau coefficient. It is shown that the subcritical instability can appear in the linearly stable regime. The present bifurcation theory shows that the flow is subcritically unstable to disturbances of long wave-lengths (kx˜0) in the dilute limit, and both the supercritical and subcritical states are possible at moderate densities for the dominant stationary and traveling instabilities for which kx=O(1). We show that the granular plane Couette flow is prone to a plethora of resonances.ootnotetextShukla and Alam, J. Fluid Mech. (submitted, 2010)
DEFF Research Database (Denmark)
Vich, Catalina; Berg, Rune W.; Guillamon, Antoni
2017-01-01
Subthreshold fluctuations in neuronal membrane potential traces contain nonlinear components, and employing nonlinear models might improve the statistical inference. We propose a new strategy to estimate synaptic conductances, which has been tested using in silico data and applied to in vivo...... recordings. The model is constructed to capture the nonlinearities caused by subthreshold activated currents, and the estimation procedure can discern between excitatory and inhibitory conductances using only one membrane potential trace. More precisely, we perform second order approximations of biophysical...... models to capture the subthreshold nonlinearities, resulting in quadratic integrate-and-fire models, and apply approximate maximum likelihood estimation where we only suppose that conductances are stationary in a 50–100 ms time window. The results show an improvement compared to existent procedures...
Nonlinear density waves in a marginally stable gravitating disk
International Nuclear Information System (INIS)
Korchagin, V.I.
1986-01-01
The evolution of short nonlinear density waves in a disk at the stability limit is studied for arbitrary values of the radial wave number k/sub r/. For waves with wave numbers that do not lie at the minimum of the dispersion curve, the behavior of the amplitude is described by a nonlinear parabolic equation; however, stationary soliton solutions cannot exist in such a system since there is no dispersion spreading of a packet. For wave numbers lying at the minimum of the dispersion curve, soliton structures with determined amplitude are possible. In stable gravitating disks and in a disk at the stability limit, two physically different types of soliton can exist
DEFF Research Database (Denmark)
Rasmussen, Kim; Christiansen, Peter Leth; Johansson, Magnus
1998-01-01
A one-dimensional discrete nonlinear Schrodinger (DNLS) model with the power dependence, r(-s) on the distance r, of dispersive interactions is proposed. The stationary states of the system are studied both analytically and numerically. Two kinds of trial functions, exp-like and sech-like are exp...
Linear and Non-Linear Control Techniques Applied to Actively Lubricated Journal Bearings
DEFF Research Database (Denmark)
Nicoletti, Rodrigo; Santos, Ilmar
2003-01-01
The main objectives of actively lubricated bearings are the simultaneous reduction of wear and vibration between rotating and stationary machinery parts. For reducing wear and dissipating vibration energy until certain limits, one can count with the conventional hydrodynamic lubrication. For furt......The main objectives of actively lubricated bearings are the simultaneous reduction of wear and vibration between rotating and stationary machinery parts. For reducing wear and dissipating vibration energy until certain limits, one can count with the conventional hydrodynamic lubrication....... For further reduction of shaft vibrations one can count with the active lubrication action, which is based on injecting pressurised oil into the bearing gap through orifices machined in the bearing sliding surface. The design and efficiency of some linear (PD, PI and PID) and non-linear controllers, applied...... vibration reduction of unbalance response of a rigid rotor, where the PD and the non-linear P controllers show better performance for the frequency range of study (0 to 80 Hz). The feasibility of eliminating rotor-bearing instabilities (phenomena of whirl) by using active lubrication is also investigated...
Michoski, Craig; Janhunen, Salomon; Faghihi, Danial; Carey, Varis; Moser, Robert
2017-10-01
The suppression of micro-turbulence and ultimately the inhibition of large-scale instabilities observed in tokamak plasmas is partially characterized by the onset of a global stationary state. This stationary attractor corresponds experimentally to a state of ``marginal stability'' in the plasma. The critical threshold that characterizes the onset in the nonlinear regime is observed both experimentally and numerically to exhibit an upshift relative to the linear theory. That is, the onset in the stationary state is up-shifted from those predicted by the linear theory as a function of the ion temperature gradient R0 /LT . Because the transition to this state with enhanced transport and therefore reduced confinement times is inaccessible to the linear theory, strategies for developing nonlinear reduced physics models to predict the upshift have been ongoing. As a complement to these effort, the principle aim of this work is to establish low-fidelity surrogate models that can be used to predict instability driven loss of confinement using training data from high-fidelity models. DE-SC0008454 and DE-AC02-09CH11466.
Linear and nonlinear optical properties of a hydrogenic donor in lens-shaped quantum dots
International Nuclear Information System (INIS)
Vahdani, M.R.K.; Rezaei, G.
2009-01-01
Optical transitions in a Lens-Shaped Quantum Dot (LSD) are investigated in the presence of a hydrogenic impurity. The electronic wave functions are obtained analytically and the energy eigenvalues are calculated numerically. The density matrix formulation with the intersubband relaxation are used to evaluate the (linear and third order nonlinear) absorption coefficient (AC) and the change in the refractive indices (RI) analytically. The effect of the size of the LSD and optical intensity on the AC and RI are investigated. It is found that AC and RI are strongly affected by the optical intensity and the size of the LSD.
Linear and nonlinear optical properties of a hydrogenic donor in lens-shaped quantum dots
Energy Technology Data Exchange (ETDEWEB)
Vahdani, M.R.K. [Department of Physics, College of Sciences, Shiraz University, Shiraz 71454 (Iran, Islamic Republic of); Rezaei, G., E-mail: grezaei@mail.yu.ac.i [Department of Physics, College of Sciences, Yasouj University, Yasouj 75914 (Iran, Islamic Republic of)
2009-08-17
Optical transitions in a Lens-Shaped Quantum Dot (LSD) are investigated in the presence of a hydrogenic impurity. The electronic wave functions are obtained analytically and the energy eigenvalues are calculated numerically. The density matrix formulation with the intersubband relaxation are used to evaluate the (linear and third order nonlinear) absorption coefficient (AC) and the change in the refractive indices (RI) analytically. The effect of the size of the LSD and optical intensity on the AC and RI are investigated. It is found that AC and RI are strongly affected by the optical intensity and the size of the LSD.
Nonlinear magnetic electron tripolar vortices in streaming plasmas.
Vranjes, J; Marić, G; Shukla, P K
2000-06-01
Magnetic electron modes in nonuniform magnetized and unmagnetized streaming plasmas, with characteristic frequencies between the ion and electron plasma frequencies and at spatial scales of the order of the collisionless skin depth, are studied. Two coupled equations, for the perturbed (in the case of magnetized plasma) or self-generated (for the unmagnetized plasma case) magnetic field, and the temperature, are solved in the strongly nonlinear regime and stationary traveling solutions in the form of tripolar vortices are found.
Renormalization theory of stationary homogeneous strong turbulence in a collisionless plasma
International Nuclear Information System (INIS)
Zhang, Y.Z.
1984-01-01
A renormalization procedure for the perturbation expansion of the Vlasov-Poisson equation is presented to describe stationary homogeneous turbulence. By using the diagramatic scheme the theory is shown to be renormalizable to any order. The expressions for the renormalized propagator, the renormalized dielectric function, and the intrinsically incoherent source are given. The renormalization leads to a complete separation of the fluctuating distribution function f/sub k/ into two parts, the coherent part, which is proved to represent the dielectric effect of the medium, and the intrinsically incoherent part, which represents the effect of nonlinear source. The turbulent collisional operator in the transport equation is proved equal to GAMMA 0 , the frequency broadening when k = 0
International Nuclear Information System (INIS)
Donoso, Guillermo; Ladera, Celso L
2012-01-01
We study the nonlinear oscillations of a forced and weakly dissipative spring–magnet system moving in the magnetic fields of two fixed coaxial, hollow induction coils. As the first coil is excited with a dc current, both a linear and a cubic magnet-position dependent force appear on the magnet–spring system. The second coil, located below the first, excited with an ac current, provides the oscillating magnetic driving force on the system. From the magnet–coil interactions, we obtain, analytically, the nonlinear motion equation of the system, found to be a forced and damped cubic Duffing oscillator moving in a quartic potential. The relative strengths of the coefficients of the motion equation can be easily set by varying the coils’ dc and ac currents. We demonstrate, theoretically and experimentally, the nonlinear behaviour of this oscillator, including its oscillation modes and nonlinear resonances, the fold-over effect, the hysteresis and amplitude jumps, and its chaotic behaviour. It is an oscillating system suitable for teaching an advanced experiment in nonlinear dynamics both at senior undergraduate and graduate levels. (paper)
The stationary Alfven wave in laboratory and space regimes
Finnegan, S. M.
In this thesis, a non-linear, collisional, two-fluid model of uniform plasma convection across field-aligned current (FAC) sheets, describing stationary Alfven (StA) waves is developed in support of laboratory experiments performed to test the hypothesis that a stationary inertial Alfven wave pattern forms within a channel of parallel electron current across which plasma is convected. In a previous work, Knudsen (D. J. Knudsen, J. Geophys. Res. 101, 10,761 (1996)) showed that, for cold, collisionless plasma, stationary inertial Alfven (StIA) waves can accelerate electrons parallel to a background magnetic field and cause large, time-independent plasma-density variations having spatial periodicity in the direction of the convective flow over a broad range of spatial scales and energies. Here, Knudsen's model has been generalized for warm, collisional, anisotropic plasma. The inclusion of parallel electron thermal pressure introduces dispersive effects which extend the model to the kinetic (beta > me/mi) regime. The effects of both ion-neutral and electron-ion collisional resistivity on StIA and stationary kinetic Alfven (StKA) wave solutions is studied. Conditions for both periodic and solitary wave solutions are identified. In the small amplitude limit, it is shown that the StA wave equation reduces to the differential equation describing the behavior of a forced harmonic oscillator. Analytical solutions are obtained for both a step and impulse, of finite width, forcing functions. Plasma rotation experiments in the West Virginia University Q-machine (WVUQ) demonstrate that an electron-emitting spiral electrode produces controllable, parabolic radial profile of floating potential, while the space potential showed no such structure. Laser-induced fluorescence measurements confirmed that the azimuthal ion drift velocity is inconsistent with a drift due to a gradient in the space potential. Experiments designed to produce StIA wave signatures were performed in the
Differential quadrature method of nonlinear bending of functionally graded beam
Gangnian, Xu; Liansheng, Ma; Wang, Youzhi; Quan, Yuan; Weijie, You
2018-02-01
Using the third-order shear deflection beam theory (TBT), nonlinear bending of functionally graded (FG) beams composed with various amounts of ceramic and metal is analyzed utilizing the differential quadrature method (DQM). The properties of beam material are supposed to accord with the power law index along to thickness. First, according to the principle of stationary potential energy, the partial differential control formulae of the FG beams subjected to a distributed lateral force are derived. To obtain numerical results of the nonlinear bending, non-dimensional boundary conditions and control formulae are dispersed by applying the DQM. To verify the present solution, several examples are analyzed for nonlinear bending of homogeneous beams with various edges. A minute parametric research is in progress about the effect of the law index, transverse shear deformation, distributed lateral force and boundary conditions.
DEFF Research Database (Denmark)
Christiansen, Peter Leth; Gaididei, Yuri Borisovich; Rasmussen, Kim
1996-01-01
The dynamics of two-dimensional discrete structures is studied in the framework of the generalized two-dimensional discrete nonlinear Schrodinger equation. The nonlinear coupling in the form of the Ablowitz-Ladik nonlinearity and point impurities is taken into account. The stability properties...... of the stationary solutions are examined. The essential importance of the existence of stable immobile solitons in the two-dimensional dynamics of the traveling pulses is demonstrated. The typical scenario of the two-dimensional quasicollapse of a moving intense pulse represents the formation of standing trapped...... narrow spikes. The influence of the point impurities on this dynamics is also investigated....
Vasta, M.; Roberts, J. B.
1998-06-01
Methods for using fourth order spectral quantities to estimate the unknown parameters in non-linear, randomly excited dynamic systems are developed. Attention is focused on the case where only the response is measurable and the excitation is unmeasurable and known only in terms of a stochastic process model. The approach is illustrated through application to a non-linear oscillator with both non-linear damping and stiffness and with excitation modelled as a stationary Gaussian white noise process. The methods have applications in studies of the response of structures to random environmental loads, such as wind and ocean wave forces.
Non-linear wave equations:Mathematical techniques
International Nuclear Information System (INIS)
1978-01-01
An account of certain well-established mathematical methods, which prove useful to deal with non-linear partial differential equations is presented. Within the strict framework of Functional Analysis, it describes Semigroup Techniques in Banach Spaces as well as variational approaches towards critical points. Detailed proofs are given of the existence of local and global solutions of the Cauchy problem and of the stability of stationary solutions. The formal approach based upon invariance under Lie transformations deserves attention due to its wide range of applicability, even if the explicit solutions thus obtained do not allow for a deep analysis of the equations. A compre ensive introduction to the inverse scattering approach and to the solution concept for certain non-linear equations of physical interest are also presented. A detailed discussion is made about certain convergence and stability problems which arise in importance need not be emphasized. (author) [es
Quasi-stationary mechanics of elastic continua with bending stiffness wrapping on a pulley system
Kaczmarczyk, S.; Mirhadizadeh, S.
2016-05-01
In many engineering applications elastic continua such as ropes and belts often are subject to bending when they pass over pulleys / sheaves. In this paper the quasi-stationary mechanics of a cable-pulley system is studied. The cable is modelled as a moving Euler- Bernoulli beam. The distribution of tension is non-uniform along its span and due to the bending stiffness the contact points at the pulley-beam boundaries are not unknown. The system is described by a set of nonlinear ordinary differential equations with undetermined boundary conditions. The resulting nonlinear Boundary Value Problem (BVP) with unknown boundaries is solved by converting the problem into the ‘standard’ form defined over a fixed interval. Numerical results obtained for a range of typical configurations with relevant boundary conditions applied demonstrate that due to the effects of bending stiffness the angels of wrap are reduced and the span tensions are increased.
Chen, Yun; Yang, Hui
2013-01-01
Heart rate variability (HRV) analysis has emerged as an important research topic to evaluate autonomic cardiac function. However, traditional time and frequency-domain analysis characterizes and quantify only linear and stationary phenomena. In the present investigation, we made a comparative analysis of three alternative approaches (i.e., wavelet multifractal analysis, Lyapunov exponents and multiscale entropy analysis) for quantifying nonlinear dynamics in heart rate time series. Note that these extracted nonlinear features provide information about nonlinear scaling behaviors and the complexity of cardiac systems. To evaluate the performance, we used 24-hour HRV recordings from 54 healthy subjects and 29 heart failure patients, available in PhysioNet. Three nonlinear methods are evaluated not only individually but also in combination using three classification algorithms, i.e., linear discriminate analysis, quadratic discriminate analysis and k-nearest neighbors. Experimental results show that three nonlinear methods capture nonlinear dynamics from different perspectives and the combined feature set achieves the best performance, i.e., sensitivity 97.7% and specificity 91.5%. Collectively, nonlinear HRV features are shown to have the promise to identify the disorders in autonomic cardiovascular function.
Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis
International Nuclear Information System (INIS)
Hossan, Mohammad Robiul; Dillon, Robert; Dutta, Prashanta
2014-01-01
Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices
Stationary and Transient Response Statistics
DEFF Research Database (Denmark)
Madsen, Peter Hauge; Krenk, Steen
1982-01-01
The covariance functions for the transient response of a linear MDOF-system due to stationary time limited excitation with an arbitrary frequency content are related directly to the covariance functions of the stationary response. For rational spectral density functions closed form expressions fo...
Directory of Open Access Journals (Sweden)
Yukun Ren
2018-02-01
Full Text Available Induced-charge electroosmosis has attracted lots of attention from the microfluidic community over the past decade. Most previous researches on this subject focused on induced-charge electroosmosis (ICEO vortex streaming actuated on ideally polarizable surfaces immersed in electrolyte solutions. Starting from this point, we conduct herein a linear asymptotic analysis on nonlinear electroosmotic flow next to leaky dielectric blocks of arbitrary electrical conductivity and dielectric permittivity in harmonic AC electric fields, and theoretically demonstrate that observable ICEO fluid motion can be generated at high field frequencies in the vicinity of nearly insulating semiconductors, a very low electrical conductivity, of which can evidently increase the double-layer relaxation frequency (inversely proportional to the solid permittivity to be much higher than the typical reciprocal RC time constant for induced double-layer charging on ideally polarizable surfaces. A computational model is developed to study the feasibility of this high-frequency vortex flow field of ICEO for sample mixing in microfluidics, in which the usage of AC voltage signal at high field frequencies may be beneficial to suppress electrochemical reactions to some extent. The influence of various parameters for developing an efficient mixer is investigated, and an integrated arrangement of semiconductor block array is suggested for achieving a reliable mixing performance at relatively high sample fluxes. Our physical demonstration with high-frequency ICEO next to leaky dielectric blocks using a simple channel structure offers valuable insights into the design of high-throughput micromixers for a variety of lab-on-a-chip applications.
Finite element solution of quasistationary nonlinear magnetic field
International Nuclear Information System (INIS)
Zlamal, Milos
1982-01-01
The computation of quasistationary nonlinear two-dimensional magnetic field leads to the following problem. There is given a bounded domain OMEGA and an open nonempty set R included in OMEGA. We are looking for the magnetic vector potential u(x 1 , x 2 , t) which satisifies: 1) a certain nonlinear parabolic equation and an initial condition in R: 2) a nonlinear elliptic equation in S = OMEGA - R which is the stationary case of the above mentioned parabolic equation; 3) a boundary condition on delta OMEGA; 4) u as well as its conormal derivative are continuous accross the common boundary of R and S. This problem is formulated in two equivalent abstract ways. There is constructed an approximate solution completely discretized in space by a generalized Galerkin method (straight finite elements are a special case) and by backward A-stable differentiation methods in time. Existence and uniqueness of a weak solution is proved as well as a weak and strong convergence of the approximate solution to this solution. There are also derived error bounds for the solution of the two-dimensional nonlinear magnetic field equations under the assumption that the exact solution is sufficiently smooth
Finite-element analysis and comparison of the AC loss performance of BSCCO and YBCO conductors
International Nuclear Information System (INIS)
Stavrev, Svetlomir; Grilli, Francesco; Dutoit, Bertrand; Ashworth, Stephen
2006-01-01
The AC loss performance of two BSCCO and two YBCO conductors of different geometry, characterized by the same self-field critical current of 150 A, is analysed and compared quantitatively. The comparison is made using the finite-element method with a nonlinear B-dependent E-J relation. A new shell-region model is utilised for the simulations of thin YBCO strips. Different AC working conditions are simulated: self-field, applied external field, and combined transport current and external perpendicular field application. Magnetic field and current density profiles are investigated in order to illustrate the reasons for the loss difference in the conductors. Depending on the application, the advantages of using BSCCO or YBCO conductors with specific geometry are outlined
Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer
Directory of Open Access Journals (Sweden)
Phuc Thinh Doan
2013-06-01
Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43
Directory of Open Access Journals (Sweden)
Catalina Vich
2017-07-01
Full Text Available Subthreshold fluctuations in neuronal membrane potential traces contain nonlinear components, and employing nonlinear models might improve the statistical inference. We propose a new strategy to estimate synaptic conductances, which has been tested using in silico data and applied to in vivo recordings. The model is constructed to capture the nonlinearities caused by subthreshold activated currents, and the estimation procedure can discern between excitatory and inhibitory conductances using only one membrane potential trace. More precisely, we perform second order approximations of biophysical models to capture the subthreshold nonlinearities, resulting in quadratic integrate-and-fire models, and apply approximate maximum likelihood estimation where we only suppose that conductances are stationary in a 50–100 ms time window. The results show an improvement compared to existent procedures for the models tested here.
30 CFR 57.14115 - Stationary grinding machines.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Stationary grinding machines. 57.14115 Section... and Equipment Safety Devices and Maintenance Requirements § 57.14115 Stationary grinding machines. Stationary grinding machines, other than special bit grinders, shall be equipped with— (a) Peripheral hoods...
Nonlinear mode conversion with chaotic soliton generation at plasma resonance
International Nuclear Information System (INIS)
Pietsch, H.; Laedke, E.W.; Spatschek, K.H.
1993-01-01
The resonant absorption of electromagnetic waves near the critical density in inhomogeneous plasmas is studied. A driven nonlinear Schroedinger equation for the mode-converted oscillations is derived by multiple-scaling techniques. The model is simulated numerically. The generic transition from a stationary to a time-dependent solution is investigated. Depending on the parameters, a time-chaotic behavior is found. By a nonlinear analysis, based on the inverse scattering transform, solitons of a corresponding integrable equation are identified as the dominant coherent structures of the chaotic dynamics. Finally, a map is presented which predicts chaotic soliton generation and emission at the critical density. Its qualitative behavior, concerning the bifurcation points, is in excellent agreement with the numerical simulations
Universal Critical Power for Nonlinear Schroedinger Equations with a Symmetric Double Well Potential
International Nuclear Information System (INIS)
Sacchetti, Andrea
2009-01-01
Here we consider stationary states for nonlinear Schroedinger equations in any spatial dimension n with symmetric double well potentials. These states may bifurcate as the strength of the nonlinear term increases and we observe two different pictures depending on the value of the nonlinearity power: a supercritical pitchfork bifurcation, and a subcritical pitchfork bifurcation with two asymmetric branches occurring as the result of saddle-node bifurcations. We show that in the semiclassical limit, or for a large barrier between the two wells, the first kind of bifurcation always occurs when the nonlinearity power is less than a critical value; in contrast, when the nonlinearity power is larger than such a critical value then we always observe the second scenario. The remarkable fact is that such a critical value is a universal constant in the sense that it does not depend on the shape of the double well potential and on the dimension n.
Energy Technology Data Exchange (ETDEWEB)
Han, Jiu-Ning, E-mail: hanjiuning@126.com; He, Yong-Lin; Luo, Jun-Hua; Nan, Ya-Gong; Han, Zhen-Hai; Dong, Guang-Xing [College of Physics and Electromechanical Engineering, Hexi University, Zhangye 734000 (China); Duan, Wen-Shan [College of Physics and Electronic Engineering, Northwest Normal University, Lanzhou 730070 (China); Li, Jun-Xiu [College of Civil Engineering, Hexi University, Zhangye 734000 (China)
2014-01-15
With the consideration of the superthermal electron distribution, we present a theoretical investigation about the nonlinear propagation of electron-acoustic solitary and shock waves in a dissipative, nonplanar non-Maxwellian plasma comprised of cold electrons, superthermal hot electrons, and stationary ions. The reductive perturbation technique is used to obtain a modified Korteweg-de Vries Burgers equation for nonlinear waves in this plasma. We discuss the effects of various plasma parameters on the time evolution of nonplanar solitary waves, the profile of shock waves, and the nonlinear structure induced by the collision between planar solitary waves. It is found that these parameters have significant effects on the properties of nonlinear waves and collision-induced nonlinear structure.
Asymptotic Theory for the QMLE in GARCH-X Models with Stationary and Non-Stationary Covariates
DEFF Research Database (Denmark)
Han, Heejoon; Kristensen, Dennis
as captured by its long-memory parameter dx; in particular, we allow for both stationary and non-stationary covariates. We show that the QMLE'’s of the regression coefficients entering the volatility equation are consistent and normally distributed in large samples independently of the degree of persistence....... This implies that standard inferential tools, such as t-statistics, do not have to be adjusted to the level of persistence. On the other hand, the intercept in the volatility equation is not identifi…ed when the covariate is non-stationary which is akin to the results of Jensen and Rahbek (2004, Econometric...
30 CFR 56.14115 - Stationary grinding machines.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Stationary grinding machines. 56.14115 Section... Equipment Safety Devices and Maintenance Requirements § 56.14115 Stationary grinding machines. Stationary grinding machines, other than special bit grinders, shall be equipped with— (a) Peripheral hoods capable of...
International Nuclear Information System (INIS)
Elmer, Christopher E.; Vleck, Erik S. van
2003-01-01
This article is concerned with effect of spatial and temporal discretizations on traveling wave solutions to parabolic PDEs (Nagumo type) possessing piecewise linear bistable nonlinearities. Solution behavior is compared in terms of waveforms and in terms of the so-called (a,c) relationship where a is a parameter controlling the bistable nonlinearity by varying the potential energy difference of the two phases and c is the wave speed of the traveling wave. Uniform spatial discretizations and A(α) stable linear multistep methods in time are considered. Results obtained show that although the traveling wave solutions to parabolic PDEs are stationary for only one value of the parameter a,a 0 , spatial discretization of these PDEs produce traveling waves which are stationary for a nontrivial interval of a values which include a 0 , i.e., failure of the solution to propagate in the presence of a driving force. This is true no matter how wide the interface is with respect to the discretization. For temporal discretizations at large wave speeds the set of parameter a values for which there are traveling wave solutions is constrained. An analysis of a complete discretization points out the potential for nonuniqueness in the (a,c) relationship
The hair-trigger effect for a class of nonlocal nonlinear equations
Finkelshtein, Dmitri; Tkachov, Pasha
2018-06-01
We prove the hair-trigger effect for a class of nonlocal nonlinear evolution equations on which have only two constant stationary solutions, 0 and . The effect consists in that the solution with an initial condition non identical to zero converges (when time goes to ) to θ locally uniformly in . We also find sufficient conditions for existence, uniqueness and comparison principle in the considered equations.
Nonlinear nuclear magnetic resonance in ferromagnets
International Nuclear Information System (INIS)
Nurgaliev, T.
1988-01-01
The properties of nonlinear nuclear magnetic resonance (NMR) have been studied theoretically by taking into account the interaction between NMR and FMR in the ferromagnets. The Landau-Lifshitz-Bloch equations, describing the electron and nuclear magnetization behaviour in ferromagnets are presented in an integral form for a weakly excited electronic system. The stationary solution of these equations has been analysed in the case of equal NMR and FMR frequencies: the criteria for the appearance of two stable dynamic states is found and the high-frequency magnetic susceptibility for these systems is investigated. 2 figs., 8 refs
Elwakil, S. A.; El-hanbaly, A. M.; Elgarayh, A.; El-Shewy, E. K.; Kassem, A. I.
2014-11-01
The properties of nonlinear electron-acoustic rogue waves have been investigated in an unmagnetized collisionless four-component plasma system consisting of a cold electron fluid, non-thermal hot electrons obeying a non-thermal distribution, an electron beam and stationary ions. It is found that the basic set of fluid equations is reduced to a nonlinear Schrodinger equation. The dependence of rogue wave profiles on the electron beam and energetic population parameter are discussed. The results of the present investigation may be applicable in auroral zone plasma.
Nonlinear electrokinetics at large voltages
Energy Technology Data Exchange (ETDEWEB)
Bazant, Martin Z [Department of Chemical Engineering and Institute for Soldier Nanotechnologies, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Sabri Kilic, Mustafa; Ajdari, Armand [Department of Mathematics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Storey, Brian D [Franklin W Olin College of Engineering, Needham, MA 02492 (United States)], E-mail: bazant@mit.edu
2009-07-15
The classical theory of electrokinetic phenomena assumes a dilute solution of point-like ions in chemical equilibrium with a surface whose double-layer voltage is of order the thermal voltage, k{sub B}T/e=25 mV. In nonlinear 'induced-charge' electrokinetic phenomena, such as ac electro-osmosis, several volts {approx}100k{sub B}T/e are applied to the double layer, and the theory breaks down and cannot explain many observed features. We argue that, under such a large voltage, counterions 'condense' near the surface, even for dilute bulk solutions. Based on simple models, we predict that the double-layer capacitance decreases and the electro-osmotic mobility saturates at large voltages, due to steric repulsion and increased viscosity of the condensed layer, respectively. The former suffices to explain observed high-frequency flow reversal in ac electro-osmosis; the latter leads to a salt concentration dependence of induced-charge flows comparable to experiments, although a complete theory is still lacking.
Virtual Stationary Automata for Mobile Networks
National Research Council Canada - National Science Library
Dolev, Shlomi; Gilbert, Seth; Lahiani, Limor; Lynch, Nancy; Nolte, Tina
2005-01-01
We define a programming abstraction for mobile networks called the Virtual Stationary Automata programming layer, consisting of real mobile clients, virtual timed I/O automata called virtual stationary automata (VSAs...
Non-stationary hydrologic frequency analysis using B-spline quantile regression
Nasri, B.; Bouezmarni, T.; St-Hilaire, A.; Ouarda, T. B. M. J.
2017-11-01
Hydrologic frequency analysis is commonly used by engineers and hydrologists to provide the basic information on planning, design and management of hydraulic and water resources systems under the assumption of stationarity. However, with increasing evidence of climate change, it is possible that the assumption of stationarity, which is prerequisite for traditional frequency analysis and hence, the results of conventional analysis would become questionable. In this study, we consider a framework for frequency analysis of extremes based on B-Spline quantile regression which allows to model data in the presence of non-stationarity and/or dependence on covariates with linear and non-linear dependence. A Markov Chain Monte Carlo (MCMC) algorithm was used to estimate quantiles and their posterior distributions. A coefficient of determination and Bayesian information criterion (BIC) for quantile regression are used in order to select the best model, i.e. for each quantile, we choose the degree and number of knots of the adequate B-spline quantile regression model. The method is applied to annual maximum and minimum streamflow records in Ontario, Canada. Climate indices are considered to describe the non-stationarity in the variable of interest and to estimate the quantiles in this case. The results show large differences between the non-stationary quantiles and their stationary equivalents for an annual maximum and minimum discharge with high annual non-exceedance probabilities.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Probabilistic dual heuristic programming-based adaptive critic
Herzallah, Randa
2010-02-01
Adaptive critic (AC) methods have common roots as generalisations of dynamic programming for neural reinforcement learning approaches. Since they approximate the dynamic programming solutions, they are potentially suitable for learning in noisy, non-linear and non-stationary environments. In this study, a novel probabilistic dual heuristic programming (DHP)-based AC controller is proposed. Distinct to current approaches, the proposed probabilistic (DHP) AC method takes uncertainties of forward model and inverse controller into consideration. Therefore, it is suitable for deterministic and stochastic control problems characterised by functional uncertainty. Theoretical development of the proposed method is validated by analytically evaluating the correct value of the cost function which satisfies the Bellman equation in a linear quadratic control problem. The target value of the probabilistic critic network is then calculated and shown to be equal to the analytically derived correct value. Full derivation of the Riccati solution for this non-standard stochastic linear quadratic control problem is also provided. Moreover, the performance of the proposed probabilistic controller is demonstrated on linear and non-linear control examples.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Stationary states of a PT symmetric two-mode Bose–Einstein condensate
International Nuclear Information System (INIS)
Graefe, Eva-Maria
2012-01-01
The understanding of nonlinear PT symmetric quantum systems, arising for example in the theory of Bose–Einstein condensates in PT symmetric potentials, is widely based on numerical investigations, and little is known about generic features induced by the interplay of PT symmetry and nonlinearity. To gain deeper insights it is important to have analytically solvable toy models at hand. In the present paper the stationary states of a simple toy model of a PT symmetric system previously introduced in [1, 2] are investigated. The model can be interpreted as a simple description of a Bose–Einstein condensate in a PT symmetric double well trap in a two-mode approximation. The eigenvalues and eigenstates of the system can be explicitly calculated in a straightforward manner; the resulting structures resemble those that have recently been found numerically for a more realistic PT symmetric double delta potential. In addition, a continuation of the system is introduced that allows an interpretation in terms of a simple linear matrix model. This article is part of a special issue of Journal of Physics A: Mathematical and Theoretical devoted to ‘Quantum physics with non-Hermitian operators’. (paper)
Strong Stationary Duality for Diffusion Processes
Fill, James Allen; Lyzinski, Vince
2014-01-01
We develop the theory of strong stationary duality for diffusion processes on compact intervals. We analytically derive the generator and boundary behavior of the dual process and recover a central tenet of the classical Markov chain theory in the diffusion setting by linking the separation distance in the primal diffusion to the absorption time in the dual diffusion. We also exhibit our strong stationary dual as the natural limiting process of the strong stationary dual sequence of a well ch...
International Nuclear Information System (INIS)
Kono, M.; Kawakita, M.
1990-01-01
A nonlinear equation describing the development of the Buneman instability has been derived and solved with the aid of Hirota's bilinear transform [J. Math. Phys. 14, 810 (1973)] to give a variety of stationary solutions, such as pulsating solitons, temporally localized and spatially periodic solutions, as well as ordinary solitons
Acoustic nonlinear periodic waves in pair-ion plasmas
Mahmood, Shahzad; Kaladze, Tamaz; Ur-Rehman, Hafeez
2013-09-01
Electrostatic acoustic nonlinear periodic (cnoidal) waves and solitons are investigated in unmagnetized pair-ion plasmas consisting of same mass and oppositely charged ion species with different temperatures. Using reductive perturbation method and appropriate boundary conditions, the Korteweg-de Vries (KdV) equation is derived. The analytical solutions of both cnoidal wave and soliton solutions are discussed in detail. The phase plane plots of cnoidal and soliton structures are shown. It is found that both compressive and rarefactive cnoidal wave and soliton structures are formed depending on the temperature ratio of positive and negative ions in pair-ion plasmas. In the special case, it is revealed that the amplitude of soliton may become larger than it is allowed by the nonlinear stationary wave theory which is equal to the quantum tunneling by particle through a potential barrier effect. The serious flaws in the earlier published results by Yadav et al., [PRE 52, 3045 (1995)] and Chawla and Misra [Phys. Plasmas 17, 102315 (2010)] of studying ion acoustic nonlinear periodic waves are also pointed out.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Nonlinear processes of magnons in insulating ferromagnetic materials
International Nuclear Information System (INIS)
Araujo, C.B. de.
1975-04-01
The representation of coherent states is used to investigate the excitation of magnons by 'parallel pumping', 'perpendicular pumping' and 'phonon pumping'. The stationary regime of the processes is studied with respect to the magnon population and the statistic behavior of the system below and just above the threshold. Particular attention is given to the thermodynamic and the coherence properties of the parametric states. The results show that just above the threshold the generated states become coherent. Also, it is shown that the non-linear processes have characteristics of a second-order phase transition with the pumping power as the 'reservoir variable' and the transverse dynamical magnetization as the 'order parameter'. Finally, the possibilities to extend the theory, its experimental check, and its convenience to study the other nonlinear processes of magnons and phonons in magnetic insulators are discussed. (author) [pt
Energy Technology Data Exchange (ETDEWEB)
Azadeh, A; Seraj, O [Department of Industrial Engineering and Research Institute of Energy Management and Planning, Center of Excellence for Intelligent-Based Experimental Mechanics, College of Engineering, University of Tehran, P.O. Box 11365-4563 (Iran); Saberi, M [Department of Industrial Engineering, University of Tafresh (Iran); Institute for Digital Ecosystems and Business Intelligence, Curtin University of Technology, Perth (Australia)
2010-06-15
This study presents an integrated fuzzy regression and time series framework to estimate and predict electricity demand for seasonal and monthly changes in electricity consumption especially in developing countries such as China and Iran with non-stationary data. Furthermore, it is difficult to model uncertain behavior of energy consumption with only conventional fuzzy regression (FR) or time series and the integrated algorithm could be an ideal substitute for such cases. At First, preferred Time series model is selected from linear or nonlinear models. For this, after selecting preferred Auto Regression Moving Average (ARMA) model, Mcleod-Li test is applied to determine nonlinearity condition. When, nonlinearity condition is satisfied, the preferred nonlinear model is selected and defined as preferred time series model. At last, the preferred model from fuzzy regression and time series model is selected by the Granger-Newbold. Also, the impact of data preprocessing on the fuzzy regression performance is considered. Monthly electricity consumption of Iran from March 1994 to January 2005 is considered as the case of this study. The superiority of the proposed algorithm is shown by comparing its results with other intelligent tools such as Genetic Algorithm (GA) and Artificial Neural Network (ANN). (author)
The nonlinear ambipolar drift and periodic structure of non-self-sustained discharge
International Nuclear Information System (INIS)
Dem'yanov, A.V.; Mazalov, D.A.; Napartovich, A.P.
1995-01-01
Gas discharge is well known to be strongly nonlinear self-organizing system. The diverse nonlinear structures, observed at different conditions (arc, stationary and non-stationary strata, hot spot patterns on the electrodes and so on), are usually explained by the theory taking into account the processes of diffusion and thermoconductivity. In plasma of high pressure discharge these processes become negligible within the characteristic intervals. At these conditions electron drift becomes the main process. Owing to the continuity of full current and plasma quasineutrality there appear effective flows of convective type with the rate depending on the concentration of charged particles. It is this reason that is responsible for the observed structure of the non-moving luminous layers in non-self-sustained discharge in 10%H 2 +Ar mixture under p≥l atm. The present report shows the results of detail experimental and theoretical study of this phenomenon. The experiments have been carried out on the setup with the discharge gap of about 1 cm or of much greater size. Mach-Zender interferometer and an image-converter intensifier operating as a strip or framing camera. The experiments have been carried out under the pressure 1-3 atm. They show that the stationary layers sequentially appear one after another along the direction from the cathode to the anode. Interferometry shows that there is a gas density modulation corresponding to the periodical structure of fringes. The picture of Fig.1 is a typical interferogram, and that of Fig.2 is a gas density distribution restored from it
Nonlinear behaviors of a bounded electron beam-plasma system
International Nuclear Information System (INIS)
Iizuka, Satoru; Saeki, Koichi; Sato, Noriyoshi; Hatta, Yoshisuke
1985-01-01
Nonlinear developments of a bounded electron beam-plasma system including stationary electrons are investigated experimentally. A stable double layer is formed as a result of ion trapping in a growing negative potential dip induced by the Pierce instability above the current regime of the Buneman instability. In the in-between regime of the Buneman and Pierce instabilities, energetic ions are observed. This effective ion heating is caused by ion detrapping due to double-layer disruption, being consistent with computer simulation. (author)
International Nuclear Information System (INIS)
Combes, J.M.
1980-10-01
A complementary approach to the time dependent scattering theory for one-body Schroedinger operators is presented. The stationary theory is concerned with objects of quantum theory like scattering waves and amplitudes. In the more recent abstract stationary theory some generalized form of the Lippman-Schwinger equation plays the basic role. Solving this equation leads to a linear map between generalized eigenfunctions of the perturbed and unperturbed operators. This map is the section at fixed energy of the wave-operator from the time dependent theory. Although the radiation condition does not appears explicitely in this formulation it can be shown to hold a posteriori in a variety of situations thus restoring the link with physical theories
Relation between current sheets and vortex sheets in stationary incompressible MHD
Directory of Open Access Journals (Sweden)
D. H. Nickeler
2012-03-01
Full Text Available Magnetohydrodynamic configurations with strong localized current concentrations and vortices play an important role in the dissipation of energy in space and astrophysical plasma. Within this work we investigate the relation between current sheets and vortex sheets in incompressible, stationary equilibria. For this approach it is helpful that the similar mathematical structure of magnetohydrostatics and stationary incompressible hydrodynamics allows us to transform static equilibria into stationary ones. The main control function for such a transformation is the profile of the Alfvén-Mach number MA, which is always constant along magnetic field lines, but can change from one field line to another. In the case of a global constant MA, vortices and electric current concentrations are parallel. More interesting is the nonlinear case, where MA varies perpendicular to the field lines. This is a typical situation at boundary layers like the magnetopause, heliopause, the solar wind flowing around helmet streamers and at the boundary of solar coronal holes. The corresponding current and vortex sheets show in some cases also an alignment, but not in every case. For special density distributions in 2-D, it is possible to have current but no vortex sheets. In 2-D, vortex sheets of field aligned-flows can also exist without strong current sheets, taking the limit of small Alfvén Mach numbers into account. The current sheet can vanish if the Alfvén Mach number is (almost constant and the density gradient is large across some boundary layer. It should be emphasized that the used theory is not only valid for small Alfvén Mach numbers MA MA ≲ 1. Connection to other theoretical approaches and observations and physical effects in space plasmas are presented. Differences in the various aspects of theoretical investigations of current sheets and vortex sheets are given.
Romero, Pilar; Barderas, Gonzalo; Mejuto, Javier
2018-05-01
We present a qualitative analysis in a phase space to determine the longitudinal equilibrium positions on the planetary stationary orbits by applying an analytical model that considers linear gravitational perturbations. We discuss how these longitudes are related with the orientation of the planetary principal inertia axes with respect to their Prime Meridians, and then we use this determination to derive their positions with respect to the International Celestial Reference Frame. Finally, a numerical analysis of the non-linear effects of the gravitational fields on the equilibrium point locations is developed and their correlation with gravity field anomalies shown.
Multi-diffusive nonlinear Fokker–Planck equation
International Nuclear Information System (INIS)
Ribeiro, Mauricio S; Casas, Gabriela A; Nobre, Fernando D
2017-01-01
Nonlinear Fokker–Planck equations, characterized by more than one diffusion term, have appeared recently in literature. Here, it is shown that these equations may be derived either from approximations in a master equation, or from a Langevin-type approach. An H-theorem is proven, relating these Fokker–Planck equations to an entropy composed by a sum of contributions, each of them associated with a given diffusion term. Moreover, the stationary state of the Fokker–Planck equation is shown to coincide with the equilibrium state, obtained by extremization of the entropy, in the sense that both procedures yield precisely the same equation. Due to the nonlinear character of this equation, the equilibrium probability may be obtained, in most cases, only by means of numerical approaches. Some examples are worked out, where the equilibrium probability distribution is computed for nonlinear Fokker–Planck equations presenting two diffusion terms, corresponding to an entropy characterized by a sum of two contributions. It is shown that the resulting equilibrium distribution, in general, presents a form that differs from a sum of the equilibrium distributions that maximizes each entropic contribution separately, although in some cases one may construct such a linear combination as a good approximation for the equilibrium distribution. (paper)
On the Stability of Three-Dimensional Boundary Layers. Part 1; Linear and Nonlinear Stability
Janke, Erik; Balakumar, Ponnampalam
1999-01-01
The primary stability of incompressible three-dimensional boundary layers is investigated using the Parabolized Stability Equations (PSE). We compute the evolution of stationary and traveling disturbances in the linear and nonlinear region prior to transition. As model problems, we choose Swept Hiemenz Flow and the DLR Transition Experiment. The primary stability results for Swept Hiemenz Flow agree very well with computations by Malik et al. For the DLR Experiment, the mean flow profiles are obtained by solving the boundary layer equations for the measured pressure distribution. Both linear and nonlinear results show very good agreement with the experiment.
International Nuclear Information System (INIS)
Patra, A.; Saha Ray, S.
2014-01-01
Highlights: • A stationary transport equation has been solved using the technique of Haar wavelet Collocation Method. • This paper intends to provide the great utility of Haar wavelets to nuclear science problem. • In the present paper, two-dimensional Haar wavelets are applied. • The proposed method is mathematically very simple, easy and fast. - Abstract: This paper emphasizes on finding the solution for a stationary transport equation using the technique of Haar wavelet Collocation Method (HWCM). Haar wavelet Collocation Method is efficient and powerful in solving wide class of linear and nonlinear differential equations. Recently Haar wavelet transform has gained the reputation of being a very effective tool for many practical applications. This paper intends to provide the great utility of Haar wavelets to nuclear science problem. In the present paper, two-dimensional Haar wavelets are applied for solution of the stationary Neutron Transport Equation in homogeneous isotropic medium. The proposed method is mathematically very simple, easy and fast. To demonstrate about the efficiency of the method, one test problem is discussed. It can be observed from the computational simulation that the numerical approximate solution is much closer to the exact solution
Modulational instability and discrete breathers in a nonlinear helicoidal lattice model
Ding, Jinmin; Wu, Tianle; Chang, Xia; Tang, Bing
2018-06-01
We investigate the problem on the discrete modulation instability of plane waves and discrete breather modes in a nonlinear helicoidal lattice model, which is described by a discrete nonlinear Schrödinger equation with the first-, second-, and third-neighbor coupling. By means of the linear stability analysis, we present an analytical expression of the instability growth rate and identify the regions of modulational instability of plane waves. It is shown that the introduction of the third-neighbor coupling will affect the shape of the areas of modulational instability significantly. Based on the results obtained by the modulational instability analysis, we predict the existence conditions for the stationary breather modes. Otherwise, by making use of the semidiscrete multiple-scale method, we obtain analytical solutions of discrete breather modes and analyze their properties for different types of nonlinearities. Our results show that the discrete breathers obtained are stable for a long time only when the system exhibits the repulsive nonlinearity. In addition, it is found that the existence of the stable bright discrete breather closely relates to the presence of the third-neighbor coupling.
Vector control of three-phase AC machines system development in the practice
Quang, Nguyen Phung; Dittrich, J
2015-01-01
This book addresses the vector control of three-phase AC machines, in particular induction motors with squirrel-cage rotors (IM), permanent magnet synchronous motors (PMSM) and doubly-fed induction machines (DFIM), from a practical design and development perspective. The main focus is on the application of IM and PMSM in electrical drive systems, where field-orientated control has been successfully established in practice. It also discusses the use of grid-voltage oriented control of DFIMs in wind power plants. This second, enlarged edition includes new insights into flatness-based nonlinear
Stationary infinitely divisible processes
DEFF Research Database (Denmark)
Barndorff-Nielsen, Ole E.
Several recent strands of work has led to the consideration of various types of continuous time stationary and infinitely divisible processes. A review of these types, with some new results, is presented.......Several recent strands of work has led to the consideration of various types of continuous time stationary and infinitely divisible processes. A review of these types, with some new results, is presented....
Flood frequency analysis of historical flood data under stationary and non-stationary modelling
Machado, M. J.; Botero, B. A.; López, J.; Francés, F.; Díez-Herrero, A.; Benito, G.
2015-06-01
Historical records are an important source of information on extreme and rare floods and fundamental to establish a reliable flood return frequency. The use of long historical records for flood frequency analysis brings in the question of flood stationarity, since climatic and land-use conditions can affect the relevance of past flooding as a predictor of future flooding. In this paper, a detailed 400 yr flood record from the Tagus River in Aranjuez (central Spain) was analysed under stationary and non-stationary flood frequency approaches, to assess their contribution within hazard studies. Historical flood records in Aranjuez were obtained from documents (Proceedings of the City Council, diaries, chronicles, memoirs, etc.), epigraphic marks, and indirect historical sources and reports. The water levels associated with different floods (derived from descriptions or epigraphic marks) were computed into discharge values using a one-dimensional hydraulic model. Secular variations in flood magnitude and frequency, found to respond to climate and environmental drivers, showed a good correlation between high values of historical flood discharges and a negative mode of the North Atlantic Oscillation (NAO) index. Over the systematic gauge record (1913-2008), an abrupt change on flood magnitude was produced in 1957 due to constructions of three major reservoirs in the Tagus headwaters (Bolarque, Entrepeñas and Buendia) controlling 80% of the watershed surface draining to Aranjuez. Two different models were used for the flood frequency analysis: (a) a stationary model estimating statistical distributions incorporating imprecise and categorical data based on maximum likelihood estimators, and (b) a time-varying model based on "generalized additive models for location, scale and shape" (GAMLSS) modelling, which incorporates external covariates related to climate variability (NAO index) and catchment hydrology factors (in this paper a reservoir index; RI). Flood frequency
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
Nonlinear Rayleigh-Taylor instability in partially ionized plasma and the equatorial spread - F
International Nuclear Information System (INIS)
Jain, R.K.; Das, A.C.
1978-01-01
The nonlinear evolution of the collisional gravitation induced Rayleigh-Taylor (R-T) instability in the equatorial F region is investigated taking into account the finite Larmor radius (FLR) effects and the complete ion inertial term in ion equation of motion. A special class of coherent weakly nonlinear modes as solutions to the wave equation describing R-T instability driven modes is obtained. The leading nonlinear effects in the wave equation are found to appear through Vsub(L), the ion diamagnetic drift which essentially gives the FLR corrections. It is shown that the R-T modes in the equatorial F region can evolve into coherent, nonlinear, almost sinusoidal, stationary wave structures. These structures are found to travel with a constant phase velocity and to have slightly distorted sinusoidal shapes. These results seem to have a good agreement with many of the recent rocket and satellite observations of the equatorial spread F irregularities. (author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Nonlinear Impedance of Whole Cells Near an Electrode as a Probe of Mitochondrial Activity
Directory of Open Access Journals (Sweden)
John H. Miller Jr.
2011-04-01
Full Text Available By simultaneously measuring the bulk media and electrode interface voltages of a yeast (Saccharomyces cerevisiae suspension subjected to an AC voltage, a yeast-dependent nonlinear response was found only near the current injection electrodes. Computer simulation of yeast near a current injection electrode found an enhanced voltage drop across the yeast near the electrode due to slowed charging of the electrode interfacial capacitance. This voltage drop is sufficient to induce conformation change in membrane proteins. Disruption of the mitochondrial electron transport chain is found to significantly change the measured nonlinear current response, suggesting nonlinear impedance can be used as a non-invasive probe of cellular metabolic activity.
Unit Root Testing and Estimation in Nonlinear ESTAR Models with Normal and Non-Normal Errors.
Directory of Open Access Journals (Sweden)
Umair Khalil
Full Text Available Exponential Smooth Transition Autoregressive (ESTAR models can capture non-linear adjustment of the deviations from equilibrium conditions which may explain the economic behavior of many variables that appear non stationary from a linear viewpoint. Many researchers employ the Kapetanios test which has a unit root as the null and a stationary nonlinear model as the alternative. However this test statistics is based on the assumption of normally distributed errors in the DGP. Cook has analyzed the size of the nonlinear unit root of this test in the presence of heavy-tailed innovation process and obtained the critical values for both finite variance and infinite variance cases. However the test statistics of Cook are oversized. It has been found by researchers that using conventional tests is dangerous though the best performance among these is a HCCME. The over sizing for LM tests can be reduced by employing fixed design wild bootstrap remedies which provide a valuable alternative to the conventional tests. In this paper the size of the Kapetanios test statistic employing hetroscedastic consistent covariance matrices has been derived and the results are reported for various sample sizes in which size distortion is reduced. The properties for estimates of ESTAR models have been investigated when errors are assumed non-normal. We compare the results obtained through the fitting of nonlinear least square with that of the quantile regression fitting in the presence of outliers and the error distribution was considered to be from t-distribution for various sample sizes.
Stationary solutions and asymptotic flatness I
International Nuclear Information System (INIS)
Reiris, Martin
2014-01-01
In general relativity, a stationary isolated system is defined as an asymptotically flat (AF) stationary spacetime with compact material sources. Other definitions that are less restrictive on the type of asymptotic could in principle be possible. Between this article and its sequel, we show that under basic assumptions, asymptotic flatness indeed follows as a consequence of Einstein's theory. In particular, it is proved that any vacuum stationary spacetime-end whose (quotient) manifold is diffeomorphic to R 3 minus a ball and whose Killing field has its norm bounded away from zero, is necessarily AF with Schwarzschildian fall off. The ‘excised’ ball would contain (if any) the actual material body, but this information is unnecessary to reach the conclusion. In this first article, we work with weakly asymptotically flat (WAF) stationary ends, a notion that generalizes as much as possible that of the AF end, and prove that WAF ends are AF with Schwarzschildian fall off. Physical and mathematical implications are also discussed. (paper)
Analyzing Non Stationary Processes in Radiometers
Racette, Paul
2010-01-01
The lack of well-developed techniques for modeling changing statistical moments in our observations has stymied the application of stochastic process theory for many scientific and engineering applications. Non linear effects of the observation methodology is one of the most perplexing aspects to modeling non stationary processes. This perplexing problem was encountered when modeling the effect of non stationary receiver fluctuations on the performance of radiometer calibration architectures. Existing modeling approaches were found not applicable; particularly problematic is modeling processes across scales over which they begin to exhibit non stationary behavior within the time interval of the calibration algorithm. Alternatively, the radiometer output is modeled as samples from a sequence random variables; the random variables are treated using a conditional probability distribution function conditioned on the use of the variable in the calibration algorithm. This approach of treating a process as a sequence of random variables with non stationary stochastic moments produce sensible predictions of temporal effects of calibration algorithms. To test these model predictions, an experiment using the Millimeter wave Imaging Radiometer (MIR) was conducted. The MIR with its two black body calibration references was configured in a laboratory setting to observe a third ultra-stable reference (CryoTarget). The MIR was programmed to sequentially sample each of the three references in approximately a 1 second cycle. Data were collected over a six-hour interval. The sequence of reference measurements form an ensemble sample set comprised of a series of three reference measurements. Two references are required to estimate the receiver response. A third reference is used to estimate the uncertainty in the estimate. Typically, calibration algorithms are designed to suppress the non stationary effects of receiver fluctuations. By treating the data sequence as an ensemble
Nonlinear Development and Secondary Instability of Traveling Crossflow Vortices
Li, Fei; Choudhari, Meelan M.; Duan, Lian; Chang, Chau-Lyan
2014-01-01
Transition research under NASA's Aeronautical Sciences Project seeks to develop a validated set of variable fidelity prediction tools with known strengths and limitations, so as to enable "sufficiently" accurate transition prediction and practical transition control for future vehicle concepts. This paper builds upon prior effort targeting the laminar breakdown mechanisms associated with stationary crossflow instability over a swept-wing configuration relevant to subsonic aircraft with laminar flow technology. Specifically, transition via secondary instability of traveling crossflow modes is investigated as an alternate scenario for transition. Results show that, for the parameter range investigated herein, secondary instability of traveling crossflow modes becomes insignificant in relation to the secondary instability of the stationary modes when the relative initial amplitudes of the traveling crossflow instability are lower than those of the stationary modes by approximately two orders of magnitudes or more. Linear growth predictions based on the secondary instability theory are found to agree well with those based on PSE and DNS, with the most significant discrepancies being limited to spatial regions of relatively weak secondary growth, i.e., regions where the primary disturbance amplitudes are smaller in comparison to its peak amplitude. Nonlinear effects on secondary instability evolution is also investigated and found to be initially stabilizing, prior to breakdown.
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Demaria, E. M.; Goodrich, D. C.; Keefer, T.
2017-12-01
Observed sub-daily precipitation intensities from contrasting hydroclimatic environments in the USA are used to evaluate temporal trends and to develop Intensity-Duration Frequency (IDF) curves under stationary and nonstationary climatic conditions. Analyses are based on observations from two United States Department of Agriculture (USDA)-Agricultural Research Service (ARS) experimental watersheds located in a semi-arid and a temperate environment. We use an Annual Maximum Series (AMS) and a Partial Duration Series (PDS) approach to identify temporal trends in maximum intensities for durations ranging from 5- to 1440-minutes. A Bayesian approach with Monte Carlo techniques is used to incorporate the effect of non-stationary climatic assumptions in the IDF curves. The results show increasing trends in observed AMS sub-daily intensities in both watersheds whereas trends in the PDS observations are mostly positive in the semi-arid site and a mix of positive and negative in the temperate site. Stationary climate assumptions lead to much lower estimated sub-daily intensities than those under non-stationary assumptions with larger absolute differences found for shorter durations and smaller return periods. The risk of failure (R) of a hydraulic structure is increased for non-stationary effects over those of stationary effects, with absolute differences of 25% for a 100-year return period (T) and a project life (n) of 100 years. The study highlights the importance of considering non-stationarity, due to natural variability or to climate change, in storm design.
Photo-physics of third-order nonlinear optical processes in organic dyes
International Nuclear Information System (INIS)
Delysse, Stephane
1997-01-01
We study some aspects of the nonlinear picosecond photo-physics in organic dyes using Kerr ellipsometry. The aim is to establish link between the photo-physics and nonlinear optics in these compounds. First, we study coherent processes directly linked to the third-order susceptibility. Thus, we measure two-photon absorption spectra of large internal charge transfer dyes. We take into account all coupling between three electronic states which can interfere to explain the particular response of some stilbene dyes. On the second hand, we expose a more photophysical approach to determine the S 1 → S n transition energies and moments using the measurement of excited state absorption cross sections. These results allow the prediction of the susceptibilities relevant to alternative nonlinear optical methods. Nevertheless, the stationary approach hides the complex relaxation processes which can take place in organic dyes. As an illustration, we study the formation and disappearance of a TICT (Twisted intramolecular charge transfer) in a pyrylium salt in solvents of increasing viscosity. (author) [fr
Nonlinear vortex structures and Rayleigh instability condition in shear flow plasmas
International Nuclear Information System (INIS)
Haque, Q.; Saleem, H.; Mirza, A.M.
2009-01-01
Full text: It is shown that the shear flow produced by externally applied electric field can unstable the drift waves. Due to shear flow, the Rayleigh instability condition is modified, which is obtained for both electron-ion and electron-positron-ion plasmas. These shear flow driven drift waves can be responsible for large amplitude electrostatic fluctuations in tokamak edges. In the nonlinear regime, the stationary structures may appear in electron-positron-ion plasmas similar to electron-ion plasmas. The nonlinear vortex structures like counter rotating dipole vortices and vortex chains can be formed with the aid of special type of shear flows. The positrons can be used as a probe in laboratory plasmas, which make it a multi-component plasma. The presence of positrons in electron-ion plasma system can affect the speed and amplitude of the nonlinear vortex structures. This investigation can have application in both laboratory and astrophysical plasmas. (author)
Ramini, Abdallah; Al Hennawi, Qais M.; Younis, Mohammad I.
2016-01-01
We present theoretical and experimental investigation of the nonlinear behavior of a clamped-clamped in-plane MEMS arch when excited by a DC electrostatic load superimposed to an AC harmonic load. Experimentally, a case study of in-plane silicon
Stationary closed strings in five-dimensional flat spacetime
Igata, Takahisa; Ishihara, Hideki; Nishiwaki, Keisuke
2012-11-01
We investigate stationary rotating closed Nambu-Goto strings in five-dimensional flat spacetime. The stationary string is defined as a world sheet that is tangent to a timelike Killing vector. The Nambu-Goto equation of motion for the stationary string is reduced to the geodesic equation on the orbit space of the isometry group action generated by the Killing vector. We take a linear combination of a time-translation vector and space-rotation vectors as the Killing vector, and explicitly construct general solutions of stationary rotating closed strings in five-dimensional flat spacetime. We show a variety of their configurations and properties.
Interference effects in the nonlinear charge density wave dynamics
International Nuclear Information System (INIS)
Jelcic, D.; Batistic, I.; Bjelis, A.
1987-12-01
The main features of the nonlinear charge density wave transport in the external dc-ac field are shown to be the natural consequences of resonant phase slip diffusion. This process is treated numerically within the time dependent Landau-Ginzburg model, developed by Gor'kov. The resonances in the ac field are manifested as Shapiro steps in I-V characteristics, present at all rational ratios of internal frequency of current oscillations and external ac frequency. The origin of Shapiro steps, as well as their forms and heights, are cosidered in detail. In particular, it is shown that close to resonances the phase slip voltage acquires a highly nonsinusoidal modulation which leads to the appearance of low frequency and satellite peaks in the Fourier spectrum. Taking into account the interference of adjacent phase slips and the segment or domain structure of physical samples, we interpret the finite width of steps, side wings, synchronization, incomplete and complete mode locking and some other effects observed in numerous experiments on NbSe 3 and other CDW materials. (author). 36 refs, 12 figs
2016 CIME Course on Nonlocal and Nonlinear Diffusions and Interactions : New Methods and Directions
Grillo, Gabriele
2017-01-01
Presenting a selection of topics in the area of nonlocal and nonlinear diffusions, this book places a particular emphasis on new emerging subjects such as nonlocal operators in stationary and evolutionary problems and their applications, swarming models and applications to biology and mathematical physics, and nonlocal variational problems. The authors are some of the most well-known mathematicians in this innovative field, which is presently undergoing rapid development. The intended audience includes experts in elliptic and parabolic equations who are interested in extending their expertise to the nonlinear setting, as well as Ph.D. or postdoctoral students who want to enter into the most promising research topics in the field.
International Nuclear Information System (INIS)
Karimi, M.J.; Rezaei, G.; Nazari, M.
2014-01-01
Based on the effective mass and parabolic one band approximations, simultaneous effects of the geometrical size, hydrogenic impurity, hydrostatic pressure, and temperature on the intersubband optical absorption coefficients and refractive index changes in multilayered spherical quantum dots are studied. Energy eigenvalues and eigenvectors are calculated using the fourth-order Runge–Kutta method and optical properties are obtained using the compact density matrix approach. The results indicate that the hydrogenic impurity, hydrostatic pressure, temperature and geometrical parameters such as the well and barrier widths have a great influence on the linear, the third-order nonlinear and the total optical absorption coefficients and refractive index changes. -- Highlights: • Hydrogenic impurity effects on the optical properties of a MSQD are investigated. • Hydrostatic pressure and temperature effects are also studied. • Hydrogenic impurity has a great influence on the linear and nonlinear ACs and RICs. • Hydrostatic pressure and temperature change the linear and nonlinear ACs and RICs
A Result on the Existence and Uniqueness of Stationary Solutions for a Bioconvective Flow Model
Directory of Open Access Journals (Sweden)
Aníbal Coronel
2018-01-01
Full Text Available In this note, we prove the existence and uniqueness of weak solutions for the boundary value problem modelling the stationary case of the bioconvective flow problem. The bioconvective model is a boundary value problem for a system of four equations: the nonlinear Stokes equation, the incompressibility equation, and two transport equations. The unknowns of the model are the velocity of the fluid, the pressure of the fluid, the local concentration of microorganisms, and the oxygen concentration. We derive some appropriate a priori estimates for the weak solution, which implies the existence, by application of Gossez theorem, and the uniqueness by standard methodology of comparison of two arbitrary solutions.
NONPARAMETRIC IDENTIFICATION FOR NONLINEAR AUTOREGRESSIVE TIMESERIES MODELS: CONVERGENCE RATES
Institute of Scientific and Technical Information of China (English)
LUZUDI; CHENGPING
1999-01-01
In this paper the optimal convergence rates of estimators ba~ed on kernel approach fornonlinear AR model are investigated in the sense of Stone[17'1a]. By combining the mixingproperty of the stationary solution with the characteristics of the model itself, the restrictiveconditions in the literature which are not easy to be satisfied by the nonlinear AR model axeremoved, and the mild conditions are obtained to guarantee the optimal ratea of the estimatorof autoregTession function. In addition: the strongly coasistent estimator of the ~riance ofwhite noise is also constructed.
Non-parametric system identification from non-linear stochastic response
DEFF Research Database (Denmark)
Rüdinger, Finn; Krenk, Steen
2001-01-01
An estimation method is proposed for identification of non-linear stiffness and damping of single-degree-of-freedom systems under stationary white noise excitation. Non-parametric estimates of the stiffness and damping along with an estimate of the white noise intensity are obtained by suitable...... of the energy at mean-level crossings, which yields the damping relative to white noise intensity. Finally, an estimate of the noise intensity is extracted by estimating the absolute damping from the autocovariance functions of a set of modified phase plane variables at different energy levels. The method...
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
International Nuclear Information System (INIS)
Frank, T D
2009-01-01
Using a nonlinear Fokker-Planck perspective we re-formulate the linear discrepancy model proposed by Boster and colleagues that describes the emergence of risky shifts during group decision making. Analytical expressions for the stationary case are derived and risky shifts are obtained by Monte Carlo simulations. Striking similarities with the Kuramoto model for group synchronization are pointed out
Nonlocal effective actions in semiclassical gravity: Thermal effects in stationary geometries
Elías, M.; Mazzitelli, F. D.; Trombetta, L. G.
2017-11-01
We compute the gravitational effective action by integrating out quantum matter fields in a weak gravitational field, using the Schwinger-Keldysh (in-in) formalism. We pay particular attention to the role of the initial quantum state in the structure of the nonlocal terms in the effective action, with an eye to nonlinear completions of the theory that may be relevant in astrophysics and cosmology. In this first paper we consider a quantum scalar field in thermal equilibrium, in a stationary gravitational field. We obtain a covariant expression for the nonlocal effective action, which can be expressed in terms of the curvature tensor, the four-velocity of the thermal bath, and the local Tolman temperature. We discuss the connection between the results for ultrastatic and static metrics through conformal transformations, and the main features of the thermal corrections to the semiclassical Einstein equations.
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Stationary shear flows in CGL anisotropic toroidal plasmas
International Nuclear Information System (INIS)
Pastukhov, V.P.; Ilgisonis, V.I.
1996-01-01
Recently a general structure of stationary shear flows in toroidal plasmas was obtained in the frame of ideal isotropic-pressure MHD model. The structure of the stationary plasma flows was shown to be determined by a hidden symmetry of MHD equations inherent in the toroidal systems with nested magnetic surfaces. However, the characteristic frequencies of the stationary plasma motion can considerably exceed the collisional frequencies in real plasma experiments. In this case the CGL collisionless MHD model seems to be more adequate than the simplified isotropic-pressure MHD model to describe the stationary plasma flows. In this paper we have generalized our approach to analyze the stationary plasma flows in the frame of the collisionless CGL model. We have found again that the hidden symmetry inherent in the toroidal topology results in two integral invariants which depend on two independent surface functions. The structure of stationary flows for CGL model is still the same as for isotropic MHD, however, the pressure tensor components satisfy a appreciably modifies the steady state force-balance equation. These results are applied to analyze the generalized equilibrium in axisymmetric (tokamak-like) magnetic confinement systems
30 CFR 75.1723 - Stationary grinding machines; protective devices.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Stationary grinding machines; protective....1723 Stationary grinding machines; protective devices. (a) Stationary grinding machines other than... the wheel. (3) Safety washers. (b) Grinding wheels shall be operated within the specifications of the...
Predicting speech intelligibility in conditions with nonlinearly processed noisy speech
DEFF Research Database (Denmark)
Jørgensen, Søren; Dau, Torsten
2013-01-01
The speech-based envelope power spectrum model (sEPSM; [1]) was proposed in order to overcome the limitations of the classical speech transmission index (STI) and speech intelligibility index (SII). The sEPSM applies the signal-tonoise ratio in the envelope domain (SNRenv), which was demonstrated...... to successfully predict speech intelligibility in conditions with nonlinearly processed noisy speech, such as processing with spectral subtraction. Moreover, a multiresolution version (mr-sEPSM) was demonstrated to account for speech intelligibility in various conditions with stationary and fluctuating...
The application of unattended ground sensors to stationary targets
International Nuclear Information System (INIS)
Sleefe, G.E.; Peglow, S.; Hamrick, R.
1997-01-01
The unattended sensing of stationary (i.e. non-mobile) targets is important in applications ranging from counter-proliferation to law enforcement. With stationary targets, sources of seismic, acoustic, and electro-magnetic emissions can potentially be used to detect, identify, and locate the target. Stationary targets have considerably different sensing requirements than the traditional mobile-target unattended ground sensor applications. This paper presents the novel features and requirements of a system for sensing stationary targets. In particular, issues associated with long-listen time signal processing for signal detection, and array processing techniques for signal localization are presented. Example data and signal processing outputs from a stationary target will be used to illustrate these issues. The impact on sensor, electronic signal processing, battery subsystem, and communication requirements will also be discussed. The paper will conclude with a detailed comparison between mobile-target and stationary-target unattended ground sensor architectures
Masood, W.; Mirza, Arshad M.
2010-11-01
Linear and nonlinear properties of coupled Shukla-Varma (SV) and convective cell modes in the presence of electron thermal effects are studied in a nonuniform magnetoplasma composed of electrons, ions, and extremely massive and negatively charged immobile dust grains. In the linear case, the modified dispersion relation is given and, in the nonlinear case, stationary solutions of the nonlinear equations that govern the dynamics of coupled SV and convective cell modes are obtained. It is found that electrostatic dipolar and vortex street type solutions can appear in such a plasma. The relevance of the present investigation with regard to the Earth's mesosphere as well as in ionospheric plasmas is also pointed out.
International Nuclear Information System (INIS)
Masood, W.; Mirza, Arshad M.
2010-01-01
Linear and nonlinear properties of coupled Shukla-Varma (SV) and convective cell modes in the presence of electron thermal effects are studied in a nonuniform magnetoplasma composed of electrons, ions, and extremely massive and negatively charged immobile dust grains. In the linear case, the modified dispersion relation is given and, in the nonlinear case, stationary solutions of the nonlinear equations that govern the dynamics of coupled SV and convective cell modes are obtained. It is found that electrostatic dipolar and vortex street type solutions can appear in such a plasma. The relevance of the present investigation with regard to the Earth's mesosphere as well as in ionospheric plasmas is also pointed out.
Network evolution by nonlinear preferential rewiring of edges
Xu, Xin-Jian; Hu, Xiao-Ming; Zhang, Li-Jie
2011-06-01
The mathematical framework for small-world networks proposed in a seminal paper by Watts and Strogatz sparked a widespread interest in modeling complex networks in the past decade. However, most of research contributing to static models is in contrast to real-world dynamic networks, such as social and biological networks, which are characterized by rearrangements of connections among agents. In this paper, we study dynamic networks evolved by nonlinear preferential rewiring of edges. The total numbers of vertices and edges of the network are conserved, but edges are continuously rewired according to the nonlinear preference. Assuming power-law kernels with exponents α and β, the network structures in stationary states display a distinct behavior, depending only on β. For β>1, the network is highly heterogeneous with the emergence of starlike structures. For β<1, the network is widely homogeneous with a typical connectivity. At β=1, the network is scale free with an exponential cutoff.
Stability and instability of stationary solutions for sublinear parabolic equations
Kajikiya, Ryuji
2018-01-01
In the present paper, we study the initial boundary value problem of the sublinear parabolic equation. We prove the existence of solutions and investigate the stability and instability of stationary solutions. We show that a unique positive and a unique negative stationary solutions are exponentially stable and give the exact exponent. We prove that small stationary solutions are unstable. For one space dimensional autonomous equations, we elucidate the structure of stationary solutions and study the stability of all stationary solutions.
Direct imaging of slow, stored and stationary EIT polaritons
Campbell, Geoff T.; Cho, Young-Wook; Su, Jian; Everett, Jesse; Robins, Nicholas; Lam, Ping Koy; Buchler, Ben
2017-09-01
Stationary and slow light effects are of great interest for quantum information applications. Using laser-cooled Rb87 atoms, we performed side imaging of our atomic ensemble under slow and stationary light conditions, which allows direct comparison with numerical models. The polaritons were generated using electromagnetically induced transparency (EIT), with stationary light generated using counter-propagating control fields. By controlling the power ratio of the two control fields, we show fine control of the group velocity of the stationary light. We also compare the dynamics of stationary light using monochromatic and bichromatic control fields. Our results show negligible difference between the two situations, in contrast to previous work in EIT-based systems.
30 CFR 77.401 - Stationary grinding machines; protective devices.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Stationary grinding machines; protective... OF UNDERGROUND COAL MINES Safeguards for Mechanical Equipment § 77.401 Stationary grinding machines; protective devices. (a) Stationary grinding machines other than special bit grinders shall be equipped with...
The Use of Nonlinear Constitutive Equations to Evaluate Draw Resistance and Filter Ventilation
Directory of Open Access Journals (Sweden)
Eitzinger B
2014-12-01
Full Text Available This study investigates by nonlinear constitutive equations the influence of tipping paper, cigarette paper, filter, and tobacco rod on the degree of filter ventilation and draw resistance. Starting from the laws of conservation, the path to the theory of fluid dynamics in porous media and Darcy's law is reviewed and, as an extension to Darcy's law, two different nonlinear pressure drop-flow relations are proposed. It is proven that these relations are valid constitutive equations and the partial differential equations for the stationary flow in an unlit cigarette covering anisotropic, inhomogeneous and nonlinear behaviour are derived. From these equations a system of ordinary differential equations for the one-dimensional flow in the cigarette is derived by averaging pressure and velocity over the cross section of the cigarette. By further integration, the concept of an electrical analog is reached and discussed in the light of nonlinear pressure drop-flow relations. By numerical calculations based on the system of ordinary differential equations, it is shown that the influence of nonlinearities cannot be neglected because variations in the degree of filter ventilation can reach up to 20% of its nominal value.
Nonlinear saturation of E x B instability in a plasma slab
International Nuclear Information System (INIS)
Alfsen, K.H.; Holter, Oe.
1984-09-01
The saturation of the E bar x B bar instability is investigated in the nonlinear regime. The governing equations are studied analytically and numerically by using a spectral method with mode truncation. The nonlinear stabilization is due to modifications of the background density- and potential profiles. In the time asymptotic limit a stationary solution, which is independent of the initial conditions is obtained. The asymptotic state is characterized by a splitting of the interacting modes into two almost non-interacting groups, where the modes with even mode number sum; i.e. the modes driven by the linearly most unstable mode, is found to dominate the system. For this group fixed point calculations are performed analytically with six interacting modes. Comparison with numerical calculations indicates excellent agreement far into the unstable region. (Auth.)
International Nuclear Information System (INIS)
Brito, P.E. de; Nazareno, H.N.
2012-01-01
The object of the present work is to analyze the effect of nonlinearity on wave packet propagation in a square lattice subject to a magnetic and an electric field in the Hall configuration, by using the Discrete Nonlinear Schrödinger Equation (DNLSE). In previous works we have shown that without the nonlinear term, the presence of the magnetic field induces the formation of vortices that remain stationary, while a wave packet is introduced in the system. As for the effect of an applied electric field, it was shown that the vortices propagate in a direction perpendicular to the electric field, similar behavior as presented in the classical treatment, we provide a quantum mechanics explanation for that. We have performed the calculations considering first the action of the magnetic field as well as the nonlinearity. The results indicate that for low values of the nonlinear parameter U the vortices remain stationary while preserving the form. For greater values of the parameter the picture gets distorted, the more so, the greater the nonlinearity. As for the inclusion of the electric field, we note that for small U, the wave packet propagates perpendicular to the applied field, until for greater values of U the wave gets partially localized in a definite region of the lattice. That is, for strong nonlinearity the wave packet gets partially trapped, while the tail of it can propagate through the lattice. Note that this tail propagation is responsible for the over-diffusion for long times of the wave packet under the action of an electric field. We have produced short films that show clearly the time evolution of the wave packet, which can add to the understanding of the dynamics.
Stationary axisymmetric Einstein--Maxwell field equations
International Nuclear Information System (INIS)
Catenacci, R.; Diaz Alonso, J.
1976-01-01
We show the existence of a formal identity between Einstein's and Ernst's stationary axisymmetric gravitational field equations and the Einstein--Maxwell and the Ernst equations for the electrostatic and magnetostatic axisymmetric cases. Our equations are invariant under very simple internal symmetry groups, and one of them appears to be new. We also obtain a method for associating two stationary axisymmetric vacuum solutions with every electrostatic known
Energy Technology Data Exchange (ETDEWEB)
Kharkovskiy, A. I., E-mail: akharkovskiy@inbox.ru [International Laboratory of High Magnetic Fields and Low Temperatures, Gajowicka 95, 53-421 Wrocław (Poland); L.F. Vereshchagin Institute for High Pressure Physics RAS, 142190 Troitsk, Moscow (Russian Federation); Shaldin, Yu. V. [International Laboratory of High Magnetic Fields and Low Temperatures, Gajowicka 95, 53-421 Wrocław (Poland); Institute for Crystallography RAS, Lenin' s Avenue 59, 119333 Moscow (Russian Federation); Nizhankovskii, V. I. [International Laboratory of High Magnetic Fields and Low Temperatures, Gajowicka 95, 53-421 Wrocław (Poland)
2016-01-07
The direct nonlinear magnetoelectric (ME) effect and the magnetostriction of piezoelectric CsCuCl{sub 3} single crystals were comprehensively studied over a wide temperature range in stationary magnetic fields of up to 14 T. The direct nonlinear ME effect measurements were also performed in pulsed magnetic fields up to 31 T, at liquid helium temperature in the antiferromagnetic (AF) state for the crystallographic direction in which effect has the maximum value. The nonlinear ME effect was quadratic in the paramagnetic state for the whole range of magnetic fields. In the AF state the phase transition between different configurations of spins manifested itself as plateau-like peculiarity on the nonlinear ME effect. The nonlinear ME effect was saturated by the phase transition to the spin-saturated paramagnetic state. Two contributions to the nonlinear ME effects in CsCuCl{sub 3} were extracted from the experimental data: the intrinsic ME effect originated from the magnetoelectric interactions, and the extrinsic one, which resulted from a magnetostriction-induced piezoelectric effect.
International Nuclear Information System (INIS)
Bocek, M.; Armas, I.
1982-01-01
It was the aim of the present investigation to examine how the recovery rate in creep is influenced by a non-stationary stress. For purposes of phenomenological analysis it is postulated that, irrespective of whether the applied stress is stationary or not, for large strains the mean internal stress sigmasub(i) approaches a stationary value sigmasub(i,s). The stationary recovery rate Rsub(s) for constant load creep turns out be governed by the applied stress indicating that the recovery mechanism is dynamic in nature. For sigma-ramp loading, Rsub(s) is dependent on the stress rate sigma. In tensional stress cycling, Rsub(s) is governed by the maximum stress sigmasub(M) and is also dependent on the ratio of sigmasub(M) to the minimum stress sigma 0 . TEM examination of Zircaloy-4 specimens crept at 800 0 C at constant and cycling load respectively could not reveal any differences in the deformation substructure for the two loading types. Subgrain formation did not appear, individual dislocations were observed only rarely. However, typical networks were formed as well as pileups which perhaps are responsible for the back stress in high temperature plasticity (HTP). (orig.)
Stationary stochastic processes theory and applications
Lindgren, Georg
2012-01-01
Some Probability and Process BackgroundSample space, sample function, and observablesRandom variables and stochastic processesStationary processes and fieldsGaussian processesFour historical landmarksSample Function PropertiesQuadratic mean propertiesSample function continuityDerivatives, tangents, and other characteristicsStochastic integrationAn ergodic resultExercisesSpectral RepresentationsComplex-valued stochastic processesBochner's theorem and the spectral distributionSpectral representation of a stationary processGaussian processesStationary counting processesExercisesLinear Filters - General PropertiesLinear time invariant filtersLinear filters and differential equationsWhite noise in linear systemsLong range dependence, non-integrable spectra, and unstable systemsThe ARMA-familyLinear Filters - Special TopicsThe Hilbert transform and the envelopeThe sampling theoremKarhunen-Loève expansionClassical Ergodic Theory and MixingThe basic ergodic theorem in L2Stationarity and transformationsThe ergodic th...
Jin, Young Kyu
2010-11-01
In this present study, we experimentally investigated the effects of electric fields on the characteristics of flames spreading over electric-wires with AC fields. The dependence of the rate at which a flame spreads over polyethylene-insulated wires on the frequency and amplitude of the applied AC electric field was examined. The spreading of the flame can be categorized into linear spreading and non-linearly accelerated spreading of flame. This categorization is based on the axial distribution of the field strength of the applied electric field. The rate at which the flame spreads is highly dependent on the inclined direction of the wire fire. It could be possible to explain the spreading of the flame on the basis of thermal balance. © 2010 The Korean Society of Mechanical Engineers.
Stationary radiation of objects with scattering media
International Nuclear Information System (INIS)
Vasil'eva, Inna A
2001-01-01
The radiation observed inside or outside a stationary radiator with a scattering medium is a sum of components, each being determined by, first, the primary radiation from some part of the radiator and, second, the probability of this radiation reaching the region where it is observed. In this review, general and rather simple relations between these components are discussed. These relations, unlike the components themselves, are independent of the specific optical characteristics of the object as well as of its geometry, inhomogeneity, etc. In deriving the relations, the situations in which geometrical optics is either applicable or inapplicable to radiation in a scattering medium are considered. For the case where geometrical optics does apply, stationary relations are derived from the probabilistic stationarity condition for radiation passing through the medium, i.e., from the fact that all radiation emitted in a stationary regime disappears with probability unity. Equilibrium relations are derived from the stationary relations in the particular case of a thermal radiator in an isothermal cavity. To derive the stationary relations in the geometrical optics approximation, we obtain general solutions of the linear equation of transfer using the Green function approach. If geometrical optics cannot be applied to a scattering and radiating medium, only relations for the components of outgoing thermal radiation are obtained, and the generalized Kirchhoff law, obtained by Levin and Rytov using statistical radio-physics methods, is employed. In this case, stationary relations are also derived from a probabilistic stationarity condition; the equilibrium relations follow from the stationary ones as well as from the equilibrium condition for radiation in the isothermal cavity. The quantities involved in all the relations obtained are a subject of experimental and computational spectroscopic studies. Examples of current and potential applications are given. The relations
Fan, Quan-Yong; Yang, Guang-Hong
2016-01-01
This paper is concerned with the problem of integral sliding-mode control for a class of nonlinear systems with input disturbances and unknown nonlinear terms through the adaptive actor-critic (AC) control method. The main objective is to design a sliding-mode control methodology based on the adaptive dynamic programming (ADP) method, so that the closed-loop system with time-varying disturbances is stable and the nearly optimal performance of the sliding-mode dynamics can be guaranteed. In the first step, a neural network (NN)-based observer and a disturbance observer are designed to approximate the unknown nonlinear terms and estimate the input disturbances, respectively. Based on the NN approximations and disturbance estimations, the discontinuous part of the sliding-mode control is constructed to eliminate the effect of the disturbances and attain the expected equivalent sliding-mode dynamics. Then, the ADP method with AC structure is presented to learn the optimal control for the sliding-mode dynamics online. Reconstructed tuning laws are developed to guarantee the stability of the sliding-mode dynamics and the convergence of the weights of critic and actor NNs. Finally, the simulation results are presented to illustrate the effectiveness of the proposed method.
NONLINEAR DYNAMICS OF CARBON NANOTUBES UNDER LARGE ELECTROSTATIC FORCE
Xu, Tiantian
2015-06-01
Because of the inherent nonlinearities involving the behavior of CNTs when excited by electrostatic forces, modeling and simulating their behavior is challenging. The complicated form of the electrostatic force describing the interaction of their cylindrical shape, forming upper electrodes, to lower electrodes poises serious computational challenges. This presents an obstacle against applying and using several nonlinear dynamics tools typically used to analyze the behavior of complicated nonlinear systems undergoing large motion, such as shooting, continuation, and integrity analysis techniques. This works presents an attempt to resolve this issue. We present an investigation of the nonlinear dynamics of carbon nanotubes when actuated by large electrostatic forces. We study expanding the complicated form of the electrostatic force into enough number of terms of the Taylor series. Then, we utilize this form along with an Euler-Bernoulli beam model to study for the first time the dynamic behavior of CNTs when excited by large electrostatic force. The geometric nonlinearity and the nonlinear electrostatic force are considered. An efficient reduced-order model (ROM) based on the Galerkin method is developed and utilized to simulate the static and dynamic responses of the CNTs. Several results are generated demonstrating softening and hardening behavior of the CNTs near their primary and secondary resonances. The effects of the DC and AC voltage loads on the behavior have been studied. The impacts of the initial slack level and CNT diameter are also demonstrated.
Nonlinear Dynamics of Carbon Nanotubes Under Large Electrostatic Force
Xu, Tiantian
2015-06-01
Because of the inherent nonlinearities involving the behavior of CNTs when excited by electrostatic forces, modeling and simulating their behavior is challenging. The complicated form of the electrostatic force describing the interaction of their cylindrical shape, forming upper electrodes, to lower electrodes poises serious computational challenges. This presents an obstacle against applying and using several nonlinear dynamics tools typically used to analyze the behavior of complicated nonlinear systems undergoing large motion, such as shooting, continuation, and integrity analysis techniques. This works presents an attempt to resolve this issue. We present an investigation of the nonlinear dynamics of carbon nanotubes when actuated by large electrostatic forces. We study expanding the complicated form of the electrostatic force into enough number of terms of the Taylor series. Then, we utilize this form along with an Euler-Bernoulli beam model to study for the first time the dynamic behavior of CNTs when excited by large electrostatic force. The geometric nonlinearity and the nonlinear electrostatic force are considered. An efficient reduced-order model (ROM) based on the Galerkin method is developed and utilized to simulate the static and dynamic responses of the CNTs. Several results are generated demonstrating softening and hardening behavior of the CNTs near their primary and secondary resonances. The effects of the DC and AC voltage loads on the behavior have been studied. The impacts of the initial slack level and CNT diameter are also demonstrated.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Chaotic Bohmian trajectories for stationary states
International Nuclear Information System (INIS)
Cesa, Alexandre; Martin, John; Struyve, Ward
2016-01-01
In Bohmian mechanics, the nodes of the wave function play an important role in the generation of chaos. However, so far, most of the attention has been on moving nodes; little is known about the possibility of chaos in the case of stationary nodes. We address this question by considering stationary states, which provide the simplest examples of wave functions with stationary nodes. We provide examples of stationary wave functions for which there is chaos, as demonstrated by numerical computations, for one particle moving in three spatial dimensions and for two and three entangled particles in two dimensions. Our conclusion is that the motion of the nodes is not necessary for the generation of chaos. What is important is the overall complexity of the wave function. That is, if the wave function, or rather its phase, has a complex spatial variation, it will lead to complex Bohmian trajectories and hence to chaos. Another aspect of our work concerns the average Lyapunov exponent, which quantifies the overall amount of chaos. Since it is very hard to evaluate the average Lyapunov exponent analytically, which is often computed numerically, it is useful to have simple quantities that agree well with the average Lyapunov exponent. We investigate possible correlations with quantities such as the participation ratio and different measures of entanglement, for different systems and different families of stationary wave functions. We find that these quantities often tend to correlate to the amount of chaos. However, the correlation is not perfect, because, in particular, these measures do not depend on the form of the basis states used to expand the wave function, while the amount of chaos does. (paper)
Application for Single Price Auction Model (SPA) in AC Network
Wachi, Tsunehisa; Fukutome, Suguru; Chen, Luonan; Makino, Yoshinori; Koshimizu, Gentarou
This paper aims to develop a single price auction model with AC transmission network, based on the principle of maximizing social surplus of electricity market. Specifically, we first formulate the auction market as a nonlinear optimization problem, which has almost the same form as the conventional optimal power flow problem, and then propose an algorithm to derive both market clearing price and trade volume of each player even for the case of market-splitting. As indicated in the paper, the proposed approach can be used not only for the price evaluation of auction or bidding market but also for analysis of bidding strategy, congestion effect and other constraints or factors. Several numerical examples are used to demonstrate effectiveness of our method.
Cosmic Shear With ACS Pure Parallels
Rhodes, Jason
2002-07-01
Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.
Studies of nonlinear electrodynamics of high-temperature superconductors
International Nuclear Information System (INIS)
Lam, Q.H.
1991-01-01
Nonlinear electrodynamics of high-Tc superconductors are studied theoretically and experimentally. For powdered samples, a novel model is presented in which the metallographically observed superconducting grains in the powder are modeled as superconducting current loops of various areas with weak links. Surprising harmonic generation behavior in an ac field, H 1 cos(ωt), is predicted by the model; the power at high harmonics show sharp dips almost periodic in a super-posing dc magnetic field, revealing flux quantization in the prototype loops in the model. Such oscillation of the harmonic power in dc magnetic field, P nf (H dc ), is experimentally observed in powdered YBa 2 Cu 3 O 7 . For bulk sintered cylindrical samples, a generalized critical state model is presented. The nonlinear electrodynamics are due to flux-pinning. Experiments in ac and dc magnetic fields on a sintered cylindrical rod of YBa 2 Cu 3 O 7 yield unambiguous evidence of independent inter- and intragranular contributions to the complex harmonic permeability μ n = μ' n - iμ double-prime n . These data, together with P nf (H dc ), are explained quantitatively by the generalized critical state model, yielding a dependence on magnetic field of J c (H) ∼ H 02 local for the intergranular component, a steeper field dependence than for conventional type-II superconductors. Temperature-dependence measurements reveal that, while the intragranular supercurrents disappear at T c ≥ 91.2 K, the intergranular supercurrents disappear at T ≥ 86.6 K
The stationary neutron radiography system
International Nuclear Information System (INIS)
Weeks, A.A.; Newell, D.L.; Heidel, C.C.
1990-01-01
To provide the high intensity neutron beam and support systems necessary for radiography, the Stationary Neutron Radiography System was constructed at McClellan Air Force Base. The Stationary Neutron Radiography System utilizes a one megawatt TRIGA reactor contained in an Aluminium tank surrounded by eight foot thick concrete walls. There are four neutron beam tubes at inclined angles from the reactor core to separate radiography bays. In three of the bays, robotic systems manipulate aircraft components in the neutron beam, while real-time imaging systems provide images concurrent with the irradiation. Film radiography of smaller components is performed in the remaining bay
Kashiwabara, Takahito
Strong solutions of the non-stationary Navier-Stokes equations under non-linearized slip or leak boundary conditions are investigated. We show that the problems are formulated by a variational inequality of parabolic type, to which uniqueness is established. Using Galerkin's method and deriving a priori estimates, we prove global and local existence for 2D and 3D slip problems respectively. For leak problems, under no-leak assumption at t=0 we prove local existence in 2D and 3D cases. Compatibility conditions for initial states play a significant role in the estimates.
International Nuclear Information System (INIS)
Moawad, S. M.; Ibrahim, D. A.
2016-01-01
The equilibrium properties of three-dimensional ideal magnetohydrodynamics (MHD) are investigated. Incompressible and compressible flows are considered. The governing equations are taken in a steady state such that the magnetic field is parallel to the plasma flow. Equations of stationary equilibrium for both of incompressible and compressible MHD flows are derived and described in a mathematical mode. For incompressible MHD flows, Alfvénic and non-Alfvénic flows with constant and variable magnetofluid density are investigated. For Alfvénic incompressible flows, the general three-dimensional solutions are determined with the aid of two potential functions of the velocity field. For non-Alfvénic incompressible flows, the stationary equilibrium equations are reduced to two differential constraints on the potential functions, flow velocity, magnetofluid density, and the static pressure. Some examples which may be of some relevance to axisymmetric confinement systems are presented. For compressible MHD flows, equations of the stationary equilibrium are derived with the aid of a single potential function of the velocity field. The existence of three-dimensional solutions for these MHD flows is investigated. Several classes of three-dimensional exact solutions for several cases of nonlinear equilibrium equations are presented.
Target Tracking in 3-D Using Estimation Based Nonlinear Control Laws for UAVs
Directory of Open Access Journals (Sweden)
Mousumi Ahmed
2016-02-01
Full Text Available This paper presents an estimation based backstepping like control law design for an Unmanned Aerial Vehicle (UAV to track a moving target in 3-D space. A ground-based sensor or an onboard seeker antenna provides range, azimuth angle, and elevation angle measurements to a chaser UAV that implements an extended Kalman filter (EKF to estimate the full state of the target. A nonlinear controller then utilizes this estimated target state and the chaser’s state to provide speed, flight path, and course/heading angle commands to the chaser UAV. Tracking performance with respect to measurement uncertainty is evaluated for three cases: (1 stationary white noise; (2 stationary colored noise and (3 non-stationary (range correlated white noise. Furthermore, in an effort to improve tracking performance, the measurement model is made more realistic by taking into consideration range-dependent uncertainties in the measurements, i.e., as the chaser closes in on the target, measurement uncertainties are reduced in the EKF, thus providing the UAV with more accurate control commands. Simulation results for these cases are shown to illustrate target state estimation and trajectory tracking performance.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Non-stationary covariance function modelling in 2D least-squares collocation
Darbeheshti, N.; Featherstone, W. E.
2009-06-01
Standard least-squares collocation (LSC) assumes 2D stationarity and 3D isotropy, and relies on a covariance function to account for spatial dependence in the observed data. However, the assumption that the spatial dependence is constant throughout the region of interest may sometimes be violated. Assuming a stationary covariance structure can result in over-smoothing of, e.g., the gravity field in mountains and under-smoothing in great plains. We introduce the kernel convolution method from spatial statistics for non-stationary covariance structures, and demonstrate its advantage for dealing with non-stationarity in geodetic data. We then compared stationary and non- stationary covariance functions in 2D LSC to the empirical example of gravity anomaly interpolation near the Darling Fault, Western Australia, where the field is anisotropic and non-stationary. The results with non-stationary covariance functions are better than standard LSC in terms of formal errors and cross-validation against data not used in the interpolation, demonstrating that the use of non-stationary covariance functions can improve upon standard (stationary) LSC.
Liu, Yan; Guan, Yefeng; Li, Hai; Luo, Zhihuan; Mai, Zhijie
2017-08-01
We study families of stationary nonlinear localized modes and composite gray and anti-gray solitons in a one-dimensional linear waveguide array with dual phase-flip nonlinear point defects. Unstaggered fundamental and dipole bright modes are studied when the defect nonlinearity is self-focusing. For the fundamental modes, symmetric and asymmetric nonlinear modes are found. Their stable areas are studied using different defect coefficients and their total power. For the nonlinear dipole modes, the stability conditions of this type of mode are also identified by different defect coefficients and the total power. When the defect nonlinearity is replaced by the self-defocusing one, staggered fundamental and dipole bright modes are created. Finally, if we replace the linear waveguide with a full nonlinear waveguide, a new type of gray and anti-gray solitons, which are constructed by a kink and anti-kink pair, can be supported by such dual phase-flip defects. In contrast to the usual gray and anti-gray solitons formed by a single kink, their backgrounds on either side of the gray hole or bright hump have the same phase.
Eddy current modeling in linear and nonlinear multifilamentary composite materials
Menana, Hocine; Farhat, Mohamad; Hinaje, Melika; Berger, Kevin; Douine, Bruno; Lévêque, Jean
2018-04-01
In this work, a numerical model is developed for a rapid computation of eddy currents in composite materials, adaptable for both carbon fiber reinforced polymers (CFRPs) for NDT applications and multifilamentary high temperature superconductive (HTS) tapes for AC loss evaluation. The proposed model is based on an integro-differential formulation in terms of the electric vector potential in the frequency domain. The high anisotropy and the nonlinearity of the considered materials are easily handled in the frequency domain.
Directory of Open Access Journals (Sweden)
Shanming Wang
2015-01-01
Full Text Available Now electric machines integrate with power electronics to form inseparable systems in lots of applications for high performance. For such systems, two kinds of nonlinearities, the magnetic nonlinearity of iron core and the circuit nonlinearity caused by power electronics devices, coexist at the same time, which makes simulation time-consuming. In this paper, the multiloop model combined with FE model of AC-DC synchronous generators, as one example of electric machine with power electronics system, is set up. FE method is applied for magnetic nonlinearity and variable-step variable-topology simulation method is applied for circuit nonlinearity. In order to improve the simulation speed, the incomplete Cholesky conjugate gradient (ICCG method is used to solve the state equation. However, when power electronics device switches off, the convergence difficulty occurs. So a straightforward approach to achieve convergence of simulation is proposed. At last, the simulation results are compared with the experiments.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Study on Control Scheme for the Inverters in Low Voltage Microgrid with Nonlinear Loads
Xu, Jiqiang; Lu, Wenzhou; Wu, Lei
2017-05-01
There are a lot of nonlinear loads in real low voltage microgrid system. It will cause serious output voltage and grid current harmonic distortions problems in island and grid-connected modes, respectively. To solve this problem, this paper proposes a droop control scheme with quasi-proportion and resonant (quasi-PR) controller based on αβ stationary reference frame to make microgrid smoothly switch between grid-connected and island modes without changing control method. Moreover, in island mode, not only stable output voltage and frequency, but also reduced output voltage harmonics with added nonlinear loads can be achieved; In grid-connected mode, not only constant power, but also reduced grid current harmonics can be achieved. Simulation results verify the effectiveness of the proposed control scheme.
Non-stationary condition monitoring through event alignment
DEFF Research Database (Denmark)
Pontoppidan, Niels Henrik; Larsen, Jan
2004-01-01
We present an event alignment framework which enables change detection in non-stationary signals. change detection. Classical condition monitoring frameworks have been restrained to laboratory settings with stationary operating conditions, which are not resembling real world operation....... In this paper we apply the technique for non-stationary condition monitoring of large diesel engines based on acoustical emission sensor signals. The performance of the event alignment is analyzed in an unsupervised probabilistic detection framework based on outlier detection with either Principal Component...... Analysis or Gaussian Processes modeling. We are especially interested in the true performance of the condition monitoring performance with mixed aligned and unaligned data, e.g. detection of fault condition of unaligned examples versus false alarms of aligned normal condition data. Further, we expect...
International Nuclear Information System (INIS)
La Pointe, P.R.
1994-11-01
This report describes the comparison of stationary and non-stationary geostatistical models for the purpose of inferring block-scale hydraulic conductivity values from packer tests at Aespoe. The comparison between models is made through the evaluation of cross-validation statistics for three experimental designs. The first experiment consisted of a 'Delete-1' test previously used at Finnsjoen. The second test consisted of 'Delete-10%' and the third test was a 'Delete-50%' test. Preliminary data analysis showed that the 3 m and 30 m packer test data can be treated as a sample from a single population for the purposes of geostatistical analyses. Analysis of the 3 m data does not indicate that there are any systematic statistical changes with depth, rock type, fracture zone vs non-fracture zone or other mappable factor. Directional variograms are ambiguous to interpret due to the clustered nature of the data, but do not show any obvious anisotropy that should be accounted for in geostatistical analysis. Stationary analysis suggested that there exists a sizeable spatially uncorrelated component ('Nugget Effect') in the 3 m data, on the order of 60% of the observed variance for the various models fitted. Four different nested models were automatically fit to the data. Results for all models in terms of cross-validation statistics were very similar for the first set of validation tests. Non-stationary analysis established that both the order of drift and the order of the intrinsic random functions is low. This study also suggests that conventional cross-validation studies and automatic variogram fitting are not necessarily evaluating how well a model will infer block scale hydraulic conductivity values. 20 refs, 20 figs, 14 tabs
Nonlinear dynamics analysis of a low-temperature-differential kinematic Stirling heat engine
Izumida, Yuki
2018-03-01
The low-temperature-differential (LTD) Stirling heat engine technology constitutes one of the important sustainable energy technologies. The basic question of how the rotational motion of the LTD Stirling heat engine is maintained or lost based on the temperature difference is thus a practically and physically important problem that needs to be clearly understood. Here, we approach this problem by proposing and investigating a minimal nonlinear dynamic model of an LTD kinematic Stirling heat engine. Our model is described as a driven nonlinear pendulum where the motive force is the temperature difference. The rotational state and the stationary state of the engine are described as a stable limit cycle and a stable fixed point of the dynamical equations, respectively. These two states coexist under a sufficient temperature difference, whereas the stable limit cycle does not exist under a temperature difference that is too small. Using a nonlinear bifurcation analysis, we show that the disappearance of the stable limit cycle occurs via a homoclinic bifurcation, with the temperature difference being the bifurcation parameter.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Nonlinear Dynamic Behavior of Impact Damage in a Composite Skin-Stiffener Structure
Ooijevaar, T. H.; Rogge, M. D.; Loendersloot, R.; Warnet, L.; Akkerman, R.; deBoer, A.
2013-01-01
One of the key issues in composite structures for aircraft applications is the early identification of damage. Often, service induced damage does not involve visible plastic deformation, but internal matrix related damage, like delaminations. A wide range of technologies, comprising global vibration and local wave propagation methods can be employed for health monitoring purposes. Traditional low frequency modal analysis based methods are linear methods. The effectiveness of these methods is often limited since they rely on a stationary and linear approximation of the system. The nonlinear interaction between a low frequency wave field and a local impact induced skin-stiffener failure is experimentally demonstrated in this paper. The different mechanisms that are responsible for the nonlinearities (opening, closing and contact) of the distorted harmonic waveforms are separated with the help of phase portraits. A basic analytical model is employed to support the observations.
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
The spectral analysis of cyclo-non-stationary signals
Abboud, D.; Baudin, S.; Antoni, J.; Rémond, D.; Eltabach, M.; Sauvage, O.
2016-06-01
Condition monitoring of rotating machines in speed-varying conditions remains a challenging task and an active field of research. Specifically, the produced vibrations belong to a particular class of non-stationary signals called cyclo-non-stationary: although highly non-stationary, they contain hidden periodicities related to the shaft angle; the phenomenon of long term modulations is what makes them different from cyclostationary signals which are encountered under constant speed regimes. In this paper, it is shown that the optimal way of describing cyclo-non-stationary signals is jointly in the time and the angular domains. While the first domain describes the waveform characteristics related to the system dynamics, the second one reveals existing periodicities linked to the system kinematics. Therefore, a specific class of signals - coined angle-time cyclostationary is considered, expressing the angle-time interaction. Accordingly, the related spectral representations, the order-frequency spectral correlation and coherence functions are proposed and their efficiency is demonstrated on two industrial cases.
Nonlinear VLF Wave Physics in the Radiation Belts
Crabtree, C. E.; Tejero, E. M.; Ganguli, G.; Mithaiwala, M.; Rudakov, L.; Hospodarsky, G. B.; Kletzing, C.
2014-12-01
Electromagnetic VLF waves, such as whistler mode waves, both control the lifetime of trapped electrons in the radiation belts by pitch-angle scattering and are responsible for the energization of electrons during storms. Traditional approaches to understanding the influence of waves on trapped electrons have assumed that the wave characteristics (frequency spectrum, wave-normal angle distribution, etc.) were both stationary in time and amplitude independent from event to event. In situ data from modern satellite missions, such as the Van Allen probes, are showing that this assumption may not be justified. In addition, recent theoretical results [Crabtree et al. 2012] show that the threshold for nonlinear wave scattering can often be met by naturally occurring VLF waves in the magnetosphere, with wave magnetic fields of the order of 50-100 pT inside the plasmapause. Nonlinear wave scattering (Nonlinear Landau Damping) is an amplitude dependent mechanism that can strongly alter VLF wave propagation [Ganguli et al. 2010], primarily by altering the direction of propagation. Laboratory results have confirmed the dramatic change in propagation direction when the pump wave has sufficient amplitude to exceed the nonlinear threshold [Tejero et al. 2014]. Nonlinear scattering can alter the macroscopic dynamics of waves in the radiation belts leading to the formation of a long-lasting wave-cavity [Crabtree et al. 2012] and, when amplification is present, a multi-pass amplifier [Ganguli et al., 2012]. Such nonlinear wave effects can dramatically reduce electron lifetimes. Nonlinear wave dynamics such as these occur when there are more than one wave present, such a condition necessarily violates the assumption of traditional wave-normal analysis [Santolik et al., 2003] which rely on the plane wave assumption. To investigate nonlinear wave dynamics using modern in situ data we apply the maximum entropy method [Skilling and Bryan, 1984] to solve for the wave distribution function
Linear and nonlinear dynamics of current-driven waves in dusty plasmas
Ahmad, Ali; Ali Shan, S.; Haque, Q.; Saleem, H.
2012-09-01
The linear and nonlinear dynamics of a recently proposed plasma mode of dusty plasma is studied using kappa distribution for electrons. This electrostatic wave can propagate in the plasma due to the sheared flow of electrons and ions parallel to the external magnetic field in the presence of stationary dust. The coupling of this wave with the usual drift wave and ion acoustic wave is investigated. D'Angelo's mode is also modified in the presence of superthermal electrons. In the nonlinear regime, the wave can give rise to dipolar vortex structures if the shear in flow is weaker and tripolar vortices if the flow has steeper gradient. The results have been applied to Saturn's magnetosphere corresponding to negatively charged dust grains. But the theoretical model is applicable for positively charged dust as well. This work will be useful for future observations and studies of dusty environments of planets and comets.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
International Nuclear Information System (INIS)
Kravets, E.A.; Berezhnaya, V.V.; Sakada, V.I.; Rashidov, N.M.; Grodzinskij, D.M.; Kravets, E.A.; Berezhnaya, V.V.; Sakada, V.I.; Rashidov, N.M.; Grodzinskij, D.M.
2012-01-01
The dose dependences of the aberrant anaphases in the root meristem in 48 hours after the irradiation have non-linear character and a plateau in the region about 6-8 Gy. The plateau indicates the activation of recovery processes. In the plateau range, the level of damages for this genotype is 33% for aberrant anaphases (FAA), 2.3 aberrations per aberrant anaphase (A/AC), and 0.74 aberrations for the total number of anaphases. At 10 Gy, the dose curve forms the exponential region caused by the involvement of the large number of new cells with unrepaired damages in the mutation process. The increase of A/AC to 1.1 indicate the ''criticality'' of the meristem radiation damage.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
Ortiz-Villanueva, Elena; Tauler, Romà
2017-01-01
Metabolomics is a powerful and widely used approach that aims to screen endogenous small molecules (metabolites) of different families present in biological samples. The large variety of compounds to be determined and their wide diversity of physical and chemical properties have promoted the development of different types of hydrophilic interaction liquid chromatography (HILIC) stationary phases. However, the selection of the most suitable HILIC stationary phase is not straightforward. In this work, four different HILIC stationary phases have been compared to evaluate their potential application for the analysis of a complex mixture of metabolites, a situation similar to that found in non-targeted metabolomics studies. The obtained chromatographic data were analyzed by different chemometric methods to explore the behavior of the considered stationary phases. ANOVA-simultaneous component analysis (ASCA), principal component analysis (PCA) and partial least squares regression (PLS) were used to explore the experimental factors affecting the stationary phase performance, the main similarities and differences among chromatographic conditions used (stationary phase and pH) and the molecular descriptors most useful to understand the behavior of each stationary phase. PMID:29064436
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Algorithm for determining two-periodic steady-states in AC machines directly in time domain
Directory of Open Access Journals (Sweden)
Sobczyk Tadeusz J.
2016-09-01
Full Text Available This paper describes an algorithm for finding steady states in AC machines for the cases of their two-periodic nature. The algorithm enables to specify the steady-state solution identified directly in time domain despite of the fact that two-periodic waveforms are not repeated in any finite time interval. The basis for such an algorithm is a discrete differential operator that specifies the temporary values of the derivative of the two-periodic function in the selected set of points on the basis of the values of that function in the same set of points. It allows to develop algebraic equations defining the steady state solution reached in a chosen point set for the nonlinear differential equations describing the AC machines when electrical and mechanical equations should be solved together. That set of those values allows determining the steady state solution at any time instant up to infinity. The algorithm described in this paper is competitive with respect to the one known in literature an approach based on the harmonic balance method operated in frequency domain.
Non-Stationary Dependence Structures for Spatial Extremes
Huser, Raphaël
2016-03-03
Max-stable processes are natural models for spatial extremes because they provide suitable asymptotic approximations to the distribution of maxima of random fields. In the recent past, several parametric families of stationary max-stable models have been developed, and fitted to various types of data. However, a recurrent problem is the modeling of non-stationarity. In this paper, we develop non-stationary max-stable dependence structures in which covariates can be easily incorporated. Inference is performed using pairwise likelihoods, and its performance is assessed by an extensive simulation study based on a non-stationary locally isotropic extremal t model. Evidence that unknown parameters are well estimated is provided, and estimation of spatial return level curves is discussed. The methodology is demonstrated with temperature maxima recorded over a complex topography. Models are shown to satisfactorily capture extremal dependence.
Directory of Open Access Journals (Sweden)
Xiaoxiao Meng
2018-01-01
Full Text Available AC microgrid mainly comprise inverter-interfaced distributed generators (IIDGs, which are nonlinear complex systems with multiple time scales, including frequency control, time delay measurements, and electromagnetic transients. The droop control-based IIDG in an AC microgrid is selected as the research object in this study, which comprises power droop controller, voltage- and current-loop controllers, and filter and line. The multi-time scale characteristics of the detailed IIDG model are divided based on singular perturbation theory. In addition, the IIDG model order is reduced by neglecting the system fast dynamics. The static and transient stability consistency of the IIDG model order reduction are demonstrated by extracting features of the IIDG small signal model and using the quadratic approximation method of the stability region boundary, respectively. The dynamic response consistencies of the IIDG model order reduction are evaluated using the frequency, damping and amplitude features extracted by the Prony transformation. Results are applicable to provide a simplified model for the dynamic characteristic analysis of IIDG systems in AC microgrid. The accuracy of the proposed method is verified by using the eigenvalue comparison, the transient stability index comparison and the dynamic time-domain simulation.
Simple and complex chimera states in a nonlinearly coupled oscillatory medium
Bolotov, Maxim; Smirnov, Lev; Osipov, Grigory; Pikovsky, Arkady
2018-04-01
We consider chimera states in a one-dimensional medium of nonlinear nonlocally coupled phase oscillators. In terms of a local coarse-grained complex order parameter, the problem of finding stationary rotating nonhomogeneous solutions reduces to a third-order ordinary differential equation. This allows finding chimera-type and other inhomogeneous states as periodic orbits of this equation. Stability calculations reveal that only some of these states are stable. We demonstrate that an oscillatory instability leads to a breathing chimera, for which the synchronous domain splits into subdomains with different mean frequencies. Further development of instability leads to turbulent chimeras.
On Analysis of Stationary Viscous Incompressible Flow Through a Radial Blade Machine
Neustupa, Tomáš
2010-09-01
The paper is concerned with the analysis of the two dimensional model of incompressible, viscous, stationary flow through a radial blade machine. This type of turbine is sometimes called Kaplan's turbine. In the technical area the use is either to force some regular characteristic to the flow of the medium going through the turbine (flow of melted iron, air conditioning) or to gain some energy from the flowing medium (water). The inflow and outflow part of boundary are in general a concentric circles. The larger one represents an inflow part of boundary the smaller one the outflow part of boundary. Between them are regularly spaced the blades of the machine. We study the existence of the weak solution in the case of nonlinear boundary condition of the "do-nothing" type. The model is interesting for study the behavior of the flow when the boundary is formed by mutually disjoint and separated parts.
Cosmological red shift in the Seeliger-Einstein stationary Universe
International Nuclear Information System (INIS)
Kropotkin, P.N.
1988-01-01
A problem of Seeliger-Einstein stationary Universe is considered. Simple empirical relations between cosmological and physical constants to which attention was paid by Stanukovich K., Dikke R., Dirac P. testify to the supposition on stationary Universe. The Universe expansion being absent, a hypothesis of ''photon aging'' suggested in 1929 by Belopolskij A. and Zwicky F. must be accepted for explanation of Hubble effect. It is stated that abandon the Seeliger-Einstein stationary cosmological model would be premature. Study and comparison of different mechanisms suggested for validation of photon aging hypothesis is necessary
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Nonlinear mechanism for the suppression of error field magnetic islands by plasma flow
International Nuclear Information System (INIS)
Parker, R.D.
1992-01-01
Non-axisymmetric magnetic field perturbations generated, for example, by errors in the alignment of the field coils are known to lead to reduced confinement in a tokamak. By inducing the formation of small, stationary, magnetic islands on all rational surfaces they can enhance radial transport and under certain circumstances interact with MHD instabilities to trigger the onset of locked modes leading, in some cases, to disruption of the plasma discharge. Given the stationary nature of the error field islands it is natural to consider whether they can be reduced significantly by the viscous drag of a sheared flow resulting from a bulk rotation of the plasma. In this paper, we examine this interaction by modelling the nonlinear growth and saturation of force-reconnected magnetic islands driven by a corrugated boundary in a slab plasma with an initially uniform flow. A systematic parameter study is made of the time asymptotic steady state. (author) 3 figs., 5 refs
Nonlinear propagation of ultra-low-frequency electronic modes in a magnetized dusty plasma
International Nuclear Information System (INIS)
Mamun, A.A.
1999-07-01
A theoretical investigation has been made of nonlinear propagation of ultra-low-frequency electromagnetic waves in a magnetized two fluid (negatively charged dust and positively charged ion fluids) dusty plasma. These are modified Alfven waves for small value of θ and are modified magnetosonic waves for large θ, where θ is the angle between the directions of the external magnetic field and the wave propagation. A nonlinear evolution equation for the wave magnetic field, which is known as Korteweg de Vries (K-dV) equation and which admits a stationary solitary wave solution, is derived by the reductive perturbation method. The effects of external magnetic field and dust characteristics on the amplitude and the width of these solitary structures are examined. The implications of these results to some space and astrophysical plasma systems, especially to planetary ring-systems, are briefly mentioned. (author)
Stationary states of two-level open quantum systems
International Nuclear Information System (INIS)
Gardas, Bartlomiej; Puchala, Zbigniew
2011-01-01
A problem of finding stationary states of open quantum systems is addressed. We focus our attention on a generic type of open system: a qubit coupled to its environment. We apply the theory of block operator matrices and find stationary states of two-level open quantum systems under certain conditions applied on both the qubit and the surrounding.
Modeling stationary and moving pebbles in a pebble bed reactor
International Nuclear Information System (INIS)
Zhao, Xiang; Montgomery, Trent; Zhang, Sijun
2015-01-01
Highlights: • The stationary and moving pebbles in a PBR are numerically studied by DEM. • The packing structure of stationary pebbles is simulated by a filling process. • The packing structural properties are obtained and analyzed. • The dynamic behavior of pebbles is predicted and discussed. - Abstract: This paper presents a numerical study of the stationary and moving pebbles in a pebble bed reactor (PBR) by means of discrete element method (DEM). The packing structure of stationary pebbles is simulated by a filling process that terminates with the settling of the pebbles into a PBR. The packing structural properties are obtained and analyzed. Subsequently, when the outlet of the PBR is opened during the operation of the PBR, the stationary pebbles start to flow downward and are removed at the bottom of the PBR. The dynamic behavior of pebbles is predicted and discussed. Our results indicate the DEM can offer both macroscopic and microscopic information for PBR design calculations and safety assessment
Optical activity via Kerr nonlinearity in a spinning chiral medium
Energy Technology Data Exchange (ETDEWEB)
Khan, Anwar Ali, E-mail: anwarali@uom.edu.pk [Department of Physics, University of Malakand at Chakdara Dir(L) (Pakistan); Bacha, Bakht Amin, E-mail: aminoptics@gmail.com [Department of Physics, University of Malakand at Chakdara Dir(L) (Pakistan); Khan, Rahmat Ali, E-mail: rahmat_alipk@yahoo.com [Department of Mathematics, University of Malakand (Pakistan)
2016-11-11
Optical activity is investigated in a chiral medium by employing the four level cascade atomic model, in which the optical responses of the atomic medium are studied with Kerr nonlinearity. Light entering into a chiral medium splits into circular birefringent beams. The angle of divergence between the circular birefringent beams and the polarization states of the two light beams is manipulated with Kerr nonlinearity. In the stationary chiral medium the angle of divergence between the circular birefringent beams is calculated to be 1.3 radian. Furthermore, circular birefringence is optically controlled in a spinning chiral medium, where the maximum rotary photon drag angle for left (right) circularly polarized beam is ±1.1 (±1.5) microradian. The change in the angle of divergence between circular birefringent beams by rotary photon drag is calculated to be 0.4 microradian. The numerical results may help to understand image designing, image coding, discovery of photonic crystals and optical sensing technology. - Highlights: • Coherent control of a circular birefringence in a chiral medium is studied. • Angle of divergence between birefringent beams is modified with Kerr nonlinearity. • Rotary photon drag is controlled for birefringent beams and enhanced with Kerr nonlinearity in a spinning medium. • Rotation of the angle of divergence is observed with mechanical rotation of the medium about an axis and modified with Kerr effect. • A change in the angle of divergence is calculated by about a microradian with rotary photon drag.
Two-stage nonlinear filter for processing of scintigrams
International Nuclear Information System (INIS)
Pistor, P.; Hoener, J.; Walch, G.
1973-01-01
Linear filters which have been successfully used to process scintigrams can be modified in a meaningful manner by a preceding non-linear point operator, the Anscombe-transform. The advantages are: The scintigraphic noise becomes quasi-stationary and thus independent of the image. By these means the noise can be readily allowed for in the design of the convolutional operators. Transformed images with a stationary signal-to-noise ratio and a non-constant background t correspond to untransformed images with a signal-to-noise ratio that varies in certain limits. The filter chain automatically adapts to these changes. Our filter has the advantage over the majority of space-varying filters of being realizable by Fast Fourier Transform techniques. These advantages have to be paid for by reduced signal amplitude to background ratios. If the background is known, this shortcoming can be easily by-passed by processing trendfree scintigrams. If not, the filter chain should be completed by a third operator which reverses the Anscombe-transform. The Anscombe-transform influences the signal-to-noise ratio of cold spots and of hot spots in a different way. It remains an open question if this fact can be utilized to directly influence the detectability of the different kinds of spots
The non-linear ion trap. Part 5. Nature of non-linear resonances and resonant ion ejection
Franzen, J.
1994-01-01
The superposition of higher order multipole fields on the basic quadrupole field in ion traps generates a non-harmonic oscillator system for the ions. Fourier analyses of simulated secular oscillations in non-linear ion traps, therefore, not only reveal the sideband frequencies, well-known from the Mathieu theory, but additionally a commonwealth of multipole-specific overtones (or higher harmonics), and corresponding sidebands of overtones. Non-linear resonances occur when the overtone frequencies match sideband frequencies. It can be shown that in each of the resonance conditions, not just one overtone matches one sideband, instead, groups of overtones match groups of sidebands. The generation of overtones is studied by Fourier analysis of computed ion oscillations in the direction of thez axis. Even multipoles (octopole, dodecapole, etc.) generate only odd orders of higher harmonics (3, 5, etc.) of the secular frequency, explainable by the symmetry with regard to the planez = 0. In contrast, odd multipoles (hexapole, decapole, etc.) generate all orders of higher harmonics. For all multipoles, the lowest higher harmonics are found to be strongest. With multipoles of higher orders, the strength of the overtones decreases weaker with the order of the harmonics. Forz direction resonances in stationary trapping fields, the function governing the amplitude growth is investigated by computer simulations. The ejection in thez direction, as a function of timet, follows, at least in good approximation, the equation wheren is the order of multipole, andC is a constant. This equation is strictly valid for the electrically applied dipole field (n = 1), matching the secular frequency or one of its sidebands, resulting in a linear increase of the amplitude. It is valid also for the basic quadrupole field (n = 2) outside the stability area, giving an exponential increase. It is at least approximately valid for the non-linear resonances by weak superpositions of all higher odd
Towards Gravitating Discs around Stationary Black Holes
Semerák, Oldřich
This article outlines the search for an exact general relativistic description of the exterior(vacuum) gravitational field of a rotating spheroidal black hole surrounded by a realistic axially symmetric disc of matter. The problem of multi-body stationary spacetimes is first exposed from the perspective of the relativity theory (section 1) and astrophysics (section 2), listing the basic methods employed and results obtained. Then (in section 3) basic formulas for stationary axisymmetric solutions are summarized. Sections 4 and 5 review what we have learnt with Miroslav Žáček and Tomáš Zellerin about certain static and stationary situations recently. Concluding remarks are given in section 6. Although the survey part is quite general, the list of references cannot be complete.Our main desideratum was the informative value rather than originality — novelties have been preferred, mainly reviews and those with detailed introductions.
Quantum manipulation of two-color stationary light: Quantum wavelength conversion
International Nuclear Information System (INIS)
Moiseev, S. A.; Ham, B. S.
2006-01-01
We present a quantum manipulation of a traveling light pulse using electromagnetically induced transparency-based slow light phenomenon for the generation of two-color stationary light. We theoretically discuss the two-color stationary light for the quantum wavelength conversion process in terms of pulse area, energy transfer, and propagation directions. The condition of the two-color stationary light pulse generation has been found and the quantum light dynamics has been studied analytically in the adiabatic limit. The quantum frequency conversion rate of the traveling light is dependent on the spatial spreading of the two-color stationary light pulse and can be near unity in an optically dense medium for the optimal frequencies of the control laser fields
Linear and nonlinear dynamics of current-driven waves in dusty plasmas
Energy Technology Data Exchange (ETDEWEB)
Ahmad, Ali [National Centre for Physics (NCP), Shahdara Valley Road, 44000 Islamabad (Pakistan); Department of Physics, COMSATS Institute of Information Technology (CIIT), Islamabad (Pakistan); Theoretical Plasma Physics Division, PINSTECH, P. O. Nilore, Islamabad (Pakistan); Ali Shan, S.; Haque, Q. [National Centre for Physics (NCP), Shahdara Valley Road, 44000 Islamabad (Pakistan); Theoretical Plasma Physics Division, PINSTECH, P. O. Nilore, Islamabad (Pakistan); Saleem, H. [National Centre for Physics (NCP), Shahdara Valley Road, 44000 Islamabad (Pakistan); Department of Physics, COMSATS Institute of Information Technology (CIIT), Islamabad (Pakistan)
2012-09-15
The linear and nonlinear dynamics of a recently proposed plasma mode of dusty plasma is studied using kappa distribution for electrons. This electrostatic wave can propagate in the plasma due to the sheared flow of electrons and ions parallel to the external magnetic field in the presence of stationary dust. The coupling of this wave with the usual drift wave and ion acoustic wave is investigated. D'Angelo's mode is also modified in the presence of superthermal electrons. In the nonlinear regime, the wave can give rise to dipolar vortex structures if the shear in flow is weaker and tripolar vortices if the flow has steeper gradient. The results have been applied to Saturn's magnetosphere corresponding to negatively charged dust grains. But the theoretical model is applicable for positively charged dust as well. This work will be useful for future observations and studies of dusty environments of planets and comets.
Automated detection of sleep apnea from electrocardiogram signals using nonlinear parameters
International Nuclear Information System (INIS)
Acharya, U Rajendra; Faust, Oliver; Chua, Eric Chern-Pin; Lim, Teik-Cheng; Lim, Liang Feng Benjamin
2011-01-01
Sleep apnoea is a very common sleep disorder which can cause symptoms such as daytime sleepiness, irritability and poor concentration. To monitor patients with this sleeping disorder we measured the electrical activity of the heart. The resulting electrocardiography (ECG) signals are both non-stationary and nonlinear. Therefore, we used nonlinear parameters such as approximate entropy, fractal dimension, correlation dimension, largest Lyapunov exponent and Hurst exponent to extract physiological information. This information was used to train an artificial neural network (ANN) classifier to categorize ECG signal segments into one of the following groups: apnoea, hypopnoea and normal breathing. ANN classification tests produced an average classification accuracy of 90%; specificity and sensitivity were 100% and 95%, respectively. We have also proposed unique recurrence plots for the normal, hypopnea and apnea classes. Detecting sleep apnea with this level of accuracy can potentially reduce the need of polysomnography (PSG). This brings advantages to patients, because the proposed system is less cumbersome when compared to PSG
International Nuclear Information System (INIS)
Mogaddam, Mehran Wahdani; Shuvalov, Vladimir V
2005-01-01
The dynamics of formation of a nonlinear response of a double phase-conjugate (PC) BaTiO 3 mirror is calculated. It is shown that because of competition between processes of different types (related to the presence of several PC channels, the local and nonlocal components of the photorefractive nonlinearity), the transient and dynamic lasing regimes for this mirror can be substantially different. It is found that the development of lasing begins with the successive formation and phasing of dynamic holograms of two different types (two PC channels). It is shown that even under optimal conditions, the lasing regime is not stationary due to competition between processes of different types, and the parameters of output fields fluctuate in time in a nontrivial way (due to the presence of the in-phase and out-of-phase components). Several scenarios of transition to the dynamic chaos are described. (nonlinear optical phenomena)
Impurity in a granular gas under nonlinear Couette flow
International Nuclear Information System (INIS)
Vega Reyes, Francisco; Garzó, Vicente; Santos, Andrés
2008-01-01
We study in this work the transport properties of an impurity immersed in a granular gas under stationary nonlinear Couette flow. The starting point is a kinetic model for low-density granular mixtures recently proposed by the authors (Vega Reyes et al 2007 Phys. Rev. E 75 061306). Two routes have been considered. First, a hydrodynamic or normal solution is found by exploiting a formal mapping between the kinetic equations for the gas particles and for the impurity. We show that the transport properties of the impurity are characterized by the ratio between the temperatures of the impurity and gas particles and by five generalized transport coefficients: three related to the momentum flux (a nonlinear shear viscosity and two normal stress differences) and two related to the heat flux (a nonlinear thermal conductivity and a cross-coefficient measuring a component of the heat flux orthogonal to the thermal gradient). Second, by means of a Monte Carlo simulation method we numerically solve the kinetic equations and show that our hydrodynamic solution is valid in the bulk of the fluid when realistic boundary conditions are used. Furthermore, the hydrodynamic solution applies to arbitrarily (inside the continuum regime) large values of the shear rate, of the inelasticity, and of the rest of the parameters of the system. Preliminary simulation results of the true Boltzmann description show the reliability of the nonlinear hydrodynamic solution of the kinetic model. This shows again the validity of a hydrodynamic description for granular flows, even under extreme conditions, beyond the Navier–Stokes domain
Weakly nonlinear electromagnetic waves in an electron-ion positron plasma
International Nuclear Information System (INIS)
Rizzato, F.B.; Schneider, R.S.; Dillenburg, D.
1987-01-01
The modulation of a high-frequency electromagnetic wave which is circulary polarized and propagates in a plasma made up of electrons, ions and positrons is investigated. The coefficient of the cubic nonlinear term in the Schroedinger equation may change sign as the relative particle concentrations vary, and consequently a marginal state of modulation instability may exist. To described the system in the neighbourhood of this state an appropriate equation is derived. Particular stationary solutions of this equation are envelope solitary waves, envelope Kinks and envelope hole solitary waves. The dependence of the amplitude of the solutions on the propagation velocity and the particle concentrations is discussed. (author) [pt
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Nonlinear Mechanics of MEMS Rectangular Microplates under Electrostatic Actuation
Saghir, Shahid
2016-12-01
The first objective of the dissertation is to develop a suitable reduced order model capable of investigating the nonlinear mechanical behavior of von-Karman plates under electrostatic actuation. The second objective is to investigate the nonlinear static and dynamic behavior of rectangular microplates under small and large actuating forces. In the first part, we present and compare various approaches to develop reduced order models for the nonlinear von-Karman rectangular microplates actuated by nonlinear electrostatic forces. The reduced-order models aim to investigate the static and dynamic behavior of the plate under small and large actuation forces. A fully clamped microplate is considered. Different types of basis functions are used in conjunction with the Galerkin method to discretize the governing equations. First we investigate the convergence with the number of modes retained in the model. Then for validation purpose, a comparison of the static results is made with the results calculated by a nonlinear finite element model. The linear eigenvalue problem for the plate under the electrostatic force is solved for a wide range of voltages up to pull-in. In the second part, we present an investigation of the static and dynamic behavior of a fully clamped microplate. We investigate the effect of different non-dimensional design parameters on the static response. The forced-vibration response of the plate is then investigated when the plate is excited by a harmonic AC load superimposed to a DC load. The dynamic behavior is examined near the primary and secondary (superharmonic and subharmonic) resonances. The microplate shows a strong hardening behavior due to the cubic nonlinearity of midplane stretching. However, the behavior switches to softening as the DC load is increased. Next, near-square plates are studied to understand the effect of geometric imperfections of microplates. In the final part of the dissertation, we investigate the mechanical behavior of
Energy Technology Data Exchange (ETDEWEB)
Dall' Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.
2015-07-01
This paper considers a collection of networked nonlinear dynamical systems, and addresses the synthesis of feedback controllers that seek optimal operating points corresponding to the solution of pertinent network-wide optimization problems. Particular emphasis is placed on the solution of semidefinite programs (SDPs). The design of the feedback controller is grounded on a dual e-subgradient approach, with the dual iterates utilized to dynamically update the dynamical-system reference signals. Global convergence is guaranteed for diminishing stepsize rules, even when the reference inputs are updated at a faster rate than the dynamical-system settling time. The application of the proposed framework to the control of power-electronic inverters in AC distribution systems is discussed. The objective is to bridge the time-scale separation between real-time inverter control and network-wide optimization. Optimization objectives assume the form of SDP relaxations of prototypical AC optimal power flow problems.
Complex state variable- and disturbance observer-based current controllers for AC drives
DEFF Research Database (Denmark)
Dal, Mehmet; Teodorescu, Remus; Blaabjerg, Frede
2013-01-01
In vector-controlled AC drives, the design of current controller is usually based on a machine model defined in synchronous frame coordinate, where the drive performance may be degraded by both the variation of the machine parameters and the cross-coupling between the d- and q-axes components...... of the stator current. In order to improve the current control performance an alternative current control strategy was proposed previously aiming to avoid the undesired cross-coupling and non-linearities between the state variables. These effects are assumed as disturbances arisen in the closed-loop path...... of the parameter and the cross-coupling effect. Moreover, it provides a better performance, smooth and low noisy operation with respect to the complex variable controller....
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Saghir, Shahid; Younis, Mohammad I.
2016-01-01
We present an investigation of the static and dynamic behavior of the nonlinear von-Karman plates when actuated by the nonlinear electrostatic forces. The investigation is based on a reduced order model developed using the Galerkin method, which rely on modeshapes and in-plane shape functions extracted using a finite element method. In this study, a fully clamped microplate is considered. We investigate the static behavior and the results are validated by comparison with the results calculated by a finite element model. The forced-vibration response of the plate is then investigated when the plate is excited by a harmonic AC load superimposed to a DC load. The dynamic behavior is examined near the primary resonance. The microplate shows a strong hardening behavior due to the cubic nonlinearity of mid-plane stretching. However, the behavior switches to softening as the DC load is increased.
Saghir, Shahid
2016-11-16
We present an investigation of the static and dynamic behavior of the nonlinear von-Karman plates when actuated by the nonlinear electrostatic forces. The investigation is based on a reduced order model developed using the Galerkin method, which rely on modeshapes and in-plane shape functions extracted using a finite element method. In this study, a fully clamped microplate is considered. We investigate the static behavior and the results are validated by comparison with the results calculated by a finite element model. The forced-vibration response of the plate is then investigated when the plate is excited by a harmonic AC load superimposed to a DC load. The dynamic behavior is examined near the primary resonance. The microplate shows a strong hardening behavior due to the cubic nonlinearity of mid-plane stretching. However, the behavior switches to softening as the DC load is increased.
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Nonlinear acoustic waves in partially ionized collisional plasmas
International Nuclear Information System (INIS)
Rao, N.N.; Kaup, D.J.; Shukla, P.K.
1991-01-01
Nonlinear propagation of acoustic-type waves in a partially ionized three-component collisional plasma consisting of electrons, ions and neutral particles is investigated. For bidirectional propagation, it is shown that the small- but finite-amplitude waves are governed by the Boussinesq equation, which for unidirectional propagation near the acoustic speed reduces to the usual Korteweg-de Vries equation. For large-amplitude waves, it is demonstrated that the relevant fluid equations are integrable in a stationary frame, and the parameter values for the existence of finite-amplitude solutions are explicitly obtained. In both cases, the different temperatures of the individual species, are taken into account. The relevance of the results to the earth's ionospheric plasma in the lower altitude ranges is pointed out. (author)
Stationary black holes: large D analysis
International Nuclear Information System (INIS)
Suzuki, Ryotaku; Tanabe, Kentaro
2015-01-01
We consider the effective theory of large D stationary black holes. By solving the Einstein equations with a cosmological constant using the 1/D expansion in near zone of the black hole we obtain the effective equation for the stationary black hole. The effective equation describes the Myers-Perry black hole, bumpy black holes and, possibly, the black ring solution as its solutions. In this effective theory the black hole is represented as an embedded membrane in the background, e.g., Minkowski or Anti-de Sitter spacetime and its mean curvature is given by the surface gravity redshifted by the background gravitational field and the local Lorentz boost. The local Lorentz boost property of the effective equation is observed also in the metric itself. In fact we show that the leading order metric of the Einstein equation in the 1/D expansion is generically regarded as a Lorentz boosted Schwarzschild black hole. We apply this Lorentz boost property of the stationary black hole solution to solve perturbation equations. As a result we obtain an analytic formula for quasinormal modes of the singly rotating Myers-Perry black hole in the 1/D expansion.
Energy Technology Data Exchange (ETDEWEB)
Haque, Q. [Theoretical Physics Division, PINSTECH, P.O. Nilore, Islamabad (Pakistan); Zakir, U. [Department of Physics, University of Peshawar, Khyber Pakhtun Khwa 25000 (Pakistan); Department of Physics, University of Malakand, Khyber Pakhtun Khwa 18800 (Pakistan); Qamar, A. [Department of Physics, University of Peshawar, Khyber Pakhtun Khwa 25000 (Pakistan)
2015-12-15
Linear and nonlinear dynamics of electron temperature gradient mode along with parallel electron dynamics is investigated by considering hydrodynamic electrons and non-Maxwellian ions. It is noticed that the growth rate of η{sub e}-mode driven linear instability decreases by increasing the value of spectral index and increases by reducing the ion/electron temperature ratio along the magnetic field lines. The eigen mode dispersion relation is also found in the ballooning mode limit. Stationary solutions in the form of dipolar vortices are obtained for both circular and elliptic boundary conditions. It is shown that the dynamics of both circular and elliptic vortices changes with the inclusion of inhomogeneity and non-Maxwellian effects.
Haque, Q.; Zakir, U.; Qamar, A.
2015-12-01
Linear and nonlinear dynamics of electron temperature gradient mode along with parallel electron dynamics is investigated by considering hydrodynamic electrons and non-Maxwellian ions. It is noticed that the growth rate of ηe-mode driven linear instability decreases by increasing the value of spectral index and increases by reducing the ion/electron temperature ratio along the magnetic field lines. The eigen mode dispersion relation is also found in the ballooning mode limit. Stationary solutions in the form of dipolar vortices are obtained for both circular and elliptic boundary conditions. It is shown that the dynamics of both circular and elliptic vortices changes with the inclusion of inhomogeneity and non-Maxwellian effects.
Berger, Jorge
2018-06-01
In the customary mode of operation of a SQUID, the electromagnetic field in the SQUID is an oscillatory function of time. In this situation, electromagnetic radiation is emitted and couples to the sample. This is a back action that can alter the state that we intend to measure. A circuit that could perform as a stationary SQUID consists of a loop of superconducting material that encloses the magnetic flux, connected to a superconducting and to a normal electrode. This circuit does not contain Josephson junctions, or any other miniature feature. We study the evolution of the order parameter and of the electrochemical potential in this circuit; they converge to a stationary regime, and the voltage between the electrodes depends on the enclosed flux. We obtain expressions for the power dissipation and for the heat transported by the electric current; the validity of these expressions does not rely on a particular evolution model for the order parameter. We evaluate the influence of fluctuations. For a SQUID perimeter of the order of 1μ m and temperature 0.9T_c, we obtain a flux resolution of the order of 10^{-5}Φ _0/Hz^{1/2}; the resolution is expected to improve as the temperature is lowered.
Investigation of the stationary-thermonuclear-reaction realization possibility in a tokamak device
International Nuclear Information System (INIS)
Kolesnichenko, Ya.I.; Reznik, S.N.; Fursa, A.D.
1976-01-01
The stationary (quasistationary) selfsustaining thermonuclear D-T reaction is shown to be possible in a toroidal device such as 'Tokamak' with large enough plasma radius. The stationary temperature of the plasma can be quite high. Thus when the transport processes are assumed to be neoclassical the temperature of the central part of a plasma colomn of radius approximately 10-200 cm in the stationary state is 70 keV.The stationary temperature distribution is reached spontaneously as a result of the thermal instability development if plasma is preheated to 10 keV. The stationary thermonuclear burning is also possible at lower temperatures if plasma energy balance is controlled
Efficient Market Hypothesis in South Africa: Evidence from Linear and Nonlinear Unit Root Tests
Directory of Open Access Journals (Sweden)
Andrew Phiri
2015-12-01
Full Text Available This study investigates the weak form efficient market hypothesis (EMH for five generalized stock indices in the Johannesburg Stock Exchange (JSE using weekly data collected from 31st January 2000 to 16th December 2014. In particular, we test for weak form market efficiency using a battery of linear and nonlinear unit root testing procedures comprising of the classical augmented Dickey-Fuller (ADF tests, the two-regime threshold autoregressive (TAR unit root tests described in Enders and Granger (1998 as well as the three-regime unit root tests described in Bec, Salem, and Carrasco (2004. Based on our empirical analysis, we are able to demonstrate that whilst the linear unit root tests advocate for unit roots within the time series, the nonlinear unit root tests suggest that most stock indices are threshold stationary processes. These results bridge two opposing contentions obtained from previous studies by concluding that under a linear framework the JSE stock indices offer support in favour of weak form market efficiency whereas when nonlinearity is accounted for, a majority of the indices violate the weak form EMH.
Analysis of stress and deformation in non-stationary creep
International Nuclear Information System (INIS)
Feijoo, R.A.; Taroco, E.; Guerreiro, J.N.C.
1980-12-01
A variational method and its algorithm are presented; they permit the analysis of stress and deformation in non-stationary creep. This algorithm is applied to an infinite cylinder submitted to an internal pressure. The solution obtained is compared with the solution of non-stationary creep problems [pt
ENSO's non-stationary and non-Gaussian character: the role of climate shifts
Boucharel, J.; Dewitte, B.; Garel, B.; Du Penhoat, Y.
2009-07-01
El Niño Southern Oscillation (ENSO) is the dominant mode of climate variability in the Pacific, having socio-economic impacts on surrounding regions. ENSO exhibits significant modulation on decadal to inter-decadal time scales which is related to changes in its characteristics (onset, amplitude, frequency, propagation, and predictability). Some of these characteristics tend to be overlooked in ENSO studies, such as its asymmetry (the number and amplitude of warm and cold events are not equal) and the deviation of its statistics from those of the Gaussian distribution. These properties could be related to the ability of the current generation of coupled models to predict ENSO and its modulation. Here, ENSO's non-Gaussian nature and asymmetry are diagnosed from in situ data and a variety of models (from intermediate complexity models to full-physics coupled general circulation models (CGCMs)) using robust statistical tools initially designed for financial mathematics studies. In particular α-stable laws are used as theoretical background material to measure (and quantify) the non-Gaussian character of ENSO time series and to estimate the skill of ``naïve'' statistical models in producing deviation from Gaussian laws and asymmetry. The former are based on non-stationary processes dominated by abrupt changes in mean state and empirical variance. It is shown that the α-stable character of ENSO may result from the presence of climate shifts in the time series. Also, cool (warm) periods are associated with ENSO statistics having a stronger (weaker) tendency towards Gaussianity and lower (greater) asymmetry. This supports the hypothesis of ENSO being rectified by changes in mean state through nonlinear processes. The relationship between changes in mean state and nonlinearity (skewness) is further investigated both in the Zebiak and Cane (1987)'s model and the models of the Intergovernmental Panel for Climate Change (IPCC). Whereas there is a clear relationship in all
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Stability of Bifurcating Stationary Solutions of the Artificial Compressible System
Teramoto, Yuka
2018-02-01
The artificial compressible system gives a compressible approximation of the incompressible Navier-Stokes system. The latter system is obtained from the former one in the zero limit of the artificial Mach number ɛ which is a singular limit. The sets of stationary solutions of both systems coincide with each other. It is known that if a stationary solution of the incompressible system is asymptotically stable and the velocity field of the stationary solution satisfies an energy-type stability criterion, then it is also stable as a solution of the artificial compressible one for sufficiently small ɛ . In general, the range of ɛ shrinks when the spectrum of the linearized operator for the incompressible system approaches to the imaginary axis. This can happen when a stationary bifurcation occurs. It is proved that when a stationary bifurcation from a simple eigenvalue occurs, the range of ɛ can be taken uniformly near the bifurcation point to conclude the stability of the bifurcating solution as a solution of the artificial compressible system.
Chertock, A.
2012-02-02
Aquatic bacteria like Bacillus subtilis are heavier than water yet they are able to swim up an oxygen gradient and concentrate in a layer below the water surface, which will undergo Rayleigh-Taylor-type instabilities for sufficiently high concentrations. In the literature, a simplified chemotaxis-fluid system has been proposed as a model for bio-convection in modestly diluted cell suspensions. It couples a convective chemotaxis system for the oxygen-consuming and oxytactic bacteria with the incompressible Navier-Stokes equations subject to a gravitational force proportional to the relative surplus of the cell density compared to the water density. In this paper, we derive a high-resolution vorticity-based hybrid finite-volume finite-difference scheme, which allows us to investigate the nonlinear dynamics of a two-dimensional chemotaxis-fluid system with boundary conditions matching an experiment of Hillesdon et al. (Bull. Math. Biol., vol. 57, 1995, pp. 299-344). We present selected numerical examples, which illustrate (i) the formation of sinking plumes, (ii) the possible merging of neighbouring plumes and (iii) the convergence towards numerically stable stationary plumes. The examples with stable stationary plumes show how the surface-directed oxytaxis continuously feeds cells into a high-concentration layer near the surface, from where the fluid flow (recurring upwards in the space between the plumes) transports the cells into the plumes, where then gravity makes the cells sink and constitutes the driving force in maintaining the fluid convection and, thus, in shaping the plumes into (numerically) stable stationary states. Our numerical method is fully capable of solving the coupled chemotaxis-fluid system and enabling a full exploration of its dynamics, which cannot be done in a linearised framework. © 2012 Cambridge University Press.
Monte Carlo simulation of nonlinear reactive contaminant transport in unsaturated porous media
International Nuclear Information System (INIS)
Giacobbo, F.; Patelli, E.
2007-01-01
In the current proposed solutions of radioactive waste repositories, the protective function against the radionuclide water-driven transport back to the biosphere is to be provided by an integrated system of engineered and natural geologic barriers. The occurrence of several nonlinear interactions during the radionuclide migration process may render burdensome the classical analytical-numerical approaches. Moreover, the heterogeneity of the barriers' media forces approximations to the classical analytical-numerical models, thus reducing their fidelity to reality. In an attempt to overcome these difficulties, in the present paper we adopt a Monte Carlo simulation approach, previously developed on the basis of the Kolmogorov-Dmitriev theory of branching stochastic processes. The approach is here extended for describing transport through unsaturated porous media under transient flow conditions and in presence of nonlinear interchange phenomena between the liquid and solid phases. This generalization entails the determination of the functional dependence of the parameters of the proposed transport model from the water content and from the contaminant concentration, which change in space and time during the water infiltration process. The corresponding Monte Carlo simulation approach is verified with respect to a case of nonreactive transport under transient unsaturated flow and to a case of nonlinear reactive transport under stationary saturated flow. Numerical applications regarding linear and nonlinear reactive transport under transient unsaturated flow are reported
Non-Stationary Internal Tides Observed with Satellite Altimetry
Ray, Richard D.; Zaron, E. D.
2011-01-01
Temporal variability of the internal tide is inferred from a 17-year combined record of Topex/Poseidon and Jason satellite altimeters. A global sampling of along-track sea-surface height wavenumber spectra finds that non-stationary variance is generally 25% or less of the average variance at wavenumbers characteristic of mode-l tidal internal waves. With some exceptions the non-stationary variance does not exceed 0.25 sq cm. The mode-2 signal, where detectable, contains a larger fraction of non-stationary variance, typically 50% or more. Temporal subsetting of the data reveals interannual variability barely significant compared with tidal estimation error from 3-year records. Comparison of summer vs. winter conditions shows only one region of noteworthy seasonal changes, the northern South China Sea. Implications for the anticipated SWOT altimeter mission are briefly discussed.
Stability of a nonlinear second order equation under parametric bounded noise excitation
International Nuclear Information System (INIS)
Wiebe, Richard; Xie, Wei-Chau
2016-01-01
The motivation for the following work is a structural column under dynamic axial loads with both deterministic (harmonic transmitted forces from the surrounding structure) and random (wind and/or earthquake) loading components. The bounded noise used herein is a sinusoid with an argument composed of a random (Wiener) process deviation about a mean frequency. By this approach, a noise parameter may be used to investigate the behavior through the spectrum from simple harmonic forcing, to a bounded random process with very little harmonic content. The stability of both the trivial and non-trivial stationary solutions of an axially-loaded column (which is modeled as a second order nonlinear equation) under parametric bounded noise excitation is investigated by use of Lyapunov exponents. Specifically the effect of noise magnitude, amplitude of the forcing, and damping on stability of a column is investigated. First order averaging is employed to obtain analytical approximations of the Lyapunov exponents of the trivial solution. For the non-trivial stationary solution however, the Lyapunov exponents are obtained via Monte Carlo simulation as the stability equations become analytically intractable. (paper)
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Two-parameter nonlinear spacetime perturbations: gauge transformations and gauge invariance
International Nuclear Information System (INIS)
Bruni, Marco; Gualtieri, Leonardo; Sopuerta, Carlos F
2003-01-01
An implicit fundamental assumption in relativistic perturbation theory is that there exists a parametric family of spacetimes that can be Taylor expanded around a background. The choice of the latter is crucial to obtain a manageable theory, so that it is sometime convenient to construct a perturbative formalism based on two (or more) parameters. The study of perturbations of rotating stars is a good example: in this case one can treat the stationary axisymmetric star using a slow rotation approximation (expansion in the angular velocity Ω), so that the background is spherical. Generic perturbations of the rotating star (say parametrized by λ) are then built on top of the axisymmetric perturbations in Ω. Clearly, any interesting physics requires nonlinear perturbations, as at least terms λΩ need to be considered. In this paper, we analyse the gauge dependence of nonlinear perturbations depending on two parameters, derive explicit higher-order gauge transformation rules and define gauge invariance. The formalism is completely general and can be used in different applications of general relativity or any other spacetime theory
Evaluation of the Methods for Response Analysis under Non-Stationary Excitation
Directory of Open Access Journals (Sweden)
R.S. Jangid
1999-01-01
Full Text Available Response of structures to non-stationary ground motion can be obtained either by the evolutionary spectral analysis or by the Markov approach. In certain conditions, a quasi-stationary analysis can also be performed. The first two methods of analysis are difficult to apply for complex situations such as problems involving soil-structure interaction, non-classical damping and primary-secondary structure interaction. The quasi-stationary analysis, on the other hand, provides an easier solution procedure for such cases. Here-in, the effectiveness of the quasi-stationary analysis is examined with the help of the analysis of a single degree-of-freedom (SDOF system under a set of parametric variations. For this purpose, responses of the SDOF system to uniformly modulated non-stationary random ground excitation are obtained by the three methods and they are compared. In addition, the relative computational efforts for different methods are also investigated.
Large-Deviation Results for Discriminant Statistics of Gaussian Locally Stationary Processes
Directory of Open Access Journals (Sweden)
Junichi Hirukawa
2012-01-01
Full Text Available This paper discusses the large-deviation principle of discriminant statistics for Gaussian locally stationary processes. First, large-deviation theorems for quadratic forms and the log-likelihood ratio for a Gaussian locally stationary process with a mean function are proved. Their asymptotics are described by the large deviation rate functions. Second, we consider the situations where processes are misspecified to be stationary. In these misspecified cases, we formally make the log-likelihood ratio discriminant statistics and derive the large deviation theorems of them. Since they are complicated, they are evaluated and illustrated by numerical examples. We realize the misspecification of the process to be stationary seriously affecting our discrimination.
Stationary Double Layers in a Collisionless Magnetoplasma
DEFF Research Database (Denmark)
Noriyoshi, Sato; Mieno, Tetsu; Hatakeyama, Rikizo
1983-01-01
of the plate on the low-potential side, being accompanied with current limitation. This localized potential drop moves along the plasma column, but finally stops and results in the formation of the stationary double layer in the presence of sufficient plasma supply from the plate on the high-potential side.......Stationary double layers are generated in a magnetoplasma by applying potential differences between two heated plates on which the plasma is produced by surface ionization. By measuring the double-layer formation process, a localized potential drop is found to be formed initially in front...
Lin, Yezhi; Liu, Yinping; Li, Zhibin
2012-01-01
The Adomian decomposition method (ADM) is one of the most effective methods for constructing analytic approximate solutions of nonlinear differential equations. In this paper, based on the new definition of the Adomian polynomials, and the two-step Adomian decomposition method (TSADM) combined with the Padé technique, a new algorithm is proposed to construct accurate analytic approximations of nonlinear differential equations with initial conditions. Furthermore, a MAPLE package is developed, which is user-friendly and efficient. One only needs to input a system, initial conditions and several necessary parameters, then our package will automatically deliver analytic approximate solutions within a few seconds. Several different types of examples are given to illustrate the validity of the package. Our program provides a helpful and easy-to-use tool in science and engineering to deal with initial value problems. Program summaryProgram title: NAPA Catalogue identifier: AEJZ_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/AEJZ_v1_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.html No. of lines in distributed program, including test data, etc.: 4060 No. of bytes in distributed program, including test data, etc.: 113 498 Distribution format: tar.gz Programming language: MAPLE R13 Computer: PC Operating system: Windows XP/7 RAM: 2 Gbytes Classification: 4.3 Nature of problem: Solve nonlinear differential equations with initial conditions. Solution method: Adomian decomposition method and Padé technique. Running time: Seconds at most in routine uses of the program. Special tasks may take up to some minutes.
Cosmic Shear With ACS Pure Parallels. Targeted Portion.
Rhodes, Jason
2002-07-01
Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan i {F775W} we will measure for the first time: the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.
Relativistic elasticity of stationary fluid branes
Armas, Jay; Obers, Niels A.
2013-02-01
Fluid mechanics can be formulated on dynamical surfaces of arbitrary codimension embedded in a background space-time. This has been the main object of study of the blackfold approach in which the emphasis has primarily been on stationary fluid configurations. Motivated by this approach we show under certain conditions that a given stationary fluid configuration living on a dynamical surface of vanishing thickness and satisfying locally the first law of thermodynamics will behave like an elastic brane when the surface is subject to small deformations. These results, which are independent of the number of space-time dimensions and of the fluid arising from a gravitational dual, reveal the (electro)elastic character of (charged) black branes when considering extrinsic perturbations.
Woźniak, M.
2016-06-02
We study the features of a new mixed integration scheme dedicated to solving the non-stationary variational problems. The scheme is composed of the FEM approximation with respect to the space variable coupled with a 3-leveled time integration scheme with a linearized right-hand side operator. It was applied in solving the Cahn-Hilliard parabolic equation with a nonlinear, fourth-order elliptic part. The second order of the approximation along the time variable was proven. Moreover, the good scalability of the software based on this scheme was confirmed during simulations. We verify the proposed time integration scheme by monitoring the Ginzburg-Landau free energy. The numerical simulations are performed by using a parallel multi-frontal direct solver executed over STAMPEDE Linux cluster. Its scalability was compared to the results of the three direct solvers, including MUMPS, SuperLU and PaSTiX.
Self-synchronization of populations of nonlinear oscillators in the thermodynamic limit
International Nuclear Information System (INIS)
Bonilla, L.L.; Casado, J.M.; Morillo, M.
1987-01-01
A population of identical nonlinear oscillators, subject to random forces and coupled via a mean-field interaction, is studied in the thermodynamic limit. The model presents a nonequilibrium phase transition from a stationary to a time-periodic probability density. Below the transition line, the population of oscillators is in a quiescent state with order parameter equal to zero. Above the transition line, there is a state of collective rhythmicity characterized by a time-periodic behavior of the order parameter and all moments of the probability distribution. The information entropy of the ensemble is a constant both below and above the critical line. Analytical and numerical analyses of the model are provided
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Inference for local autocorrelations in locally stationary models.
Zhao, Zhibiao
2015-04-01
For non-stationary processes, the time-varying correlation structure provides useful insights into the underlying model dynamics. We study estimation and inferences for local autocorrelation process in locally stationary time series. Our constructed simultaneous confidence band can be used to address important hypothesis testing problems, such as whether the local autocorrelation process is indeed time-varying and whether the local autocorrelation is zero. In particular, our result provides an important generalization of the R function acf() to locally stationary Gaussian processes. Simulation studies and two empirical applications are developed. For the global temperature series, we find that the local autocorrelations are time-varying and have a "V" shape during 1910-1960. For the S&P 500 index, we conclude that the returns satisfy the efficient-market hypothesis whereas the magnitudes of returns show significant local autocorrelations.
A Generalized Framework for Non-Stationary Extreme Value Analysis
Ragno, E.; Cheng, L.; Sadegh, M.; AghaKouchak, A.
2017-12-01
Empirical trends in climate variables including precipitation, temperature, snow-water equivalent at regional to continental scales are evidence of changes in climate over time. The evolving climate conditions and human activity-related factors such as urbanization and population growth can exert further changes in weather and climate extremes. As a result, the scientific community faces an increasing demand for updated appraisal of the time-varying climate extremes. The purpose of this study is to offer a robust and flexible statistical tool for non-stationary extreme value analysis which can better characterize the severity and likelihood of extreme climatic variables. This is critical to ensure a more resilient environment in a changing climate. Following the positive feedback on the first version of Non-Stationary Extreme Value Analysis (NEVA) Toolbox by Cheng at al. 2014, we present an improved version, i.e. NEVA2.0. The upgraded version herein builds upon a newly-developed hybrid evolution Markov Chain Monte Carlo (MCMC) approach for numerical parameters estimation and uncertainty assessment. This addition leads to a more robust uncertainty estimates of return levels, return periods, and risks of climatic extremes under both stationary and non-stationary assumptions. Moreover, NEVA2.0 is flexible in incorporating any user-specified covariate other than the default time-covariate (e.g., CO2 emissions, large scale climatic oscillation patterns). The new feature will allow users to examine non-stationarity of extremes induced by physical conditions that underlie the extreme events (e.g. antecedent soil moisture deficit, large-scale climatic teleconnections, urbanization). In addition, the new version offers an option to generate stationary and/or non-stationary rainfall Intensity - Duration - Frequency (IDF) curves that are widely used for risk assessment and infrastructure design. Finally, a Graphical User Interface (GUI) of the package is provided, making NEVA
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Membrane oscillations in the channel of a stationary plasma motor
International Nuclear Information System (INIS)
Bugrova, A.I.; Lipatov, A.S.; Morozov, A.I.; Kharchevnikov, V.K.
1999-01-01
Results of measuring the ion flux density in the channel of the stationary plasma drive are presented. Two plane easters move both along and transverse to the plasma flux. During the experiment, the strong low-frequency oscillations (∼ 35 kHz) are observed in the channel of the stationary plasma drive. It is found that membrane oscillations are accompanied by oscillations of the electron temperature. These membrane oscillations affect the divergence of the output plasma jet and the erosion of the output part of the channel of the stationary plasma drive [ru
Valenza, G; Romigi, A; Citi, L; Placidi, F; Izzi, F; Albanese, M; Scilingo, E P; Marciani, M G; Duggento, A; Guerrisi, M; Toschi, N; Barbieri, R
2016-08-01
Symptoms of temporal lobe epilepsy (TLE) are frequently associated with autonomic dysregulation, whose underlying biological processes are thought to strongly contribute to sudden unexpected death in epilepsy (SUDEP). While abnormal cardiovascular patterns commonly occur during ictal events, putative patterns of autonomic cardiac effects during pre-ictal (PRE) periods (i.e. periods preceding seizures) are still unknown. In this study, we investigated TLE-related heart rate variability (HRV) through instantaneous, nonlinear estimates of cardiovascular oscillations during inter-ictal (INT) and PRE periods. ECG recordings from 12 patients with TLE were processed to extract standard HRV indices, as well as indices of instantaneous HRV complexity (dominant Lyapunov exponent and entropy) and higher-order statistics (bispectra) obtained through definition of inhomogeneous point-process nonlinear models, employing Volterra-Laguerre expansions of linear, quadratic, and cubic kernels. Experimental results demonstrate that the best INT vs. PRE classification performance (balanced accuracy: 73.91%) was achieved only when retaining the time-varying, nonlinear, and non-stationary structure of heartbeat dynamical features. The proposed approach opens novel important avenues in predicting ictal events using information gathered from cardiovascular signals exclusively.
The Proteome and Lipidome of Thermococcus kodakarensis across the Stationary Phase
Gagen, Emma J.; Yoshinaga, Marcos Y.; Garcia Prado, Franka; Hinrichs, Kai-Uwe; Thomm, Michael
2016-01-01
The majority of cells in nature probably exist in a stationary-phase-like state, due to nutrient limitation in most environments. Studies on bacteria and yeast reveal morphological and physiological changes throughout the stationary phase, which lead to an increased ability to survive prolonged nutrient limitation. However, there is little information on archaeal stationary phase responses. We investigated protein- and lipid-level changes in Thermococcus kodakarensis with extended time in the...
Generating stationary entangled states in superconducting qubits
International Nuclear Information System (INIS)
Zhang Jing; Liu Yuxi; Li Chunwen; Tarn, T.-J.; Nori, Franco
2009-01-01
When a two-qubit system is initially maximally entangled, two independent decoherence channels, one per qubit, would greatly reduce the entanglement of the two-qubit system when it reaches its stationary state. We propose a method on how to minimize such a loss of entanglement in open quantum systems. We find that the quantum entanglement of general two-qubit systems with controllable parameters can be controlled by tuning both the single-qubit parameters and the two-qubit coupling strengths. Indeed, the maximum fidelity F max between the stationary entangled state, ρ ∞ , and the maximally entangled state, ρ m , can be about 2/3≅max(tr(ρ ∞ ρ m ))=F max , corresponding to a maximum stationary concurrence, C max , of about 1/3≅C(ρ ∞ )=C max . This is significant because the quantum entanglement of the two-qubit system can be produced and kept, even for a long time. We apply our proposal to several types of two-qubit superconducting circuits and show how the entanglement of these two-qubit circuits can be optimized by varying experimentally controllable parameters.
Propagation of Boundary-Induced Discontinuity in Stationary Radiative Transfer
Kawagoe, Daisuke; Chen, I.-Kun
2018-01-01
We consider the boundary value problem of the stationary transport equation in the slab domain of general dimensions. In this paper, we discuss the relation between discontinuity of the incoming boundary data and that of the solution to the stationary transport equation. We introduce two conditions posed on the boundary data so that discontinuity of the boundary data propagates along positive characteristic lines as that of the solution to the stationary transport equation. Our analysis does not depend on the celebrated velocity averaging lemma, which is different from previous works. We also introduce an example in two dimensional case which shows that piecewise continuity of the boundary data is not a sufficient condition for the main result.
Framework for Assessing Biogenic CO2 Emissions from Stationary Sources
This revision of the 2011 report, Accounting Framework for Biogenic CO2 Emissions from Stationary Sources, evaluates biogenic CO2 emissions from stationary sources, including a detailed study of the scientific and technical issues associated with assessing biogenic carbon dioxide...
Lin, Yezhi; Liu, Yinping; Li, Zhibin
2013-01-01
The Adomian decomposition method (ADM) is one of the most effective methods to construct analytic approximate solutions for nonlinear differential equations. In this paper, based on the new definition of the Adomian polynomials, Rach (2008) [22], the Adomian decomposition method and the Padé approximants technique, a new algorithm is proposed to construct analytic approximate solutions for nonlinear fractional differential equations with initial or boundary conditions. Furthermore, a MAPLE software package is developed to implement this new algorithm, which is user-friendly and efficient. One only needs to input the system equation, initial or boundary conditions and several necessary parameters, then our package will automatically deliver the analytic approximate solutions within a few seconds. Several different types of examples are given to illustrate the scope and demonstrate the validity of our package, especially for non-smooth initial value problems. Our package provides a helpful and easy-to-use tool in science and engineering simulations. Program summaryProgram title: ADMP Catalogue identifier: AENE_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/AENE_v1_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.html No. of lines in distributed program, including test data, etc.: 12011 No. of bytes in distributed program, including test data, etc.: 575551 Distribution format: tar.gz Programming language: MAPLE R15. Computer: PCs. Operating system: Windows XP/7. RAM: 2 Gbytes Classification: 4.3. Nature of problem: Constructing analytic approximate solutions of nonlinear fractional differential equations with initial or boundary conditions. Non-smooth initial value problems can be solved by this program. Solution method: Based on the new definition of the Adomian polynomials [1], the Adomian decomposition method and the Pad
Hammouda, Imen; Mihoubi, Daoued
2017-12-01
This work deals with a numerical study of the response of a porcelain slab when subjected to convective drying in stationary and non-stationary conditions. The used model describes heat, mass, and momentum transfers is applied to an unsaturated viscoelastic medium described by a Maxwell model. The numerical code allows us to determine the effect of the surrounding air temperature on drying kinetics and on mechanical stress intensities. Von Mises stresses are analysed in order to foresee an eventual damage that may occur during drying. Simulation results for several temperatures in the range of [30 °C, 90 °C] shows that for the temperature from 30 °C to 60 °C, Von Mises stresses are always lower than the yield strength. But above 70 °C, Von Mises stresses are higher than the ultimate strength, and consequently there is a risk of crack at the end of the constant drying rate period. The idea proposed in this work is to integrate a reducing temperature phase when the predicted Von Mises stress intensity exceeds the admissible stress. Simulation results shows that a non-stationary convective drying (90-60 °C) allows us to optimize costs and quality by reducing the drying time and maintaining Von Mises stress values under the admissible stress.
Nonlinear many-body reaction theories from nuclear mean field approximations
International Nuclear Information System (INIS)
Griffin, J.J.
1983-01-01
Several methods of utilizing nonlinear mean field propagation in time to describe nuclear reaction have been studied. The property of physical asymptoticity is analyzed in this paper, which guarantees that the prediction by a reaction theory for the physical measurement of internal fragment properties shall not depend upon the precise location of the measuring apparatus. The physical asymptoticity is guaranteed in the Schroedinger collision theory of a scuttering system with translationally invariant interaction by the constancy of the S-matrix elements and by the translational invariance of the internal motion for well-separated fragments. Both conditions are necessary for the physical asymptoticity. The channel asymptotic single-determinantal propagation can be described by the Dirac-TDHF (time dependent Hartree-Fock) time evolution. A new asymptotic Hartree-Fock stationary phase (AHFSP) description together with the S-matrix time-dependent Hartree-Fock (TD-S-HF) theory constitute the second example of a physically asymptotic nonlinear many-body reaction theory. A review of nonlinear mean field many-body reaction theories shows that initial value TDHF is non-asymptotic. The TD-S-HF theory is asymptotic by the construction. The gauge invariant periodic quantized solution of the exact Schroedinger problem has been considered to test whether it includes all of the exact eigenfunctions as it ought to. It did, but included as well an infinity of all spurions solutions. (Kato, T.)
A Novel Vehicle Stationary Detection Utilizing Map Matching and IMU Sensors
Directory of Open Access Journals (Sweden)
Md. Syedul Amin
2014-01-01
Full Text Available Precise navigation is a vital need for many modern vehicular applications. The global positioning system (GPS cannot provide continuous navigation information in urban areas. The widely used inertial navigation system (INS can provide full vehicle state at high rates. However, the accuracy diverges quickly in low cost microelectromechanical systems (MEMS based INS due to bias, drift, noise, and other errors. These errors can be corrected in a stationary state. But detecting stationary state is a challenging task. A novel stationary state detection technique from the variation of acceleration, heading, and pitch and roll of an attitude heading reference system (AHRS built from the inertial measurement unit (IMU sensors is proposed. Besides, the map matching (MM algorithm detects the intersections where the vehicle is likely to stop. Combining these two results, the stationary state is detected with a smaller timing window of 3 s. A longer timing window of 5 s is used when the stationary state is detected only from the AHRS. The experimental results show that the stationary state is correctly identified and the position error is reduced to 90% and outperforms previously reported work. The proposed algorithm would help to reduce INS errors and enhance the performance of the navigation system.
Three-dimensional boundary layer stability and transition
Malik, M. R.; Li, F.
1992-01-01
Nonparallel and nonlinear stability of a three-dimensional boundary layer, subject to crossflow instability, is investigated using parabolized stability equations (PSEs). Both traveling and stationary disturbances are considered and nonparallel effect on crossflow instability is found to be destabilizing. Our linear PSE results for stationary disturbances agree well with the results from direct solution of Navier-Stokes equations obtained by Spalart (1989). Nonlinear calculations have been carried out for stationary vortices and the computed wall vorticity pattern results in streamwise streaks which resemble remarkably well with the surface oil-flow visualizations in swept-wing experiments. Other features of the stationary vortex development (half-mushroom structure, inflected velocity profiles, vortex doubling, etc.) are also captured in our nonlinear calculations. Nonlinear interaction of the stationary amplitude of the stationary vortex is large as compared to the traveling mode, and the stationary vortex dominates most of the downstream development. When the two modes have the same initial amplitude, the traveling mode dominates the downstream development owing to its higher growth rate, and there is a tendency for the stationary mode to be suppressed. The effect of nonlinear wave development on the skin-friction coefficient is also computed.
Nonlinear magneto-optical rotation produced by atoms near a J=1→J=0 transition
International Nuclear Information System (INIS)
Roscinski, Vitalij; Czub, Janusz; Miklaszewski, Wieslaw
2004-01-01
The nonlinear magneto-optical rotation in a medium consisting of J=1→J=0 atoms placed in a static magnetic field is studied. The density matrix approach and irreducible atomic basis are used to describe the state of the atomic system. The stationary propagation equations for two collinear laser beams with perpendicular circular polarizations are derived and analyzed in the case of the magnetic field perpendicular to the light propagation direction. The effect of the linear polarization rotation toward the direction parallel or perpendicular to the magnetic field vector and lossless propagation of the resulting light are predicted. The conversion of the circularly polarized beam into linearly polarized one is shown. The propagation of the leading edges of switched on cw-laser beams and their stationary propagation are analyzed numerically. The dependence of the considered effects on the light detuning and on the additional magnetic field component parallel to the light propagation direction is discussed. The destructive role of the collisional relaxation is demonstrated
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Vacillations induced by interference of stationary and traveling planetary waves
Salby, Murry L.; Garcia, Rolando R.
1987-01-01
The interference pattern produced when a traveling planetary wave propagates over a stationary forced wave is explored, examining the interference signature in a variety of diagnostics. The wave field is first restricted to a diatomic spectrum consisting of two components: a single stationary wave and a single monochromatic traveling wave. A simple barotropic normal mode propagating over a simple stationary plane wave is considered, and closed form solutions are obtained. The wave fields are then restricted spatially, providing more realistic structures without sacrificing the advantages of an analytical solution. Both stationary and traveling wave fields are calculated numerically with the linearized Primitive Equations in a realistic basic state. The mean flow reaction to the fluctuating eddy forcing which results from interference is derived. Synoptic geopotential behavior corresponding to the combined wave and mean flow fields is presented, and the synoptic signature in potential vorticity on isentropic surfaces is examined.
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Costationarity of Locally Stationary Time Series Using costat
Cardinali, Alessandro; Nason, Guy P.
2013-01-01
This article describes the R package costat. This package enables a user to (i) perform a test for time series stationarity; (ii) compute and plot time-localized autocovariances, and (iii) to determine and explore any costationary relationship between two locally stationary time series. Two locally stationary time series are said to be costationary if there exists two time-varying combination functions such that the linear combination of the two series with the functions produces another time...
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Partial synchronization in networks of non-linearly coupled oscillators: The Deserter Hubs Model
Energy Technology Data Exchange (ETDEWEB)
Freitas, Celso, E-mail: cbnfreitas@gmail.com; Macau, Elbert, E-mail: elbert.macau@inpe.br [Associate Laboratory for Computing and Applied Mathematics - LAC, Brazilian National Institute for Space Research - INPE (Brazil); Pikovsky, Arkady, E-mail: pikovsky@uni-potsdam.de [Department of Physics and Astronomy, University of Potsdam, Germany and Department of Control Theory, Nizhni Novgorod State University, Gagarin Av. 23, 606950, Nizhni Novgorod (Russian Federation)
2015-04-15
We study the Deserter Hubs Model: a Kuramoto-like model of coupled identical phase oscillators on a network, where attractive and repulsive couplings are balanced dynamically due to nonlinearity of interactions. Under weak force, an oscillator tends to follow the phase of its neighbors, but if an oscillator is compelled to follow its peers by a sufficient large number of cohesive neighbors, then it actually starts to act in the opposite manner, i.e., in anti-phase with the majority. Analytic results yield that if the repulsion parameter is small enough in comparison with the degree of the maximum hub, then the full synchronization state is locally stable. Numerical experiments are performed to explore the model beyond this threshold, where the overall cohesion is lost. We report in detail partially synchronous dynamical regimes, like stationary phase-locking, multistability, periodic and chaotic states. Via statistical analysis of different network organizations like tree, scale-free, and random ones, we found a measure allowing one to predict relative abundance of partially synchronous stationary states in comparison to time-dependent ones.
Bossa, Matias; Zacur, Ernesto; Olmos, Salvador
2010-07-01
Tensor-based morphometry (TBM) is an analysis technique where anatomical information is characterized by means of the spatial transformations mapping a customized template with the observed images. Therefore, accurate inter-subject non-rigid registration is an essential prerequisite for both template estimation and image warping. Subsequent statistical analysis on the spatial transformations is performed to highlight voxel-wise differences. Most of previous TBM studies did not explore the influence of the registration parameters, such as the parameters defining the deformation and the regularization models. In this work performance evaluation of TBM using stationary velocity field (SVF) diffeomorphic registration was performed in a subset of subjects from Alzheimer's Disease Neuroimaging Initiative (ADNI) study. A wide range of values of the registration parameters that define the transformation smoothness and the balance between image matching and regularization were explored in the evaluation. The proposed methodology provided brain atrophy maps with very detailed anatomical resolution and with a high significance level compared with results recently published on the same data set using a non-linear elastic registration method. Copyright (c) 2010 Elsevier Inc. All rights reserved.
Non-stationary pre-envelope covariances of non-classically damped systems
Muscolino, G.
1991-08-01
A new formulation is given to evaluate the stationary and non-stationary response of linear non-classically damped systems subjected to multi-correlated non-separable Gaussian input processes. This formulation is based on a new and more suitable definition of the impulse response function matrix for such systems. It is shown that, when using this definition, the stochastic response of non-classically damped systems involves the evaluation of quantities similar to those of classically damped ones. Furthermore, considerations about non-stationary cross-covariances, spectral moments and pre-envelope cross-covariances are presented for a monocorrelated input process.
Nonlinear dynamics of an elliptic vortex embedded in an oscillatory shear flow.
Ryzhov, Eugene A
2017-11-01
The nonlinear dynamics of an elliptic vortex subjected to a time-periodic linear external shear flow is studied numerically. Making use of the ideas from the theory of nonlinear resonance overlaps, the study focuses on the appearance of chaotic regimes in the ellipse dynamics. When the superimposed flow is stationary, two general types of the steady-state phase portrait are considered: one that features a homoclinic separatrix delineating bounded and unbounded phase trajectories and one without a separatrix (all the phase trajectories are bounded in a periodic domain). When the external flow is time-periodic, the ensuing nonlinear dynamics differs significantly in both cases. For the case with a separatrix and two distinct types of phase trajectories: bounded and unbounded, the effect of the most influential nonlinear resonance with the winding number of 1:1 is analyzed in detail. Namely, the process of occupying the central stability region associated with the steady-state elliptic critical point by the stability region associated with the nonlinear resonance of 1:1 as the perturbation frequency gradually varies is investigated. A stark increase in the persistence of the central regular dynamics region against perturbation when the resonance of 1:1 associated stability region occupies the region associated with the steady-state elliptic critical point is observed. An analogous persistence of the regular motion occurs for higher perturbation frequencies when the corresponding stability islands reach the central stability region associated with the steady-state elliptic point. An analysis for the case with the resonance of 1:2 is presented. For the second case with only bounded phase trajectories and, therefore, no separatrix, the appearance of much bigger stability islands associated with nonlinear resonances compared with the case with a separatrix is reported.
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Hydrogen Fuel Cell Analysis: Lessons Learned from Stationary Power Generation Final Report
Energy Technology Data Exchange (ETDEWEB)
Scott E. Grasman; John W. Sheffield; Fatih Dogan; Sunggyu Lee; Umit O. Koylu; Angie Rolufs
2010-04-30
This study considered opportunities for hydrogen in stationary applications in order to make recommendations related to RD&D strategies that incorporate lessons learned and best practices from relevant national and international stationary power efforts, as well as cost and environmental modeling of pathways. The study analyzed the different strategies utilized in power generation systems and identified the different challenges and opportunities for producing and using hydrogen as an energy carrier. Specific objectives included both a synopsis/critical analysis of lessons learned from previous stationary power programs and recommendations for a strategy for hydrogen infrastructure deployment. This strategy incorporates all hydrogen pathways and a combination of distributed power generating stations, and provides an overview of stationary power markets, benefits of hydrogen-based stationary power systems, and competitive and technological challenges. The motivation for this project was to identify the lessons learned from prior stationary power programs, including the most significant obstacles, how these obstacles have been approached, outcomes of the programs, and how this information can be used by the Hydrogen, Fuel Cells & Infrastructure Technologies Program to meet program objectives primarily related to hydrogen pathway technologies (production, storage, and delivery) and implementation of fuel cell technologies for distributed stationary power. In addition, the lessons learned address environmental and safety concerns, including codes and standards, and education of key stakeholders.
Some models of propagation of extremely short electromagnetic pulses in a nonlinear medium
International Nuclear Information System (INIS)
Maimistov, Andrei I
2000-01-01
Some cases of model media considered in this paper allow analytical solutions to nonlinear wave equations to be found and the time dependence of the electric field strength to be determined in the explicit form for arbitrarily short electromagnetic pulses. Our analysis does not employ any assumptions concerning a harmonic carrier wave or the variation rate of the field in such pulses. The class of models considered includes two-level resonance and quasi-resonance systems. Nonresonance media are analysed in terms of models of anharmonic oscillators - the Duffing and Lorentz models. In most cases, only particular solutions describing the stationary propagation of a video pulse (a unipolar transient of the electric field or a pulse including a small number of oscillations of the electric field around zero) can be found. These solutions correspond to sufficiently strong electromagnetic fields when the dispersion inherent in the medium is suppressed by nonlinear processes. (invited paper)
Periodic oscillations in linear continuous media coupled with nonlinear discrete systems
International Nuclear Information System (INIS)
Lupini, R.
1998-01-01
A general derivation of partial differential equations with boundary conditions in the form of ordinary differential equations is obtained using the principle of stationary action for a Lagrangian function composed of continuous plus discrete parts in interaction across the boundaries of a 1-dimensional medium. This approach leads directly to the theorem of energy conservation. For linear continuous medium, homogeneous Dirichlet condition at one boundary, and nonlinear oscillator at the other boundary, the entire differential problem reduces to a nonlinear differential-difference equation of neutral type and of the second order. The lag parameter is τ = l/c, where c is the phase speed, l the length of the continuum. The Author investigate the problem of the occurrence of periodic solutions of period integer multiple of the lag (super harmonic solutions) in the case of zero inertia of the boundary system. The problem for such oscillations is shown to reduce to systems of ordinary differential equations with matching conditions in a phase space of lower dimensionality: Phase-plane techniques are used to determine solutions of period 4τ, 8τ and 6τ
STATIONARY HIGH-PERFORMANCE DISCHARGES IN THE DIII-D TOKAMAK
International Nuclear Information System (INIS)
LUCE, TC; WADE, MR; FERRON, JR; HYATT, AW; KELLMAN, AG; KINSEY, JE; LAHAYE, RJ; LASNIER, CJ; MURAKAMI, M; POLITZER, PA; SCOVILLE, JT
2002-01-01
A271 STATIONARY HIGH-PERFORMANCE DISCHARGES IN THE DII-D TOKAMAK. Discharges which can satisfy the high gain goals of burning plasma experiments have been demonstrated in the DIII-D tokamak under stationary conditions at relatively low plasma current (q 95 > 4). A figure of merit for fusion gain (β N H 89 /q 95 2 ) has been maintained at values corresponding to | = 10 operation in a burning plasma for > 6 s or 36τ E and 2τ R . The key element is the relaxation of the current profile to a stationary state with q min > 1. In the absence of sawteeth and fishbones, stable operation has been achieved up to the estimated no-wall β limit. Feedback control of the energy content and particle inventory allow reproducible, stationary operation. The particle inventory is controlled by gas fueling and active pumping; the wall plays only a small role in the particle balance. The reduced current lessens significantly the potential for structural damage in the event of a major disruption. In addition, the pulse length capability is greatly increased, which is essential for a technology testing phase of a burning plasma experiment where fluence (duty cycle) is important
Stationary strings near a higher-dimensional rotating black hole
International Nuclear Information System (INIS)
Frolov, Valeri P.; Stevens, Kory A.
2004-01-01
We study stationary string configurations in a space-time of a higher-dimensional rotating black hole. We demonstrate that the Nambu-Goto equations for a stationary string in the 5D (five-dimensional) Myers-Perry metric allow a separation of variables. We present these equations in the first-order form and study their properties. We prove that the only stationary string configuration that crosses the infinite redshift surface and remains regular there is a principal Killing string. A worldsheet of such a string is generated by a principal null geodesic and a timelike at infinity Killing vector field. We obtain principal Killing string solutions in the Myers-Perry metrics with an arbitrary number of dimensions. It is shown that due to the interaction of a string with a rotating black hole, there is an angular momentum transfer from the black hole to the string. We calculate the rate of this transfer in a space-time with an arbitrary number of dimensions. This effect slows down the rotation of the black hole. We discuss possible final stationary configurations of a rotating black hole interacting with a string
Photon induced non-linear quantized double layer charging in quaternary semiconducting quantum dots.
Nair, Vishnu; Ananthoju, Balakrishna; Mohapatra, Jeotikanta; Aslam, M
2018-03-15
Room temperature quantized double layer charging was observed in 2 nm Cu 2 ZnSnS 4 (CZTS) quantum dots. In addition to this we observed a distinct non-linearity in the quantized double layer charging arising from UV light modulation of double layer. UV light irradiation resulted in a 26% increase in the integral capacitance at the semiconductor-dielectric (CZTS-oleylamine) interface of the quantum dot without any change in its core size suggesting that the cause be photocapacitive. The increasing charge separation at the semiconductor-dielectric interface due to highly stable and mobile photogenerated carriers cause larger electrostatic forces between the quantum dot and electrolyte leading to an enhanced double layer. This idea was supported by a decrease in the differential capacitance possible due to an enhanced double layer. Furthermore the UV illumination enhanced double layer gives us an AC excitation dependent differential double layer capacitance which confirms that the charging process is non-linear. This ultimately illustrates the utility of a colloidal quantum dot-electrolyte interface as a non-linear photocapacitor. Copyright © 2017 Elsevier Inc. All rights reserved.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
International Nuclear Information System (INIS)
Solarin, Sakiru Adebola; Lean, Hooi Hooi
2016-01-01
This paper examines the integration properties of the total oil consumption in 57 countries for the period of 1965–2012. A combination of new and powerful linear and nonlinear stationarity tests are employed to achieve the objectives of the study. We find that the oil consumption series in 21 countries follow a nonlinearity path while those in the other countries are linear in nature. Evidence of the presence of a unit root is found for the total oil consumption series in 38 countries while the series is stationary in the remaining 19 countries. An important insight is that the blueprints that were designed to reduce oil consumption are likely to have a permanent effect in most of the countries. - Highlights: • We examine the integration properties of total oil consumption in 57 countries. • We apply new and powerful linear and nonlinear stationarity tests. • Unit root is found in two third of the countries. • Blueprints designed to reduce oil consumption are likely to have permanent effect.
Gao, Peng
2018-04-01
This work concerns the problem associated with averaging principle for a higher order nonlinear Schrödinger equation perturbed by a oscillating term arising as the solution of a stochastic reaction-diffusion equation evolving with respect to the fast time. This model can be translated into a multiscale stochastic partial differential equations. Stochastic averaging principle is a powerful tool for studying qualitative analysis of stochastic dynamical systems with different time-scales. To be more precise, under suitable conditions, we prove that there is a limit process in which the fast varying process is averaged out and the limit process which takes the form of the higher order nonlinear Schrödinger equation is an average with respect to the stationary measure of the fast varying process. Finally, by using the Khasminskii technique we can obtain the rate of strong convergence for the slow component towards the solution of the averaged equation, and as a consequence, the system can be reduced to a single higher order nonlinear Schrödinger equation with a modified coefficient.
Gao, Peng
2018-06-01
This work concerns the problem associated with averaging principle for a higher order nonlinear Schrödinger equation perturbed by a oscillating term arising as the solution of a stochastic reaction-diffusion equation evolving with respect to the fast time. This model can be translated into a multiscale stochastic partial differential equations. Stochastic averaging principle is a powerful tool for studying qualitative analysis of stochastic dynamical systems with different time-scales. To be more precise, under suitable conditions, we prove that there is a limit process in which the fast varying process is averaged out and the limit process which takes the form of the higher order nonlinear Schrödinger equation is an average with respect to the stationary measure of the fast varying process. Finally, by using the Khasminskii technique we can obtain the rate of strong convergence for the slow component towards the solution of the averaged equation, and as a consequence, the system can be reduced to a single higher order nonlinear Schrödinger equation with a modified coefficient.
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
Quantum field theory in stationary coordinate systems
International Nuclear Information System (INIS)
Pfautsch, J.D.
1981-01-01
Quantum field theory is examined in stationary coordinate systems in Minkowski space. Preliminary to quantization of the scalar field, all of the possible stationary coordinate systems in flat spacetime are classified and explicitly constructed. Six distinct classes of such systems are found. Of these six, three have (identical) event horizons associated with them and five have Killing horizons. Two classes have distinct Killing and event horizons, with an intervening region analogous to the ergosphere in rotating black holes. Particular representatives of each class are selected for subsequent use in the quantum field theory. The scalar field is canonically quantized and a vacuum defined in each of the particular coordinate systems chosen. The vacuum states can be regarded as adapted to the six classes of stationary motions. There are only two vacuum states found, the Minkowski vacuum in those coordinate systems without event horizons and the Fulling vacuum in those with event horizons. The responses of monopole detectors traveling along stationary world lines are calculated in both the Minkowski and Fulling vacuums. The responses for each class of motions are distinct from those for every other class. A vacuum defined by the response of a detector must therefore not be equivalent in general to a vacuum defined by canonical quantization. Quantization of the scalar field within a rotating wedge is examined. It has not been possible to construct mode functions satisfying appropriate boundary conditions on the surface of the wedge. The asymptotic form of the renormalized stress tensor near the surfaces had been calculated and is found to include momentum terms which represent a circulation of energy within the wedge
Expansions of general stationary stochastic optical fields: general formalism
International Nuclear Information System (INIS)
Martinez-Herrero, R.; Mejias, P.M.
1985-01-01
A new expansion of a general stationary stochastic optical field is derived. Each term of the series is seen to represent a recently defined new class of optical fields, the so-called spectrally quasi-factorizable fields. Alternative expansion in terms of nonstationary fields that obey the wave equation is also shown. A relationship between temporal and spatial features of stationary free optical fields is discussed
Geophysics-based method of locating a stationary earth object
Daily, Michael R [Albuquerque, NM; Rohde, Steven B [Corrales, NM; Novak, James L [Albuquerque, NM
2008-05-20
A geophysics-based method for determining the position of a stationary earth object uses the periodic changes in the gravity vector of the earth caused by the sun- and moon-orbits. Because the local gravity field is highly irregular over a global scale, a model of local tidal accelerations can be compared to actual accelerometer measurements to determine the latitude and longitude of the stationary object.
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Stationary nonimaging lenses for solar concentration.
Kotsidas, Panagiotis; Chatzi, Eleni; Modi, Vijay
2010-09-20
A novel approach for the design of refractive lenses is presented, where the lens is mounted on a stationary aperture and the Sun is tracked by a moving solar cell. The purpose of this work is to design a quasi-stationary concentrator by replacing the two-axis tracking of the Sun with internal motion of the miniaturized solar cell inside the module. Families of lenses are designed with a variation of the simultaneous multiple surface technique in which the sawtooth genetic algorithm is implemented to optimize the geometric variables of the optic in order to produce high fluxes for a range of incidence angles. Finally, we show examples of the technique for lenses with 60° and 30° acceptance half-angles, with low to medium attainable concentrations.
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Modeling stationary and dynamic pebbles in a pebble bed reactor
International Nuclear Information System (INIS)
Zhao, Xiang; Montgomery, Trent; Zhang, Sijun
2011-01-01
This paper presents a numerical study of the stationary and dynamic pebbles in a pebble bed reactor (PBR) by means of discrete element method (DEM). At first, the packing structure of stationary pebbles is simulated by filling process until the settling of pebbles into PBR. The packing structural properties are obtained and analyzed. Subsequently, when the outlet of PBR is open during the operational maintenance of PBR, the stationary pebbles start to flow downward and are removed at the bottom of PBR. The dynamic behavior of pebbles is predicted and discussed. Our results indicate the DEM can offer both macroscopic and microscopic information for PBR design calculations and safety assessment. (author)
Directory of Open Access Journals (Sweden)
Fan Liang
2013-01-01
Full Text Available Off-pump Coronary Artery Bypass Graft (CABG surgery outperforms traditional on-pump surgery because the assisted robotic tools can alleviate the relative motion between the beating heart and robotic tools. Therefore, it is possible for the surgeon to operate on the beating heart and thus lessens post surgery complications for the patients. Due to the highly irregular and non-stationary nature of heart motion, it is critical that the beating heart motion is predicted in the model-based track control procedures. It is technically preferable to model heart motion in a nonlinear way because the characteristic analysis of 3D heart motion data through Bi-spectral analysis and Fourier methods demonstrates the involved nonlinearity of heart motion. We propose an adaptive nonlinear heart motion model based on the Volterra Series in this paper. We also design a fast lattice structure to achieve computational-efficiency for real-time online predictions. We argue that the quadratic term of the Volterra Series can improve the prediction accuracy by covering sharp change points and including the motion with sufficient detail. The experiment results indicate that the adaptive nonlinear heart motion prediction algorithm outperforms the autoregressive (AR and the time-varying Fourier-series models in terms of the root mean square of the prediction error and the prediction error in extreme cases.
International Nuclear Information System (INIS)
Ge, Gen; Li, ZePeng
2016-01-01
A modified stochastic averaging method on single-degree-of-freedom (SDOF) oscillators under white noise excitations with strongly nonlinearity was proposed. Considering the existing approach dealing with strongly nonlinear SDOFs derived by Zhu and Huang [14, 15] is quite time consuming in calculating the drift coefficient and diffusion coefficients and the expressions of them are considerable long, the so-called He's energy balance method was applied to overcome the minor defect of the Zhu and Huang's method. The modified method can offer more concise approximate expressions of the drift and diffusion coefficients without weakening the accuracy of predicting the responses of the systems too much by giving an averaged frequency beforehand. Three examples, a cubic and quadratic nonlinearity coexisting oscillator, a quadratic nonlinear oscillator under external white noise excitations and an externally excited Duffing–Rayleigh oscillator, were given to illustrate the approach we proposed. The three examples were excited by the Gaussian white noise and the Gaussian colored noise separately. The stationary responses of probability density of amplitudes and energy, together with joint probability density of displacement and velocity are studied to verify the presented approach. The reliability of the systems were also investigated to offer further support. Digital simulations were carried out and the output of that are coincide with the theoretical approximations well.
Stationary theory of scattering
International Nuclear Information System (INIS)
Kato, T.
1977-01-01
A variant of the stationary methods is described, and it is shown that it is useful in a wide range of problems, including scattering, by long-range potentials, two-space scattering, and multichannel scattering. The method is based on the notion of spectral forms. The paper is restricted to the simplest case of continuous spectral forms defined on a Banach space embedded in the basic Hilbert space. (P.D.)
Research and simulation of the decoupling transformation in AC motor vector control
He, Jiaojiao; Zhao, Zhongjie; Liu, Ken; Zhang, Yongping; Yao, Tuozhong
2018-04-01
Permanent magnet synchronous motor (PMSM) is a nonlinear, strong coupling, multivariable complex object, and transformation decoupling can solve the coupling problem of permanent magnet synchronous motor. This paper gives a permanent magnet synchronous motor (PMSM) mathematical model, introduces the permanent magnet synchronous motor vector control coordinate transformation in the process of modal matrix inductance matrix transform through the matrix related knowledge of different coordinates of diagonalization, which makes the coupling between the independent, realize the control of motor current and excitation the torque current coupling separation, and derived the coordinate transformation matrix, the thought to solve the coupling problem of AC motor. Finally, in the Matlab/Simulink environment, through the establishment and combination between the PMSM ontology, coordinate conversion module, built the simulation model of permanent magnet synchronous motor vector control, introduces the model of each part, and analyzed the simulation results.
International Nuclear Information System (INIS)
Chao, A.W.; Lee, M.J.
1975-09-01
Effects upon longitudinal bunch shape in a storage ring due to linear and nonlinear potential can be calculated by finding the stationary solution to the Fokker-Planck equation for the particle distribution. Effects upon transverse bunch shape of a stored electron beam due to photon emissions and damping can be calculated by this method. It has been found that this method can also be used for a case in which the transverse modes of oscillation are coupled to the energy deviation δ. Examples of lattice elements which produce linear coupling between these oscillations are skew quadrupole magnets and solenoid magnets. For the linearly coupled case the stationary solution has been found to be given by exp (ΣΣA/sub ij/ x/sub i/x/sub j/) with x/sub i/ the canonical variables (x,p/sub x/, y, p/sub y/, δ, p/sub δ/) and A /sub ij/ some constants. The solution for the values of A /sub ij/'s will be described in this report. It will be shown that this solution can be expressed in a compact form. For simple cases, this form of solution leads directly to analytic expressions for the values of A /sub ij/'s and the bunch shape can be calculated by integrating the distribution function over some of the coordinates; for the more complex cases, it can be conveniently adapted as an algorithm for numerical evaluation. 16 refs
Coherent nonlinear quantum model for composite fermions
Energy Technology Data Exchange (ETDEWEB)
Reinisch, Gilbert [Science Institute, University of Iceland, Dunhaga 3, IS-107 Reykjavik (Iceland); Gudmundsson, Vidar, E-mail: vidar@hi.is [Science Institute, University of Iceland, Dunhaga 3, IS-107 Reykjavik (Iceland); Manolescu, Andrei [School of Science and Engineering, Reykjavik University, Menntavegur 1, IS-101 Reykjavik (Iceland)
2014-04-01
Originally proposed by Read [1] and Jain [2], the so-called “composite-fermion” is a phenomenological quasi-particle resulting from the attachment of two local flux quanta, seen as nonlocal vortices, to electrons situated on a two-dimensional (2D) surface embedded in a strong orthogonal magnetic field. In this Letter this phenomenon is described as a highly-nonlinear and coherent mean-field quantum process of the soliton type by use of a 2D stationary Schrödinger–Poisson differential model with only two Coulomb-interacting electrons. At filling factor ν=1/3 of the lowest Landau level the solution agrees with both the exact two-electron antisymmetric Schrödinger wavefunction and with Laughlin's Jastrow-type guess for the fractional quantum Hall effect, hence providing this latter with a tentative physical justification deduced from the experimental results and based on first principles.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Radio-Oxidation in Polyolefins: Non-Stationary Kinetic Conditions
International Nuclear Information System (INIS)
Dely, N.
2006-01-01
In the last fifty years, many authors have been interested in the radio-oxidation processes occurring in polymers. The polymer degradation under ionising radiations in presence of dioxygen is well described by a radical chemistry. The radio-oxidation process occurs in three steps: the first one is the production of radicals P degree by interaction between the polymer and the ionising radiations; then radicals P degree react spontaneously with O 2 solved in the polymer giving a peroxy radical POO degree which attacks the polymer forming a hydroperoxide POOH and a new radical P degree (propagation). The third step corresponds to the termination step, that is bimolecular reactions between radicals. It is generally assumed that the stationary state is rapidly reached and consequently that the oxidation induced during the built-up period of the radical concentration can be neglected. However, to our best knowledge, the temporal evolution of radical concentrations before reaching the steady state regime has never been studied in details. We recently performed a complete study of oxygen consumption under electron irradiation for an EPDM elastomer. An analysis, as function of dose rate and oxygen pressure, and assuming steady state conditions, allowed extracting all the kinetic constants. Starting for these experimental data, we calculated the build-up of the radical concentration by solving numerically the differential equations with help of the Minichem code. We conclude that, in fact, the oxidation induced during the built-up period is negligible. In this paper we show that [P degree] could present a quasi-stationary plateau before reaching its stationary level. Consequently, the full radical time evolution is essentially determined by two characteristic times for reaching the quasi and stationary levels and three concentrations: [P degree] and [POO degree] at the stationary level and [P degree] at the quasi-stationary plateau. We show that realistic approximations can
International Nuclear Information System (INIS)
Gordin, V.A.
1998-01-01
First integral of the systems of nonlinear equations governing the behaviour of atmospheric, oceanic and MHD plasma models are determined. The Lyapunov stability conditions for the solutions under small initial disturbances are analyzed. (author)
Stationary neoclassical profiles of plasma parameters in stellarators
International Nuclear Information System (INIS)
Danilkin, I.S.; Mineev, A.B.
1991-01-01
Peculiarities of neoclassical model of heat and particle transfer, occuring by calculations of plasma stationary profile parameters in stellarators are considered. The main peculiarity out of all consists in ineadequate compatibility with real physical conditions on the boundary, requiring application of supplementary 'anomalous' transfer or special (but technically possible) adjustment of particle and heat sources to achieve solution in form of 'correct' monotonically sloping profile. It is stated, that neoclassical theory does not provide for well-known ambiguity of solutions for ambipolar electrical field by search of monotonous stationary profiles supported by outside sources
Spin in stationary gravitational fields and rotating frames
International Nuclear Information System (INIS)
Obukhov, Yuri N.; Silenko, Alexander J.; Teryaev, Oleg V.
2010-01-01
A spin motion of particles in stationary spacetimes is investigated in the framework of the classical gravity and relativistic quantum mechanics. We bring the Dirac equation for relativistic particles in nonstatic spacetimes to the Hamiltonian form and perform the Foldy-Wouthuysen transformation. We show the importance of the choice of tetrads for description of spin dynamics in the classical gravity. We derive classical and quantum mechanical equations of motion of the spin for relativistic particles in stationary gravitational fields and rotating frames and establish the full agreement between the classical and quantum mechanical approaches.
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Backset-stationary and during car driving.
Jonsson, Bertil; Stenlund, Hans; Björnstig, Ulf
2008-12-01
The aim of the study was to measure and analyze backset, defined as the horizontal distance between the back of the occupant's head and a point located on the ventral/top aspect of the sewn rim of the head restraint, with the car stationary and during driving, in the driver's position in a modern car. A population of 65 subjects, 35 males and 30 females, was studied in a Volvo V70 car, model year 2007. The subjects were studied in the driver's position, in a self-selected posture. Stationary backset was measured with the technique described by Jonsson et al. (2007) and backset during driving with video analysis. Descriptive data were calculated, and variability and correlation analyses were performed. A t-test was used to test differences of means. Significance level was set to 0.05. In comparison to stationary backset, mean backset during driving was 43 mm greater in males and 41 mm greater in females. Driving backset was 44 mm larger in males than in females. Driving backset was moderately correlated (0.37-0.43) to stature, seated height, and seat back angle in males and moderately correlated (0.44-0.52) to hip width, waist circumference, and weight in females. The overall intraclass correlation coefficient for backset during driving was 0.81 (CI: 0.75-0.86). These results may be of use in designing future updates of test protocols/routines for geometric backset, such as RCAR and RCAR-IIWPG.
Stationary flywheel energy storage
Energy Technology Data Exchange (ETDEWEB)
Gilhaus, A; Hau, E; Gassner, G; Huss, G; Schauberger, H
1981-01-01
The aim of this system study is to find out industrial applications of stationary flywheel energy accumulators. The economic value for the consumer and the effects on the power supply grid are investigated. Up to now, stationary flywheel energy accumulators have only been used in a small range. The main reason for thinking of the application in a wider range was the hope that those could be used economically for lowering the maximum output demand of the power supply grid. The possible savings in energy costs, however, proved to be too small for paying back the investment costs. Further benefits are necessary for advantageous application. As to overall economy, compensation of short time maximum power output seems to be more favorable at the power stations. An additional possibility for energy storage by flywheels is given where otherwise lost energy can be used effectively, according to the successful brake energy storage in vehicles. Under this aspect the future use of flywheels in wind-power-plants seems to be promising. Attractive savings of energy can be obtained by introducing modern flywheel technology for emergency power supply units which are employed for instance in telecommunication systems. Especially the application for emergency power supply, in power stations and in combustion with wind energy converters need further investigation.
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
Directory of Open Access Journals (Sweden)
V. S. Zarubin
2016-01-01
Full Text Available A temperature state of the solid body may depend both on the conditions of heat exchange with external environment surrounding its surface and on the energy release within the body volume, caused, for example, by the processes in nuclear reactor elements or exothermic chemical reactions, absorption of penetrating radiation energy or transformation of a part of the electrical power into heat with flowing electric current (so-called Joule heat.If with growing temperature the intensity of bulk power density increases, a limited steady temperature state can emerge at which heat extracted to the body surface and released within its volume reaches maximum. Thus, small increments of temperature lead to an increase of heat release, which can not be extracted to the body surface by conduction without further temperature increase. As a result, the steady temperature distribution in the body becomes impossible that determines the state of the thermal explosion, so named due to the fact that in this case the appropriate mathematical model predicts an unlimited temperature increase.A lot of published papers and monographs concerning the study of the combustion and explosion processes in a stationary medium analyse the thermal explosion state. The most famous papers consider a mathematical model to describe a temperature distribution in the case when heat release is because of exothermic chemical reactions the rate of which increases with temperature growth. The dependence of the chemical reaction rate on temperature is usually described by the exponential Arrhenius law, which makes it necessary to consider an essentially nonlinear mathematical model containing differential equation, which includes the term, nonlinearly rising with increasing temperature. Even with simplifying assumptions, this model allows an exact closed form solution only in the case of one-dimensional temperature distributions in the two areas of the canonical form: in the plate, infinite
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Distinguishing Stationary/Nonstationary Scaling Processes Using Wavelet Tsallis q-Entropies
Directory of Open Access Journals (Sweden)
Julio Ramirez Pacheco
2012-01-01
Full Text Available Classification of processes as stationary or nonstationary has been recognized as an important and unresolved problem in the analysis of scaling signals. Stationarity or nonstationarity determines not only the form of autocorrelations and moments but also the selection of estimators. In this paper, a methodology for classifying scaling processes as stationary or nonstationary is proposed. The method is based on wavelet Tsallis q-entropies and particularly on the behaviour of these entropies for scaling signals. It is demonstrated that the observed wavelet Tsallis q-entropies of 1/f signals can be modeled by sum-cosh apodizing functions which allocates constant entropies to a set of scaling signals and varying entropies to the rest and that this allocation is controlled by q. The proposed methodology, therefore, differentiates stationary signals from non-stationary ones based on the observed wavelet Tsallis entropies for 1/f signals. Experimental studies using synthesized signals confirm that the proposed method not only achieves satisfactorily classifications but also outperforms current methods proposed in the literature.
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Non-Linear Dynamics of Saturn's Rings
Esposito, L. W.
2016-12-01
Non-linear processes can explain why Saturn's rings are so active and dynamic. Ring systems differ from simple linear systems in two significant ways: 1. They are systems of granular material: where particle-to-particle collisions dominate; thus a kinetic, not a fluid description needed. Stresses are strikingly inhomogeneous and fluctuations are large compared to equilibrium. 2. They are strongly forced by resonances: which drive a non-linear response, that push the system across thresholds that lead to persistent states. Some of this non-linearity is captured in a simple Predator-Prey Model: Periodic forcing from the moon causes streamline crowding; This damps the relative velocity. About a quarter phase later, the aggregates stir the system to higher relative velocity and the limit cycle repeats each orbit, with relative velocity ranging from nearly zero to a multiple of the orbit average. Summary of Halo Results: A predator-prey model for ring dynamics produces transient structures like `straw' that can explain the halo morphology and spectroscopy: Cyclic velocity changes cause perturbed regions to reach higher collision speeds at some orbital phases, which preferentially removes small regolith particles; surrounding particles diffuse back too slowly to erase the effect: this gives the halo morphology; this requires energetic collisions (v ≈ 10m/sec, with throw distances about 200km, implying objects of scale R ≈ 20km).Transform to Duffing Eqn : With the coordinate transformation, z = M2/3, the Predator-Prey equations can be combined to form a single second-order differential equation with harmonic resonance forcing.Ring dynamics and history implications: Moon-triggered clumping explains both small and large particles at resonances. We calculate the stationary size distribution using a cell-to-cell mapping procedure that converts the phase-plane trajectories to a Markov chain. Approximating it as an asymmetric random walk with reflecting boundaries
Learning Markov models for stationary system behaviors
DEFF Research Database (Denmark)
Chen, Yingke; Mao, Hua; Jaeger, Manfred
2012-01-01
to a single long observation sequence, and in these situations existing automatic learning methods cannot be applied. In this paper, we adapt algorithms for learning variable order Markov chains from a single observation sequence of a target system, so that stationary system properties can be verified using......Establishing an accurate model for formal verification of an existing hardware or software system is often a manual process that is both time consuming and resource demanding. In order to ease the model construction phase, methods have recently been proposed for automatically learning accurate...... the learned model. Experiments demonstrate that system properties (formulated as stationary probabilities of LTL formulas) can be reliably identified using the learned model....
Stationary Density Variation Produced by a Standing Plasma Wave
DEFF Research Database (Denmark)
Michelsen, Poul; Pécseli, Hans; Juul Rasmussen, Jens
1977-01-01
Measurements are presented of a stationary density modulation produced by a standing electron plasma wave. The experimental results are well explained by taking into account the ponderomotive forces on the electrons exerted by the high frequency field.......Measurements are presented of a stationary density modulation produced by a standing electron plasma wave. The experimental results are well explained by taking into account the ponderomotive forces on the electrons exerted by the high frequency field....
Pushing concentration of stationary solar concentrators to the limit.
Winston, Roland; Zhang, Weiya
2010-04-26
We give the theoretical limit of concentration allowed by nonimaging optics for stationary solar concentrators after reviewing sun- earth geometry in direction cosine space. We then discuss the design principles that we follow to approach the maximum concentration along with examples including a hollow CPC trough, a dielectric CPC trough, and a 3D dielectric stationary solar concentrator which concentrates sun light four times (4x), eight hours per day year around.
Tightly localized stationary pulses in a multilevel atomic system
International Nuclear Information System (INIS)
Liu, Xiong-Jun; Oh, C. H.; Liu, Xin; Liu, Zheng-Xin; Kwek, L. C.
2007-01-01
We show that the pulse matching phenomenon can be obtained in the general multilevel system with electromagnetically induced transparency. For this we find a different way to create tightly localized stationary pulses by using counterpropagating pump fields. The present process is a spatial compression of excitation so that it allows us to shape and further intensify the localized stationary pulses, without using standing waves of pump fields or spatially modulated pump fields
Application of H∞ control theory to power control of a nonlinear reactor model
International Nuclear Information System (INIS)
Suzuki, Katsuo; Shimazaki, Junya; Shinohara, Yoshikuni
1993-01-01
The H∞ control theory is applied to the compensator design of a nonlinear nuclear reactor model, and the results are compared with standard linear quadratic Gaussian (LQG) control. The reactor model is assumed to be provided with a control rod drive system having the compensation of rod position feedback. The nonlinearity of the reactor model exerts a great influence on the stability of the control system, and hence, it is desirable for a power control system of a nuclear reactor to achieve robust stability and to improve the sensitivity of the feedback control system. A computer simulation based on a power control system synthesized by LQG control was performed revealing that the control system has some stationary offset and less stability. Therefore, here, attention is given to the development of a methodology for robust control that can withstand exogenous disturbances and nonlinearity in view of system parameter changes. The developed methodology adopts H∞ control theory in the feedback system and shows interesting features of robustness. The results of the computer simulation indicate that the feedback control system constructed by the developed H∞ compensator possesses sufficient robustness of control on the stability and disturbance attenuation, which are essential for the safe operation of a nuclear reactor
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Mallak, Saed
1996-01-01
Ankara : Department of Mathematics and Institute of Engineering and Sciences of Bilkent University, 1996. Thesis (Master's) -- Bilkent University, 1996. Includes bibliographical references leaves leaf 29 In thi.s work, we studierl the Ergodicilv of Non-Stationary .Markov chains. We gave several e.xainples with different cases. We proved that given a sec[uence of Markov chains such that the limit of this sec|uence is an Ergodic Markov chain, then the limit of the combination ...
International Nuclear Information System (INIS)
Tippins, R.S.; Parry, J.M.
1982-01-01
The main points to emerge from this comparison of the radiosensitivity of stationary, exponential and G 1 phase yeast cultures were: (1) In wild type yeast cultures, G 1 cells were the most sensitive to the lethal effects of X-rays, exponential phase cells were the most resistant and stationary phase cells were intermediate in sensitivity. (2) With the excision-repair-defective strain D61-3 (rad 3) stationary phase cells were more resistant than exponential cells with G 1 cells again being most sensitive. (3) The rad 50 gene present in JD50 had a marked effect on the X-ray inactivation response of this strain. In the presence of the defective rad 50 allele, exponential phase cells were as sensitive as G 1 phase cells, with stationary phase cells being more resistant than either. (4) There were marked differences in sensitivity between stationary phase and G 1 phase cells. These differences, along with other physiological differences reported by other workers, lead the authors to suggest that stationary phase cells can be better described as being in G 0 phase, i.e. a stage which is outside the normal mitotic cell cycle of an exponential culture. (author)
Generation of Stationary Non-Gaussian Time Histories with a Specified Cross-spectral Density
Directory of Open Access Journals (Sweden)
David O. Smallwood
1997-01-01
Full Text Available The paper reviews several methods for the generation of stationary realizations of sampled time histories with non-Gaussian distributions and introduces a new method which can be used to control the cross-spectral density matrix and the probability density functions (pdfs of the multiple input problem. Discussed first are two methods for the specialized case of matching the auto (power spectrum, the skewness, and kurtosis using generalized shot noise and using polynomial functions. It is then shown that the skewness and kurtosis can also be controlled by the phase of a complex frequency domain description of the random process. The general case of matching a target probability density function using a zero memory nonlinear (ZMNL function is then covered. Next methods for generating vectors of random variables with a specified covariance matrix for a class of spherically invariant random vectors (SIRV are discussed. Finally the general case of matching the cross-spectral density matrix of a vector of inputs with non-Gaussian marginal distributions is presented.
International Nuclear Information System (INIS)
Caraballo, T.; Kloeden, P.E.
2006-01-01
Under a one-sided dissipative Lipschitz condition on its drift, a stochastic evolution equation with additive noise of the reaction-diffusion type is shown to have a unique stochastic stationary solution which pathwise attracts all other solutions. A similar situation holds for each Galerkin approximation and each implicit Euler scheme applied to these Galerkin approximations. Moreover, the stationary solution of the Euler scheme converges pathwise to that of the Galerkin system as the stepsize tends to zero and the stationary solutions of the Galerkin systems converge pathwise to that of the evolution equation as the dimension increases. The analysis is carried out on random partial and ordinary differential equations obtained from their stochastic counterparts by subtraction of appropriate Ornstein-Uhlenbeck stationary solutions
Nonparametric estimation of the stationary M/G/1 workload distribution function
DEFF Research Database (Denmark)
Hansen, Martin Bøgsted
2005-01-01
In this paper it is demonstrated how a nonparametric estimator of the stationary workload distribution function of the M/G/1-queue can be obtained by systematic sampling the workload process. Weak convergence results and bootstrap methods for empirical distribution functions for stationary associ...
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
The Proteome and Lipidome of Thermococcus kodakarensis across the Stationary Phase.
Gagen, Emma J; Yoshinaga, Marcos Y; Garcia Prado, Franka; Hinrichs, Kai-Uwe; Thomm, Michael
2016-01-01
The majority of cells in nature probably exist in a stationary-phase-like state, due to nutrient limitation in most environments. Studies on bacteria and yeast reveal morphological and physiological changes throughout the stationary phase, which lead to an increased ability to survive prolonged nutrient limitation. However, there is little information on archaeal stationary phase responses. We investigated protein- and lipid-level changes in Thermococcus kodakarensis with extended time in the stationary phase. Adaptations to time in stationary phase included increased proportion of membrane lipids with a tetraether backbone, synthesis of proteins that ensure translational fidelity, specific regulation of ABC transporters (upregulation of some, downregulation of others), and upregulation of proteins involved in coenzyme production. Given that the biological mechanism of tetraether synthesis is unknown, we also considered whether any of the protein-level changes in T. kodakarensis might shed light on the production of tetraether lipids across the same period. A putative carbon-nitrogen hydrolase, a TldE (a protease in Escherichia coli) homologue, and a membrane bound hydrogenase complex subunit were candidates for possible involvement in tetraether-related reactions, while upregulation of adenosylcobalamin synthesis proteins might lend support to a possible radical mechanism as a trigger for tetraether synthesis.
The Proteome and Lipidome of Thermococcus kodakarensis across the Stationary Phase
Directory of Open Access Journals (Sweden)
Emma J. Gagen
2016-01-01
Full Text Available The majority of cells in nature probably exist in a stationary-phase-like state, due to nutrient limitation in most environments. Studies on bacteria and yeast reveal morphological and physiological changes throughout the stationary phase, which lead to an increased ability to survive prolonged nutrient limitation. However, there is little information on archaeal stationary phase responses. We investigated protein- and lipid-level changes in Thermococcus kodakarensis with extended time in the stationary phase. Adaptations to time in stationary phase included increased proportion of membrane lipids with a tetraether backbone, synthesis of proteins that ensure translational fidelity, specific regulation of ABC transporters (upregulation of some, downregulation of others, and upregulation of proteins involved in coenzyme production. Given that the biological mechanism of tetraether synthesis is unknown, we also considered whether any of the protein-level changes in T. kodakarensis might shed light on the production of tetraether lipids across the same period. A putative carbon-nitrogen hydrolase, a TldE (a protease in Escherichia coli homologue, and a membrane bound hydrogenase complex subunit were candidates for possible involvement in tetraether-related reactions, while upregulation of adenosylcobalamin synthesis proteins might lend support to a possible radical mechanism as a trigger for tetraether synthesis.
Similarity flows between a rotating and a stationary disk
International Nuclear Information System (INIS)
Buchmann, J.H.; Qassim, R.Y.
1981-07-01
The radial distribution of fluid pressure on a stationary disk coaxial with a rotating disk is determined experimentally for various inter-disc spacings. The results show that similarity flows are only possible for both small and large values of this distance. In the former case, the flow faraway from the stationary disk appears to be that suggested by Batchelor, while in the latter case, the flow turns out to be in accordance with the assumption of Stewartson. (Author) [pt
On Maximal Hard-Core Thinnings of Stationary Particle Processes
Hirsch, Christian; Last, Günter
2018-02-01
The present paper studies existence and distributional uniqueness of subclasses of stationary hard-core particle systems arising as thinnings of stationary particle processes. These subclasses are defined by natural maximality criteria. We investigate two specific criteria, one related to the intensity of the hard-core particle process, the other one being a local optimality criterion on the level of realizations. In fact, the criteria are equivalent under suitable moment conditions. We show that stationary hard-core thinnings satisfying such criteria exist and are frequently distributionally unique. More precisely, distributional uniqueness holds in subcritical and barely supercritical regimes of continuum percolation. Additionally, based on the analysis of a specific example, we argue that fluctuations in grain sizes can play an important role for establishing distributional uniqueness at high intensities. Finally, we provide a family of algorithmically constructible approximations whose volume fractions are arbitrarily close to the maximum.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Only adding stationary storage to vaccine supply chains may create and worsen transport bottlenecks.
Haidari, Leila A; Connor, Diana L; Wateska, Angela R; Brown, Shawn T; Mueller, Leslie E; Norman, Bryan A; Schmitz, Michelle M; Paul, Proma; Rajgopal, Jayant; Welling, Joel S; Leonard, Jim; Claypool, Erin G; Weng, Yu-Ting; Chen, Sheng-I; Lee, Bruce Y
2013-01-01
Although vaccine supply chains in many countries require additional stationary storage and transport capacity to meet current and future needs, international donors tend to donate stationary storage devices far more often than transport equipment. To investigate the impact of only adding stationary storage equipment on the capacity requirements of transport devices and vehicles, we used HERMES (Highly Extensible Resource for Modeling Supply Chains) to construct a discrete event simulation model of the Niger vaccine supply chain. We measured the transport capacity requirement for each mode of transport used in the Niger vaccine cold chain, both before and after adding cold rooms and refrigerators to relieve all stationary storage constraints in the system. With the addition of necessary stationary storage, the average transport capacity requirement increased from 88% to 144% for cold trucks, from 101% to 197% for pickup trucks, and from 366% to 420% for vaccine carriers. Therefore, adding stationary storage alone may worsen or create new transport bottlenecks as more vaccines flow through the system, preventing many vaccines from reaching their target populations. Dynamic modeling can reveal such relationships between stationary storage capacity and transport constraints.
Kucerova, Gabriela; Kalikova, Kveta; Tesarova, Eva
2017-06-01
The enantioselective potential of two polysaccharide-based chiral stationary phases for analysis of chiral structurally diverse biologically active compounds was evaluated in supercritical fluid chromatography using a set of 52 analytes. The chiral selectors immobilized on 2.5 μm silica particles were tris-(3,5-dimethylphenylcarmabate) derivatives of cellulose or amylose. The influence of the polysaccharide backbone, different organic modifiers, and different mobile phase additives on retention and enantioseparation was monitored. Conditions for fast baseline enantioseparation were found for the majority of the compounds. The success rate of baseline and partial enantioseparation with cellulose-based chiral stationary phase was 51.9% and 15.4%, respectively. Using amylose-based chiral stationary phase we obtained 76.9% of baseline enantioseparations and 9.6% of partial enantioseparations of the tested compounds. The best results on cellulose-based chiral stationary phase were achieved particularly with propane-2-ol and a mixture of isopropylamine and trifluoroacetic acid as organic modifier and additive to CO 2 , respectively. Methanol and basic additive isopropylamine were preferred on amylose-based chiral stationary phase. The complementary enantioselectivity of the cellulose- and amylose-based chiral stationary phases allows separation of the majority of the tested structurally different compounds. Separation systems were found to be directly applicable for analyses of biologically active compounds of interest. © 2017 Wiley Periodicals, Inc.
Netz, Roland R
2018-05-14
An exactly solvable, Hamiltonian-based model of many massive particles that are coupled by harmonic potentials and driven by stochastic non-equilibrium forces is introduced. The stationary distribution and the fluctuation-dissipation relation are derived in closed form for the general non-equilibrium case. Deviations from equilibrium are on one hand characterized by the difference of the obtained stationary distribution from the Boltzmann distribution; this is possible because the model derives from a particle Hamiltonian. On the other hand, the difference between the obtained non-equilibrium fluctuation-dissipation relation and the standard equilibrium fluctuation-dissipation theorem allows us to quantify non-equilibrium in an alternative fashion. Both indicators of non-equilibrium behavior, i.e., deviations from the Boltzmann distribution and deviations from the equilibrium fluctuation-dissipation theorem, can be expressed in terms of a single non-equilibrium parameter α that involves the ratio of friction coefficients and random force strengths. The concept of a non-equilibrium effective temperature, which can be defined by the relation between fluctuations and the dissipation, is by comparison with the exactly derived stationary distribution shown not to hold, even if the effective temperature is made frequency dependent. The analysis is not confined to close-to-equilibrium situations but rather is exact and thus holds for arbitrarily large deviations from equilibrium. Also, the suggested harmonic model can be obtained from non-linear mechanical network systems by an expansion in terms of suitably chosen deviatory coordinates; the obtained results should thus be quite general. This is demonstrated by comparison of the derived non-equilibrium fluctuation dissipation relation with experimental data on actin networks that are driven out of equilibrium by energy-consuming protein motors. The comparison is excellent and allows us to extract the non
Netz, Roland R.
2018-05-01
An exactly solvable, Hamiltonian-based model of many massive particles that are coupled by harmonic potentials and driven by stochastic non-equilibrium forces is introduced. The stationary distribution and the fluctuation-dissipation relation are derived in closed form for the general non-equilibrium case. Deviations from equilibrium are on one hand characterized by the difference of the obtained stationary distribution from the Boltzmann distribution; this is possible because the model derives from a particle Hamiltonian. On the other hand, the difference between the obtained non-equilibrium fluctuation-dissipation relation and the standard equilibrium fluctuation-dissipation theorem allows us to quantify non-equilibrium in an alternative fashion. Both indicators of non-equilibrium behavior, i.e., deviations from the Boltzmann distribution and deviations from the equilibrium fluctuation-dissipation theorem, can be expressed in terms of a single non-equilibrium parameter α that involves the ratio of friction coefficients and random force strengths. The concept of a non-equilibrium effective temperature, which can be defined by the relation between fluctuations and the dissipation, is by comparison with the exactly derived stationary distribution shown not to hold, even if the effective temperature is made frequency dependent. The analysis is not confined to close-to-equilibrium situations but rather is exact and thus holds for arbitrarily large deviations from equilibrium. Also, the suggested harmonic model can be obtained from non-linear mechanical network systems by an expansion in terms of suitably chosen deviatory coordinates; the obtained results should thus be quite general. This is demonstrated by comparison of the derived non-equilibrium fluctuation dissipation relation with experimental data on actin networks that are driven out of equilibrium by energy-consuming protein motors. The comparison is excellent and allows us to extract the non
Power variation for Gaussian processes with stationary increments
DEFF Research Database (Denmark)
Barndorff-Nielsen, Ole Eiler; Corcuera, J.M.; Podolskij, Mark
2009-01-01
We develop the asymptotic theory for the realised power variation of the processes X=•G, where G is a Gaussian process with stationary increments. More specifically, under some mild assumptions on the variance function of the increments of G and certain regularity conditions on the path of the pr......We develop the asymptotic theory for the realised power variation of the processes X=•G, where G is a Gaussian process with stationary increments. More specifically, under some mild assumptions on the variance function of the increments of G and certain regularity conditions on the path...... a chaos representation....
Income dynamics with a stationary double Pareto distribution.
Toda, Alexis Akira
2011-04-01
Once controlled for the trend, the distribution of personal income appears to be double Pareto, a distribution that obeys the power law exactly in both the upper and the lower tails. I propose a model of income dynamics with a stationary distribution that is consistent with this fact. Using US male wage data for 1970-1993, I estimate the power law exponent in two ways--(i) from each cross section, assuming that the distribution has converged to the stationary distribution, and (ii) from a panel directly estimating the parameters of the income dynamics model--and obtain the same value of 8.4.
Boguslawsky, Iliya; Hayakawa, Masashi
2017-01-01
In this monograph the authors solve the modern scientific problems connected with A.C. motors and generators, based first on the detailed consideration of their physical phenomena. The authors describe the theory and investigative methods they developed and applied in practice, which are considered to be of essential interest for specialists in the field of the electrical engineering industry in European countries, the USA, Argentina, and Brazil, as well as in such countries as India, China, and Iran. This book will be of interest to engineers specialized in the field of the manufacture, operation, and repair of A.C. machines (motors and generators) as well as electric drives; to professors, lecturers, and post-graduate students of technical universities, who are specializing in the field of electric machine engineering and electric drives; and to students who are engaged in the field of high current techniques, electric drives, and electric machine engineering.
International Nuclear Information System (INIS)
Butabaev, Yu.S.
1994-01-01
The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs
[Sampling methods for PM2.5 from stationary sources: a review].
Jiang, Jing-Kun; Deng, Jian-Guo; Li, Zhen; Li, Xing-Hua; Duan, Lei; Hao, Ji-Ming
2014-05-01
The new China national ambient air quality standard has been published in 2012 and will be implemented in 2016. To meet the requirements in this new standard, monitoring and controlling PM2,,5 emission from stationary sources are very important. However, so far there is no national standard method on sampling PM2.5 from stationary sources. Different sampling methods for PM2.5 from stationary sources and relevant international standards were reviewed in this study. It includes the methods for PM2.5 sampling in flue gas and the methods for PM2.5 sampling after dilution. Both advantages and disadvantages of these sampling methods were discussed. For environmental management, the method for PM2.5 sampling in flue gas such as impactor and virtual impactor was suggested as a standard to determine filterable PM2.5. To evaluate environmental and health effects of PM2.5 from stationary sources, standard dilution method for sampling of total PM2.5 should be established.
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Near-optimal order-reduced control for A/C (air-conditioning) system of EVs (electric vehicles)
International Nuclear Information System (INIS)
Chiu, Chien-Chin; Tsai, Nan-Chyuan; Lin, Chun-Chi
2014-01-01
This work is aimed to investigate the regulation problem for thermal comfortableness and propose control strategies for cabin environment of EVs (electric vehicles) by constructing a reduced-scale A/C (air-conditioning) system which mainly consists of two modules: ECB (environmental control box) and AHU (air-handling unit). Temperature and humidity in the ECB can be regulated by AHU via cooling, heating, mixing air streams and adjusting speed of fans. To synthesize the near-optimal controllers, the mathematical model for the system thermodynamics is developed by employing the equivalent lumped heat capacity approach, energy/mass conservation principle and the heat transfer theories. In addition, from the clustering pattern of system eigenvalues, the thermodynamics of the interested system can evidently be characterized by two-time-scale property. That is, the studied system can be decoupled into two subsystems, slow mode and fast mode, by singular perturbation technique. As to the optimal control strategies for EVs, by taking thermal comfortableness, humidity and energy consumption all into account, a series of optimal controllers is synthesized on the base of the order-reduced thermodynamic model. The feedback control loop for the experimental test rig is examined and realized by the aid of the control system development kit dSPACE DS1104 and the commercial software MATLAB/Simulink. To sum up, the intensive computer simulations and experimental results verify that the performance of the near-optimal order-reduced control law is almost as superior as that of standard LQR (Linear-Quadratic Regulator). - Highlights: • A reduced-scale test rig for A/C (air-conditioning) system to imitate the temperature/humidity of cabin in EV (electric vehicle) is constructed. • The non-linear thermodynamic model of A/C system can be decoupled by singular perturbation technique. • The temperature/humidity in cabin is regulated to the desired values by proposed optimal
Segmented slant hole collimator for stationary cardiac SPECT: Monte Carlo simulations.
Mao, Yanfei; Yu, Zhicong; Zeng, Gengsheng L
2015-09-01
This work is a preliminary study of a stationary cardiac SPECT system. The goal of this research is to propose a stationary cardiac SPECT system using segmented slant-hole collimators and to perform computer simulations to test the feasibility. Compared to the rotational SPECT, a stationary system has a benefit of acquiring temporally consistent projections. The most challenging issue in building a stationary system is to provide sufficient projection view-angles. A GATE (GEANT4 application for tomographic emission) Monte Carlo model was developed to simulate a two-detector stationary cardiac SPECT that uses segmented slant-hole collimators. Each detector contains seven segmented slant-hole sections that slant to a common volume at the rotation center. Consequently, 14 view-angles over 180° were acquired without any gantry rotation. The NCAT phantom was used for data generation and a tailored maximum-likelihood expectation-maximization algorithm was used for image reconstruction. Effects of limited number of view-angles and data truncation were carefully evaluated in the paper. Simulation results indicated that the proposed segmented slant-hole stationary cardiac SPECT system is able to acquire sufficient data for cardiac imaging without a loss of image quality, even when the uptakes in the liver and kidneys are high. Seven views are acquired simultaneously at each detector, leading to 5-fold sensitivity gain over the conventional dual-head system at the same total acquisition time, which in turn increases the signal-to-noise ratio by 19%. The segmented slant-hole SPECT system also showed a good performance in lesion detection. In our prototype system, a short hole-length was used to reduce the dead zone between neighboring collimator segments. The measured sensitivity gain is about 17-fold over the conventional dual-head system. The gate Monte Carlo simulations confirm the feasibility of the proposed stationary cardiac SPECT system with segmented slant
Segmented slant hole collimator for stationary cardiac SPECT: Monte Carlo simulations
Energy Technology Data Exchange (ETDEWEB)
Mao, Yanfei, E-mail: ymao@ucair.med.utah.edu [Department of Radiology, Utah Center for Advanced Imaging Research (UCAIR), University of Utah, Salt Lake City, Utah 84108 and Department of Bioengineering, University of Utah, Salt Lake City, Utah 84112 (United States); Yu, Zhicong [Department of Radiology, Mayo Clinic, Rochester, Minnesota 55905 (United States); Zeng, Gengsheng L. [Department of Radiology, Utah Center for Advanced Imaging Research (UCAIR), University of Utah, Salt Lake City, Utah 84108 and Department of Engineering, Weber State University, Ogden, Utah 84408 (United States)
2015-09-15
Purpose: This work is a preliminary study of a stationary cardiac SPECT system. The goal of this research is to propose a stationary cardiac SPECT system using segmented slant-hole collimators and to perform computer simulations to test the feasibility. Compared to the rotational SPECT, a stationary system has a benefit of acquiring temporally consistent projections. The most challenging issue in building a stationary system is to provide sufficient projection view-angles. Methods: A GATE (GEANT4 application for tomographic emission) Monte Carlo model was developed to simulate a two-detector stationary cardiac SPECT that uses segmented slant-hole collimators. Each detector contains seven segmented slant-hole sections that slant to a common volume at the rotation center. Consequently, 14 view-angles over 180° were acquired without any gantry rotation. The NCAT phantom was used for data generation and a tailored maximum-likelihood expectation-maximization algorithm was used for image reconstruction. Effects of limited number of view-angles and data truncation were carefully evaluated in the paper. Results: Simulation results indicated that the proposed segmented slant-hole stationary cardiac SPECT system is able to acquire sufficient data for cardiac imaging without a loss of image quality, even when the uptakes in the liver and kidneys are high. Seven views are acquired simultaneously at each detector, leading to 5-fold sensitivity gain over the conventional dual-head system at the same total acquisition time, which in turn increases the signal-to-noise ratio by 19%. The segmented slant-hole SPECT system also showed a good performance in lesion detection. In our prototype system, a short hole-length was used to reduce the dead zone between neighboring collimator segments. The measured sensitivity gain is about 17-fold over the conventional dual-head system. Conclusions: The GATE Monte Carlo simulations confirm the feasibility of the proposed stationary cardiac
Detection of Multiple Stationary Humans Using UWB MIMO Radar
Directory of Open Access Journals (Sweden)
Fulai Liang
2016-11-01
Full Text Available Remarkable progress has been achieved in the detection of single stationary human. However, restricted by the mutual interference of multiple humans (e.g., strong sidelobes of the torsos and the shadow effect, detection and localization of the multiple stationary humans remains a huge challenge. In this paper, ultra-wideband (UWB multiple-input and multiple-output (MIMO radar is exploited to improve the detection performance of multiple stationary humans for its multiple sight angles and high-resolution two-dimensional imaging capacity. A signal model of the vital sign considering both bi-static angles and attitude angle of the human body is firstly developed, and then a novel detection method is proposed to detect and localize multiple stationary humans. In this method, preprocessing is firstly implemented to improve the signal-to-noise ratio (SNR of the vital signs, and then a vital-sign-enhanced imaging algorithm is presented to suppress the environmental clutters and mutual affection of multiple humans. Finally, an automatic detection algorithm including constant false alarm rate (CFAR, morphological filtering and clustering is implemented to improve the detection performance of weak human targets affected by heavy clutters and shadow effect. The simulation and experimental results show that the proposed method can get a high-quality image of multiple humans and we can use it to discriminate and localize multiple adjacent human targets behind brick walls.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Threshold Dynamics in Stochastic SIRS Epidemic Models with Nonlinear Incidence and Vaccination
Directory of Open Access Journals (Sweden)
Lei Wang
2017-01-01
Full Text Available In this paper, the dynamical behaviors for a stochastic SIRS epidemic model with nonlinear incidence and vaccination are investigated. In the models, the disease transmission coefficient and the removal rates are all affected by noise. Some new basic properties of the models are found. Applying these properties, we establish a series of new threshold conditions on the stochastically exponential extinction, stochastic persistence, and permanence in the mean of the disease with probability one for the models. Furthermore, we obtain a sufficient condition on the existence of unique stationary distribution for the model. Finally, a series of numerical examples are introduced to illustrate our main theoretical results and some conjectures are further proposed.
Danish emission inventories for stationary combustion plants
DEFF Research Database (Denmark)
Nielsen, M.; Illerup, J. B.
Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are: SO2, NOx, NMVOC, CH4, CO, CO2, N2O, particulate matter, heavy metals, dioxins and PAH. Since 1990 the fuel consumption...... in stationary combustion has increased by 12% - the fossil fuel consumption however only by 6%. Despite the increased fuel consumption the emission of several pollutants have decreased due to the improved flue gas cleaning technology, improved burner technology and the change of fuel type used. A considerable...... plants. The emission of PAH increased as a result of the increased combustion of wood in residential boilers and stoves. Uncertainties for the emissions and trends have been estimated....
Danish emission inventories for stationary combustion plants
DEFF Research Database (Denmark)
Nielsen, M.; Illerup, J. B.
Emission inventories for stationary combustion plants are presented and the methodologies and assumptions used for the inventories are described. The pollutants considered are SO2, NOX, NMVOC, CH4, CO, CO2, N2O, particulate matter, heavy metals, dioxins and PAH. Since 1990 the fuel consumption...... in stationary combustion has increased by 14% - the fossil fuel consumption however only by 8%. Despite the increased fuel consumption the emission of several pollutants has decreased due to the improved flue gas cleaning technology, improved burner technology and the change of fuel type used. A considerable...... plants. The emission of PAH increased as a result of the increased combustion of wood in residential boilers and stoves. Uncertainties for the emissions and trends have been estimated...
Identification of nonlinear coupling in wave turbulence at the surface of water
Campagne, Antoine; Hassaini, Roumaissa; Redor, Ivan; Aubourg, Quentin; Sommeria, Joël; Mordant, Nicolas
2017-11-01
The Weak Turbulence Theory is a theory, in the limit of vanishing nonlinearity, that derive analytically statistical features of wave turbulence. The stationary spectrum for the surface elevation in the case of gravity waves, is predicted to E(k) k - 5 / 2 . This spectral exponent -5/2 remains elusive in all experiments. in which the measured exponent is systematically lower than the prediction. Furthermore in the experiments the weaker the nonlinearity the further the spectral exponent is from the prediction. In order to investigate the reason for this observation we developed an experiment in the CORIOLIS facility in Grenoble. It is a 13m-diameter circular pool filled with water with a 70 cm depth. We generate wave turbulence by using two wedge wavemakers. Surface elevation measurements are performed by a stereoscopic optical technique and by capacitive probes. The nonlinear coupling at work in this system are analyzed by computing 3- and 4-wave correlations of the Fourier wave amplitudes in frequency. Theory predicts that coupling should occur through 4-wave resonant interaction. In our data, strong 3-wave correlations are observed in addition to the 4-wave correlation. Most our observations are consistent with field observation in the Black Sea (Leckler et al. 2015). This project has received funding from the European Research Council (ERC, Grant Agreement No 647018-WATU).
Multi-scale analysis of teleconnection indices: climate noise and nonlinear trend analysis
Directory of Open Access Journals (Sweden)
C. Franzke
2009-02-01
Full Text Available The multi-scale nature and climate noise properties of teleconnection indices are examined by using the Empirical Mode Decomposition (EMD procedure. The EMD procedure allows for the analysis of non-stationary time series to extract physically meaningful intrinsic mode functions (IMF and nonlinear trends. The climatologically relevant monthly mean teleconnection indices of the North Atlantic Oscillation (NAO, the North Pacific index (NP and the Southern Annular Mode (SAM are analyzed.
The significance of IMFs and trends are tested against the null hypothesis of climate noise. The analysis of surrogate monthly mean time series from a red noise process shows that the EMD procedure is effectively a dyadic filter bank and the IMFs (except the first IMF are nearly Gaussian distributed. The distribution of the variance contained in IMFs of an ensemble of AR(1 simulations is nearly χ2 distributed. To test the statistical significance of the IMFs of the teleconnection indices and their nonlinear trends we utilize an ensemble of corresponding monthly averaged AR(1 processes, which we refer to as climate noise. Our results indicate that most of the interannual and decadal variability of the analysed teleconnection indices cannot be distinguished from climate noise. The NP and SAM indices have significant nonlinear trends, while the NAO has no significant trend when tested against a climate noise hypothesis.
A simulation of a multifilamentary wire carrying a transport current in an AC applied field
International Nuclear Information System (INIS)
Rem, P.C.; Hartmann, R.A.; Dijkstra, D.; Van Beckum, F.P.H.; Van de Klundert, L.J.M.
1986-01-01
The problem of calculating the current distribution in a multi-filamentary wire subjected to a time-dependent field becomes difficult as soon as the non-linearity due to the saturation of layers of filaments can be neglected no more. Such a problem can be solved approximately if the shape of the boundaries between unsaturated regions can be prescribed on the basis of general considerations such as symmetry arguments. For cases involving both a transport current and an applied field, however, little is known about the boundaries and their time-dependence behaviour. For such cases a brute force numerical calculation may provide an answer. The results presented below were calculated for a combination of DC transport current and AC applied field
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Stationary distribution and ergodicity of a stochastic food-chain model with Lévy jumps
Yu, Jingyi; Liu, Meng
2017-09-01
In this paper, a three-species stochastic food-chain model with Lévy jumps is proposed and analyzed. Sharp sufficient criteria for the existence and uniqueness of an ergodic stationary distribution are established. The effects of Lévy jumps on the existence of the stationary distribution are revealed: in some cases, the Lévy jumps could make the stationary distribution appear, while in some cases, the Lévy jumps could make the stationary distribution disappear. Some numerical simulations are introduced to illustrate the theoretical results.
Stabilization of Hypersonic Boundary Layers by Linear and Nonlinear Optimal Perturbations
Paredes, Pedro; Choudhari, Meelan M.; Li, Fei
2017-01-01
The effect of stationary, finite-amplitude, linear and nonlinear optimal perturbations on the modal disturbance growth in a Mach 6 axisymmetric flow over a 7 deg. half-angle cone with 0:126 mm nose radius and 0:305 m length is investigated. The freestream parameters (M = 6, Re(exp 1) = 18 x 10(exp. 6) /m) are selected to match the flow conditions of a previous experiment in the VKI H3 hypersonic tunnel. Plane-marching parabolized stability equations are used in conjunction with a partial-differential equation based planar eigenvalue analysis to characterize the boundary layer instability in the presence of azimuthally periodic streaks. The streaks are observed to stabilize nominally planar Mack mode instabilities, although oblique Mack mode and first-mode disturbances are destabilized. Experimentally measured transition onset in the absence of any streaks correlates with an amplification factor of N = 6 for the planar Mack modes. For high enough streak amplitudes, the transition threshold of N = 6 is not reached by the Mack mode instabilities within the length of the cone; however, subharmonic first-mode instabilities, which are destabilized by the presence of the streaks, do reach N = 6 near the end of the cone. The highest stabilization is observed at streak amplitudes of approximately 20 percent of the freestream velocity. Because the use of initial disturbance profiles based on linear optimal growth theory may yield suboptimal control in the context of nonlinear streaks, the computational predictions are extended to nonlinear optimal growth theory. Results show that by using nonlinearly optimal perturbation leads to slightly enhanced stabilization of plane Mack mode disturbances as well as reduced destabilization of subharmonic first-mode disturbances.
International Nuclear Information System (INIS)
Sabari Girisun, T.C.; Dhanuskodi, S.
2010-01-01
Materials with low dielectric constant have attracted a great deal of interest in the field of nonlinear applications and microelectronic industry. Metal complexes of thiourea with group II transition metals (Zn, Cd) as central atom and period III elements (S, Cl) were synthesized by chemical reaction method and single crystals were grown from aqueous solution by slow evaporation method. By parallel plate capacitor technique, the dielectric response, dissipation factor, ac conductivity and impedance of virgin and metal complexes have been studied in the frequency (100 Hz to 5 MHz) and temperature (303-423 K) ranges. Metal complexes of thiourea with cadmium substitute have a low dielectric constant less than 10. Also the presence of chlorine in the metal complex induces noncentro symmetric structure. Hence the role of group II transition metals and period III elements in tuning the dielectric properties for efficient nonlinear applications has been studied.