WorldWideScience

Sample records for nitric acid purification

  1. Study on Purification Diatomite with nitric acid by Thermal Closed System

    Directory of Open Access Journals (Sweden)

    Kuang Meng

    2016-01-01

    Full Text Available In this research, a purification approach using nitric acid leaching at thermal closed system was developed to improve the porous structure of raw diatomite by removal of impurities from its surface and clogged pores. The feasibility and efficiency of this approach were determined by XRF for chemical constitution of diatomite, SEM for morphology and BET for specific surface area of purified diatomite. The investigations indicated that the content of SiO2 was in order of 85.14% for raw diatomite and 98% for purified diatomite, the content of Fe2O3 decreases after purified; the integrity of the porous structure was confirmed by SEM, and increase in specific surface area from 18m2·g-1 to 36m2·g-1.

  2. Determination of Nitric Acid in Aqueous Solution of Uranium and Plutonium Purification Cycle by Near Infrared Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    LI; Ding-ming; WANG; Lin; ZHANG; Li-hua; GONG; Yan-ping; MU; Ling; WU; Ji-zong

    2012-01-01

    <正>The concentration of nitric acid interfered with the distribution of uranium and plutonium in nuclear fuel reprocessing process. So, in the reprocessing process control analysis, the determination of the free acid plays an important role. Traditional laboratory analytical method of free acid needs large size sample and is time-consuming. Hence, development of fast analytical method for free acid has important significance for the reprocessing process control analysis. Near-infrared spectroscopy (NIRS) has been proved to be a powerful analytical tool and used in various fields, it’s seldom, however, used in spent

  3. RBS/EBS/PIXE measurement of single-walled carbon nanotube modification by nitric acid purification treatment

    Science.gov (United States)

    Jeynes, J. C. G.; Jeynes, C.; Kirkby, K. J.; Rümmeli, M.; Silva, S. R. P.

    2008-04-01

    Single-walled carbon nanotubes (SWCNTs) have many potential applications, including a number of promising biological applications. Nitric acid treatment solubilises CNTs by introducing functional groups, as well as removing amorphous carbon contaminants. Here, we report simultaneous RBS/EBS/PIXE measurements of nitric acid treated SWCNTs, focussing on the metal, nitrogen and oxygen content. We found that nitrogen remains constant in the samples despite washing and dialysis indicating it has either bound irreversibly via intercalation with the SWCNT and/or has been included in functional groups. We also found that the ratio between oxygen and platinum (catalyst) remains constant with treatment time (sampled at 2, 4, 6 h), indicating no more functional groups are made after 2 h exposure.

  4. 49 CFR 173.158 - Nitric acid.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Nitric acid. 173.158 Section 173.158... Nitric acid. (a) Nitric acid exceeding 40 percent concentration may not be packaged with any other material. (b) Nitric acid in any concentration which does not contain sulfuric acid or hydrochloric acid as...

  5. Alternative to Nitric Acid Passivation

    Science.gov (United States)

    Kessel, Kurt R.

    2016-01-01

    Corrosion is an extensive problem that affects the National Aeronautics and Space Administration (NASA) and European Space Agency (ESA). The deleterious effects of corrosion result in steep costs, asset downtime affecting mission readiness, and safety risks to personnel. It is vital to reduce corrosion costs and risks in a sustainable manner. The primary objective of this effort is to qualify citric acid as an environmentally-preferable alternative to nitric acid for passivation of stainless steel alloys.

  6. The Oxidation of Hydrazine by Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Karraker, D.G.

    2001-07-02

    Hydrazine nitrate-nitric acid solutions are used in the ion exchange process for separating Pu-238 and Np-237 and have been found to dissolve plutonium metal in a manner advantageous to SRP metal recovery operations. Laboratory tests on the stability of hydrazine in nitric acid solutions were performed to obtain accurate data, and the results of these tests are reported here. These tests provide sufficient information to specify temperature control for hydrazine-nitric acid solutions in plant processes.

  7. Alternative to Nitric Acid Passivation

    Science.gov (United States)

    Kessel, Kurt R.

    2015-01-01

    The Ground Systems Development and Operations (GSDO) Program at NASA John F. Kennedy Space Center (KSC), Florida, has the primary objective of modernizing and transforming the launch and range complex at KSC to benefit current and future NASA programs along with other emerging users. Described as the launch support and infrastructure modernization program in the NASA Authorization Act of 2010, the GSDO Program will develop and implement shared infrastructure and process improvements to provide more flexible, affordable, and responsive capabilities to a multi-user community. In support of NASA and the GSDO Program, the objective of this project is to qualify citric acid as an environmentally-preferable alternative to nitric acid for passivation of stainless steel alloys. This project is a direct follow-on to United Space Alliance (USA) work at KSC to optimize the parameters for the use of citric acid and verify effectiveness. This project will build off of the USA study to further evaluate citric acids effectiveness and suitability for corrosion protection of a number of stainless steels alloys used by NASA, the Department of Defense (DoD), and the European Space Agency (ESA).

  8. Citric Acid Alternative to Nitric Acid Passivation

    Science.gov (United States)

    Lewis, Pattie L. (Compiler)

    2013-01-01

    The Ground Systems Development and Operations GSDO) Program at NASA John F. Kennedy Space Center (KSC) has the primary objective of modernizing and transforming the launch and range complex at KSC to benefit current and future NASA programs along with other emerging users. Described as the launch support and infrastructure modernization program in the NASA Authorization Act of 2010, the GSDO Program will develop and implement shared infrastructure and process improvements to provide more flexible, affordable, and responsive capabilities to a multi-user community. In support of the GSDO Program, the purpose of this project is to demonstratevalidate citric acid as a passivation agent for stainless steel. Successful completion of this project will result in citric acid being qualified for use as an environmentally preferable alternative to nitric acid for passivation of stainless steel alloys in NASA and DoD applications.

  9. Electrochemical Behavior of Aluminum in Nitric Acid

    Institute of Scientific and Technical Information of China (English)

    CHEN; Hui; ZHU; Li-yang; LIN; Ru-shan; TAN; Hong-bin; HE; Hui

    2013-01-01

    Aluminum is one of cladding materials for nuclear fuel,it is important to investigate the electrolytic dissolution of aluminum in nitric acid.The electrochemical impedance spectroscopy,polarization curve and cyclic voltammetry cure of anodic aluminum electrode in nitric acid under various conditions were collected(Fig.1).It turns out,under steady state,the thickness of the passivated film of aluminum

  10. Alternative to Nitric Acid Passivation Project Overview

    Science.gov (United States)

    Lewis, Pattie L.

    2013-01-01

    The standard practice for protection of stainless steel is a process called passivation. This procedure results in the formation of a metal oxide layer to prevent corrosion. Typical passivation procedures call for the use of nitric acid which exhibits excellent corrosion performance; however, there are a number of environmental, worker safety, and operational issues associated with its use. The longtime military specification for the passivation of stainless steel was cancelled in favor of newer specifications which allow for the use of citric acid in place of nitric acid. Citric acid offers a variety of benefits that include increased safety for personnel, reduced environmental impact, and reduced operational costs. There have been few studies, however, to determine whether citric acid is an acceptable alternative for NASA and DoD. This paper details activities to date including development of the joint test plan, on-going and planned testing, and preliminary results.

  11. Speciation in aqueous solutions of nitric acid.

    Science.gov (United States)

    Hlushak, S; Simonin, J P; De Sio, S; Bernard, O; Ruas, A; Pochon, P; Jan, S; Moisy, P

    2013-02-28

    In this study, speciation in aqueous solutions of nitric acid at 25 °C was assessed in two independent ways. First, Raman experiments were carried out and interpreted in terms of free nitrate ions, ion pairs and neutral HNO(3) molecules. In parallel, a model was developed to account for the formation of these two kinds of pairs. It was based on an extension of the binding mean spherical approximation (BiMSA), or associative MSA (AMSA), in which the size and the charge of the ions in the chemical pair may differ from those of the free ions. A simultaneous fit of the osmotic coefficient and of the proportion of free ions (obtained from Raman spectroscopy experiments) led to an estimation of the speciation in nitric acid solutions. The result obtained using this procedure was compared with the estimation obtained from the Raman experiments.

  12. Metastable Nitric Acid Trihydrate in Ice Clouds

    Science.gov (United States)

    Weiss, Fabian; Kubel, Frank; Gálvez, Oscar; Hölzel, Markus; Parker, Stewart F.; Baloh, Philipp; Iannarelli, Riccardo; Rossi, Michel J.; Grothe, Hinrich

    2016-04-01

    The composition of high altitude ice clouds is still a matter of intense discussion. The constituents in question are ice and nitric acid hydrates. The identification and formation mechanisms, however, are still unknown but are essential to understand atmospheric processing such as the seasonal ozone depletion in the lower polar stratosphere or the radiation balance of planet Earth. We found conclusive evidence for a long-predicted phase, which has been named alpha nitric acid trihydrate (alpha-NAT). This phase has been proven by combination of X-ray and neutron diffraction experiments allowing a convincing structure solution. Additionally, vibrational spectra (infrared and inelastic neutron scattering) were recorded and compared with theoretical calculations. A strong affinity between water ice and alpha-NAT has been found, which explains the experimental spectra and the phase transition kinetics essential for identification in the atmosphere. On the basis of our results, we propose a new three-step mechanism for NAT-formation in high altitude ice clouds. F. Weiss et al. Angew. Chem. Int. Ed. 2016, accepted, DOI:10.1002/anie.201510841

  13. EFFECTS OF NITRIC ACID ON CRITICALITY SAFETY ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    Williamson, B.

    2011-08-18

    As nitric acid molarity is increased, there are two competing phenomena affecting the reactivity of the system. First, there is interaction between each of the 10 wells in the basket-like insert. As the molarity of the nitric acid solution is increased (it moves from 100% water to 100% HNO{sub 3}), the hydrogen atom density decreases by about 80%. However, it remains a relatively efficient moderator. The moderating ratio of nitric acid is about 90% that of water. As the media between the wells is changed from 100% water to 100% nitric acid, the density of the media increases by 50%. A higher density typically leads to a better reflector. However, when the macroscopic scattering cross sections are considered, nitric acid is a much worse reflector than water. The effectiveness of nitric acid as a reflector is about 40% that of water. Since the media between the wells become a worse reflector and still remains an effective moderator, interaction between the wells increases. This phenomenon will cause reactivity to increase as nitric acid molarity increases. The seond phenomenon is due to the moderating ratio changing in the high concentration fissile-nitric acid solution in the 10 wells. Since the wells contain relatively small volumes of high concentration solutions, a small decrease in moderating power has a large effect on reactivity. This is due to the fact that neutrons are more likely to escape the high concentration fissile solution before causing another fission event. The result of this phenomenon is that as nitric acid molarity increases, reactivity decreases. Recent studies have shown that the second phenomenon is indeed the dominating force in determining reactivity changes in relation to nitric acid molarity changes. When considering the system as a whole, as nitric acid molarity increases, reactivity decreases.

  14. Adverse experiences with nitric acid at the Savannah River Site

    Energy Technology Data Exchange (ETDEWEB)

    Durant, W.S.; Craig, D.K.; Vitacco, M.J.; McCormick, J.A.

    1991-06-01

    Nitric acid is used routinely at the Savannah River Site (SRS) in many processes. However, the site has experienced a number of adverse situations in handling nitric acid. These have ranged from minor injuries to personnel to significant explosions. This document compiles many of these events and includes discussions of process upsets, fires, injuries, and toxic effects of nitric acid and its decomposition products. The purpose of the publication is to apprise those using the acid that it is a potentially dangerous material and can react in many ways as demonstrated by SRS experience. 10 refs.

  15. Corrosion studies in fuel element reprocessing environments containing nitric acid

    Energy Technology Data Exchange (ETDEWEB)

    Beavers, J A; White, R R; Berry, W E; Griess, J C

    1982-04-01

    Nitric acid is universally used in aqueous fuel element reprocessing plants; however, in the processing scheme being developed by the Consolidated Fuel Reprocessing Program, some of the equipment will be exposed to nitric acid under conditions not previously encountered in fuel element reprocessing plants. A previous report presented corrosion data obtained in hyperazeotropic nitric acid and in concentrated magnesium nitrate solutions used in its preparation. The results presented in this report are concerned with the following: (1) corrosion of titanium in nitric acid; (2) corrosion of nickel-base alloys in a nitric acid-hydrofluoric acid solution; (3) the formation of Cr(VI), which enhances corrosion, in nitric acid solutions; and (4) corrosion of mechanical pipe connectors in nitric acid. The results show that the corrosion rate of titanium increased with the refreshment rate of boiling nitric acid, but the effect diminished rapidly as the temperature decreased. The addition of iodic acid inhibited attack. Also, up to 200 ppM of fluoride in 70% HNO/sub 3/ had no major effect on the corrosion of either titanium or tantalum. In boiling 8 M HNO/sub 3/-0.05 M HF, Inconel 671 was more resistant than Inconel 690, but both alloys experienced end-grain attack. In the case of Inconel 671, heat treatment was very important; annealed and quenched material was much more resistant than furnace-cooled material.The rate of oxidation of Cr(III) to Cr(VI) increased significantly as the nitric acid concentration increased, and certain forms of ruthenium in the solution seemed to accelerate the rate of formation. Mechanical connectors of T-304L stainless steel experienced end-grain attack on the exposed pipe ends, and seal rings of both stainless steel and a titanium alloy (6% Al-4% V) underwent heavy attack in boiling 8 M HNO/sub 3/.

  16. Nitric acid vapor removal by activated, impregnated carbons

    Energy Technology Data Exchange (ETDEWEB)

    Wood, G.O.

    1996-12-31

    Laboratory and industrial workers can be exposed to vapors of nitric acid, especially in accidents, such as spills. Nitric acid can also be a product of incineration for energy production or waste (e.g., CW agent) disposal. Activated carbons containing impregnants for enhancing vapor and gas removal have been tested for effectiveness in removing vapors of nitric acid from air. The nitric acid vapor was generated from concentrated acid solutions and detected by trapping in a water bubbler for pH measurements. Both low and moderate relative humidity conditions were used. All carbons were effective at vapor contact times representative of air-purifying respirator use. One surprising observation was the desorption of low levels of ammonia from impregnated carbons. This was apparently due to residual ammonia from the impregnation processes.

  17. Diamagnetism and Strucure of Nitric Acid-Treated Bulk Polyethylene

    OpenAIRE

    Ania, F.; Baltá Calleja, F. J.; Cagiao, M.E.

    1982-01-01

    An alternative procedure to examine the nature of the end product of nitric-acid-treated bulk polyethylene involving the measurement of the diamagnetic susceptibility is reported. This simple non-destructive method complements previous results obtained by means of IR spectroscopy. Thus after selectively removing the surface layer of the polyethylene lamellae with nitric acid (t > 50h) the diamagnetic susceptibility substantially decreases to values wich are consistent with tilted paraff...

  18. Acute chemical pneumonitis caused by nitric acid inhalation: case report

    Energy Technology Data Exchange (ETDEWEB)

    Choe, Hyung Shim; Lee, In Jae; Ko, Eun Young; Lee, Jae Young; Kim, Hyun Beom; Hwang, Dae Hyun; Lee, Kwan Seop; Lee, Yul; Bae, Sang Hoon [Hallym University Sacred Heart Hospital, Anyang (Korea, Republic of)

    2003-06-01

    Chemical pneumonitis induced by nitric acid inhalation is a rare clinical condition. The previously reported radiologic findings of this disease include acute permeability pulmonary edema, delayed bronchiolitis obliterans, and bronchiectasis. In very few published rare radiologic reports has this disease manifested as acute alveolar injury; we report a case of acute chemical pneumonitis induced by nitric acid inhalation which at radiography manifested as bilateral perihilar consolidation and ground-glass attenuation, suggesting acute alveolar injury.

  19. Photochemical reactions of neptunium in nitric acid solution containing photocatalyst

    Energy Technology Data Exchange (ETDEWEB)

    Fukasawa, Tetsuo; Kawamura, Fumio (Hitachi Ltd., Ibaraki (Japan). Energy Research Lab.)

    1991-01-01

    Photochemical oxidation and reduction behaviors of neptunium were preliminarily investigated in 3 mol/l nitric acid solution. Nitric acid of 3 mol/l simulated the high level waste solution from a spent fuel reprocessing process. Concentrations of Np(V), Np(VI) and nitrous acid were determined with a photospectrometer, and solution potential with an electrode. Without additives, Np(VI) was reduced to Np(V) by nitrous acid which was photolytically generated from nitric acid. With a scavenger for nitrous acid, Np(V) was oxidized to extractable Np(VI) by a photolytically generated oxidizing reagent which were predicted by the solution potential measurement. The reduction rate was higher than the oxidation rate because of the larger quantity and higher reactivity of nitrous acid than an oxidizing reagent. Photocatalyst was proved to be effective for the oxidation of Np(V) to Np(VI). (author).

  20. Extraction of nitric acid, uranyl nitrate, and bismuth nitrate from aqueous nitric acid solutions with CMPO

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, B.B.

    1995-08-01

    DOE sponsored development of the transuranium extraction (TRUEX) process for removing actinides from radioactive wastes. The solvent is a mixture of CMPO and TBP. Since the extraction characteristics of CMPO are not as well understood as those of TBP, the extraction of nitric acid, uranyl nitrate, and bismuth nitrate with CMPO (dissolved in n-dodecane) were studied. Results indicate that CMPO extracts nitric acid with a 1:1 stoichiometry; equilibrium constant is 2. 660{plus_minus}0.092 at 25 C, and extraction enthalpy is -5. 46{plus_minus}0.46 kcal/mol. Slope analysis indicates that uranyl nitrate extracts with a mixed equilibria of 1:1 and 2:1 stoichiometries in nearly equal proportion. Equil. constant of the 2: 1 extraction was 1.213 {times} 10{sup 6}{plus_minus}3.56 {times} 10{sup 4} at 25 C; reaction enthalpy was -9.610{plus_minus}0.594 kcal/mol. Nitration complexation constant is 8.412{plus_minus}0.579, with an enthalpy of -10.72{plus_minus}1.87 kcal/mol. Bismuth nitrate also extracts with a mixed equilibria of (perhaps) 1:1 and 2:1 stoichiometries. A 2:1 extraction equilibrium and a nitrate complexation adequately model the data. Kinetics and enthalpies were also measured.

  1. Enhanced sidewall functionalization of single-wall carbon nanotubes using nitric acid.

    Science.gov (United States)

    Tobias, Gerard; Shao, Lidong; Ballesteros, Belin; Green, Malcolm L H

    2009-10-01

    When a sample of as-made single-walled carbon nanotubes (SWNTs) is treated with nitric acid, oxidation debris are formed due to the functionalization (mainly carboxylation) of the amorphous carbon present in the sample and a continuous coating along the carbon nanotube walls is created preventing the sidewall functionalization of the SWNTs. This oxidation debris can be easily removed by an aqueous base wash leaving behind a sample with a low degree of functionality. After removal of the amorphous carbon (by steam purification) from a sample of as-made SWNTs, the resulting purified SWNTs are readily carboxylated on the walls by nitric acid treatment. The use of steam for the purification of SWNTs samples allows the removal of the amorphous carbon and graphitic layers coating the metal particles present in the sample without altering the tubular structure of the SWNTs. The exposed metal particles can then be easily removed by an acid wash. Comparison between the steam treatment and molten sodium hydroxide treatment is made.

  2. Simulated dry deposition of nitric acid near forest edges

    NARCIS (Netherlands)

    DeJong, JJM; Klaassen, W; Jong, J.J.M. de

    1997-01-01

    Dry deposition is simulated to understand and generalize observations of enhanced deposition of air pollution near forest edges. Nitric acid is taken as an example as its deposition velocity is often assumed to be determined by turbulent transport only. The simulations are based on the micro-meteoro

  3. REACTIVITY OF RESORCINOL FORMALDEHYDE RESIN WITH NITRIC ACID

    Energy Technology Data Exchange (ETDEWEB)

    King, W; Fernando Fondeur, F; Bill Wilmarth, B; Myra Pettis, M; Shirley Mccollum, S

    2006-06-14

    Solid-state infrared spectroscopy, differential scanning calorimetry, and elemental analysis have been used to evaluate the reactivity of resorcinol formaldehyde resin with nitric acid and characterize the solid product. Two distinct reactions were identified within the temperature range 25-55 C. The first reaction is primarily associated with resin nitration, while the second involves bulk oxidation and degradation of the polymer network leading to dissolution and off-gassing. Reaction was confirmed with nitric acid concentrations as low as 3 M at 25 C applied temperature and 0.625 M at 66 C. Although a nitrated resin product can be isolated under appropriate experimental conditions, calorimetry testing indicates no significant hazard associated with handling the dry material.

  4. Reactivity of Resorcinol Formaldehyde Resin with Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    King, William D.; Fondeur, Fernando F.; Wilmarth, William R.; Pettis, Myra E.

    2005-10-25

    Solid-state infrared spectroscopy, differential scanning calorimetry, and elemental analysis have been used to evaluate the reactivity of resorcinol formaldehyde resin with nitric acid and characterize the solid product. Two distinct reactions were identified within the temperature range 25-55 C. The first reaction is primarily associated with resin nitration, while the second involves bulk oxidation and degradation of the polymer network leading to dissolution and off-gassing. The threshold conditions promoting reaction have been identified. Reaction was confirmed with nitric acid concentrations as low as 3 M at 25 C applied temperature and 0.625 M at 66 C. Although a nitrated resin product can be isolated under appropriate experimental conditions, calorimetry testing indicates no significant hazard associated with handling the dry material.

  5. Nitric acid trihydrate (NAT) in polar stratospheric clouds.

    Science.gov (United States)

    Voigt, C; Schreiner, J; Kohlmann, A; Zink, P; Mauersberger, K; Larsen, N; Deshler, T; Kröger, C; Rosen, J; Adriani, A; Cairo, F; Di Donfrancesco, G; Viterbini, M; Ovarlez, J; Ovarlez, H; David, C; Dörnbrack, A

    2000-12-01

    A comprehensive investigation of polar stratospheric clouds was performed on 25 January 2000 with instruments onboard a balloon gondola flown from Kiruna, Sweden. Cloud layers were repeatedly encountered at altitudes between 20 and 24 kilometers over a wide range of atmospheric temperatures (185 to 197 kelvin). Particle composition analysis showed that a large fraction of the cloud layers was composed of nitric acid trihydrate (NAT) particles, containing water and nitric acid at a molar ratio of 3:1; this confirmed that these long-sought solid crystals exist well above ice formation temperatures. The presence of NAT particles enhances the potential for chlorine activation with subsequent ozone destruction in polar regions, particularly in early and late winter.

  6. Temperature effects on the nitric acid oxidation of industrial grade multiwalled carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Nadia F., E-mail: nadia@fisica.ufc.br [Universidade Federal do Ceara, Departamento de Fisica (Brazil); Martinez, Diego Stefani T., E-mail: diegostefani.br@gmail.com; Paula, Amauri J., E-mail: amaurijp@gmail.com [Universidade Estadual de Campinas (UNICAMP), Laboratorio de Quimica do Estado Solido (LQES), Instituto de Quimica (Brazil); Silveira, Jose V. [Universidade Federal do Ceara, Departamento de Fisica (Brazil); Alves, Oswaldo L., E-mail: oalves@iqm.unicamp.br [Universidade Estadual de Campinas (UNICAMP), Laboratorio de Quimica do Estado Solido (LQES), Instituto de Quimica (Brazil); Souza Filho, Antonio G., E-mail: agsf@fisica.ufc.br [Universidade Federal do Ceara, Departamento de Fisica (Brazil)

    2013-07-15

    In this study, we report an oxidative treatment of multiwalled carbon nanotubes (MWCNTs) by using nitric acid at different temperatures (25-175 Degree-Sign C). The analyzed materials have diameters varying from 10 to 40 nm and majority lengths between 3 and 6 {mu}m. The characterization results obtained by different techniques (e.g., field emission scanning electron microscopy, thermogravimetric analysis, energy-filtered transmission electron microscopy, Braunauer, Emmet and Teller method, {zeta}-potential and confocal Raman spectroscopy) allowed us to access the effects of temperature treatment on the relevant physico-chemical properties of the MWCNTs samples studied in view of an integrated perspective to use these samples in a bio-toxicological context. Analytical microbalance measurements were used to access the purity of samples (metallic residue) after thermogravimetric analysis. Confocal Raman spectroscopy measurements were used to evaluate the density of structural defects created on the surface of the tubes due to the oxidation process by using 2D Raman image. Finally, we have demonstrated that temperature is an important parameter in the generation of oxidation debris (a byproduct which has not been properly taken into account in the literature) in the industrial grade MWCNTs studied after nitric acid purification and functionalization.

  7. Bronchiolitis obliterans organizing pneumonia following nitric acid fume exposure.

    Science.gov (United States)

    Lee, L T; Ho, C H B; Putti, T C

    2014-03-01

    We describe a patient with clinical, radiological and pathological features of bronchiolitis obliterans organizing pneumonia. Investigation showed that this was likely to have been a delayed consequence of inhalation of nitric acid fumes (containing nitrogen dioxide) after a fire. This case shows that thorough investigation of the aetiology is important not only in clinical management but also in ensuring patients benefit from appropriate work injury compensation.

  8. Alternative to Nitric Acid for Passivation of Stainless Steel Alloys

    Science.gov (United States)

    Lewis, Pattie L.; Kolody, Mark; Curran, Jerry

    2013-01-01

    Corrosion is an extensive problem that affects the Department of Defense (DoD) and National Aeronautics and Space Administration (NASA). The deleterious effects of corrosion result in steep costs, asset downtime affecting mission readiness, and safety risks to personnel. Consequently, it is vital to reduce corrosion costs and risks in a sustainable manner. The DoD and NASA have numerous structures and equipment that are fabricated from stainless steel. The standard practice for protection of stainless steel is a process called passivation. Typical passivation procedures call for the use of nitric acid; however, there are a number of environmental, worker safety, and operational issues associated with its use. Citric acid offers a variety of benefits including increased safety for personnel, reduced environmental impact, and reduced operational cost. DoD and NASA agreed to collaborate to validate citric acid as an acceptable passivating agent for stainless steel. This paper details our investigation of prior work developing the citric acid passivation process, development of the test plan, optimization of the process for specific stainless steel alloys, ongoing and planned testing to elucidate the process' resistance to corrosion in comparison to nitric acid, and preliminary results.

  9. Reduction Rates for Higher Americium Oxidation States in Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Grimes, Travis Shane [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mincher, Bruce Jay [Idaho National Lab. (INL), Idaho Falls, ID (United States); Schmitt, Nicholas C [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-30

    The stability of hexavalent americium was measured using multiple americium concentrations and nitric acid concentrations after contact with the strong oxidant sodium bismuthate. Contrary to our hypotheses Am(VI) was not reduced faster at higher americium concentrations, and the reduction was only zero-order at short time scales. Attempts to model the reduction kinetics using zero order kinetic models showed Am(VI) reduction in nitric acid is more complex than the autoreduction processes reported by others in perchloric acid. The classical zero-order reduction of Am(VI) was found here only for short times on the order of a few hours. We did show that the rate of Am(V) production was less than the rate of Am(VI) reduction, indicating that some Am(VI) undergoes two electron-reduction to Am(IV). We also monitored the Am(VI) reduction in contact with the organic diluent dodecane. A direct comparison of these results with those in the absence of the organic diluent showed the reduction rates for Am(VI) were not statistically different for both systems. Additional americium oxidations conducted in the presence of Ce(IV)/Ce(III) ions showed that Am(VI) is reduced without the typical growth of Am(V) observed in the systems sans Ce ion. This was an interesting result which suggests a potential new reduction/oxidation pathway for Am in the presence of Ce; however, these results were very preliminary, and will require additional experiments to understand the mechanism by which this occurs. Overall, these studies have shown that hexavalent americium is fundamentally stable enough in nitric acid to run a separations process. However, the complicated nature of the reduction pathways based on the system components is far from being rigorously understood.

  10. Nitric acid: modeling osmotic coefficients and acid-base dissociation using the BIMSA theory.

    Science.gov (United States)

    Ruas, Alexandre; Pochon, Patrick; Simonin, Jean-Pierre; Moisy, Philippe

    2010-11-14

    This work is aimed at a description of the thermodynamic properties of highly concentrated aqueous solutions of nitric acid salts at 25 °C within the binding mean spherical approximation (BIMSA) theory. The predictive capability of this model was examined. First, Raman spectroscopy was used to study the proportion of associated nitric acid as a function of concentration. The corresponding apparent association constant values were compared with literature values. Besides, the BIMSA model, taking into account complex formation, was used to represent literature experimental osmotic coefficient variation with concentration. This theoretical description led to an assessment of the degree of association. The so calculated amount of associated nitric acid coincides accurately with our Raman experimental results up to a high concentration of acid.

  11. Nitric acid: modeling osmotic coefficients and acid-base dissociation using the BIMSA theory

    Energy Technology Data Exchange (ETDEWEB)

    Ruas, A.; Pochon, P.; Moisy, Ph. [CEA Marcoule, Nucl Energy Div, RadioChem and Proc Dept, F-30207 Bagnols Sur Ceze (France); Simonin, J. P. [Univ Paris 06, CNRS, UMR 7195, Lab PECSA, F-75252 Paris 05, (France)

    2010-07-01

    This work is aimed at a description of the thermodynamic properties of highly concentrated aqueous solutions of nitric acid salts at 25 C within the binding mean spherical approximation (BIMSA) theory. The predictive capability of this model was examined. First, Raman spectroscopy was used to study the proportion of associated nitric acid as a function of concentration. The corresponding apparent association constant values were compared with literature values. Besides, the BIMSA model, taking into account complex formation, was used to represent literature experimental osmotic coefficient variation with concentration. This theoretical description led to an assessment of the degree of association. The so calculated amount of associated nitric acid coincides accurately with our Raman experimental results up to a high concentration of acid. (authors)

  12. Energy integration of nitric acid production using pinch methodology

    Directory of Open Access Journals (Sweden)

    Ivaniš Gorica R.

    2015-01-01

    Full Text Available Pinch methodology was applied to the heat exchangers network (HEN synthesis of nitric acid production. The integration is analyzed in two ways, and the results are presented as two different solutions: (i the first solution is based on the original heat transfer equipment arrangement, (ii in order to eliminate the shortages of the first solution the second HEN was obtained using process simulation with optimized process parameters. Optimized HEN, with new arrangement of heat exchangers, gave good results in energy and process optimization. [Projekat Ministarstva nauke Republike Srbije, br. P172063

  13. Separation of thorium and uranium in nitric acid solution using silica based anion exchange resin.

    Science.gov (United States)

    Chen, Yanliang; Wei, Yuezhou; He, Linfeng; Tang, Fangdong

    2016-09-30

    To separate thorium and uranium in nitric acid solution using anion exchange process, a strong base silica-based anion exchange resin (SiPyR-N4) was synthesized. Batch experiments were conducted and the separation factor of thorium and uranium in 9M nitric acid was about 10. Ion exchange chromatography was applied to separate thorium and uranium in different ratios. Uranium could be eluted by 9M nitric acid and thorium was eluted by 0.1M nitric acid. It was proved that thorium and uranium can be separated and recovered successfully by this method.

  14. Hydrothermal nitric acid treatment for effectual lipid extraction from wet microalgae biomass.

    Science.gov (United States)

    Lee, Ilgyu; Park, Ji-Yeon; Choi, Sun-A; Oh, You-Kwan; Han, Jong-In

    2014-11-01

    Hydrothermal acid (combined with autoclaving and nitric acid) pretreatment was applied to Nannochloropsis salina as a cost-effective yet efficient way of lipid extraction from wet biomass. The optimal conditions for this pretreatment were determined using a statistical approach, and the roles of nitric acid were also determined. The maximum lipid yield (predicted: 24.6%; experimental: 24.4%) was obtained using 0.57% nitric acid at 120°C for 30min through response surface methodology. A relatively lower lipid yield (18.4%) was obtained using 2% nitric acid; however, chlorophyll and unsaturated fatty acids, both of which adversely affect the refinery and oxidative stability of biodiesel, were found to be not co-extracted. Considering its comparable extractability even from wet biomass and ability to reduce chlorophyll and unsaturated fatty acids, the hydrothermal nitric acid pretreatment can serve as one direct and promising route of extracting microalgae oil. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. A sulfuric-lactic acid process for efficient purification of fungal chitosan with intact molecular weight.

    Science.gov (United States)

    Naghdi, Mitra; Zamani, Akram; Karimi, Keikhosro

    2014-02-01

    The most recent method of fungal chitosan purification, i.e., two steps of dilute sulfuric acid treatment, pretreatment of cell wall at room temperature for phosphate removal and extraction of chitosan from the phosphate free cell wall at high temperature, significantly reduces the chitosan molecular weight. This study was aimed at improvement of this method. In the pretreatment step, to choose the best conditions, cell wall of Rhizopus oryzae, containing 9% phosphate, 10% glucosamine, and 21% N-acetyl glucosamine, was treated with sulfuric, lactic, acetic, nitric, or hydrochloric acid, at room temperature. Sulfuric acid showed the best performance in phosphate removal (90%) and cell wall recovery (89%). To avoid depolymerisation of chitosan, hot sulfuric acid extraction was replaced with lactic acid treatment at room temperature, and a pure fungal chitosan was obtained (0.12 g/g cell wall). Similar pretreatment and extraction processes were conducted on pure shrimp chitosan and resulted in a chitosan recovery of higher than 87% while the reduction of chitosan viscosity was less than 15%. Therefore, the sulfuric-lactic acid method purified the fungal chitosan without significant molecular weight manipulation.

  16. Nitrosation and Nitration of Fulvic Acid, Peat and Coal with Nitric Acid.

    Directory of Open Access Journals (Sweden)

    Kevin A Thorn

    Full Text Available Nitrohumic acids, produced from base extraction of coals and peats oxidized with nitric acid, have received considerable attention as soil ammendments in agriculture. The nitration chemistry however is incompletely understood. Moreover, there is a need to understand the reaction of nitric acid with natural organic matter (NOM in general, in the context of a variety of environmental and biogeochemical processes. Suwannee River NOM, Suwannee River fulvic acid, and Pahokee Peat fulvic acid were treated with 15N-labeled nitric acid at concentrations ranging from 15% to 22% and analyzed by liquid and solid state 15N NMR spectroscopy. Bulk Pahokee peat and Illinois #6 coal were also treated with nitric acid, at 29% and 40% respectively, and analyzed by solid state 15N NMR spectroscopy. In addition to nitro groups from nitration of aromatic carbon, the 15N NMR spectra of all five samples exhibited peaks attributable to nitrosation reactions. These include nitrosophenol peaks in the peat fulvic acid and Suwannee River samples, from nitrosation of phenolic rings, and N-nitroso groups in the peat samples, from nitrosation of secondary amides or amines, the latter consistent with the peat samples having the highest naturally abundant nitrogen contents. Peaks attributable to Beckmann and secondary reactions of the initially formed oximes were present in all spectra, including primary amide, secondary amide, lactam, and nitrile nitrogens. The degree of secondary reaction product formation resulting from nitrosation reactions appeared to correlate inversely with the 13C aromaticities of the samples. The nitrosation reactions are most plausibly effected by nitrous acid formed from the reduction of nitric acid by oxidizable substrates in the NOM and coal samples.

  17. Nitrosation and nitration of fulvic acid, peat and coal with nitric acid

    Science.gov (United States)

    Thorn, Kevin A.; Cox, Larry G.

    2016-01-01

    Nitrohumic acids, produced from base extraction of coals and peats oxidized with nitric acid, have received considerable attention as soil ammendments in agriculture. The nitration chemistry however is incompletely understood. Moreover, there is a need to understand the reaction of nitric acid with natural organic matter (NOM) in general, in the context of a variety of environmental and biogeochemical processes. Suwannee River NOM, Suwannee River fulvic acid, and Pahokee Peat fulvic acid were treated with 15N-labeled nitric acid at concentrations ranging from 15% to 22% and analyzed by liquid and solid state 15N NMR spectroscopy. Bulk Pahokee peat and Illinois #6 coal were also treated with nitric acid, at 29% and 40% respectively, and analyzed by solid state 15N NMR spectroscopy. In addition to nitro groups from nitration of aromatic carbon, the 15N NMR spectra of all five samples exhibited peaks attributable to nitrosation reactions. These include nitrosophenol peaks in the peat fulvic acid and Suwannee River samples, from nitrosation of phenolic rings, and N-nitroso groups in the peat samples, from nitrosation of secondary amides or amines, the latter consistent with the peat samples having the highest naturally abundant nitrogen contents. Peaks attributable to Beckmann and secondary reactions of the initially formed oximes were present in all spectra, including primary amide, secondary amide, lactam, and nitrile nitrogens. The degree of secondary reaction product formation resulting from nitrosation reactions appeared to correlate inversely with the 13C aromaticities of the samples. The nitrosation reactions are most plausibly effected by nitrous acid formed from the reduction of nitric acid by oxidizable substrates in the NOM and coal samples.

  18. Nitrosation and Nitration of Fulvic Acid, Peat and Coal with Nitric Acid.

    Science.gov (United States)

    Thorn, Kevin A; Cox, Larry G

    2016-01-01

    Nitrohumic acids, produced from base extraction of coals and peats oxidized with nitric acid, have received considerable attention as soil ammendments in agriculture. The nitration chemistry however is incompletely understood. Moreover, there is a need to understand the reaction of nitric acid with natural organic matter (NOM) in general, in the context of a variety of environmental and biogeochemical processes. Suwannee River NOM, Suwannee River fulvic acid, and Pahokee Peat fulvic acid were treated with 15N-labeled nitric acid at concentrations ranging from 15% to 22% and analyzed by liquid and solid state 15N NMR spectroscopy. Bulk Pahokee peat and Illinois #6 coal were also treated with nitric acid, at 29% and 40% respectively, and analyzed by solid state 15N NMR spectroscopy. In addition to nitro groups from nitration of aromatic carbon, the 15N NMR spectra of all five samples exhibited peaks attributable to nitrosation reactions. These include nitrosophenol peaks in the peat fulvic acid and Suwannee River samples, from nitrosation of phenolic rings, and N-nitroso groups in the peat samples, from nitrosation of secondary amides or amines, the latter consistent with the peat samples having the highest naturally abundant nitrogen contents. Peaks attributable to Beckmann and secondary reactions of the initially formed oximes were present in all spectra, including primary amide, secondary amide, lactam, and nitrile nitrogens. The degree of secondary reaction product formation resulting from nitrosation reactions appeared to correlate inversely with the 13C aromaticities of the samples. The nitrosation reactions are most plausibly effected by nitrous acid formed from the reduction of nitric acid by oxidizable substrates in the NOM and coal samples.

  19. Study of Removal Nitrous Acid From Nitric Acid Solution Using Packed Column

    Institute of Scientific and Technical Information of China (English)

    LAN; Tian; CHANG; Shang-wen; LIU; Jin-ping; ZHOU; Xian-ming; LI; Gao-liang; TANG; Hong-bin; HE; Hui

    2013-01-01

    It is necessary that the adjustment of the Pu(Ⅲ)to Pu(Ⅳ)should be used excess nitride gases befor the cycle of Pu purification in Purex.The mass of nitrous acid were present in solution after adjustment.Ifthe solution contain the mass of nitrous acid arrived at the cycle of Pupurification,the nitrous could react with Pu reducing agent in the processof Pu back-extractionbecause nitrous acid could extracted to organic,

  20. Impact of scaling on the nitric-glycolic acid flowsheet

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, D. [Savannah River Site (SRS), Aiken, SC (United States)

    2016-02-01

    Savannah River Remediation (SRR) is considering using glycolic acid as a replacement for formic acid in Sludge Receipt and Adjustment Tank (SRAT) processing in the Defense Waste Processing Facility (DWPF). Catalytic decomposition of formic acid is responsible for the generation of hydrogen, a potentially flammable gas, during processing. To prevent the formation of a flammable mixture in the offgas, an air purge is used to dilute the hydrogen concentration below the 60% of the Composite Lower Flammability Limit (CLFL). The offgas is continuously monitored for hydrogen using Gas Chromatographs (GCs). Since formic acid is much more volatile and toxic than glycolic acid, a formic acid spill would lead to the release of much larger quantities to the environment. Switching from formic acid to glycolic acid is expected to eliminate the hydrogen flammability hazard leading to lower air purges, thus downgrading of Safety Significant GCs to Process Support GCs, and minimizing the consequence of a glycolic acid tank leak in DWPF. Overall this leads to a reduction in process operation costs and an increase in safety margin. Experiments were completed at three different scales to demonstrate that the nitric-glycolic acid flowsheet scales from the 4-L lab scale to the 22-L bench scale and 220-L engineering scale. Ten process demonstrations of the sludge-only flowsheet for SRAT and Slurry Mix Evaporator (SME) cycles were performed using Sludge Batch 8 (SB8)-Tank 40 simulant. No Actinide Removal Process (ARP) product or strip effluent was added during the runs. Six experiments were completed at the 4-L scale, two experiments were completed at the 22-L scale, and two experiments were completed at the 220-L scale. Experiments completed at the 4-L scale (100 and 110% acid stoichiometry) were repeated at the 22-L and 220-L scale for scale comparisons.

  1. Extraction equilibrium of indium(III) from nitric acid solutions by di(2-ethylhexyl)phosphoric acid dissolved in kerosene

    National Research Council Canada - National Science Library

    Tsai, Hung-Sheng; Tsai, Teh-Hua

    2012-01-01

    The extraction equilibrium of indium(III) from a nitric acid solution using di(2-ethylhexyl) phosphoric acid (D2EHPA) as an acidic extractant of organophosphorus compounds dissolved in kerosene was studied...

  2. Purification and Structure Identification of Hyaluronic Acid

    Institute of Scientific and Technical Information of China (English)

    Shui Sheng HONG; Jia CHEN; Jian Guo ZHANG; Yan Chun TAO; Lan Ying LIU

    2004-01-01

    Polysaccharide produced by mutated strain of Streptococcus zooepidemicus was purified by the procedures including Savage method, quaternary ammonium compound precipitation, DEAE-cellulose(DE52) chromatography and Sephadex G-75 gel filtration. The structure of the purified polysaccharide has been characterized by means of chemical composition analysis, 13C NMR spectrum, infrared spectrum and circular dichroism (CD). All the results showed that the purified polysaccharide was hyaluronic acid (HA). The single helix conformation of the purified HA was determined by Congo red experiment. The molecular weight of the HA was about 1.16×106D, which was measured by viscosity method.

  3. 46 CFR 151.50-80 - Nitric acid (70% or less).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Nitric acid (70% or less). 151.50-80 Section 151.50-80 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-80 Nitric acid (70% or...

  4. Research on the Stability of Dimethyl Hydroxylamine-methyl Hydrazinein Nitric Acid Medium

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    By the means of the comparison of the extraction of PU(Ⅲ) and plutonium in nitric acid mediumcontaining dimethyl hydroxylamine-methyl hydrazine and the analysis of the percent content of PU(Ⅳ) inthe system, the stability of dimethyl hydroxylamine-methyl hydrazine in nitric acid medium is

  5. Process development and optimisation of lactic acid purification using electrodialysis.

    Science.gov (United States)

    Madzingaidzo, L; Danner, H; Braun, R

    2002-07-03

    Cell free sodium lactate solutions were subjected to purification based on mono- and bi-polar electrodialysis. Lactate concentration in the product stream increased to a maximum of 15% during mono-polar electrodialysis. Stack energy consumption averaged 0.6 kW h kg(-1) lactate transported at current efficiencies in the 90% range. Under optimum feed concentration (125 g l(-1)) and process conditions (auto-current mode with conductivity setpoints of minimum 5 and maximum 40 mS cm(-1)), lactate flux reached 300 g m(-2) h(-1) and water flux were low for mono-polar electrodialysis averaging 0.3 kg H(2)O per M lactate transported. Glucose in the concentrate stream solutions was reduced to concentrate stream solutions. After mono-polar electrodialysis, the concentrated sodium lactate solutions were further purified using bi-polar electrodialysis. Water transport during bi-polar electrodialysis reached figures of 0.070 - 0.222 kg H(2)O per M lactate. Free lactic acid concentration reached 16% with lactate flux of up to 300 g m(-2) h(-1). Stack energy consumption ranged from 0.6 to 1 kW h per kg lactate. Under optimised process conditions current efficiency during bi-polar electrodialysis was consistently around 90%. Glucose was further reduced from 2 to solution. Acetic acid impurity remained at around 1 g l(-1). Significant reduction in colour and minerals in the product streams was observed during electrodialysis purification.

  6. A New Process Study on Comprehensive Utilization of NOx from Nitric Acid Plant

    Institute of Scientific and Technical Information of China (English)

    Zhou Hou-zhen; Liang Hua

    2003-01-01

    Based on studies of controlling NOx from nitric acid exhaust gas domestic and abroad, this paper has developed a new technique on removal of NOx and production of a by-product with high added value-- MnO2. Experiment shows, pyrolusite, whose valid composition is MnO2, of absorbing NOx has the following characteristics: quick, low cost, no secondary pollutant. Moreover, exhaust gas can attain the required standards. If the temperature of the pyrolusite serum is 30℃, pH=4, containing 90 g/L MnO2, the absorptivity for 3 000 mg/m3 NOx is 89.2%. Furthermore,few of the impurities in pyrolusite dissolve in the absorption mother solution. The purification cost of product is very low.The purity of end product MnO2 is more than 99. 995% after purifying. Therefore, it is workable for the new technique on economy and technology. There are also obvious environmental benefits and marked economic returns.

  7. A New Process Study on Comprehensive Utilization of NOx from Nitric Acid Plant

    Institute of Scientific and Technical Information of China (English)

    ZhouHou-zhen; LiangHua

    2003-01-01

    Based on studies of controlling NOx from nitric acid exhaust gas domestic and abroad, this paper has developed a new technique on removal of NOx and production of a by-product with high added value MnO2. Experiment shows, pyrolusite, whose valid composition is MnO2, of absorbing NOx has the following characteristics: quick, low cost, no secondary pollutant. Moreover, exhaust gas can attain the required standards. If the temperature of the pyrolusite serum is 30℃, pH=4, containing 90 g/L MnO2, the absorptivity for 3 000 mg/m3 NOx is 89.2%. Furthermore,few of the impurities in pyrolusite dissolve in the absorption mother solution. The purification cost of product is very low.The purity of end product MnO2 is more than 99. 995% after purifying. Therefore, it is workable for the new technique on economy and technology. There are also obvious environmental benefits and marked economic returns.

  8. Effect of Nitric Acid Concentrations on Synthesis and Stability of Maghemite Nanoparticles Suspension

    Directory of Open Access Journals (Sweden)

    Irwan Nurdin

    2014-01-01

    Full Text Available Maghemite (γ-Fe2O3 nanoparticles have been synthesized using a chemical coprecipitation method at different nitric acid concentrations as an oxidizing agent. Characterization of all samples performed by several techniques including X-ray diffraction (XRD, transmission electron microscopy (TEM, alternating gradient magnetometry (AGM, thermogravimetric analysis (TGA, dynamic light scattering (DLS, and zeta potential. The XRD patterns confirmed that the particles were maghemite. The crystallite size of all samples decreases with the increasing concentration of nitric acid. TEM observation showed that the particles have spherical morphology with narrow particle size distribution. The particles showed superparamagnetic behavior with decreased magnetization values at the increasing concentration of nitric acid. TGA measurement showed that the stability temperature decreases with the increasing concentration of nitric acid. DLS measurement showed that the hydrodynamic particle sizes decrease with the increasing concentration of nitric acid. Zeta potential values show a decrease with the increasing concentration of nitric acid. The increasing concentration of nitric acid in synthesis of maghemite nanoparticles produced smaller size particles, lower magnetization, better thermal stability, and more stable maghemite nanoparticles suspension.

  9. Effect of nitric acid concentrations on synthesis and stability of maghemite nanoparticles suspension.

    Science.gov (United States)

    Nurdin, Irwan; Johan, Mohd Rafie; Yaacob, Iskandar Idris; Ang, Bee Chin

    2014-01-01

    Maghemite (γ-Fe2O3) nanoparticles have been synthesized using a chemical coprecipitation method at different nitric acid concentrations as an oxidizing agent. Characterization of all samples performed by several techniques including X-ray diffraction (XRD), transmission electron microscopy (TEM), alternating gradient magnetometry (AGM), thermogravimetric analysis (TGA), dynamic light scattering (DLS), and zeta potential. The XRD patterns confirmed that the particles were maghemite. The crystallite size of all samples decreases with the increasing concentration of nitric acid. TEM observation showed that the particles have spherical morphology with narrow particle size distribution. The particles showed superparamagnetic behavior with decreased magnetization values at the increasing concentration of nitric acid. TGA measurement showed that the stability temperature decreases with the increasing concentration of nitric acid. DLS measurement showed that the hydrodynamic particle sizes decrease with the increasing concentration of nitric acid. Zeta potential values show a decrease with the increasing concentration of nitric acid. The increasing concentration of nitric acid in synthesis of maghemite nanoparticles produced smaller size particles, lower magnetization, better thermal stability, and more stable maghemite nanoparticles suspension.

  10. Omega-3 fatty acids improve psychomotor performance via mechanism not related to nitric acid production

    Directory of Open Access Journals (Sweden)

    Marwan S. M. Al-Nimer

    2012-01-01

    Full Text Available Omega-3 fatty acids (ω-3FAs are essential polyunsaturated fats that protect the brain from cognitive impairment. It increases the activity of endothelial nitric oxide synthetase (eNOS and thereby increases the nitric acid (NO production. This study aimed to explore the effect of ω-3FAs on psychomotor performance and to relate this effect to the reactive nitrogen species. This study was conducted in Department of Pharmacology, College of Medicine, Al-Mustansiriya University in Baghdad, Iraq. Twenty healthy subjects, allocated randomly from medical college students, were participated in the single blind clinical trial. Participants were divided into two groups, each of ten subjects to receive either placebo or (ω-3FAs (750 mg single oral dose daily for 5 days. They were asked to perform psychomotor performance before and after 5 days of treatment, and venous blood was obtained for determination of serum nitric oxide (NO and peroxynitrite (ONOO. ω-3FAs treated group was significantly different from placebo-treated group in reducing choice and motor reaction times as well as the critical flicker frequency threshold. The serum levels of NO and ONOO in ω-3FAs-treated group did not significantly differ from placebo-treated group. Short term supplementation of ω-3FAs improves the psychomotor performance in young healthy subjects via a mechanism not related to the production of nitric oxide production. Inflorescence is a panicle few flowered and fruit is a capsule. The data of the results obtained were presented and discussed.

  11. Thermal Hazard Evaluation of Lauroyl Peroxide Mixed with Nitric Acid

    Directory of Open Access Journals (Sweden)

    Chi-Min Shu

    2012-07-01

    Full Text Available Many thermal runaway incidents have been caused by organic peroxides due to the peroxy group, –O–O–, which is essentially unstable and active. Lauroyl peroxide (LPO is also sensitive to thermal sources and is incompatible with many materials, such as acids, bases, metals, and ions. From the thermal decomposition reaction of various concentrations of nitric acid (HNO3 (from lower to higher concentrations with LPO, experimental data were obtained as to its exothermic onset temperature (T0, heat of decomposition (ΔHd, isothermal time to maximum rate (TMRiso, and other safety parameters exclusively for loss prevention of runaway reactions and thermal explosions. As a novel finding, LPO mixed with HNO3 can produce the detonation product of 1-nitrododecane. We used differential scanning calorimetry (DSC, thermal activity monitor III (TAM III, and gas chromatography/mass spectrometer (GC/MS analyses of the reactivity for LPO and itself mixed with HNO3 to corroborate the decomposition reactions and reaction mechanisms in these investigations.

  12. Integrated separation process for isolation and purification of biosuccinic acid.

    Science.gov (United States)

    Kurzrock, Tanja; Schallinger, Stefan; Weuster-Botz, Dirk

    2011-01-01

    Biotechnologically produced succinic acid has the potential to displace maleic acid and its uses. Therefore, it is of high interest for the chemical, pharmaceutical, and food industry.In addition to optimized production strains and fermentation processes, an efficient separation of succinic acid from the aqueous fermentation broth is indispensable to compete with the current petrochemical production of succinic acid. Isolation and purification of succinic acid from an Escherichia coli fermentation broth were studied with two amine-based reactive extraction systems: (i) trihexylamine in 1-octanol and (ii) diisooctylamine and dihexylamine in a mixture of 1-octanol and 1-hexanol. Back extraction of succinic acid from the organic phase was carried out using an aqueous trimethylamine solution. The trimethylammonium succinate generated after back extraction was split with an evaporation-based crystallization.The focus was on process integration, for example, reuse of the applied amines for extraction and back extraction. It was shown that the maximum trimethylamine concentration for back extraction should not exceed the stoichiometric amount (2 mol trimethylamine/mol the succinic acid in the organic phase) to ensure maximal extraction yields with the reused organic phase in subsequent extractions. Moreover, mixer-settler extraction and back extraction of succinic acid were scaled up from the milliliter- to the liter-scale making use of liquid–liquid centrifuges. The overall yield was 83.5% of the succinic acid from thefermentation supernatant. The final purity of the succinic acid crystals was 99.5%. Organic phase and amines can easily be recycled and reused. © 2011 American Institute of Chemical Engineers

  13. Synthesis of medronic acid monoesters and their purification by high-performance countercurrent chromatography or by hydroxyapatite

    OpenAIRE

    Elina Puljula; Jouko Vepsäläinen; Petri A. Turhanen

    2016-01-01

    We achieved the synthesis of important medronic acid monoalkyl esters via the dealkylation of mixed trimethyl monoalkyl esters of medronic acid. Two methods were developed for the purification of medronic acid monoesters: 1) small scale (10–20 mg) purification by using hydroxyapatite and 2) large scale (tested up to 140 mg) purification by high-performance countercurrent chromatography (HPCCC).

  14. Synthesis of medronic acid monoesters and their purification by high-performance countercurrent chromatography or by hydroxyapatite

    Directory of Open Access Journals (Sweden)

    Elina Puljula

    2016-10-01

    Full Text Available We achieved the synthesis of important medronic acid monoalkyl esters via the dealkylation of mixed trimethyl monoalkyl esters of medronic acid. Two methods were developed for the purification of medronic acid monoesters: 1 small scale (10–20 mg purification by using hydroxyapatite and 2 large scale (tested up to 140 mg purification by high-performance countercurrent chromatography (HPCCC.

  15. Purification of Carbon Nanotubes: Alternative Methods

    Science.gov (United States)

    Files, Bradley; Scott, Carl; Gorelik, Olga; Nikolaev, Pasha; Hulse, Lou; Arepalli, Sivaram

    2000-01-01

    Traditional carbon nanotube purification process involves nitric acid refluxing and cross flow filtration using surfactant TritonX. This is believed to result in damage to nanotubes and surfactant residue on nanotube surface. Alternative purification procedures involving solvent extraction, thermal zone refining and nitric acid refiuxing are used in the current study. The effect of duration and type of solvent to dissolve impurities including fullerenes and P ACs (polyaromatic compounds) are monitored by nuclear magnetic reasonance, high performance liquid chromatography, and thermogravimetric analysis. Thermal zone refining yielded sample areas rich in nanotubes as seen by scanning electric microscopy. Refluxing in boiling nitric acid seem to improve the nanotube content. Different procedural steps are needed to purify samples produced by laser process compared to arc process. These alternative methods of nanotube purification will be presented along with results from supporting analytical techniques.

  16. Assessment of electrochemical potentiokinetic reactivation tests to qualify stainless steel for nitric acid service

    Energy Technology Data Exchange (ETDEWEB)

    Olsen, A.R.; Dillon, J.J.; Peters, A.H.; Clift, T.L.

    1986-12-31

    To minimize the costs and delivery time delays associated with purchasing type 304L stainless steel materials for service in nitric-acid-containing media, an alternative to the current Oak Ridge Y-12 Plant requirement of testing in accordance with American Society for Testing and Materials (ASTM) A 262, Practice C (the boiling nitric acid test), is being sought. A possible candidate is the electrochemical potentiokinetic reactivation (EPR) test being developed for the nuclear industry and under consideration for acceptance as an ASTM standard. Based on a review of the literature and some limited screening tests, this test, as currently proposed, is not a suitable substitute for the nitric acid test. However, with additional development the EPR test is a likely candidate for providing a quantitative substitute for the current qualitative oxalic acid etching (ASTM A 282, Practice A) often used to accept, but not reject, materials for use in a nitric acid medium.

  17. Separation and purification of hyaluronic acid by glucuronic acid imprinted microbeads

    Energy Technology Data Exchange (ETDEWEB)

    Akdamar, H.Acelya; Sarioezlue, Nalan Yilmaz [Department of Biology, Anadolu University, Eskisehir (Turkey); Ozcan, Ayca Atilir; Ersoez, Arzu [Department of Chemistry, Anadolu University, Eskisehir (Turkey); Denizli, Adil [Department of Chemistry, Hacettepe University, Ankara (Turkey); Say, Ridvan, E-mail: rsay@anadolu.edu.tr [Department of Chemistry, Anadolu University, Eskisehir (Turkey); BIBAM (Plant, Drug and Scientific Researches Center), Anadolu University, Eskisehir (Turkey)

    2009-05-05

    The purification of hyaluronic acid (HA) is relatively significant to use in biomedical applications. The structure of HA is formed by the repetitive units of glucuronic acid and N-acetyl glucosamine. In this study, glucuronic acid-imprinted microbeads have been supplied for the purification of HA from cell culture (Streptococcus equi). Histidine-functional monomer, methacryloylamidohistidine (MAH) was chosen as the metal-complexing monomer. The glucuronic acid-imprinted poly(ethyleneglycoldimethacrylate-MAH-Copper(II)) [p(EDMA-MAH-Cu{sup 2+})] microbeads have been synthesized by typical suspension polymerization procedure. The template glucuronic acid has been removed by employing 5 M methanolic KOH solution. p(EDMA-MAH-Cu{sup 2+}) microbeads have been characterized by elemental analysis, Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM) images and swelling studies. Moreover, HA adsorption experiments have been performed in a batch experimental set-up. Purification of HA from cell culture supernatant has been also investigated by determining the hyaluronidase activity using purified HA as substrate. The glucuronic acid imprinted p(EDMA-MAH-Cu{sup 2+}) particles can be used many times with no significant loss in adsorption capacities. Also, the selectivity of prepared molecular imprinted polymers (MIP) has been examined. Results have showed that MIP particles are 19 times more selective for glucuronic acid than N-acetylglucose amine.

  18. Transuranic contamination of stainless steel in nitric acid

    Science.gov (United States)

    Kerry, Timothy; Banford, Anthony W.; Thompson, Olivia R.; Carey, Thomas; Schild, Dieter; Geist, Andreas; Sharrad, Clint A.

    2017-09-01

    Stainless steels coupons have been exposed to transuranic species in conditions representative of those found in a spent nuclear fuel reprocessing plant. Stainless steel was prepared to different surface finishes and exposed to nitric acid of varying concentrations containing 237Np, 239Pu or 243Am for one month at 50 °C. Contamination by these transuranics has been observed on all surfaces exposed to the solution through the use of autoradiography. This technique showed that samples held in 4 M HNO3 bind 2-3 times as much radionuclide as those held in 10.5 M HNO3. It was also found that the polished steel surfaces generally took up more transuranic contamination than the etched and ;as received; steel finishes. The extent of corrosion on the steel surfaces was found, by scanning electron microscopy, to be greater in solutions containing Np and Pu in comparison to that observed from contact with Am containing solutions, indicating that redox activity of transuranics can influence the mechanism of stainless steel corrosion.

  19. Nitric acid trihydrate (NAT formation at low NAT supersaturations

    Directory of Open Access Journals (Sweden)

    C. Voigt

    2004-12-01

    Full Text Available A polar stratospheric cloud (PSC was observed on 6 February 2003 in the Arctic stratosphere by in-situ measurements onboard the high-altitude research aircraft Geophysica. Low number densities (~10−4 cm−3 of nitric acid (HNO3 containing particles – probably NAT – with diameters up to 6 µm were measured at altitudes between 18 and 20 km. These particles have the potential to grow further and to remove HNO3 from the stratosphere, thereby enhancing polar ozone loss. Interestingly, the NAT particles formed in less than a day at temperatures T>TNAT−3.5 K, just slightly below the NAT equilibrium temperature TNAT. This unique measurement of PSC formation at extremely low NAT saturation ratios (SNAT≤11 constrains current NAT nucleation theories. In particular, NAT formation on ice can for certain be excluded. Conversely, we suggest that meteoritic particles may be favorable candidates for triggering nucleation of NAT at the observed low number densities.

  20. Moessbauer Spectroscopic Studies of {sup 237}Np in frozen nitric acid solution

    Energy Technology Data Exchange (ETDEWEB)

    Nakada, M; Wang, J; Kitazawa, T; Takahashi, M; Takeda, M; Masaki, N M; Yamashita, T [Department of Materials Science, Japan Atomic Energy Research Institute (JAERI, present JAEA: Japan Atomic Energy Agency), Tokai, Naka, Ibaraki 319-1195 (Japan); Tsutsui, S, E-mail: wangjh@dicp.ac.c [Advanced Science Research Center, JAERI, Tokai, Naka, Ibaraki 319-1195 (Japan)

    2010-03-01

    We applied Moessbauer spectroscopy to {sup 237}Np in nitric acid solutions to study chemical states. Sample solutions were adjusted to 50 mg/ml of Np(V) and Np(VI) concentration in 0.6 M nitric acid solutions. These solutions were put into original designed containers for samples and mounted to sample holders. The values of isomer shift (IS, relative to NpAl{sub 2}) of Np(V) and Np(VI) in 0.6 M nitric acid were -17.4(1) and -37.2(3) mm/s at about 10 K, respectively. It was found that Np(V) had 7 coordination number and Np(VI) had 8 in nitric acid solutions from values of IS.

  1. Research on the Stability of Diethyl Hydroxylamine in Nitric Acid Medium

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    By the means of the comparison of the extraction of PU(Ⅲ,Ⅳ) and plutonium in the aqueous Phasecontaining salting-free agent, the stability of diethyl hydroxylamine in nitric acid medium is investigated.

  2. HIRDLS/Aura Level 3 Nitric Acid (HNO3) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Nitric Acid (HNO3) Zonal Fourier Coefficients" version 7 data product (H3ZFCHNO3) contains the entire mission (~3 years) of HIRDLS data...

  3. A novel purification process for dodecanedioic acid by molecular distillation

    Institute of Scientific and Technical Information of China (English)

    Jiang Yu; Xigang Yuan; Aiwu Zeng

    2015-01-01

    A novel purification process is involved to obtain the high purity [N 99%(by mass)] dodecanedioic acid (DC12). It involves a re-crystal ization followed by molecular distil ation from the crude product. The objective of this study is to investigate general conditions, feed rate, distil ing temperature and vacuum, necessary for centrifugal distil-lation of DC12. Under the optimum conditions, distilling temperature 180 °C, pressure 30 Pa and feed flow rate 700 ml·h−1, the purity of DC12 in the residence reached 97.55%with a yield of 53.18%by the analysis of gas chromatography. Multiple-pass distillation made a considerable contribution by improving the purity to 99.22%. Additionally, the effect of pretreatment (re-crystallization) on distillation process was revealed through a series of comparative experiments.

  4. Purification of prostatic acid phosphatase (PAP) for structural and functional studies.

    Science.gov (United States)

    Herrala, Annakaisa M; Quintero, Ileana B; Vihko, Pirkko T

    2013-01-01

    High-scale purification methods are required for several protein studies such as crystallography, mass spectrometry, circular dichroism, and function. Here we describe a purification method for PAP based on anion exchange, L-(+)-tartrate affinity, and gel filtration chromatographies. Acid phosphatase activity and protein concentration were measured for each purification step, and to collect the fractions with the highest acid phosphatase activity the p-nitrophenyl phosphate method was used. The purified protein obtained by the procedure described here was used for the determination of the first reported three-dimensional structure of prostatic acid phosphatase.

  5. Disposition and transportation of surplus radioactive low specific activity nitric acid. Volume 1, Environmental Assessment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-05-01

    DOE is deactivating the PUREX plant at Hanford; this will involve the disposition of about 692,000 liters (183,000 gallons) of surplus nitric acid contaminated with low levels of U and other radionuclides. The nitric acid, designated as low specific activity, is stored in 4 storage tanks at PUREX. Five principal alternatives were evaluated: transfer for reuse (sale to BNF plc), no action, continued storage in Hanford upgraded or new facility, consolidation of DOE surplus acid, and processing the LSA nitric acid as waste. The transfer to BNF plc is the preferred alternative. From the analysis, it is concluded that the proposed disposition and transportation of the acid does not constitute a major federal action significantly affecting the quality of the human environment within the meaning of NEPA; therefore an environmental impact statement is not required.

  6. Proton transfer reactions between nitric acid and acetone, hydroxyacetone, acetaldehyde and benzaldehyde in the solid phase.

    Science.gov (United States)

    Lasne, Jérôme; Laffon, Carine; Parent, Philippe

    2012-12-01

    The heterogeneous and homogeneous reactions of acetone, hydroxyacetone, acetaldehyde and benzaldehyde with solid nitric acid (HNO(3)) films have been studied with Reflection-Absorption Infrared Spectroscopy (RAIRS) under Ultra-High Vacuum (UHV) conditions in the 90-170 K temperature range. In the bulk or at the surface of the films, nitric acid transfers its proton to the carbonyl function of the organic molecules, producing protonated acetone-H(+), hydroxyacetone-H(+), acetaldehyde-H(+) and benzaldehyde-H(+), and nitrate anions NO(3)(-), a reaction not observed when nitric acid is previously hydrated [J. Lasne, C. Laffon and Ph. Parent, Phys. Chem. Chem. Phys., 2012, 14, 697]. This provides a molecular-scale description of the carbonyl protonation reaction in an acid medium, the first step of the acid-catalyzed condensation of carbonyl compounds, fuelling the growth of secondary organic aerosols (SOA) in the atmosphere.

  7. Identification of Patchouli–Chemical Properties on Oil Purification by Using Acid-Activated Bentonite

    National Research Council Canada - National Science Library

    Netty Sri Indeswari

    2015-01-01

    This research is aimed at obtaining –oil chemical properties on purification that include solubility in alcohol, total acid, total ester, Fe Content, Patchouli Alcohol Content, Alpha Copaene (C15H24...

  8. Laboratory studies of 2H evaporator scale dissolution in dilute nitric acid

    Energy Technology Data Exchange (ETDEWEB)

    Oji, L.

    2014-09-23

    The rate of 2H evaporator scale solids dissolution in dilute nitric acid has been experimentally evaluated under laboratory conditions in the SRNL shielded cells. The 2H scale sample used for the dissolution study came from the bottom of the evaporator cone section and the wall section of the evaporator cone. The accumulation rate of aluminum and silicon, assumed to be the two principal elemental constituents of the 2H evaporator scale aluminosilicate mineral, were monitored in solution. Aluminum and silicon concentration changes, with heating time at a constant oven temperature of 90 deg C, were used to ascertain the extent of dissolution of the 2H evaporator scale mineral. The 2H evaporator scale solids, assumed to be composed of mostly aluminosilicate mineral, readily dissolves in 1.5 and 1.25 M dilute nitric acid solutions yielding principal elemental components of aluminum and silicon in solution. The 2H scale dissolution rate constant, based on aluminum accumulation in 1.5 and 1.25 M dilute nitric acid solution are, respectively, 9.21E-04 ± 6.39E-04 min{sup -1} and 1.07E-03 ± 7.51E-05 min{sup -1}. Silicon accumulation rate in solution does track the aluminum accumulation profile during the first few minutes of scale dissolution. It however diverges towards the end of the scale dissolution. This divergence therefore means the aluminum-to-silicon ratio in the first phase of the scale dissolution (non-steady state conditions) is different from the ratio towards the end of the scale dissolution. Possible causes of this change in silicon accumulation in solution as the scale dissolution progresses may include silicon precipitation from solution or the 2H evaporator scale is a heterogeneous mixture of aluminosilicate minerals with several impurities. The average half-life for the decomposition of the 2H evaporator scale mineral in 1.5 M nitric acid is 12.5 hours, while the half-life for the decomposition of the 2H evaporator scale in 1.25 M nitric acid is 10

  9. Extraction equilibrium of indium(III) from nitric acid solutions by di(2-ethylhexyl)phosphoric acid dissolved in kerosene.

    Science.gov (United States)

    Tsai, Hung-Sheng; Tsai, Teh-Hua

    2012-01-04

    The extraction equilibrium of indium(III) from a nitric acid solution using di(2-ethylhexyl) phosphoric acid (D2EHPA) as an acidic extractant of organophosphorus compounds dissolved in kerosene was studied. By graphical and numerical analysis, the compositions of indium-D2EHPA complexes in organic phase and stoichiometry of the extraction reaction were examined. Nitric acid solutions with various indium concentrations at 25 °C were used to obtain the equilibrium constant of InR₃ in the organic phase. The experimental results showed that the extraction distribution ratios of indium(III) between the organic phase and the aqueous solution increased when either the pH value of the aqueous solution and/or the concentration of the organic phase extractant increased. Finally, the recovery efficiency of indium(III) in nitric acid was measured.

  10. Synthesis of /sup 14/C-labeled perfluorooctanoic and perfluorodecanoic acids: purification of perfluorodecanoic acid

    Energy Technology Data Exchange (ETDEWEB)

    Reich, I.L.; Reich, H.J.; Menahan, L.A.; Peterson, R.E.

    1987-10-01

    Perfluoro-n-octanoic acid (PFOA) and perfluoro-n-decanoic acid (PFDA), two widely used industrial products, have been synthesized with /sup 14/C-labeling in the C-1 position. The carboxyl labeled materials were prepared in 48% and 53% yield by carbonation of perfluoroheptyllithium and perfluorononyllithium at -100/sup 0/C. An efficient chemical method for purification of PFDA was also developed. Treatment of commercial PFDA with refluxing potassium hydroxide solution resulted in removal of the mono and diprotio impurities to give 99% pure PFDA.

  11. Identification and purification of novel chlorogenic acids in Artemisia annua L

    Directory of Open Access Journals (Sweden)

    Wenwen Zhao

    2015-10-01

    Full Text Available Present work has been carried out to study the identification and purification of chlorogenic acids in Artemisia annua L. Thirty-six chlorogenic acids were identified from this plant. Among these fifteen viz. two monocaffeoylquinic acids (Mr354, five dicaffeoylquinic acids (Mr516, one feruloylquinic acid (Mr368, three caffeoylferuloylquinic acids (Mr530, two ferulylquinic acids (Mr544, one dimethoxy-cinnamoylquinic acid (Mr382 and one p-coumaroylquinic acid (Mr338 were reported first time in present study by LC/MSn . Cis-isomers of these chlorogenic acids were also identified. Furthermore, column chromatography was used for the separation and purification of these chlorogenic acid; by the use of petroleum ether and ethyl acetate decolorization methods as mentioned in the literature, thus separation and purification process carried out at the same time. Polyamide and dextran were also used to purify Dicaffeoylquinic acid and purity level reached 85.7% with a yield of 53.4% after the secondary purification by Sephadex LH-20. Result of study revealed that A. annua can not only used for the production of artemisinin, but also yielding different kinds of chlorogenic acids, thus making comprehensive utilization of this plant.

  12. Effects of Nitric Acid Concentration on the Stability of Alumina Sols

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Alumina sols with a mlar ratio of 1: 50 between aluminum sec- butoxide ( ASB ) and H2 O werefabricated by adding various amounts of nitric acid.The particle shape, zeta potential, polydispersity and effective particle size of alumina sol were examined by a TEM, a zeta PALS granularity analyzer and a zetaPALS zeta potential analyzer, respectively.By analyzing the change of zeta potential and double- layer thickness with nitric acid concentration, the potential energy curves of colloidal particles were mapped on the basis of DLVO theory, and the effects of nitric acid concentration on the stability of alumina sols were intensively studied.The results show that for the alumina sols with a mol ratio of 1: 50 between ASB and H2 O, the total interaction energy of the colloidal particle is at a maximum when the nitric acid concentration is 0.22 mol/ L.Therefore, the stability of the colloid reaches optimum at the nitric acid concentration of 0.22 mol/L.

  13. Serum uric acid levels and leukocyte nitric oxide production in multiple sclerosis patients outside relapses

    NARCIS (Netherlands)

    Mostert, JP; Ramsaransing, GSM; Heerserna, DJ; Heerings, M; Wilczak, N; De Keyser, J

    2005-01-01

    Background: A number of studies found that patients with multiple sclerosis (MS) have low serum levels of uric acid. It is unclear whether this represents a primary deficit or secondary effect. Uric acid is a scavenger of peroxynitrite, which is the product of nitric oxide (NO) and superoxide. Becau

  14. Batch salicylic acid nitration by nitric acid/acetic acid mixture under isothermal, isoperibolic and adiabatic conditions.

    Science.gov (United States)

    Andreozzi, R; Canterino, M; Caprio, V; Di Somma, I; Sanchirico, R

    2006-12-01

    Runaway phenomena and thermal explosions can originate during the nitration of salicylic acid by means of a nitric acid/acetic acid mixture when the thermal control is lost, mainly as a result of the formation and thermal decomposition of picric acid. The prediction of the behaviour of this system is thus of great importance in view of possible industrial applications and the need to avoid the occurrence of unwanted dangerous events. During a previous investigation a model was developed to simulate its behaviour when the starting concentration of the substrate is too low, thus, preventing the precipitation of poor soluble intermediates. In this work this model is extended to deal with more concentrated systems even in case of a solid phase separating during the process. To this purpose the previously assessed dependence of the solubility of 3-nitro and 5-nitrosalicylic acids upon temperature and nitric acid concentration is included in the model. It is assumed that when 3-nitro and 5-nitrosalicylic acids are partially suspended in the reacting medium a kinetic regime of "dissolution with reaction" is established; that is, the redissolution of these species is a fast process compared to the successive nitration to give dinitroderivatives. Good results are obtained in the comparison of the experimental data with those calculated both in isoperibolic and adiabatic conditions when the revised model is used.

  15. Boronic acid-modified magnetic materials for antibody purification

    Science.gov (United States)

    Dhadge, Vijaykumar L.; Hussain, Abid; Azevedo, Ana M.; Aires-Barros, Raquel; Roque, Ana C. A.

    2014-01-01

    Aminophenyl boronic acids can form reversible covalent ester interactions with cis-diol-containing molecules, serving as a selective tool for binding glycoproteins as antibody molecules that possess oligosaccharides in both the Fv and Fc regions. In this study, amino phenyl boronic acid (APBA) magnetic particles (MPs) were applied for the magnetic separation of antibody molecules. Iron oxide MPs were firstly coated with dextran to avoid non-specific binding and then with 3-glycidyloxypropyl trimethoxysilane to allow further covalent coupling of APBA (APBA_MP). When contacted with pure protein solutions of human IgG (hIgG) and bovine serum albumin (BSA), APBA_MP bound 170 ± 10 mg hIgG g−1 MP and eluted 160 ± 5 mg hIgG g−1 MP, while binding only 15 ± 5 mg BSA g−1 MP. The affinity constant for the interaction between hIgG and APBA_MP was estimated as 4.9 × 105 M−1 (Ka) with a theoretical maximum capacity of 492 mg hIgG adsorbed g−1 MP (Qmax), whereas control particles bound a negligible amount of hIgG and presented an estimated theoretical maximum capacity of 3.1 mg hIgG adsorbed g−1 MP (Qmax). APBA_MPs were also tested for antibody purification directly from CHO cell supernatants. The particles were able to bind 98% of IgG loaded and to recover 95% of pure IgG (purity greater than 98%) at extremely mild conditions. PMID:24258155

  16. Integrating nitric oxide into salicylic acid and jasmonic acid/ethylene plant defense pathways

    DEFF Research Database (Denmark)

    Mur, Luis A J; Prats, Elena; Pierre, Sandra

    2013-01-01

    Plant defence against pests and pathogens is known to be conferred by either salicylic acid (SA) or jasmonic acid (JA)/ethylene (ET) pathways, depending on infection or herbivore-grazing strategy. It is well attested that SA and JA/ET pathways are mutually antagonistic allowing defence responses...... to be tailored to particular biotic stresses. Nitric oxide (NO) has emerged as a major signal influencing resistance mediated by both signalling pathways but no attempt has been made to integrate NO into established SA/JA/ET interactions. NO has been shown to act as an inducer or suppressor of signalling along...... the cytoplasm to reduce TGA activation. In JA biosynthesis, NO will initiate the expression of JA biosynthetic enzymes, presumably to over-come any antagonistic effects of SA on JA-mediated transcription. NO will also initiate the expression of ET biosynthetic genes but a suppressive role is also observed...

  17. Preparation of nitric humic acid by catalytic oxidation from Guizhou coal with catalysts

    Institute of Scientific and Technical Information of China (English)

    Yang Zhiyuan; Gong Liang; Ran Pan

    2012-01-01

    Nitric humic acid was prepared by catalytic oxidation between nitric acid and Guizhou coal,with added catalysts.We investigated catalytic oxidation processes and the factors that affect the reactions.The effects of different catalysts,including NiSO4 support on active carbon (AC-NiSO4),NiSO4 support on silicon dioxide (SiO2-NiSO4),composites of SO42-/Fe2O3,Zr-iron and vanadium-iron composite were studied.As well.we investigated nitric humic acid yields and the chemical structure of products by element analysis,FT-IR and E4/E6 (an absorbance ratio at wavelengths of 465 and 665 nm of humic acid alkaline extraction solutions).The results show that the catalytic oxidation reaction with added catalysts can increase humic acid yields by 18.7%,16.36%,12.94%,5.61% and 8.59%,respectively.The highest yield of humic acid,i.e.,36.0%,was obtained with AC-NiSO4 as the catalyst.The amounts of C and H decreased with the amount of nitrogen.The increase in the E4/E6 ratio in catalytic oxidation of (Guizhou) coal shows that small molecular weights and high yields of nitric humic acid can be obtained by catalytic oxidation reactions.

  18. Observation of gaseous nitric acid production at a high-energy proton accelerator facility

    CERN Document Server

    Kanda, Y; Nakajima, H

    2005-01-01

    High-energy protons and neutrons produce a variety of radionuclides as well as noxious and oxidative gases, such as ozone and nitric acid, in the air mainly through the nuclear spallation of atmospheric elements. Samples were collected from the surfaces of magnets, walls, and floors in the neutrino beamline tunnel and the target station of the KEK 12-GeV proton synchrotron facility by wiping surfaces with filter paper. Considerably good correlations were found between the amounts of nitrate and tritium and between those of nitrate and /sup 7/Be. This finding gives evidence that at high-energy proton facilities, nitric acid is produced in the radiolysis of air in beam- loss regions. Also, the nitric acid on the surfaces was found to be desorbed and tended to be more uniform throughout the tunnel due to air circulation. The magnitude of diminishing from the surfaces was in the order of tritium>nitrate>/sup 7/Be1).

  19. TESTING OF 304L STAINLESS STEEL IN NITRIC ACID ENVIRONMENTS WITH FLUORIDES AND CHLORIDES

    Energy Technology Data Exchange (ETDEWEB)

    Mickalonis, J.

    2010-10-04

    Impure radioactive material processed in nitric acid solutions resulted in the presence of chlorides in a dissolver fabricated from 304L stainless steel. An experimental program was conducted to study the effects of chloride in nitric acid/fluoride solutions on the corrosion of 304L stainless steel. The test variables included temperature (80, 95, and 110 C) and the concentrations of nitric acid (6, 12, and 14 M), fluoride (0.01, 0.1, and 0.2 M) and chloride (100, 350, 1000, and 2000 ppm). The impact of welding was also investigated. Results showed that the chloride concentration alone was not a dominant variable affecting the corrosion, but rather the interaction of chloride with fluoride significantly affected corrosion.

  20. Effect of nitric acid treatment on activated carbon derived from oil palm shell

    Science.gov (United States)

    Allwar, Allwar; Hartati, Retno; Fatimah, Is

    2017-03-01

    The primary object of this work is to study the effect of nitric acid on the porous and morphology structure of activated carbon. Production of activated carbon from oil palm shell was prepared with pyrolysis process at temperature 900°C and by introduction of 10 M nitric acid. Determination of surface area, pore volume and pore size distribution of activated carbon was conducted by the N2 adsorption-desorption isotherm at 77 K. Morphology structure and elemental micro-analysis of activated carbon were estimated by Scanning Electron Microscopy (SEM) and energy dispersive X-ray (EDX), respectively. The result shows that activated carbon after treating with nitric acid proved an increasing porous characteristics involving surface area, pore volume and pore size distribution. It also could remove the contaminants including metals and exhibit an increasing of pores and crevices all over the surface.

  1. Investigation of the direct and indirect electrochemical oxidation of hydrazine in nitric acid medium on platinum; Etude de l`oxydation electrochimique directe et indirecte de l`hydrazine en milieu acide nitrique sur platine

    Energy Technology Data Exchange (ETDEWEB)

    Cames, B

    1997-12-31

    In nuclear fuel processing by the PUREX process, the purification of plutonium in nitric acid medium requires the oxidation of Pu(III) to Pu(IV), and of hydrazinium nitrate to nitrogen. The study helped to characterize the electrochemical behavior of the oxidation of hydrazinium nitrate and the reduction of nitric acid to nitrous acid, a compound which can chemically oxidize hydrazinium nitrate and Pu(III). Electro-analytical studies on polycrystalline platinum showed that hydrazine is oxidized in two potential zones, which depend on the surface texture of the platinum anode. Electrolysis in separate compartments, carried out in medium-acid media (2 and 4 mo/l) in the potential zone where these processes take place, showed that, at 0.9 V/ECS, the hydrazine oxidation reactions involved are: a four-electron process (75 %) with nitrogen formation and a one-electron process (25 %) with formation of nitrogen and ammonium ion. By contrast, electrolysis carried out at 0.65 V/ECS (with reactivation of the electrode at - 0.2 V/ECS to remove the poison from the platinum) allowed the selective oxidation of hydrazine to nitrogen by the four-electron reaction. Nitric acid can only be reduced to nitrous acid in the absence of hydrazine. For medium-acid media ({<=} 6 mol/l), this reaction takes place at potentials below - 0.2 V/ECS. However, the production rate of nitrous acid (partial order 0 with respect to nitric acid) is very low compared with the values obtained for strongly-acid media (6 to 10 mol/l) at the potential of - 0.1 V/ECS. Note that, in concentrated nitric medium, the selectivity of the reduction reaction is 47 to 85 % for nitrous acid, depending on the nitric acid concentration (6 to 10 mol/l) and the potential imposed (- 0.1 {<=} E {<=} 0.6 V/ECS). A kinetic study helped to determine the hydrazine oxidation rates as a function of the operating conditions. In all cases, the reaction rate is of partial order 0 with respect to hydrazine. These studies accordingly

  2. Stabilization and Solidification of Nitric Acid Effluent Waste at Y-12

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Dileep [Argonne National Lab. (ANL), Argonne, IL (United States); Lorenzo-Martin, Cinta [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-12-16

    Consolidated Nuclear Security, LLC (CNS) at the Y-12 plant is investigating approaches for the treatment (stabilization and solidification) of a nitric acid waste effluent that contains uranium. Because the pH of the waste stream is 1-2, it is a difficult waste stream to treat and stabilize by a standard cement-based process. Alternative waste forms are being considered. In this regard, Ceramicrete technology, developed at Argonne National Laboratory, is being explored as an option to solidify and stabilize the nitric acid effluent wastes.

  3. Coextraction of uranium(VI) form nitric acid solutions by N,N—diethyldecanamide and TBP

    Institute of Scientific and Technical Information of China (English)

    SunGuo-Xin; SunSi-Xiu; 等

    1997-01-01

    The partition of uranium(VI) between nitric acid and N,N-diethydecanamide,C9H19CON(C2H5)2,(DEDEA)in kerosene has been investigated at various concentrations of nitric acid,extractant and slating -out agent LiNO3.The mechanism of extraction is discussed in the light of the results obtained.The effect of TBP on the extraction of uranium(VI) with DEDEA has also been considered.There is apparent synergism between these two extractants at low concentration of TBP;however,at higher concentration,distributioin ratio decreases.

  4. OPTIMAL CONTROL OF AUTOCLAVE START MODE IN THE PRODUCTION OF NITRIC ACID

    OpenAIRE

    Ладієва, Леся Ростиславівна; Ширма, А. В.

    2015-01-01

    The algorithm of optimal control of autoclave start mode in the production of nitric acid is proposed. By optimality criterion is selected minimum time-autoclave at preset mode with the restriction on the concentration of nitric acid. End time start mode is entered on the terminal part of the cost function. The method of penalties and a gradient procedure is used to solve the problem. The applied algorithm is allowed to bring an autoclave at a given technological regime.Keywords: production o...

  5. OPTIMAL CONTROL OF AUTOCLAVE START MODE IN THE PRODUCTION OF NITRIC ACID

    OpenAIRE

    Ладієва, Леся Ростиславівна; Ширма, А. В.

    2015-01-01

    The algorithm of optimal control of autoclave start mode in the production of nitric acid is proposed. By optimality criterion is selected minimum time-autoclave at preset mode with the restriction on the concentration of nitric acid. End time start mode is entered on the terminal part of the cost function. The method of penalties and a gradient procedure is used to solve the problem. The applied algorithm is allowed to bring an autoclave at a given technological regime.Keywords: production o...

  6. Material compatibility evaluation for DWPF nitric-glycolic acid-literature review

    Energy Technology Data Exchange (ETDEWEB)

    Mickalonis, J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Skidmore, E. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2013-06-01

    Glycolic acid is being evaluated as an alternative for formic and nitric acid in the DWPF flowsheet. Demonstration testing and modeling for this new flowsheet has shown that glycolic acid and glycolate has a potential to remain in certain streams generated during the production of the nuclear waste glass. A literature review was conducted to assess the impact of glycolic acid on the corrosion of the materials of construction for the DWPF facility as well as facilities downstream which may have residual glycolic acid and glycolates present. The literature data was limited to solutions containing principally glycolic acid.

  7. Gamma radiolytic stability of CyMe4BTBP and the effect of nitric acid

    Directory of Open Access Journals (Sweden)

    Schmidt Holger

    2015-12-01

    Full Text Available The highly selective nitrogen donor ligand CyMe4BTBP for An(III separation by solvent extraction was irradiated in a 60Co γ-source under varying conditions. Organic solutions of 10 mmol/L ligand in 1-octanol were contacted with different concentrations of nitric acid to observe the influence of an aqueous phase during irradiation. In subsequent liquid-liquid extraction experiments, distribution ratios of 241Am and 152Eu were determined. Distribution ratios decreased with increasing absorbed dose when irradiation was performed in the absence of nitric acid. With addition of nitric acid, initial distribution ratios remained constant over the whole examined dose range up to 300 kGy. For qualitative determination of radiolysis products, HPLC-MS measurements were performed. The protective effect of nitric acid was confirmed, since in samples irradiated with acid contact, no degradation products were observed, but only addition products of the 1-octanol molecule to the CyMe4BTBP molecule.

  8. DISSOLUTION OF PLUTONIUM METAL IN 8-10 M NITRIC ACID

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.; Pierce, R.

    2012-02-21

    The H-Canyon facility will be used to dissolve Pu metal for subsequent purification and conversion to plutonium dioxide (PuO{sub 2}) using Phase II of HB-Line. To support the new mission, the development of a Pu metal dissolution flowsheet which utilizes concentrated (8-10 M) nitric acid (HNO{sub 3}) solutions containing potassium fluoride (KF) is required. Dissolution of Pu metal in concentrated HNO{sub 3} is desired to eliminate the need to adjust the solution acidity prior to purification by anion exchange. The preferred flowsheet would use 8-10 M HNO{sub 3}, 0.015-0.07 M KF, and 0.5-1.0 g/L Gd to dissolve the Pu up to 6.75 g/L. An alternate flowsheet would use 8-10 M HNO{sub 3}, 0.1-0.2 M KF, and 1-2 g/L B to dissolve the Pu. The targeted average Pu metal dissolution rate is 20 mg/min-cm{sup 2}, which is sufficient to dissolve a 'standard' 2250-g Pu metal button in 24 h. Plutonium metal dissolution rate measurements showed that if Gd is used as the nuclear poison, the optimum dissolution conditions occur in 10 M HNO{sub 3}, 0.04-0.05 M KF, and 0.5-1.0 g/L Gd at 112 to 116 C (boiling). These conditions will result in an estimated Pu metal dissolution rate of {approx}11-15 mg/min-cm{sup 2} and will result in dissolution times of 36-48 h for standard buttons. The recommended minimum and maximum KF concentrations are 0.03 M and 0.07 M, respectively. The maximum KF concentration is dictated by a potential room-temperature Pu-Gd-F precipitation issue at low Pu concentrations. The purpose of the experimental work described in this report was two-fold. Initially a series of screening experiments was performed to measure the dissolution rate of Pu metal as functions of the HNO{sub 3}, KF, and Gd or B concentrations. The objective of the screening tests was to propose optimized conditions for subsequent flowsheet demonstration tests. Based on the rate measurements, this study found that optimal dissolution conditions in solutions containing 0.5-1.0 g/L Gd

  9. DISSOLUTION OF PLUTONIUM METAL IN 8-10 M NITRIC ACID

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.; Pierce, R.

    2012-02-21

    The H-Canyon facility will be used to dissolve Pu metal for subsequent purification and conversion to plutonium dioxide (PuO{sub 2}) using Phase II of HB-Line. To support the new mission, the development of a Pu metal dissolution flowsheet which utilizes concentrated (8-10 M) nitric acid (HNO{sub 3}) solutions containing potassium fluoride (KF) is required. Dissolution of Pu metal in concentrated HNO{sub 3} is desired to eliminate the need to adjust the solution acidity prior to purification by anion exchange. The preferred flowsheet would use 8-10 M HNO{sub 3}, 0.015-0.07 M KF, and 0.5-1.0 g/L Gd to dissolve the Pu up to 6.75 g/L. An alternate flowsheet would use 8-10 M HNO{sub 3}, 0.1-0.2 M KF, and 1-2 g/L B to dissolve the Pu. The targeted average Pu metal dissolution rate is 20 mg/min-cm{sup 2}, which is sufficient to dissolve a 'standard' 2250-g Pu metal button in 24 h. Plutonium metal dissolution rate measurements showed that if Gd is used as the nuclear poison, the optimum dissolution conditions occur in 10 M HNO{sub 3}, 0.04-0.05 M KF, and 0.5-1.0 g/L Gd at 112 to 116 C (boiling). These conditions will result in an estimated Pu metal dissolution rate of {approx}11-15 mg/min-cm{sup 2} and will result in dissolution times of 36-48 h for standard buttons. The recommended minimum and maximum KF concentrations are 0.03 M and 0.07 M, respectively. The maximum KF concentration is dictated by a potential room-temperature Pu-Gd-F precipitation issue at low Pu concentrations. The purpose of the experimental work described in this report was two-fold. Initially a series of screening experiments was performed to measure the dissolution rate of Pu metal as functions of the HNO{sub 3}, KF, and Gd or B concentrations. The objective of the screening tests was to propose optimized conditions for subsequent flowsheet demonstration tests. Based on the rate measurements, this study found that optimal dissolution conditions in solutions containing 0.5-1.0 g/L Gd

  10. CHARACTERIZATION OF H CANYON CONDUCTIVITY METER INDICATIONS WITH ELEVATED URANIUM IN NITRIC ACID

    Energy Technology Data Exchange (ETDEWEB)

    Nash, C

    2007-10-31

    Solution conductivity data from the 1CU conductivity meter in H-Canyon shows that uranium concentration in the 0 to 30 gram per liter (g/L) range has no statistically significant effect on the calibration of free nitric acid measurement. Based on these results, no additional actions are needed on the 1CU Conductivity Meter prior to or during the processing of uranium solutions in the 0 to 30 g/L range. A model based only on free nitric acid concentration is shown to be appropriate for explaining the data. Data uncertainties for the free acid measurement of uranium-bearing solutions are 8.5% or less at 95% confidence. The analytical uncertainty for calibrating solutions is an order of magnitude smaller only when uranium is not present, allowing use of a more accurate analytical procedure. Literature work shows that at a free nitric acid level of 0.33 M, uranium concentration of 30 g/L and 25 C, solution conductivity is 96.4% of that of a uranium-free solution. The level of uncertainties in the literature data and its fitting equation do not justify calibration changes based on this small depression in solution conductivity. This work supports preparation of H-Canyon processing of Super Kukla fuel; however, the results will be applicable to the processing of any similar concentration uranium and nitric acid solution. Super Kukla fuel processing will increase the uranium concentration above the nominal zero to 10 g/L level, though not above 30 g/L. This work examined free nitric acid levels ranging from 0.18 to 0.52 molar. Temperature ranged from 27.9 to 28.3 C during conductivity testing. The data indicates that sequential order of measurement is not a significant factor. The conductivity meter was thus flushed effectively between measurements as desired.

  11. Research on the Reaction Between Technetium and Hydrazine in Nitric Acid Medium

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The reaction between technetium and hydrazine in nitric acid medium was studied by the titration ofthe concentration of hydrazine and pursuing the concentration of heptavalent technetium along with time.It is approved that the reaction between technetium and hydrazine includes an inducing period, a fast

  12. 77 FR 53144 - Nitric Acid; Exemption From the Requirement of a Tolerance

    Science.gov (United States)

    2012-08-31

    ... followed by pulmonary edema. Acute ingestion of nitric acid may result in ulceration, hemorrhage and... carcinogenicity of nitrate in food or drinking water. There were no treatment related effects observed in the 2... no concern for fetal susceptibility. There were no treatment related effects observed in the 2...

  13. White Paper on Potential Hazards Associated with Contaminated Cheesecloth Exposed to Nitric Acid Solutions

    Energy Technology Data Exchange (ETDEWEB)

    Hypes, Philip A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-09-20

    This white paper addresses the potential hazards associated with waste cheesecloth that has been exposed to nitric acid solutions. This issue was highlighted by the cleanup of a 100 ml leak of aqueous nitric acid solution containing Heat Source (HS) plutonium on 21 June 2016. Nitration of cellulosic material is a well-understood process due to industrial/military applications of the resulting material. Within the Department of Energy complex, nitric acids have been used extensively, as have cellulosic wipes. If cellulosic materials are nitrated, the cellulosic material can become ignitable and in extreme cases, reactive. We have chemistry knowledge and operating experience to support the conclusion that all current wastes are safe and compliant. There are technical questions worthy of further experimental evaluation. An extent of condition evaluation has been conducted back to 2004. During this time period there have been interruptions in the authorization to use cellulosic wipes in PF-4. Limited use has been authorized since 2007 (for purposes other than spill cleanup), so our extent of condition includes the entire current span of use. Our evaluation shows that there is no indication that process spills involving high molarity nitric acid were cleaned up with cheesecloth since 2007. The materials generated in the 21 June leak will be managed in a safe manner compliant with all applicable requirements.

  14. Synthesis and bioactivity of novel nitric oxide-releasing ursolic acid derivatives

    Institute of Scientific and Technical Information of China (English)

    Li Chen; Wen Qiu; Jia Tang; Zhi Feng Wang; Shu Ying He

    2011-01-01

    A series of furoxan-based novel nitric oxide-donating ursolic acid (UA) derivatives (7a-f) were synthesized, and their cytotoxic activities against HepG2 cells in vitro were evaluated by MTT method. It was found that 7a-d and 7f showed more potent cytotoxic activities than control 5-fluorouracil and UA.

  15. TWOPOT: a computer model of the two-pot extractive distillation concept for nitric acid

    Energy Technology Data Exchange (ETDEWEB)

    Jubin, R.T.; Holland, W.D.; Counce, R.M.; Beckwith, D.R.

    1985-05-01

    A mathematical model, TWOPOT, of the ''two-pot'' extractive distillation concept for nitric acid concentration has been developed. Prediction from a computer simulation using this model shows excellent agreement with the experimental data. This model is recommended for use in the design of large-scale, similar-purpose equipment. 9 refs., 15 figs., 2 tabs.

  16. ExoMol molecular line lists: XI The spectrum of nitric acid

    CERN Document Server

    Pavlyuchko, Anatoly I; Tennyson, Jonathan

    2015-01-01

    Nitric acid is a possible biomarker in the atmospheres of exoplanets. An accurate line list of rotational and rotational-vibrational transitions is computed for nitric acid (HNO$_3$). This line list covers wavelengths longer than 1.42 $\\mu$m (0 - 7000 cm$^{-1}$) and temperatures up to 500 K. The line list is computed using a hybrid variational -- perturbation theory and empirically tuned potential energy and dipole surfaces. It comprises almost 7 billion transitions involving rotations up to $J=100$. Comparisons with spectra from the HITRAN and PNNL databases demonstrate the accuracy of our calculations. Synthetic spectra of water - nitric acid mixturessuggest that nitric acid has features at 7.5 and 11.25 $\\mu$m that are capable of providing a clear signature for HNO$_3$; the feature at 11.25 $\\mu$m is particularly promising. Partition functions plus full line lists of transitions are made available in an electronic form as supplementary data to the article and at www.exomol.com.

  17. Dissolution of sludges containing uranium dioxide and metallic uranium in nitric acid

    Energy Technology Data Exchange (ETDEWEB)

    Flament, T.A.

    1998-08-25

    The dissolution in nitric acid of sludges containing uranium oxide and uranium has been modeled. That study has shown that it was necessary to continuously feed the dissolver to have an appropriate control of the reaction. If a unique procedure is deemed preferable, NH03 6M has been used.

  18. Continuous wet denuder measurements of atmospheric nitric and nitrous acids during the 1999 Atlanta Supersite

    NARCIS (Netherlands)

    Genfa, Z.; Slanina, J.; Boring, C.B.; Jongejan, A.C.; Purnendu, K.D.

    2003-01-01

    Two different measurement methods for atmospheric nitric and nitrous acid during the Atlanta Supersite study are described and compared. Both approaches combined wet denuder collection coupled to ion chromatographic analysis. One of these utilized a rotating wet annular denuder maintained indoor wit

  19. Brightening of the global cloud field by nitric acid and the associated radiative forcing

    Directory of Open Access Journals (Sweden)

    R. Makkonen

    2012-08-01

    Full Text Available Clouds cool Earth's climate by reflecting 20% of the incoming solar energy, while also trapping part of the outgoing radiation. The effect of human activities on clouds is poorly understood, but the present-day anthropogenic cooling via changes of cloud albedo and lifetime could be of the same order as warming from anthropogenic addition in CO2. Soluble trace gases can increase water condensation to particles, possibly leading to activation of smaller aerosols and more numerous cloud droplets. We have studied the effect of nitric acid on the aerosol indirect effect with the global aerosol-climate model ECHAM5.5-HAM2. Including the nitric acid effect in the model increases cloud droplet number concentrations globally by 7%. The nitric acid contribution to the present-day cloud albedo effect was found to be −0.32 W m−2 and to the total indirect effect −0.46 W m−2. The contribution to the cloud albedo effect is shown to increase to −0.37 W m−2 by the year 2100, if considering only the reductions in available cloud condensation nuclei. Overall, the effect of nitric acid can play a large part in aerosol cooling during the following decades with decreasing SO2 emissions and increasing NOx and greenhouse gases.

  20. Nitric acid-organic mixtures surveyed for use in separation by anion exchange methods

    Science.gov (United States)

    Bloomquist, C. A. A.; Faris, J. P.; Stewart, D. C.

    1968-01-01

    Column elution-spectrographic analysis technique compares certain solvents directly to the methanol system, using inert rare earths instead of actinides. Distribution ratios for americium between 90 percent solvent, 10 percent 5 M nitric acid and Dowex 1 nitrate form resin for a large group of organics miscible in water was determined.

  1. 77 FR 48433 - New Source Performance Standards Review for Nitric Acid Plants

    Science.gov (United States)

    2012-08-14

    ... standards for nitric acid plants, contact Mr. Nathan Topham, Sector Policies and Program Division, Office of... Industry 325311 Nitrogenous Fertilizer Manufacturing. Federal government Not affected. State/local/tribal... seeking to make such a demonstration to us should submit a Petition for Reconsideration to the Office of...

  2. Photosynthetic and growth responses of Schima superba seedlings to sulfuric and nitric acid depositions.

    Science.gov (United States)

    Yao, Fang-Fang; Ding, Hui-Ming; Feng, Li-Li; Chen, Jing-Jing; Yang, Song-Yu; Wang, Xi-Hua

    2016-05-01

    A continuing rise in acid deposition can cause forest degradation. In China, acid deposition has converted gradually from sulfuric acid deposition (SAD) to nitric acid deposition (NAD). However, the differing responses of photosynthesis and growth to depositions of sulfuric vs. nitric acid have not been well studied. In this study, 1-year-old seedlings of Schima superba, a dominant species in subtropical forests, were treated with two types of acid deposition SO4 (2-)/NO3 (-) ratios (8:1 and 0.7:1) with two applications (foliar spraying and soil drenching) at two pH levels (pH 3.5 and pH 2.5) over a period of 18 months. The results showed that the intensity, acid deposition type, and spraying method had significant effects on the physiological characteristics and growth performance of seedlings. Acid deposition at pH 2.5 via foliar application reduced photosynthesis and growth of S. superba, especially in the first year. Unlike SAD, NAD with high acidity potentially alleviated the negative effects of acidity on physiological properties and growth, probably due to a fertilization effect that improved foliar nitrogen and chlorophyll contents. Our results suggest that trees were damaged mainly by direct acid stress in the short term, whereas in the long term, soil acidification was also likely to be a major risk to forest ecosystems. Our data suggest that the shift in acid deposition type may complicate the ongoing challenge of anthropogenic acid deposition to ecosystem stability.

  3. The Consistency of Isotopologues of Ambient Atmospheric Nitric Acid in Passively Collected Samples

    Science.gov (United States)

    Bell, M. D.; Sickman, J. O.; Bytnerowicz, A.; Padgett, P.; Allen, E. B.

    2012-12-01

    Anthropogenic sources of nitrogen oxides have previously been shown to have distinctive isotopic signatures of oxygen and nitrogen. Nylon filters are currently used in passive sampling arrays to measure ambient atmospheric nitric acid concentrations and estimate deposition rates. This experiment measured the ability of nylon filters to consistently collect isotopologues of atmospheric nitric acid in the same ratios as they are present in the atmosphere. Samplers were deployed in continuous stirred tank reactors (CSTR) and at field sites across a nitrogen deposition gradient in Southern California. Filters were exposed over a four week period with individual filters being subjected to 1-4 week exposure times. Extracted nitric acid were measured for δ18O and δ15N ratios and compared for consistency based on length of exposure and amount of HNO3 collected. Filters within the CSTRs collected HNO3 at a consistent rate in both high and low concentration chambers. After two weeks of exposure, the mean δ18O values were within 0.5‰ of the δ18O of the source HNO3 solution. The mean of all weekly exposures were within 0.5‰ of the δ15N of the source solution, but after three weeks, the mean δ15N of adsorbed HNO3 was within 0.2‰. As the length of the exposure increased, the variability of measured delta values decreased for both elements. The field samplers collected HNO3 consistent with previously measured values along a deposition gradient. The mean δ18O at high deposition sites was 52.2‰ compared to 35.7‰ at the low deposition sites. Mean δ15N values were similar at all sites across the deposition gradient. Due to precipitation events occurring during the exposure period, the δ15N and δ18O of nitric acid were highly variable at all field sites. At single sites, changes in δ15N and δ18O were negatively correlated, consistent with two-sourcing mixing dynamics, but the slope of the regressions differed between high and low deposition sites. Anthropogenic

  4. Influence of Nitric Acid Concentration on Characteristics of Olive Stone Based Activated Carbon

    Institute of Scientific and Technical Information of China (English)

    Nouha Soudani; Souad Souissi-najar; Abdelmottaleb Ouederni

    2013-01-01

    In this work we investigated the effect of nitric acid concentration on the pore structure, surface chemis-try and liquid phase adsorption of olive stone based activated carbon prepared by mixing process using phosphoric acid and steam as activating agents. Chemicals and textural characterization show that the increase of HNO3 con-centration increases considerably the total acidic groups but decreases specific surface area and pore volume. The study of adsorption in aqueous solutions of two organics, phenol and methylene blue, on raw and oxidized activated carbon indicates that the treatment of mixed activated carbon with different concentrations of nitric acid improves the adsorbent capacity for methylene blue at HNO3 concentrations less or equal to 2 mol·L-1, while it has a negative effect on phenol adsorption.

  5. Nitric acid treated multi-walled carbon nanotubes optimized by Taguchi method

    Science.gov (United States)

    Shamsuddin, Shahidah Arina; Derman, Mohd Nazree; Hashim, Uda; Kashif, Muhammad; Adam, Tijjani; Halim, Nur Hamidah Abdul; Tahir, Muhammad Faheem Mohd

    2016-07-01

    Electron transfer rate (ETR) of CNTs can be enhanced by increasing the amounts of COOH groups to their wall and opened tips. With the aim to achieve the highest production amount of COOH, Taguchi robust design has been used for the first time to optimize the surface modification of MWCNTs by nitric acid oxidation. Three main oxidation parameters which are concentration of acid, treatment temperature and treatment time have been selected as the control factors that will be optimized. The amounts of COOH produced are measured by using FTIR spectroscopy through the absorbance intensity. From the analysis, we found that acid concentration and treatment time had the most important influence on the production of COOH. Meanwhile, the treatment temperature will only give intermediate effect. The optimum amount of COOH can be achieved with the treatment by 8.0 M concentration of nitric acid at 120 °C for 2 hour.

  6. Nitric Acid Revamp and Upgrading of the Alarm & Protection Safety System at Petrokemija, Croatia

    Directory of Open Access Journals (Sweden)

    Hoško, I.

    2012-04-01

    Full Text Available Every industrial production, particularly chemical processing, demands special attention in conducting the technological process with regard to the security requirements. For this reason, production processes should be continuously monitored by means of control and alarm safety instrumented systems. In the production of nitric acid at Petrokemija d. d., the original alarm safety system was designed as a combination of an electrical relay safety system and transistorized alarm module system. In order to increase safety requirements and modernize the technological process of nitric acid production, revamping and upgrading of the existing alarm safety system was initiated with a new microprocessor system. The newly derived alarm safety system, Simatic PCS 7, links the function of "classically" distributed control (DCS and logical systems in a common hardware and software platform with integrated engineering tools and operator interface to meet the minimum safety standards with safety integrity level 2 (SIL2 up to level 3 (SIL3, according to IEC 61508 and IEC 61511. This professional paper demonstrates the methodology of upgrading the logic of the alarm safety system in the production of nitric acid in the form of a logical diagram, which was the basis for a further step in its design and construction. Based on the mentioned logical diagram and defined security requirements, the project was implemented in three phases: analysis and testing, installation of the safety equipment and system, and commissioning. Developed also was a verification system of all safety conditions, which could be applied to other facilities for production of nitric acid. With the revamped and upgraded interlock alarm safety system, a new and improved safety boundary in the production of nitric acid was set, which created the foundation for further improvement of the production process in terms of improved analysis.

  7. KINETIC STUDIES ON THE POLYMERIZATION OF ACRYLONITRILE INITIATED BY METALLIC MAGNESIUM-NITRIC ACID SYSTEM

    Institute of Scientific and Technical Information of China (English)

    WU Chinyung

    1983-01-01

    This article reports the polymerization kinetics of acrylonitrile initiated by metallic magnesiumnitric acid system. The rate of polymerization is independent of the amount of magnesium used; when the concentration of nitric acid is higher than acrylonitrile, the equation of polymerization kinetics may be expressed as Rp=1.91 × 105e-15000/RT[Mg]0 [AN]2·2 [HNO3]0·46 The result of copolymerization of acyrlonitrile and methyl acrylate supports a free-radical mechanism.

  8. Integrating nitric oxide into salicylic acid and jasmonic acid/ ethylene plant defense pathways.

    Science.gov (United States)

    Mur, Luis A J; Prats, Elena; Pierre, Sandra; Hall, Michael A; Hebelstrup, Kim H

    2013-01-01

    Plant defense against pests and pathogens is known to be conferred by either salicylic acid (SA) or jasmonic acid (JA)/ethylene (ET) pathways, depending on infection or herbivore-grazing strategy. It is well attested that SA and JA/ET pathways are mutually antagonistic allowing defense responses to be tailored to particular biotic stresses. Nitric oxide (NO) has emerged as a major signal influencing resistance mediated by both signaling pathways but no attempt has been made to integrate NO into established SA/JA/ET interactions. NO has been shown to act as an inducer or suppressor of signaling along each pathway. NO will initiate SA biosynthesis and nitrosylate key cysteines on TGA-class transcription factors to aid in the initiation of SA-dependent gene expression. Against this, S-nitrosylation of NONEXPRESSOR OF PATHOGENESIS-RELATED PROTEINS1 (NPR1) will promote the NPR1 oligomerization within the cytoplasm to reduce TGA activation. In JA biosynthesis, NO will initiate the expression of JA biosynthetic enzymes, presumably to over-come any antagonistic effects of SA on JA-mediated transcription. NO will also initiate the expression of ET biosynthetic genes but a suppressive role is also observed in the S-nitrosylation and inhibition of S-adenosylmethionine transferases which provides methyl groups for ET production. Based on these data a model for NO action is proposed but we have also highlighted the need to understand when and how inductive and suppressive steps are used.

  9. Integrating nitric oxide into salicylic acid and jasmonic acid/ ethylene plant defence pathways.

    Directory of Open Access Journals (Sweden)

    Luis A.J. Mur

    2013-06-01

    Full Text Available Plant defence against pests and pathogens is known to be conferred by either salicylic acid (SA or jasmonic acid (JA/ethylene (ET pathways, depending on infection or herbivore-grazing strategy. It is well attested that SA and JA/ET pathways are mutually antagonistic allowing defence responses to be tailored to particular biotic stresses. Nitric oxide (NO has emerged as a major signal influencing resistance mediated by both signalling pathways but no attempt has been made to integrate NO into established SA/JA/ET interactions. NO has been shown to act as an inducer or suppressor of signalling along each pathway. NO will initiate SA biosynthesis and nitrosylate key cysteines on TGA-class transcription factors to aid in the initiation of SA—dependent gene expression. Against this, S-nitrosylation of NONEXPRESSOR OF PATHOGENESIS-RELATED PROTEINS1 (NPR1 will promote the NPR1 oligomerisation within the cytoplasm to reduce TGA activation. In JA biosynthesis, NO will initiate the expression of JA biosynthetic enzymes, presumably to over-come any antagonistic effects of SA on JA-mediated transcription. NO will also initiate the expression of ET biosynthetic genes but a suppressive role is also observed in the S –nitrosylation and inhibition of s-adenosylmethionine transferases which provides methyl groups for ethylene production. Based on these data a model for NO action is proposed but we have also highlighted the need to understand when and how inductive and suppressive steps are used.

  10. Synergistic effect of Brønsted acid and platinum on purification of automobile exhaust gases.

    Science.gov (United States)

    Fu, Wei; Li, Xin-Hao; Bao, Hong-Liang; Wang, Kai-Xue; Wei, Xiao; Cai, Yi-Yu; Chen, Jie-Sheng

    2013-01-01

    The catalytic purification of automobile exhaust gases (CO, NOx and hydrocarbons) is one of the most practiced conversion processes used to lower the emissions and to reduce the air pollution. Nevertheless, the good performance of exhaust gas purification catalysts often requires the high consumption of noble metals such as platinum. Here we report that the Brønsted acid sites on the external surface of a microporous silicoaluminophosphate (SAPO) act as a promoter for exhaust gas purification, effectively cutting the loading amount of platinum in the catalyst without sacrifice of performance. It is revealed that in the Pt-loaded SAPO-CHA catalyst, there exists a remarkable synergistic effect between the Brønsted acid sites and the Pt nanoparticles, the former helping to adsorb and activate the hydrocarbon molecules for NO reduction during the catalytic process. The thermal stability of SAPO-CHA also makes the composite catalyst stable and reusable without activity decay.

  11. Improvement in electrochemical capacitance of activated carbon from scrap tires by nitric acid treatment

    Science.gov (United States)

    Han, Yan; Zhao, Ping-Ping; Dong, Xiao-Ting; Zhang, Cui; Liu, Shuang-Xi

    2014-12-01

    Activated carbon (AC) obtained from the industrial pyrolytic tire char is treated by concentrated nitric acid (AC-HNO3) and then used as the electrode material for supercapacitors. Surface properties and electrochemical capacitances of AC and ACHNO3 are studied. It is found that the morphology and the porous texture for AC and AC-HNO3 have little difference, while the oxygen content increases and functional groups change after the acid treatment. Electrochemical results demonstrate that the AC-HNO3 electrode displays higher specific capacitance, better stability and cycling performance, and lower equivalent series resistance, indicating that AC obtained from the industrial pyrolytic tire char treated by concentrated nitric acid is applicable for supercapacitors.

  12. Extractive distillation of nitric acid using the two-pot concept

    Energy Technology Data Exchange (ETDEWEB)

    Counce, R.M.; Groenier, W.S.; Holland, W.D.; Jubin, R.T.; North, E.D.; Thompson, L.E. Jr.; Hebble, T.L.

    1982-12-01

    Experiments have confirmed the validity of a novel design for a nitric acid concentration system for use in shielded nuclear fuel reprocessing plants. Current plans for producing the scrub solution for the IODOX process require the concentration and recycle of low strength (< 68.5 wt %) nitric acid sources. The described system utilizes extractive distillation with Mg(NO/sub 3/)/sub 2/ as the solvent and features two pots: an extractive distillation pot in which a concentrated acid product is obtained by contacting the acid feed with the solvent and a solvent recovery pot in which the solvent is dehydrated and recovered for recycle. In these experiments, a concentrated product of 89 wt % nitric acid was produced from azeotropic feed. The available vapor-liquid equilibria data for the Mg(NO/sub 3/)/sub 2/-HNO/sub 3/-H/sub 2/O system has been empirically correlated, and a design methodology has been developed for the two-pot extractive distillation process.

  13. Absorption Behavior of Anion Exchange Resin to Minimal Plutonium in 3 to 4 mol/L Nitric Acid Medium

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>The acidity of liquor in the process of plutonium purification using extraction method is 3 to 4 mol/L and liquor contains minimal plutonium of certain concentration, the reclamation of plutonium is usually

  14. Study of the nitric acid influence on the production of Ce O{sub 2} with high specific surface area; Estudo da influencia do acido nitrico na obtencao de CeO{sub 2} com alta area superficial especifica

    Energy Technology Data Exchange (ETDEWEB)

    Albanez, Nelma Kunrath; Bressiani, Jose Carlos [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    1996-12-31

    The cerium oxide (Ce O{sub 2}) main characteristics for use as catalyst in an exhaust gases purification system are: high specific surface area (approximately 30 m{sup 2}/g after calcination at 800 deg C/ 2 hs), and thermal stability. The Ce O{sub 2} powders obtained by conventional route, i.e., precipitation, and submitted high temperature (800 deg C) heat treatments, showed low specific surface area. In this work nitric acid effects on the Ce O{sub 2} surface area values were investigated. The variables studied were nitric acid concentration, humidity content in the raw material, re pulp after leaching, addition of hydrogen peroxide (H{sub 2} O{sub 2}) and starting material specific surface area. By this process, it was possible to obtain powders with specific surface area larger than 40 m{sup 2}/g, after treatment at 800 deg C during two hours. (author) 8 refs., 3 figs., 1 tab.

  15. Multivariate analysis for quantification of Plutonium (IV) in nitric acid based on absorption spectra

    Energy Technology Data Exchange (ETDEWEB)

    Lines, Amanda M.; Adami, Susan R.; Sinkov, Sergey I.; Lumetta, Gregg J.; Bryan, Samuel A.

    2017-07-20

    Development of more effective, reliable, and fast methods for monitoring process streams is a growing opportunity for analytical applications. Many fields can benefit from on-line monitoring, including the nuclear fuel cycle where improved methods for monitoring radioactive materials will facilitate maintenance of proper safeguards and ensure safe and efficient processing of materials. On-line process monitoring with a focus on optical spectroscopy can provide a fast, non-destructive method for monitoring chemical species. However, identification and quantification of species can be hindered by the complexity of the solutions if bands overlap or show condition-dependent spectral features. Plutonium (IV) is one example of a species which displays significant spectral variation with changing nitric acid concentration. Single variate analysis (i.e. Beer’s Law) is difficult to apply to the quantification of Pu(IV) unless the nitric acid concentration is known and separate calibration curves have been made for all possible acid strengths. Multivariate, or chemometric, analysis is an approach that allows for the accurate quantification of Pu(IV) without a priori knowledge of nitric acid concentration.

  16. Nitric Acid-Treated Carbon Fibers with Enhanced Hydrophilicity for Candida tropicalis Immobilization in Xylitol Fermentation

    Directory of Open Access Journals (Sweden)

    Le Wang

    2016-03-01

    Full Text Available Nitric acid (HNO3-treated carbon fiber (CF rich in hydrophilic groups was applied as a cell-immobilized carrier for xylitol fermentation. Using scanning electron microscopy, we characterized the morphology of the HNO3-treated CF. Additionally, we evaluated the immobilized efficiency (IE of Candida tropicalis and xylitol fermentation yield by investigating the surface properties of nitric acid treated CF, specifically, the acidic group content, zero charge point, degree of moisture and contact angle. We found that adhesion is the major mechanism for cell immobilization and that it is greatly affected by the hydrophilic–hydrophilic surface properties. In our experiments, we found 3 hto be the optimal time for treating CF with nitric acid, resulting in an improved IE of Candida tropicalis of 0.98 g∙g−1 and the highest xylitol yield and volumetric productivity (70.13% and 1.22 g∙L−1∙h−1, respectively. The HNO3-treated CF represents a promising method for preparing biocompatible biocarriers for multi-batch fermentation.

  17. Extraction behaviour of Am(III) and Eu(III) from nitric acid medium in TEHDGA-HDEHP impregnated resins

    Energy Technology Data Exchange (ETDEWEB)

    Saipriya, G.; Kumar, T. [Bhabha Atomic Research Centre Facilities, Kalpakkam (India). Kalpakkam Reprocessing Plant; Kumaresan, R.; Nayak, P.K.; Venkatesan, K.A.; Antony, M.P. [Indira Gandhi Center for Atomic Research, Kalpakkam (India). Fuel Chemistry Div.

    2016-07-01

    The extraction behaviour of Am(III) and Eu(III) from nitric acid medium was studied in the solvent impregnated resins containing extractants such as tetra-bis(2-ethylhexyl)diglycolamide (TEHDGA) or bis-(2-ethylhexyl)phosphoric acid (HDEHP) or mixture of TEHDGA+HDEHP. The rate of extraction of Am(III) and Eu(III) from 1 M nitric acid and the effect of various parameters, such as the concentration of nitric acid in aqueous phase and concentration of TEHDGA and HDEHP in resin phase, on the distribution coefficient of Am(III) and Eu(III) was studied. The distribution coefficient of Am(III) and Eu(III) in HDEHP-impregnated resin decreased and that in TEHDGA-impregnated resin increased, with increase in the concentration of nitric acid. However, in (TEHDGA+HDEHP) - impregnated resin, synergic extraction was observed at lower nitric acid concentration and antagonism at higher nitric acid concentration. The mechanism of Am(III) and Eu(III) extraction in the combined resin was investigated by slope analysis method. The extraction of various metal ions present in the fast reactor simulated high-level liquid waste was studied. The separation factor of Am(III) over Eu(III) was studied using citrate-buffered diethylenetriaminepentaacetic acid (DTPA) solution.

  18. Oleic acid-dependent modulation of Nitric oxide associated 1 protein levels regulates nitric oxide-mediated defense signaling in Arabidopsis

    Science.gov (United States)

    The conserved cellular metabolites nitric oxide (NO) and oleic acid (18:1) are well-known regulators of disease physiologies in diverse organism. We show that NO production in plants is regulated via 18:1. Reduction in 18:1 levels, via a genetic mutation in the 18:1-synthesizing gene SUPPRESSOR OF S...

  19. Evaluation of the Magnesium Hydroxide Treatment Process for Stabilizing PFP Plutonium/Nitric Acid Solutions

    Energy Technology Data Exchange (ETDEWEB)

    Gerber, Mark A.; Schmidt, Andrew J.; Delegard, Calvin H.; Silvers, Kurt L.; Baker, Aaron B.; Gano, Susan R.; Thornton, Brenda M.

    2000-09-28

    This document summarizes an evaluation of the magnesium hydroxide [Mg(OH)2] process to be used at the Hanford Plutonium Finishing Plant (PFP) for stabilizing plutonium/nitric acid solutions to meet the goal of stabilizing the plutonium in an oxide form suitable for storage under DOE-STD-3013-99. During the treatment process, nitric acid solutions bearing plutonium nitrate are neutralized with Mg(OH)2 in an air sparge reactor. The resulting slurry, containing plutonium hydroxide, is filtered and calcined. The process evaluation included a literature review and extensive laboratory- and bench-scale testing. The testing was conducted using cerium as a surrogate for plutonium to identify and quantify the effects of key processing variables on processing time (primarily neutralization and filtration time) and calcined product properties.

  20. Easy synthesis of graphene sheets from alfalfa plants by treatment of nitric acid

    Energy Technology Data Exchange (ETDEWEB)

    Qu, Jiao, E-mail: qujiao@bhu.edu.cn [School of Chemistry and Chemical Engineering, Bohai University, Jinzhou 121013 (China); School of Urban and Environmental Sciences, Northeast Normal University, Changchun 130024 (China); Luo, Chunqiu, E-mail: fplj_lcq@163.com [School of Chemistry and Chemical Engineering, Bohai University, Jinzhou 121013 (China); Zhang, Qian; Cong, Qiao [School of Chemistry and Chemical Engineering, Bohai University, Jinzhou 121013 (China); Yuan, Xing [School of Urban and Environmental Sciences, Northeast Normal University, Changchun 130024 (China)

    2013-04-01

    Highlights: ► An easy method for synthesis of graphene sheets using alfalfa plants was introduced. ► An novelty formation mechanism of graphene sheets using alfalfa plants was proposed. ► This method exploits a new carbon source and provides a novel idea to synthesize graphene sheets. -- Abstract: This letter focuses on synthesis of graphene sheets from alfalfa plants by treatment of nitric acid. The transmission electron microscopy image (TEM) demonstrates that the graphene sheets are agglomerated and overlapped, the energy dispersive spectrum (EDS) indicates that the products are pure, and the Raman spectrum shows the graphene sheets are well graphitized. In addition, the formation mechanism of the graphene sheets from alfalfa plants by treatment nitric acid is discussed. These findings inspire the search for a new strategy for synthesis of graphene sheets from renewable natural products, and the lower cost of this new process and carbon source may facilitate industrial production.

  1. Effect of Different Electrode Materials on the Electropolymerization Process of Aniline in Nitric Acid Media

    Science.gov (United States)

    Li, Yaozong; Yi, Yun; Yang, Weifang; Liu, Xiaoqing; Li, Yuanyuan; Wang, Wei

    2016-11-01

    The electropolymerization process of aniline on different electrode surfaces such as Pt, Au, RuTi and polyaniline film in nitric acid solution containing 1 M aniline was investigated by cyclic voltammetry and electrochemical impedance spectroscopy. Proposed electrical equivalent circuits were used to give a further analysis. Results show that the electrode materials accelerate the aniline electropolymerization remarkably as a catalyst, especially the electrochemical oxidation process of monomer aniline to its cation radical, which is the key step to incur the electropolymerization reaction of aniline on the electrode surface. The polymerization of aniline on RuTi electrode has the lowest reaction resistance for its adsorption sites, and the catalytic effects of these different electrodes decrease in the order: RuTi > polyaniline film > Pt > Au. The results also show that several states of polyaniline films are formed during the potential linear scan process in nitric acid solution and the corresponding oxidation and reduction reaction are reversible.

  2. Effect of Different Electrode Materials on the Electropolymerization Process of Aniline in Nitric Acid Media

    Science.gov (United States)

    Li, Yaozong; Yi, Yun; Yang, Weifang; Liu, Xiaoqing; Li, Yuanyuan; Wang, Wei

    2017-02-01

    The electropolymerization process of aniline on different electrode surfaces such as Pt, Au, RuTi and polyaniline film in nitric acid solution containing 1 M aniline was investigated by cyclic voltammetry and electrochemical impedance spectroscopy. Proposed electrical equivalent circuits were used to give a further analysis. Results show that the electrode materials accelerate the aniline electropolymerization remarkably as a catalyst, especially the electrochemical oxidation process of monomer aniline to its cation radical, which is the key step to incur the electropolymerization reaction of aniline on the electrode surface. The polymerization of aniline on RuTi electrode has the lowest reaction resistance for its adsorption sites, and the catalytic effects of these different electrodes decrease in the order: RuTi > polyaniline film > Pt > Au. The results also show that several states of polyaniline films are formed during the potential linear scan process in nitric acid solution and the corresponding oxidation and reduction reaction are reversible.

  3. Passive Sampler for Measurements of Atmospheric Nitric Acid Vapor (HNO3 Concentrations

    Directory of Open Access Journals (Sweden)

    Andrzej Bytnerowicz

    2001-01-01

    Full Text Available Nitric acid (HNO3 vapor is an important nitrogenous air pollutant responsible for increasing saturation of forests with nitrogen and direct injury to plants. The USDA Forest Service and University of California researchers have developed a simple and inexpensive passive sampler for monitoring air concentrations of HNO3. Nitric acid is selectively absorbed on 47-mm Nylasorb nylon filters with no interference from particulate NO3-. Concentrations determined with the passive samplers closely corresponded with those measured with the co-located honeycomb annular denuder systems. The PVC protective caps of standardized dimensions protect nylon filters from rain and wind and allow for reliable measurements of ambient HNO3 concentrations. The described samplers have been successfully used in Sequoia National Park, the San Bernardino Mountains, and on Mammoth Mountain in California.

  4. Procedure of Destructive Chemical Recovery of Precious Metals in Nitric Acid Production

    OpenAIRE

    Ljubičić, M.; Zečević, N.

    2012-01-01

    The heart of the nitric acid production process is the chemical reactor containing a platinum-based catalyst pack and an associated catchment system, which allows the ammonia oxidation reaction to take place efficiently. Under the severe operating conditions imposed by the high-pressure ammonia oxidation process, the catalyst gauzes experience progressive deterioration, as shown by the restricted surface of the catalyst wires, the loss of catalytic activity and the loss of catalytic materials...

  5. Study on the Reaction Between Methyl Hydrazine and Formaldehyde in Nitric Acid Medium

    Institute of Scientific and Technical Information of China (English)

    LI; Chuan-bo; CAO; Zhi; BIAN; Xiao-yan; XIAN; Liang; YAN; Tai-hong; ZHENG; Wei-fang

    2012-01-01

    <正>To make sure whether the reaction between formaldehyde and methyl hydrazine (MMH) could happen in dilute nitric acid solution, the condensation reaction between the two ones was investigated at 16 ℃. The reaction was slow and it took over 5 hours to reach the balance and the solution turned yellow at last. The maximum absorption peaks of the product existed at 340 nm and 400-450 nm, respectively.

  6. Search for an in-line nitric acid analyzer

    Energy Technology Data Exchange (ETDEWEB)

    Gallagher, K. Y.; Johnson, C. M.

    1980-10-01

    A literature search was conducted to identify possible techniques for measuring mineral acid normality in the presence of heavy metal salts, undissolved solids, and high radiation fields. Of the techniques noted, eight were identified that could be applicable to the objective. The possibilities were reduced to two methods, which warrant further investigation. These two are refractometry and a modified coulometric-polarographic method. All methods are discussed in detail followed by rationale for including or rejecting each for further investigation.

  7. An efficient process for production and purification of hyaluronic acid from Streptococcus equi subsp. zooepidemicus.

    Science.gov (United States)

    Rangaswamy, Vidhya; Jain, Dharmendra

    2008-03-01

    Growth of Streptococcus zooepidemicus in a 10 l bioreactor with 50 g sucrose/l and 10 g casein hydrolysate/l gave 5-6 g hyaluronic acid/l after 24-28 h. Purification of hyaluronic acid gave a recovery of 65% with the final material having an Mr of approximately 4 x 10(6) Da with less than 0.1% protein.

  8. Evaluation of alternatives for human lysozyme purification from transgenic rice: impact of phytic acid and buffer.

    Science.gov (United States)

    Wilken, Lisa R; Nikolov, Zivko L

    2010-01-01

    Producing economically competitive recombinant human lysozyme from transgenic rice demands an inexpensive purification process for nonpharmaceutical applications. Human lysozyme is a basic protein, and thus, cation exchange chromatography was the selected method for lysozyme purification. Similar to other protein production systems, the identification of critical impurities in the rice extract was important for the development of an efficient purification process. Previous adsorption data indicated that phytic acid was probably responsible for an unacceptably low cation exchange adsorption capacity. In this study, we confirm that reducing phytic acid concentration improves lysozyme binding capacity and investigate alternative process conditions that reduce phytic acid interference. Compared with the previous best process, the adsorption capacity of human lysozyme was increased from 8.6 to 19.7 mg/mL when rice extract was treated with phytase to degrade phytic acid. Using tris buffer to adjust pH 4.5 extract to pH 6 before adsorption reduced phytic acid interference by minimizing phytic acid-lysozyme interactions, eliminated the need for phytase treatment, and increased the binding capacity to 25 mg/mL. Another method of reducing phytic acid concentration was to extract human lysozyme from rice flour at pH 10 with 50 mM NaCl in 50 mM sodium carbonate buffer. A similar binding capacity (25.5 mg/mL) was achieved from pH 10 extract that was clarified by acidic precipitation and adjusted to pH 6 for adsorption. Lysozyme purities ranged from 95 to 98% for all three processing methods. The tris-mediated purification was the most efficient of the alternatives considered.

  9. Extraction behaviour of Am(III) and Eu(III) from nitric acid medium in CMPO-HDEHP impregnated resins

    Energy Technology Data Exchange (ETDEWEB)

    Saipriya, K.; Kumar, T. [Bhabha Atomic Research Centre Facilities (India). Kalpakkam Reproscessing Plants; Kumaresan, R.; Nayak, P.K.; Venkatesan, K.A.; Antony, M.P. [Indira Gandhi Center for Atomic Research, Kalpakkam (India). Fuel Chemistry Div.

    2016-05-01

    Chromatographic resin containing extractants such as octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) or bis-(2-ethylhexyl)phosphoric acid (HDEHP) or mixture of extractants (CMPO + HDEHP) in an acrylic polymer matrix was prepared and studied for the extraction of Am(III) and Eu(III) over a range of nitric acid concentration. The effect of various parameters such as concentration of nitric acid in aqueous phase and the concentration of CMPO and HDEHP in the resin phase was studied. The distribution coefficient of Am(III) and Eu(III) in the impregnated resin increased with increased in the concentration of nitric acid for CMPO-impregnated resin, whereas a reverse trend was observed in HDEHP impregnated resin. In case of resin containing both the extractants, synergism was observed at low nitric acid concentration and antagonism at high nitric acid concentration. The mechanism of extraction was probed by slope analysis method at 0.01 and 2 M nitric acid concentrations. Citrate-buffered DTPA was used for the selective separation of Am(III), and a separation factor of 3-4 was obtained at pH 3.

  10. Quantitative analysis of mixed hydrofluoric and nitric acids using Raman spectroscopy with partial least squares regression.

    Science.gov (United States)

    Kang, Gumin; Lee, Kwangchil; Park, Haesung; Lee, Jinho; Jung, Youngjean; Kim, Kyoungsik; Son, Boongho; Park, Hyoungkuk

    2010-06-15

    Mixed hydrofluoric and nitric acids are widely used as a good etchant for the pickling process of stainless steels. The cost reduction and the procedure optimization in the manufacturing process can be facilitated by optically detecting the concentration of the mixed acids. In this work, we developed a novel method which allows us to obtain the concentrations of hydrofluoric acid (HF) and nitric acid (HNO(3)) mixture samples with high accuracy. The experiments were carried out for the mixed acids which consist of the HF (0.5-3wt%) and the HNO(3) (2-12wt%) at room temperature. Fourier Transform Raman spectroscopy has been utilized to measure the concentration of the mixed acids HF and HNO(3), because the mixture sample has several strong Raman bands caused by the vibrational mode of each acid in this spectrum. The calibration of spectral data has been performed using the partial least squares regression method which is ideal for local range data treatment. Several figures of merit (FOM) were calculated using the concept of net analyte signal (NAS) to evaluate performance of our methodology.

  11. Kinetics of Reaction Between Tc(Ⅶ) and Monomethylhydrazine or Dimethylhydroxylamine in Nitric Acid Medium Containing Plutonium

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>The chemical reaction kinetics research of Tc(Ⅶ) with monomethylhydrazine or dimethylhydroxy-lamine in nitric acid medium demonstrated that Tc(Ⅶ) hardly reacts with the salt-free reagents during the

  12. Thermal decomposition of organic solvent with nitric acid in nuclear fuel reprocessing plants

    Energy Technology Data Exchange (ETDEWEB)

    Koike, Tadao; Nishio, Gunji; Takada, Junichi; Tukamoto, Michio; Watanabe, Kouji [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Miyata, Sadaichirou

    1995-02-01

    Since a thermal decomposition of organic solvent containing TBP (tributyl phosphate) with nitric acid and heavy metal nitrates is an exothermic reaction, it is possible to cause an explosive decomposition of TBP-complex materials formed by a nitration between the solvent and nitric acid, if the solvent involving TBP-complex is heated upto a thermal limit in an evaporator to concentrate a fuel liquid solution from the extraction process in the reprocessing plant. In JAERI, the demonstration test for explosive decomposition of TBP-complex by the nitration was performed to elucidate the safety margin of the evaporator in the event of hypothetical explosion under auspices of the Science and Technology Agency. The demonstration test was carried out by heating TBP/n-dodecane solvent mixed with nitric acid and uranium nitrate. In the test, the thermal decomposition behavior of the solvent was examined, and also a kinematic reaction constant and a heat formation of the TBP-complex decomposition were measured by the test. In the paper, a safety analysis of a model evaporator was conducted during accidental conditions under the explosive decomposition of the solvent. (author).

  13. Supercritical fluid extraction of uranium and thorium from nitric acid medium using organophosphorous compounds

    Energy Technology Data Exchange (ETDEWEB)

    Pitchaiah, K.C.; Sujatha, K.; Rao, C.V.S. Brahmmananda; Subramaniam, S.; Sivaraman, N.; Rao, P.R. Vasudeva [Indira Gandhi Centre for Atomic Research, Kalpakkam (India). Chemistry Group

    2015-06-01

    In recent years, Supercritical Fluid Extraction (SFE) technique has been widely used for the extraction of metal ions. In the present study, extraction of uranium from nitric acid medium was investigated using supercritical carbon dioxide (Sc-CO{sub 2}) containing various organophosphorous compounds such as trialkyl phosphates e.g. tri-iso-amyl phosphate (TiAP), tri-sec-butyl phosphate (TsBP) and tri-n-butyl phosphate (TBP), dialkylalkyl phosphonates, e.g. diamylamyl phosphonate (DAAP) and dibutyl butyl phosphonate (DBBP), dialkyl hydrogen phosphonates, e.g. dioctyl hydrogen phosphonate (DOHP), dioctylphosphineoxide (DOPO), trioctyl phosphine oxide (TOPO), n-octylphenyl N,N-diisobutyl carbamoylmethylphosphine oxide (CMPO) and di-2-ethyl-hexyl phosphoric acid (HDEHP). Some of these ligands have been investigated for the first time in the supercritical phase for the extraction of uranium. The extraction efficiency of uranium was studied with TiAP, DAAP and DBBP as a function of nitric acid concentration; the kinetics of the equilibration period (static extraction) and transportation of the metal complex (dynamic extraction) was investigated. The influence of pressure and temperature on the extraction behaviour of uranium with DAAP was studied from 4 N HNO{sub 3}. The extraction efficiency of uranium from 4 N nitric acid medium was found to increase in the order of phosphates < phosphonates < HDEHP < TOPO < CMPO. In the case of phosphates and phosphonates, the maximum extraction of uranium was found to be from 4 N HNO{sub 3} medium. The acidic extractants, HDEHP and DOHP showed relatively higher extraction at lower acidities. The relative extraction of uranium and thorium from their mixture was also examined using Sc-CO{sub 2} containing phosphates, phosphonates and TOPO. The ligand, TsBP provided better fractionation between uranium and thorium compared to trialkyl phosphates, dialkyl alkyl phosphonates and TOPO.

  14. Comparison of Methods for the Purification of Alpha-1 Acid Glycoprotein from Human Plasma

    Directory of Open Access Journals (Sweden)

    Teresa R. McCurdy

    2011-01-01

    Full Text Available Alpha-1 acid glycoprotein (AGP is a highly glycosylated, negatively charged plasma protein suggested to have anti-inflammatory and/or immunomodulatory activities. Purification of AGP could be simplified if methods that exploit its high solubility under chemically harsh conditions could be demonstrated to leave the protein in its native conformation. Procedures involving exposure of AGP to hot phenol or sulphosalicylic acid (SSA were compared to solely chromatographic methods. Hot phenol-purified AGP was more rapidly cleared from mice in vivo following intravenous injection than chromatographically purified AGP. In contrast, SSA-purified AGP demonstrated an identical in vivo clearance profile and circular dichroism spectrum to chromatographically purified AGP. Similarly, no differences in susceptibility to enzymatic deglycosylation or reactivity with Sambucus nigra lectin were detected between AGP purified via the two methods. Incorporation of the SSA step in the purification scheme for AGP eliminated the need for a large (4 mL resin/mL of plasma initial chromatographic step and simplified its purification without causing any detectable distortion in the conformation of the protein. Confirmation that this procedure is nondenaturing will simplify AGP purification and investigation of its possible biological roles in laboratory animals.

  15. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Energy Technology Data Exchange (ETDEWEB)

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  16. Purification and properties of an acid phosphatase from Entamoeba histolytica HM-1:IMSS.

    Science.gov (United States)

    Aguirre-García, M M; Cerbón, J; Talamás-Rohana, P

    2000-04-24

    Entamoeba histolytica contains and secretes acid phosphatase, which has been proposed as a virulence factor in some pathogenic microorganisms. In this work, we purified and characterised a membrane-bound acid phosphatase (MAP) from E. histolytica HM-1:IMSS and studied the effect of different chemical compounds on the secreted acid phosphatase and MAP activities. MAP purification was accomplished by detergent solubilisation, and affinity and ion exchange chromatographies. The enzyme showed a pI of 5.5-6.2, an optimum pH of 5.5, and a Km value of 1.14 mM with p-nitrophenyl phosphate.

  17. A sialic acid assay in isolation and purification of bovine k-casein glycomacropeptide: a review.

    Science.gov (United States)

    Nakano, Takuo; Ozimek, Lech

    2014-01-01

    Sialic acid is a carbohydrate moiety of k-casein glycomacropeptide (GMP), which is a 64 amino acid residue C-terminal sialylated phosphorylated glycopeptide released from k-casein by the action of chymosin during cheese making. GMP lacks aromatic amino acids including phenylalanine, tyrosine, and tryptophan. Because of its unique amino acid composition and various biological activities, GMP is thought to be a potential ingredient for dietetic foods (e.g., a food for PKU patients) and pharmaceuticals. Thus, increased attention has been given to the development of techniques to purify GMP. In this review, techniques of GMP purification described in patents and scientific research papers were introduced. A sialic acid assay is the important method to track GMP isolation and purification processes, for which the thiobarbituric acid reaction with 1-propanol as a chromophore extracting solvent is an inexpensive, practical and specific technique. Sephacryl S-200 gel filtration chromatography, cellulose acetate electrophoresis, and sodium dodecyl sulfate polyacrylamide gel electrophoresis are the major techniques to identify sialic acid specific to GMP. Sephacryl S-200 chromatography and cellulose acetate electrophoresis are also used to detect GMP sialic acid in whey pearmeate and whey added commercial margarine samples. Future research includes development of an economical industrial scale method to produce high purity GMP.

  18. Studies of iso-alpha-acids : analysis, purification, and stability.

    NARCIS (Netherlands)

    Khatib, Alfi

    2006-01-01

    The female cones of hop (Humulus lupulus L.) are added to beer, providing taste and flavour and contributing to the stability of foam. The main constituents of hop related to these properties are generically known as alpha-acids. During the brewing process, these acids are isomerized, resulting in

  19. Studies of iso-alpha-acids : analysis, purification, and stability.

    NARCIS (Netherlands)

    Khatib, Alfi

    2006-01-01

    The female cones of hop (Humulus lupulus L.) are added to beer, providing taste and flavour and contributing to the stability of foam. The main constituents of hop related to these properties are generically known as alpha-acids. During the brewing process, these acids are isomerized, resulting in t

  20. Extracellular acid protease from Aspergillus niger I1: purification and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-09-15

    Sep 15, 2009 ... Proteases with high activity and stability in acid pH range have .... at a flow rate of 25 ml/h after elution with the same buffer. Protein content (abs. at ..... Role of the hydrophobic amino acid residue in the bitterness of peptides.

  1. Sludge batch 9 simulant runs using the nitric-glycolic acid flowsheet

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, D. P. [Savannah River Site (SRS), Aiken, SC (United States); Williams, M. S. [Savannah River Site (SRS), Aiken, SC (United States); Brandenburg, C. H. [Savannah River Site (SRS), Aiken, SC (United States); Luther, M. C. [Savannah River Site (SRS), Aiken, SC (United States); Newell, J. D. [Savannah River Site (SRS), Aiken, SC (United States); Woodham, W. H. [Savannah River Site (SRS), Aiken, SC (United States)

    2016-11-01

    Testing was completed to develop a Sludge Batch 9 (SB9) nitric-glycolic acid chemical process flowsheet for the Defense Waste Processing Facility’s (DWPF) Chemical Process Cell (CPC). CPC simulations were completed using SB9 sludge simulant, Strip Effluent Feed Tank (SEFT) simulant and Precipitate Reactor Feed Tank (PRFT) simulant. Ten sludge-only Sludge Receipt and Adjustment Tank (SRAT) cycles and four SRAT/Slurry Mix Evaporator (SME) cycles, and one actual SB9 sludge (SRAT/SME cycle) were completed. As has been demonstrated in over 100 simulations, the replacement of formic acid with glycolic acid virtually eliminates the CPC’s largest flammability hazards, hydrogen and ammonia. Recommended processing conditions are summarized in section 3.5.1. Testing demonstrated that the interim chemistry and Reduction/Oxidation (REDOX) equations are sufficient to predict the composition of DWPF SRAT product and SME product. Additional reports will finalize the chemistry and REDOX equations. Additional testing developed an antifoam strategy to minimize the hexamethyldisiloxane (HMDSO) peak at boiling, while controlling foam based on testing with simulant and actual waste. Implementation of the nitric-glycolic acid flowsheet in DWPF is recommended. This flowsheet not only eliminates the hydrogen and ammonia hazards but will lead to shorter processing times, higher elemental mercury recovery, and more concentrated SRAT and SME products. The steady pH profile is expected to provide flexibility in processing the high volume of strip effluent expected once the Salt Waste Processing Facility starts up.

  2. Coordination leaching of tungsten from scheelite concentrate with phosphorus in nitric acid

    Institute of Scientific and Technical Information of China (English)

    张文娟; 杨金洪; 赵中伟; 王文强; 李江涛

    2016-01-01

    A hydrometallurgical process for tungsten extraction and recovery from scheelite is reported. The technology includes leaching scheelite using phosphoric acid as chelating agent in nitric acid solutions, extracting tungsten by solvent extraction and reusing leaching agent. In the leaching process, affecting factors, such as temperature, leaching time, nitric acid and dosage of phosphoric acid, were examined on recovery of tungsten. Results show that more than 97% of tungsten could be extracted under conditions of leaching temperature of 80−90 °C, HNO3 concentration of 3.0−4.0 mol/L, liquild-to-soild ratio of 10:1, H3PO4 dosage of 3 stoichiometric ratio and leaching time of 3 h. Solvent extraction was then employed for the W recovery from the leachate with a organic system of 40%(v/v) N235, 30%(v/v) TBP, and 30%sulfonated kerosene. Approximately 99.93%of W was extracted and ammonium tungstate solution containing 193 g/L W was obtained with a stripping rate of 98.10%under the optimized conditions.

  3. FY13 GLYCOLIC-NITRIC ACID FLOWSHEET DEMONSTRATIONS OF THE DWPF CHEMICAL PROCESS CELL WITH SIMULANTS

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, D.; Zamecnik, J.; Best, D.

    2014-03-13

    Savannah River Remediation is evaluating changes to its current Defense Waste Processing Facility flowsheet to replace formic acid with glycolic acid in order to improve processing cycle times and decrease by approximately 100x the production of hydrogen, a potentially flammable gas. Higher throughput is needed in the Chemical Processing Cell since the installation of the bubblers into the melter has increased melt rate. Due to the significant maintenance required for the safety significant gas chromatographs and the potential for production of flammable quantities of hydrogen, eliminating the use of formic acid is highly desirable. Previous testing at the Savannah River National Laboratory has shown that replacing formic acid with glycolic acid allows the reduction and removal of mercury without significant catalytic hydrogen generation. Five back-to-back Sludge Receipt and Adjustment Tank (SRAT) cycles and four back-to-back Slurry Mix Evaporator (SME) cycles were successful in demonstrating the viability of the nitric/glycolic acid flowsheet. The testing was completed in FY13 to determine the impact of process heels (approximately 25% of the material is left behind after transfers). In addition, back-to-back experiments might identify longer-term processing problems. The testing was designed to be prototypic by including sludge simulant, Actinide Removal Product simulant, nitric acid, glycolic acid, and Strip Effluent simulant containing Next Generation Solvent in the SRAT processing and SRAT product simulant, decontamination frit slurry, and process frit slurry in the SME processing. A heel was produced in the first cycle and each subsequent cycle utilized the remaining heel from the previous cycle. Lower SRAT purges were utilized due to the low hydrogen generation. Design basis addition rates and boilup rates were used so the processing time was shorter than current processing rates.

  4. Nitric Acid Dehydration Using Perfluoro Carboxylate and Mixed Sulfonate/Carboxylate Membranes

    Energy Technology Data Exchange (ETDEWEB)

    Ames, Richard L. [Colorado School of Mines, Golden, CO (United States)

    2004-09-01

    Perfluoro ionomer membranes are tetrafluoro ethylene-based materials with microheterogeneous structures consisting of a hydrophobic polymer backbone and a hydrophilic side-chain cluster region. Due to the ionomer cluster morphology, these films exhibit unique transport properties. Recent investigations with perfluoro sulfonate and perfluoro sulfonate/carboxylate composite polymers have demonstrated their value in the dehydration of nitric acid and they show potential as an alternative to conventional, energy intensive unit operations in the concentration of acid feeds. As a result, investigations were conducted to determine the feasibility of using pure perfluoro carboxylate and mixed perfluoro sulfonate/carboxylate films for the dehydration of nitric acid because of the speculation of improved water selectivity of the carboxylate pendant chain. During the first phase of these investigations the effort was focused on generating a thin, solution cast perfluoro carboxylate ionomer film, to evaluate the general, chemical and physical characteristics of the polymer, and to assess the material's aqueous transport performance (flux and nitrate separation efficiencies) in pervaporation and high-pressure environments. Results demonstrated that generating robust solution-cast films was difficult yet a number of membranes survived high trans-membrane pressures up to 700 psig. General characterization of the solution cast product showed reduced ion exchange capacities when compared with thicker, ''as received'' perfluoro carboxylate and similar sulfonate films. Small angle x-ray scattering analysis results suggested that the solution cast carboxylate films contained a small fraction of sulfonate terminated side-chains. Aqueous transport experimentation showed that permeate fluxes for both pure water and nitric acid were approximately two orders of magnitude smaller for the carboxylate solution cast membranes when compared to their sulfonate

  5. Phosphoric acid purification by suspension melt crystallization: Parametric study of the crystallization and sweating steps

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Baoming; Li, Jun; Qi, Yabing; Jia, Xuhong; Luo, Jianhong [Department of Chemical Engineering, Sichuan University, Chengdu 610065 (China)

    2012-10-15

    In order to purify phosphoric acid, the suspension melt crystallization process was studied. The suspension crystallization experiments were carried out with 80, 84 and 88 wt% phosphoric acid melt at the cooling rates of 0.05, 0.1 and 0.2 K/min, respectively. Sweating experiments were executed for various crystals obtained in suspension crystallization step. The purification effects of the sweating parameters including sweating time, initial inclusion amount and initial impurity content were studied. The inclusion fraction increases with the increase in cooling rate. The inclusion fraction of the crystals which were formed with feed concentration of 84 wt% phosphoric acid melt is lowest among the three feed concentrations. Different impurities have different purification performances during sweating. High inclusion amount and low impurity concentration favor the purification of H{sub 3}PO{sub 4}.0.5H{sub 2}O crystals during sweating. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Trans fatty acids induce vascular inflammation and reduce vascular nitric oxide production in endothelial cells.

    Directory of Open Access Journals (Sweden)

    Naomi G Iwata

    Full Text Available Intake of trans fatty acids (TFA, which are consumed by eating foods made from partially hydrogenated vegetable oils, is associated with a higher risk of cardiovascular disease. This relation can be explained by many factors including TFA's negative effect on endothelial function and reduced nitric oxide (NO bioavailability. In this study we investigated the effects of three different TFA (2 common isomers of C18 found in partially hydrogenated vegetable oil and a C18 isomer found from ruminant-derived-dairy products and meat on endothelial NF-κB activation and nitric oxide (NO production. Human endothelial cells were treated with increasing concentrations of Elaidic (trans-C18:1 (9 trans, Linoelaidic (trans-C18:2 (9 trans, 12 trans, and Transvaccenic (trans-C18:1 (11 trans for 3 h. Both Elaidic and Linoelaidic acids were associated with increasing NF-κB activation as measured by IL-6 levels and phosphorylation of IκBα, and impairment of endothelial insulin signaling and NO production, whereas Transvaccenic acid was not associated with these responses. We also measured superoxide production, which has been hypothesized to be necessary in fatty acid-dependent activation of NF-κB. Both Elaidic acid and Linoelaidic acid are associated with increased superoxide production, whereas Transvaccenic acid (which did not induce inflammatory responses did not increase superoxide production. We observed differential activation of endothelial superoxide production, NF-κB activation, and reduction in NO production by different C18 isomers suggesting that the location and number of trans double bonds effect endothelial NF-κB activation.

  7. Development of ion-exchange properties of bamboo charcoal modified with concentrated nitric acid

    Science.gov (United States)

    Khandaker, S.; Kuba, T.; Toyohara, Y.; Kamida, S.; Uchikawa, Y.

    2017-08-01

    The surface chemistry and the structural properties of activated carbon can be altered by the acidic modification. The objective of this study is to investigate the changes occurring in bamboo charcoal (BC) during activation with concentrated nitric acid. Low temperature (500°C) carbonized BC has been prepared and oxidized with 70% concentrated boiling nitric acid (BC-AC). The porous properties of the BC are analyzed with nitrogen adsorption isotherm at 77 K. The surface structure is observed by Field emission scanning electronic microscope (FESEM) and the surface functional groups are examined by Fourier transform infrared (FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and the pH of the point of zero charge (pHPZC). The results reveal that severe oxidation with HNO3 considerably decreases the surface area of BC with enhanced pore widening and FESEM observation demonstrates the erosive effect of oxidation. The FTIR analysis detects that some absorption bands are assigned for carboxyl, aldehyde and ketone groups on BC-AC. The XPS analysis also clearly shows that the ratio of oxygen and acidic functional groups has been enriched significantly on the BC-AC. The low pHPZC value of BC-AC confirms that the surface is highly acidic for the fixation of acidic functional groups on surface. In general, the existence of the abundant amount of acidic functional groups on adsorbents enhances the sorption of heavy metals ions in aqueous solution. Therefore, it is strongly expected that the modified BC, activated under the proposed conditions would be a promising ion exchanger in aqueous solution and can be applied for the adsorption of different heavy metal ions and radioactive materials from effluent.

  8. Extraction of rare earth elements from a contaminated cropland soil using nitric acid, citric acid, and EDTA.

    Science.gov (United States)

    Tang, Hailong; Shuai, Weitao; Wang, Xiaojing; Liu, Yangsheng

    2017-08-01

    Rare earth elements (REEs) contamination to the surrounding soil has increased the concerns of health risk to the local residents. Soil washing was first attempted in our study to remediate REEs-contaminated cropland soil using nitric acid, citric acid, and ethylene diamine tetraacetic acid (EDTA) for soil decontamination and possible recovery of REEs. The extraction time, washing agent concentration, and pH value of the washing solution were optimized. The sequential extraction analysis proposed by Tessier was adopted to study the speciation changes of the REEs before and after soil washing. The extract containing citric acid was dried to obtain solid for the X-ray fluorescence (XRF) analysis. The results revealed that the optimal extraction time was 72 h, and the REEs extraction efficiency increased as the agent concentration increased from 0.01 to 0.1 mol/L. EDTA was efficient to extract REEs over a wide range of pH values, while citric acid was around pH 6.0. Under optimized conditions, the average extraction efficiencies of the major REEs in the contaminated soil were 70.96%, 64.38%, and 62.12% by EDTA, nitric acid, and citric acid, respectively. The sequential extraction analyses revealed that most soil-bounded REEs were mobilized or extracted except for those in the residual fraction. Under a comprehensive consideration of the extraction efficiency and the environmental impact, citric acid was recommended as the most suitable agent for extraction of the REEs from the contaminated cropland soils. The XRF analysis revealed that Mn, Al, Si, Pb, Fe, and REEs were the major elements in the extract indicating a possibile recovery of the REEs.

  9. Direct Synthesis of Phenol from Benzene on an Activated Carbon Catalyst Treated with Nitric Acid

    Institute of Scientific and Technical Information of China (English)

    Cui-hong Chen; Jia-quan Xu; Ming-ming Jin; Gui-ying Li; Chang-wei Hu

    2011-01-01

    Commercially available coal-based activated carbon was treated by nitric acid with different concentrations and the resultant samples were used as catalysts for the direct hydroxylation of benzene to phenol in acetonitrile. Boehm titration, X-ray photoelectron spectroscopy,scanning electron microscope coupled with an energy dispersive X-ray microanalyzer, and Brunauer-Emmett-Teller method were used to characterize toe samples. The number of carboxyl groups on the surface was found to be the main factor affecting the catalytic activity. An optimum catalytic performance with a yield of 15.7% and a selectivity of 87.2% to phenol was obtained.

  10. Formation of substrate-based gold nanocage chains through dealloying with nitric acid

    Directory of Open Access Journals (Sweden)

    Ziren Yan

    2015-06-01

    Full Text Available Metal nanocages have raised great interest because of their new properties and wide applications. Here, we report on the use of galvanic replacement reactions to synthesize substrate-supported Ag–Au nanocages from silver templates electrodeposited on transparent indium tin oxide (ITO film coated glass. The residual Ag in the composition was dealloyed with 10% nitric acid. It was found that chains of Au nanocages were formed on the substrate surface during dealloying. When the concentration of HNO3 increased to 20%, the structures of nanocages were damaged and formed crescent or semi-circular shapes. The transfer process on the substrate surface was discussed.

  11. Vertical Distribution of Ozone and Nitric Acid Vapor on the Mammoth Mountain, Eastern Sierra Nevada, California

    OpenAIRE

    2002-01-01

    In August and September 1999 and 2000, concentrations of ozone (O3) and nitric acid vapor (HNO3) were monitored at an elevation gradient (2184–3325 m) on the Mammoth Mountain, eastern Sierra Nevada, California. Passive samplers were used for monitoring exposure to tropospheric O3 and HNO3 vapor. The 2-week average O3 concentrations ranged between 45 and 72 ppb, while HNO3 concentrations ranged between 0.06 and 0.52 μg/m3. Similar ranges of O3 and HNO3 were determined for 2 years of the study....

  12. Microsystems for anion exchange separation of radionuclides in nitric acid media

    Energy Technology Data Exchange (ETDEWEB)

    Losno, M.; Brennetot, R.; Mariet, C. [DEN/Service d' Etudes Analytiques et de Reactivite des Surfaces - SEARS, CEA, Centre de Saclay, Universite Paris-Saclay, F-91191, Gif sur Yvette (France); Ferrante, I.; Descroix, S. [MMBM Group, Institut Curie Research Center, CNRS UMR 168, Paris (France)

    2016-07-01

    An efficient and reproducible photo-polymerized poly(ethylene glycol methacrylate methacrylate-co- allyl methacrylate) monolith was synthesized and a photo-grafting process based on the ene-thiol click-chemistry has been performed to give anion exchange properties to the monolith. Since their introduction in the early 1990's polymethacrylate monoliths have emerged as a powerful alternative for microscale separations or sample treatment. Their relatively simple implementation in columns with small internal diameters makes them particularly attractive for the new chromatographic challenges of complex matrices analysis and on-chip separations. Despite their relatively poor ion-exchange capacity due to their highly porous structure, their use as anion exchangers is of large interest for nuclear analysis as numerous separations are based on this process. This paper presents a systematic study of the synthesis of the polymeric porous monolith and the versatile and robust functionalization method developed for the specific strong acidic media used in radiochemical procedures. The robustness of the stationary phase was tested in concentrated nitric acid. It appears that the C-S bond formed via thiol-ene chemistry is strong enough to be used to graft function of interest for separation in strong nitric acid medium. The photo-grafted anion exchanger, a quaternary ammonium, presents sufficient resistance to be used for radionuclide separation in [HNO{sub 3}]=5 mol.L{sup -1}so the next step is its integration in the cyclo olefin copolymer (COC) micro-system.

  13. A Durable Catalyst for Vapor Phase Nitration of Benzene with Nitric Acid

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Experimental results in this work demonstrate that PW12-H2SO4/SiO2 catalyst is a good and durable catalyst for vapor phase nitration of benzene to nitrobenzene (NB) using 65% nitric acid at normal pressure. It retains the advantages of using H2SO4 as catalyst and the addition of phosphotungstic acid holds back the effusion of sulfuric acid. This new catalyst keeps high activity (the conversion of HNO3 is more than 92%), high selectivity of NB (more than 97%) and high space time yield (STY 1.5 kg NB/kg cat.h) even after 150 h on stream, under condition of 423 K, SV=3200 ml/g h.

  14. DISSOLUTION OF PLUTONIUM METAL IN 8-10 M NITRIC ACID

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T. S.; Pierce, R. A.

    2012-07-02

    The H-Canyon facility will be used to dissolve Pu metal for subsequent purification and conversion to plutonium dioxide (PuO{sub 2}) using Phase II of HB-Line. To support the new mission, the development of a Pu metal dissolution flowsheet which utilizes concentrated (8-10 M) nitric acid (HNO{sub 3}) solutions containing potassium fluoride (KF) is required. Dissolution of Pu metal in concentrated HNO{sub 3} is desired to eliminate the need to adjust the solution acidity prior to purification by anion exchange. The preferred flowsheet would use 8-10 M HNO{sub 3}, 0.015-0.07 M KF, and 0.5-1.0 g/L Gd to dissolve the Pu up to 6.75 g/L. An alternate flowsheet would use 8-10 M HNO{sub 3}, 0.05-0.2 M KF, and 1-2 g/L B to dissolve the Pu. The targeted average Pu metal dissolution rate is 20 mg/min-cm{sup 2}, which is sufficient to dissolve a “standard” 2250-g Pu metal button in 24 h. Plutonium metal dissolution rate measurements showed that if Gd is used as the nuclear poison, the optimum dissolution conditions occur in 10 M HNO{sub 3}, 0.04-0.05 M KF, and 0.5-1.0 g/L Gd at 112 to 116 °C (boiling). These conditions will result in an estimated Pu metal dissolution rate of ~11-15 mg/min-cm{sup 2} and will result in dissolution times of 36-48 h for standard buttons. The recommended minimum and maximum KF concentrations are 0.03 M and 0.07 M, respectively. The data also indicate that lower KF concentrations would yield dissolution rates for B comparable to those observed with Gd at the same HNO{sub 3} concentration and dissolution temperature. To confirm that the optimal conditions identified by the dissolution rate measurements can be used to dissolve Pu metal up to 6.75 g/L in the presence of representative concentrations of Fe and Gd or B, a series of experiments was performed to demonstrate the flowsheets. In three of the five experiments, the offgas generation rate during the dissolution was measured and samples were analyzed for hydrogen gas (H{sub 2}). The use of

  15. Purification of Polymer-Grade Fumaric Acid from Fermented Spent Sulfite Liquor

    Directory of Open Access Journals (Sweden)

    Diogo Figueira

    2017-04-01

    Full Text Available Fumaric acid is a chemical building block with many applications, namely in the polymer industry. The fermentative production of fumaric acid from renewable feedstock is a promising and sustainable alternative to petroleum-based chemical synthesis. The use of existing industrial side-streams as raw-materials within biorefineries potentially enables production costs competitive against current chemical processes, while preventing the use of refined sugars competing with food and feed uses and avoiding purposely grown crops requiring large areas of arable land. However, most industrial side streams contain a diversity of molecules that will add complexity to the purification of fumaric acid from the fermentation broth. A process for the recovery and purification of fumaric acid from a complex fermentation medium containing spent sulfite liquor (SSL as a carbon source was developed and is herein described. A simple two-stage precipitation procedure, involving separation unit operations, pH and temperature manipulation and polishing through the removal of contaminants with activated carbon, allowed for the recovery of fumaric acid with 68.3% recovery yield with specifications meeting the requirements of the polymer industry. Further, process integration opportunities were implemented that allowed minimizing the generation of waste streams containing fumaric acid, which enabled increasing the yield to 81.4% while keeping the product specifications.

  16. Purification, stabilization and characterization of tomato fatty acid hydroperoxide lyase

    NARCIS (Netherlands)

    Vliegenthart, J.F.G.; Suurmeijer, C.N.S.P.; Pérez-Gilabert, M.; Unen, D.-J. van; Hijden, H.T.W.M. van der; Veldink, G.A.

    2000-01-01

    Fatty acid hydroperoxide lyase (HPO-lyase) was purified 300-fold from tomatoes. The enzymatic activity appeared to be very unstable, but addition of Triton X100 and beta-mercaptoethanol to the buffer yielded an active enzyme that could be stored for several months at −80°C. The enzyme was inhibited

  17. Integrated Computational and Experimental Protocol for Understanding Rh(III) Speciation in Hydrochloric and Nitric Acid Solutions

    Energy Technology Data Exchange (ETDEWEB)

    Samuels, Alex C.; Boele, Cherilynn A.; Bennett, Kevin T.; Clark, Sue B.; Wall, Nathalie; Clark, Aurora E.

    2014-12-01

    A combined experimental and theoretical approach has investigated the complex speciation of Rh(III) in hydrochloric and nitric acid media, as a function of acid concentration. This has relevance to the separation and isolation of Rh(III) from dissolved spent nuclear fuel, which is an emergent and attractive alternative source of platinum group metals, relative to traditional mining efforts.

  18. Purification of human immunoglobulins by sequential precipitation with caprylic acid and ammonium sulphate.

    Science.gov (United States)

    Perosa, F; Carbone, R; Ferrone, S; Dammacco, F

    1990-03-27

    We have tested the usefulness of sequential precipitation with caprylic acid and ammonium sulfate to purify human monoclonal and polyclonal immunoglobulins from sera of 11 patients with monoclonal gammapathy (4 IgG kappa, 2 IgG lambda, 2 IgM kappa, 1 IgA kappa, 2 IgA lambda), four patients with autoimmune diseases and four healthy donors. In terms of purity and activity of Ig as well as execution time and cost, this two-step non-chromatographic procedure is highly efficient for the purification of IgG, IgA and IgM, thus offering several advantages over other methods of purification. Therefore, this procedure may have useful application in the preparation of human Ig for structural studies and therapeutic purposes.

  19. Separation and PurificationHomologous Compounds byof Dodecanedioic Acid from Its Falling Film Crystallization

    Institute of Scientific and Technical Information of China (English)

    李裕; 刘有智; 齐雪琴

    2004-01-01

    Separation and purification of dodecanedioic acid (DDDA) from its homologous compounds were studied experimentally by falling film crystallization (FFC). The influences of various operation parameters, including crystallizing time, flow rate of melt and temperature of glycerine bath, on purity of DDDA and crystallizing rate were investigated. Over 99% (by mole) DDDA was obtained for a feed composition of 96% (by mole). The main factors affecting the separation efficiency are flow rate of melt and temperature of glycerine bath. The crystallizing layer of DDDA was further purified by sweating and blasting. A set of optimized operation data are provided for better understanding the mechanism of heat and mass transfer in FFC, and for further industrial application of DDDA purification process.

  20. Procedure of Destructive Chemical Recovery of Precious Metals in Nitric Acid Production

    Directory of Open Access Journals (Sweden)

    Ljubičić, M.

    2012-07-01

    Full Text Available The heart of the nitric acid production process is the chemical reactor containing a platinum-based catalyst pack and an associated catchment system, which allows the ammonia oxidation reaction to take place efficiently. Under the severe operating conditions imposed by the high-pressure ammonia oxidation process, the catalyst gauzes experience progressive deterioration, as shown by the restricted surface of the catalyst wires, the loss of catalytic activity and the loss of catalytic materials. The higher the pressure of gaseous ammonia oxidation, the greater the loss of platinum group metals from the surface of the applied selective heterogeneous catalysts. Total losses for one batch over the whole period of using selective heterogeneous catalysts may account in the range from 20 to 40 % of the total installed quantity of precious metals. An important part of the platinum removed from the platinum-rhodium alloy wires can be recovered at the outlet of the reactor by means of palladium catchment gauzes. However, this catchment process, which is based on the great ability of palladium to alloy with platinum, is not 100 % effective and a fraction of the platinum and practically all of the rhodium lost by the catalyst wires, evades the catchment package and is then deposited in other parts of the plant, especially heat exchangers. From the above mentioned operating equipment, the retained mass of precious metals can be recovered by the technical procedure of non-destructive and destructive chemical solid-liquid extraction.Shown is the technical procedure of destructive chemical recovery of preheater and boiler for preheating and production of steam by applying sulfuric acid (w = 20 % and subsequent procedure of raffination of derived sludge, to the final recovery of precious metals. The technical procedure of destructive chemical recovery of precious metals from preheater and boiler for preheating and production of steam in nitric acid production is

  1. Purification of Lactic Acid by Heterogeneous Catalytic Distillation Using Ion-exchange Resins

    Institute of Scientific and Technical Information of China (English)

    马利; 张阳; 杨基础

    2005-01-01

    The purification of lactic acid based on the esterification of raw lactic acid from fermentation broth and then the catalytic distillation hydrolysis of methyl lactate simultaneously to achieve pure lactic acid is reported. The esterification kinetics of lactic acid with methanol catalyzed by strong-acid cation-exchange resins (Amberlyst-15,D001, D002, NKC, 002) was studied under the condition that simulates the real catalytic environment. Experimental results were correlated by a Langmuir-Hinselwood model and the nonideality of the solution was taken into account by using activities calculated by the universal quasichemical functional group activity coefficient (UNIFAC) method.A good agreement between the model and the experimental data was achieved. Continuous purification experiments were conducted to find the optimum column configuration and operation condition for the system. The effects of various parameters, e.g. the length of different section of the column, feed rate and ratio of reactants, packing material and catalyst type, were studied. This novel system shows good separation results in lab scale, and is potential for industrial application.

  2. Single-cycle method for partitioning of trivalent actinides using completely incinerable reagents from nitric acid medium

    Energy Technology Data Exchange (ETDEWEB)

    Ravi, Jammu; Venkatesan, K.A.; Antony, M.P.; Srinivasan, T.G.; Rao, P.R. Vasudeva [Indira Gandhi Centre for Atomic Research, Kalpakkam (India). Fuel Chemistry Div.

    2014-10-01

    A new approach, namely 'Single-cycle method for partitioning of Minor Actinides using completely incinerable ReagenTs' (SMART), has been explored for the separation of Am(III) from Eu(III) present in nitric acid medium. The extraction behavior of Am(III) and Eu(III) in a solution of an unsymmetrical diglycolamide, N,N,-didodecyl-N',N'-dioctyl-3-oxapentane-1,5-diamide (D{sup 3}DODGA), and an acidic extractant, N,N-di-2-ethylhexyl diglycolamic acid (HDEHDGA), in n-dodecane was studied. The distribution ratio of both these metal ions in D{sup 3}DODGA-HDEHDGA/n-dodecane initially decreased with increase in the concentration of nitric acid reached a minimum at 0.1 M nitric acid followed by increase. Synergic extraction of Am(III) and Eu(III) was observed at nitric acid concentrations above 0.1 M and antagonism at lower acidities. Contrasting behavior observed at different acidities was probed by the slope analysis of the extraction data. The study revealed the involvement of both D{sup 3}DODGA and HDEHDGA during synergism and increased participation of HDEHDGA during antagonism. The stripping behavior of Am(III) and Eu(III) from the loaded organic phase was studied as a function of nitric acid, DTPA, and citric acid concentrations. The conditions needed for the mutual separation of Am(III) and Eu(III) from the loaded organic phase were optimized. Our studies revealed the possibility of separating trivalent actinides from HLLW using these completely incinerable reagents. (orig.)

  3. Homogeneous nucleation rates of nitric acid dihydrate (NAD at simulated stratospheric conditions – Part II: Modelling

    Directory of Open Access Journals (Sweden)

    O. Möhler

    2006-01-01

    Full Text Available Activation energies ΔGact for the nucleation of nitric acid dihydrate (NAD in supercooled binary HNO3/H2O solution droplets were calculated from volume-based nucleation rate measurements using the AIDA (Aerosol, Interactions, and Dynamics in the Atmosphere aerosol chamber of Forschungszentrum Karlsruhe. The experimental conditions covered temperatures T between 192 and 197 K, NAD saturation ratios SNAD between 7 and 10, and nitric acid molar fractions of the nucleating sub-micron sized droplets between 0.26 and 0.28. Based on classical nucleation theory, a new parameterisation for ΔGact=A×(T ln SNAD−2+B is fitted to the experimental data with A=2.5×106 kcal K2 mol−1 and B=11.2−0.1(T−192 kcal mol−1. A and B were chosen to also achieve good agreement with literature data of ΔGact. The parameter A implies, for the temperature and composition range of our analysis, a mean interface tension σsl=51 cal mol−1 cm−2 between the growing NAD germ and the supercooled solution. A slight temperature dependence of the diffusion activation energy is represented by the parameter B. Investigations with a detailed microphysical process model showed that literature formulations of volume-based (Salcedo et al., 2001 and surface-based (Tabazadeh et al., 2002 nucleation rates significantly overestimate NAD formation rates when applied to the conditions of our experiments.

  4. Decontamination of uranium-contaminated waste oil using supercritical fluid and nitric acid.

    Science.gov (United States)

    Sung, Jinhyun; Kim, Jungsoo; Lee, Youngbae; Seol, Jeunggun; Ryu, Jaebong; Park, Kwangheon

    2011-07-01

    The waste oil used in nuclear fuel processing is contaminated with uranium because of its contact with materials or environments containing uranium. Under current law, waste oil that has been contaminated with uranium is very difficult to dispose of at a radioactive waste disposal site. To dispose of the uranium-contaminated waste oil, the uranium was separated from the contaminated waste oil. Supercritical R-22 is an excellent solvent for extracting clean oil from uranium-contaminated waste oil. The critical temperature of R-22 is 96.15 °C and the critical pressure is 49.9 bar. In this study, a process to remove uranium from the uranium-contaminated waste oil using supercritical R-22 was developed. The waste oil has a small amount of additives containing N, S or P, such as amines, dithiocarbamates and dialkyldithiophosphates. It seems that these organic additives form uranium-combined compounds. For this reason, dissolution of uranium from the uranium-combined compounds using nitric acid was needed. The efficiency of the removal of uranium from the uranium-contaminated waste oil using supercritical R-22 extraction and nitric acid treatment was determined.

  5. Bacteriocins from lactic acid bacteria: production, purification, and food applications.

    Science.gov (United States)

    De Vuyst, Luc; Leroy, Frédéric

    2007-01-01

    In fermented foods, lactic acid bacteria (LAB) display numerous antimicrobial activities. This is mainly due to the production of organic acids, but also of other compounds, such as bacteriocins and antifungal peptides. Several bacteriocins with industrial potential have been purified and characterized. The kinetics of bacteriocin production by LAB in relation to process factors have been studied in detail through mathematical modeling and positive predictive microbiology. Application of bacteriocin-producing starter cultures in sourdough (to increase competitiveness), in fermented sausage (anti-listerial effect), and in cheese (anti-listerial and anti-clostridial effects), have been studied during in vitro laboratory fermentations as well as on pilot-scale level. The highly promising results of these studies underline the important role that functional, bacteriocinogenic LAB strains may play in the food industry as starter cultures, co-cultures, or bioprotective cultures, to improve food quality and safety. In addition, antimicrobial production by probiotic LAB might play a role during in vivo interactions occurring in the human gastrointestinal tract, hence contributing to gut health.

  6. Electrochemical oxidation of 243Am(III) in nitric acid by a terpyridyl-derivatized electrode

    Energy Technology Data Exchange (ETDEWEB)

    Dares, C. J.; Lapides, A. M.; Mincher, B. J.; Meyer, T. J.

    2015-11-05

    A high surface area, tin-doped indium oxide electrode surface-derivatized with a terpyridine ligand has been applied to the oxidation of trivalent americium to Am(V) and Am(VI) in nitric acid. Potentials as low as 1.8 V vs. the saturated calomel electrode are used, 0.7 V lower than the 2.6 V potential for one-electron oxidation of Am(III) to Am(IV) in 1 M acid. This simple electrochemical procedure provides, for the first time, a method for accessing the higher oxidation states of Am in non-complexing media for developing the coordination chemistries of Am(V) and Am(VI) and, more importantly, for separation of americium from nuclear waste streams.

  7. Extraction, isolation and purification of exopolysaccharide from lactic acid bacteria using ethanol precipitation method

    Directory of Open Access Journals (Sweden)

    Vivek K. Bajpai

    2016-09-01

    Full Text Available Lactic acid bacteria are classified ‘Generally Recognized As Safe’ (GRAS with most effective potential to divert significant amount of fermentable sugars towards the biosynthesis of functional exopolysaccharide. Exopolysaccharides from lactic acid bacteria are receiving a renewed interest due to the claims of human health benefits, such as modulation of immune response system and more importantly in food and pharma industries as a texturizer, viscosifer, emulsifier and syneresis-lowering agent. Its purification methodology involves: a Extraction of cell-free supernatant from lactic acid bacteria; b Denature of protein using trichloroacetic acid; c Ethanol precipitation; d Dialysis; and e Freeze drying. However, depending on nature of research, compounds can be further purified using scanning electron microscopy (SEM, infrared spectrum (IR; and nuclear magnetic resonance (NMR spectral analyses.

  8. Purification and characterization of a branched-chain amino acid aminotransferase from Lactobacillus paracasei subsp paracasei CHCC 2115

    DEFF Research Database (Denmark)

    Thage, B.V.; Rattray, F.P.; Laustsen, M.W.;

    2004-01-01

    Purification and characterization of an aminotransferase (AT) specific for the degradation of branched-chain amino acids from Lactobacillus paracasei subsp. paracasei CHCC 2115. Methods and Results: The purification protocol consisted of anion exchange chromatography, affinity chromatography...... of other metal ions, thiol- and carbonyl-binding agents. The N-terminal sequence of the enzyme was SVNIDWNNLGFDYMQLPYRYVAHXKDGVXD, and had at the amino acid level, 60 and 53% identity to a branched-chain amino acid AT of Lact. plantarum and Lactococcus lactis, respectively. Conclusions: The results suggest...

  9. Poly(N-vinylimidazole/ethylene glycol dimethacrylate) for the purification and isolation of phenolic acids

    Energy Technology Data Exchange (ETDEWEB)

    Schemeth, Dieter; Noël, Jean-Christophe [Institute of Analytical Chemistry and Radiochemistry, Leopold-Franzens University of Innsbruck, CCB—Center of Chemistry and Biomedicine, Innrain 80-82, 6020 Innsbruck (Austria); Jakschitz, Thomas [Austrian Drug Screening Institute, Innrain 66a, 6020 Innsbruck (Austria); Rainer, Matthias, E-mail: m.rainer@uibk.ac.at [Institute of Analytical Chemistry and Radiochemistry, Leopold-Franzens University of Innsbruck, CCB—Center of Chemistry and Biomedicine, Innrain 80-82, 6020 Innsbruck (Austria); Tessadri, Richard [Institute of Mineralogy and Petrography, Leopold-Franzens University of Innsbruck, Innrain 52, 6020 Innsbruck (Austria); Huck, Christian W. [Institute of Analytical Chemistry and Radiochemistry, Leopold-Franzens University of Innsbruck, CCB—Center of Chemistry and Biomedicine, Innrain 80-82, 6020 Innsbruck (Austria); Bonn, Günther K. [Institute of Analytical Chemistry and Radiochemistry, Leopold-Franzens University of Innsbruck, CCB—Center of Chemistry and Biomedicine, Innrain 80-82, 6020 Innsbruck (Austria); Austrian Drug Screening Institute, Innrain 66a, 6020 Innsbruck (Austria)

    2015-07-23

    Highlights: • Free-radical polymerization of protonable vinylimidazole with EGMDA. • Polymer-optimization by maximum loading capacity of phenolic acids. • Performs better than SiO{sub 2} and Al{sub 2}O{sub 3} in normal phase mode using acetonitrile. • Performs equal or even better in anion-exchange mode compared to Oasis-MAX. • Efficient purification of phenolic compounds from crude extract. - Abstract: In this study we report the novel polymeric resin poly(N-vinyl imidazole/ethylene glycol dimethacrylate) for the purification and isolation of phenolic acids. The monomer to crosslinker ratio and the porogen composition were optimized for isolating phenolic acids diluted in acetonitrile at normal phase chromatography conditions, first. Acetonitrile serves as polar, aprotic solvent, dissolving phenolic acids but not interrupting interactions with the stationary phase due to the approved Hansen solubility parameters. The optimized resin demonstrated high loading capacities and adsorption abilities particularly for phenolic acids in both, acetonitrile and aqueous solutions. The adsorption behavior of aqueous standards can be attributed to ion exchange effects due to electrostatic interactions between protonated imidazole residues and deprotonated phenolic acids. Furthermore, adsorption experiments and subsequent curve fittings provide information of maximum loading capacities of single standards according to the Langmuir adsorption model. Recovery studies of the optimized polymer in the normal-phase and ion-exchange mode illustrate the powerful isolation properties for phenolic acids and are comparable or even better than typical, commercially available solid phase extraction materials. In order to prove the applicability, a highly complex extract of rosemary leaves was purified by poly(N-vinyl imidazole/ethylene glycol dimethacrylate) and the isolated compounds were identified using UHPLC–qTOF-MS.

  10. Nitric oxide metabolism and indole acetic acid biosynthesis cross-talk in Azospirillum brasilense SM.

    Science.gov (United States)

    Koul, Vatsala; Tripathi, Chandrakant; Adholeya, Alok; Kochar, Mandira

    2015-04-01

    Production of nitric oxide (NO) and the presence of NO metabolism genes, nitrous oxide reductase (nosZ), nitrous oxide reductase regulator (nosR) and nitric oxide reductase (norB) were identified in the plant-associated bacterium (PAB) Azospirillum brasilense SM. NO presence was confirmed in all overexpressing strains, while improvement in the plant growth response of these strains was mediated by increased NO and indole-3-acetic acid (IAA) levels in the strains. Electron microscopy showed random distribution to biofilm, with surface colonization of pleiomorphic Azospirilla. Quantitative IAA estimation highlighted a crucial role of nosR and norBC in regulating IAA biosynthesis. The NO quencher and donor reduced/blocked IAA biosynthesis by all strains, indicating their common regulatory role in IAA biosynthesis. Tryptophan (Trp) and l-Arginine (Arg) showed higher expression of NO genes tested, while in the case of ipdC, only Trp and IAA increased expression, while Arg had no significant effect. The highest nosR expression in SMnosR in the presence of IAA and Trp, along with its 2-fold IAA level, confirmed the relationship of nosR overexpression with Trp in increasing IAA. These results indicate a strong correlation between IAA and NO in A. brasilense SM and suggest the existence of cross-talk or shared signaling mechanisms in these two growth regulators.

  11. An instrument for automated purification of nucleic acids from contaminated forensic samples.

    Science.gov (United States)

    Broemeling, David J; Pel, Joel; Gunn, Dylan C; Mai, Laura; Thompson, Jason D; Poon, Hiron; Marziali, Andre

    2008-02-01

    Forensic crime scene sample analysis, by its nature, often deals with samples in which there are low amounts of nucleic acids, on substrates that often lead to inhibition of subsequent enzymatic reactions such as PCR amplification for STR profiling. Common substrates include denim from blue jeans, which yields indigo dye as a PCR inhibitor, and soil, which yields humic substances as inhibitors. These inhibitors frequently co-extract with nucleic acids in standard column or bead-based preps, leading to frequent failure of STR profiling. We present a novel instrument for DNA purification of forensic samples that is capable of highly effective concentration of nucleic acids from soil particulates, fabric, and other complex samples including solid components. The novel concentration process, known as SCODA, is inherently selective for long charged polymers such as DNA, and therefore is able to effectively reject known contaminants. We present an automated sample preparation instrument based on this process, and preliminary results based on mock forensic samples.

  12. Purification of an L-amino acid oxidase from Bungarus caeruleus (Indian krait venom

    Directory of Open Access Journals (Sweden)

    SS More

    2010-01-01

    Full Text Available Snake venoms are rich in enzymes such as phospholipase A2, proteolytic enzymes, hyaluronidases and phosphodiesterases, which are well characterized. However, L-amino acid oxidase (LAO EC.1.4.3.2 from snake venoms has not been extensively studied. A novel L-amino acid oxidase from Bungarus caeruleus venom was purified to homogeneity using a combination of ion-exchange by DEAE-cellulose chromatography and gel filtration on Sephadex® G-100 column. The purified monomer of LAO showed a molecular mass of 55 ±1 kDa estimated by SDS-PAGE. The specific activity of purified LAO was 6,230 ± 178 U/min/mg, versus 230 ± 3.0 U/min/mg for the whole desiccated venom, suggesting a 27-fold purification with a 25% yield. Optimal pH and temperature for maximum purified enzyme activity were 6.5 and 37ºC, respectively. Platelet aggregation studies show that purified LAO inhibited ADP-induced platelet aggregation dose-dependently at 0.01 to 0.1 µM with 50% inhibitory concentration (IC50 of 0.04 µM, whereas at a 0.08 µM concentration it did not induce appreciable aggregation on normal platelet-rich plasma (PRP. The purified protein catalyzed oxidative deamination of L-amino acids while the most specific substrate was L-leucine. The purified LAO oxidizes only L-forms, but not D-forms of amino acids, to produce H2O2. The enzyme is important for the purification and determination of certain amino acids and for the preparation of α-keto acids.

  13. Studies of dissolution solutions of ruthenium metal, oxide and mixed compounds in nitric acid

    Energy Technology Data Exchange (ETDEWEB)

    Mousset, F.; Eysseric, C.; Bedioui, F

    2004-07-01

    Ruthenium is one of the fission products generated by irradiated nuclear fuel. It is present throughout all the steps of nuclear fuel reprocessing-particularly during extraction-and requires special attention due to its complex chemistry and high {beta}{gamma} activity. An innovative electro-volatilization process is now being developed to take advantage of the volatility of RuO{sub 4} in order to eliminate it at the head end of the Purex process and thus reduce the number of extraction cycles. Although the process operates successfully with synthetic nitrato-RuNO{sup 3+} solutions, difficulties have been encountered in extrapolating it to real-like dissolution solutions. In order to better approximate the chemical forms of ruthenium found in fuel dissolution solutions, kinetic and speciation studies on dissolved species were undertaken with RuO{sub 2},xH{sub 2}O and Ru{sup 0} in nitric acid media. (authors)

  14. Extraction of uranium (VI) from nitric acid solutions with N,N,-di-n-butyloctanamide

    Energy Technology Data Exchange (ETDEWEB)

    Dembinski, W.; Gasparini, G.M.

    1980-12-01

    N,N-dialkylamides show interesting properties as new extracting agents of actinides. This report presents the data concerning the N,N-di-n-butyloctanamide: CH/sub 3/-(CH/sub 2/)/sub 5/-CH/sub 2/-C(O)N (C/sub 4/H/sub 9/)/sub 2/. In particular the following have been studied: the formation of a third phase with n-dodecane and mesitylene as diluents; the influence of the concentration of the uranium of the nitric acid and of the extractant on the distribution coeffcient, of uranium(VI); the radiation stability of this amide and the influence of the absorbed dose on the distribution coefficient for U(VI). The general properties of the di-n-butyloctanamide as potential extractant of uranium are discussed.

  15. Spatial and temporal distribution of ambient nitric acid and ammonia in the Athabasca Oil Sands Region, Alberta

    Science.gov (United States)

    A. Bytnerowicz; W. Fraczek; S. Schilling; D. Alexander

    2010-01-01

    Monthly average ambient concentrations of gaseous nitric acid (HNO3) and ammonia (NH3) were monitored at the Athabasca Oils Sands Region (AOSR), Alberta, Canada, between May 2005 and September 2008. Generally, concentrations of both pollutants were elevated and highly variable in space and time. The highest atmospheric...

  16. N,N,N‘,N’—tetrabutylmalonamide as a new extractant for extraction of nitric acid and uranium(VI)

    Institute of Scientific and Technical Information of China (English)

    WangYou-Shao; SunXiao-Yu; 等

    1997-01-01

    N,N,N',N'-tetrabutylmalonamide(TBMA) is synthesized and used for extraction of uranyl(Ⅱ) ion from nitric acid media in a diluent composed of 50% 1,2,4-trimethyl benzene (TMB) and 50% kerosene(OK),The effects of nitric acid concentration,extractant concentration,temperature,slating-out agent (LiNO3) and back extraction on distribution coefficients of uranyl(Ⅱ) ion have been studied.The extraction of nitric acid is also studied.The main adduct of TBMA and HNO3 is HNO3.TBMA,and there are more than two kinds of adducts in 3.0mol/L nitric acid solutions,such as HNO3.TBMA,(HNO3)2,TBMA and (NHO3)3.TBMA.The complex formation of uranyl(Ⅱ) ion,nitrate ion and TBMA(1:2:1) as extracted species is further confirmed by IR spectra of the saturated extraction of uranyl(Ⅱ) ion with TBMA,and the values of thermodynamic parameters have also been calculated.

  17. Evaluation of the Single Dilute (0.43 M) Nitric Acid Extraction to Determine Geochemically Reactive Elements in Soil

    NARCIS (Netherlands)

    Groenenberg, Jan E.; Römkens, Paul F.A.M.; Zomeren, van André; Rodrigues, S.M.; Comans, Rob N.J.

    2017-01-01

    Recently a dilute nitric acid extraction (0.43 M) was adopted by ISO (ISO-17586:2016) as standard for extraction of geochemically reactive elements in soil and soil like materials. Here we evaluate the performance of this extraction for a wide range of elements by mechanistic geochemical modeling

  18. Nitrous-Oxide Flux from Nitric-Acid-Treated Cattle Slurry Applied to Grassland under Semi-Controlled Conditions

    NARCIS (Netherlands)

    Velthof, G.L.; Oenema, O.

    1993-01-01

    Nitrous oxide (N2O) fluxes from cattle slurry after surface application to grassland were measured under semi-controlled environmental conditions during three periods in 1991. Three types of cattle slurry were examined; untreated slurry and slurries treated with nitric acid (HNO3) to pH 6.0 and 4.5.

  19. Nitric Acid Deposition following an Astrophysical Ionizing Radiation Event is below Critical Loads for Terrestrial and Freshwater Ecosystems

    CERN Document Server

    Melott, Ben Neuenswander Adrian

    2014-01-01

    Nitric acid rainout is one of the effects of an astrophysical ionizing radiation event. The predicted values of nitrate rainout from previous work for a typical gamma ray burst (GRB) within our galaxy serve as an extreme example and are shown to be below critical loads of eutrophication and acidification for ecoregions in Europe and the US.

  20. Ammonium nitrate evaporation and nitric acid condensation in DMT CCN counters

    Science.gov (United States)

    Romakkaniemi, S.; Jaatinen, A.; Laaksonen, A.; Nenes, A.; Raatikainen, T.

    2014-05-01

    The effect of inorganic semivolatile aerosol compounds on the cloud condensation nucleus (CCN) activity of aerosol particles was studied by using a computational model for a DMT-CCN counter, a cloud parcel model for condensation kinetics and experiments to quantify the modelled results. Concentrations of water vapour and semivolatiles as well as aerosol trajectories in the CCN column were calculated by a computational fluid dynamics model. These trajectories and vapour concentrations were then used as an input for the cloud parcel model to simulate mass transfer kinetics of water and semivolatiles between aerosol particles and the gas phase. Two different questions were studied: (1) how big a fraction of semivolatiles is evaporated from particles after entering but before particle activation in the DMT-CCN counter? (2) How much can the CCN activity be increased due to condensation of semivolatiles prior to the maximum water supersaturation in the case of high semivolatile concentration in the gas phase? Both experimental and modelling results show that the evaporation of ammonia and nitric acid from ammonium nitrate particles causes a 10 to 15 nm decrease to the critical particle size in supersaturations between 0.1% and 0.7%. On the other hand, the modelling results also show that condensation of nitric acid or similar vapour can increase the CCN activity of nonvolatile aerosol particles, but a very high gas phase concentration (as compared to typical ambient conditions) would be needed. Overall, it is more likely that the CCN activity of semivolatile aerosol is underestimated than overestimated in the measurements conducted in ambient conditions.

  1. Effect of humidity on nitric acid uptake to mineral dust aerosol particles

    Directory of Open Access Journals (Sweden)

    A. Vlasenko

    2006-01-01

    Full Text Available This study presents the first laboratory observation of HNO3 uptake by airborne mineral dust particles. The model aerosols were generated by dry dispersion of Arizona Test Dust (ATD, SiO2, and by nebulizing a saturated solution of calcium carbonate. The uptake of 13N-labeled gaseous nitric acid was observed in a flow reactor on the 0.2–2 s reaction time scale at room temperature and atmospheric pressure. The amount of nitric acid appearing in the aerosol phase at the end of the flow tube was found to be a linear function of the aerosol surface area. SiO2 particles did not show any significant uptake, while the CaCO3 aerosol was found to be more reactive than ATD. Due to the smaller uncertainty associated with the reactive surface area in the case of suspended particles as compared to bulk powder samples, we believe that we provide an improved estimate of the rate of uptake of HNO3 to mineral dust. The fact that the rate of uptake was smaller at a concentration of 1012 than at 1011 was indicative of a complex uptake mechanism. The uptake coefficient averaged over the first 2 s of reaction time at a concentration of 1012 molecules cm-3 was found to increase with increasing relative humidity, from 0.022±0.007 at 12% RH to 0.113±0.017 at 73% RH , which was attributed to an increasing degree of solvation of the more basic minerals. The extended processing of the dust by higher concentrations of HNO3 at 85% RH led to a water soluble coating on the particles and enhanced their hygroscopicity.

  2. Investigation on surface structure of potassium permanganate/nitric acid treated poly(tetrafluoroethylene)

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Congli; Liu, Shuling; Gong, Tianlong; Gu, Aiqun; Yu, Zili, E-mail: ziliyu@scu.edu.cn

    2014-10-30

    Highlights: • A new transformation (conversion) mechanism of PTFE surface from a hydrophobicity to a hydrophilicity was proposed through the treatment of KMnO{sub 4}/HNO{sub 3}. • Chemical reactions or defluorination of PTFE described in the reported paper was testified to be a misconceived conclusion by the combination of several testing measurements (IR, XPS, XRD and so on) in our present work. • Deposition of manganese oxide and/or manganese hydroxide on PTFE surface contributed to the hydrophilic property of the modified PTFE with KMnO{sub 4}/HNO{sub 3} treated. • The deposition thickness on the modified PTFE surface was about 5 μm, which was significantly helpful in enhancing the adhesive strength of PTFE with other materials. - Abstract: In the previous articles concerning the treatment of poly(tetrafluoroethylene) (PTFE) with potassium permanganate/nitric acid mixture, the conversion of a hydrophobic to a hydrophilic surface was partially assigned to the defluorination of PTFE and then the introduction of carbonyl and hydroxyl groups into the defluorinated sites. In the present work, PTFE sheets were treated with potassium permanganate/nitric acid, and the surfaces before and after treatment were comparatively characterized by Fourier transform infrared spectroscopy (FTIR), X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). The surface sediments of the treated PTFE were also determined by atomic absorption spectroscopy (AAS). The results indicate that the conversion of the hydrophobicity to the hydrophilicity on the modified PTFE surface is mainly due to the deposition of hydrophilic manganese oxides which covered the fluorocarbon surface, and no detectable chemical reactions of PTFE occur in the treating process.

  3. Optimization of the nitrous vapors experimental conditions production by nitric acid electrochemical reduction; Optimisation des conditions operatoires de production de vapeurs nitreuses par reduction electrochimique d`acide nitrique

    Energy Technology Data Exchange (ETDEWEB)

    Lemaire, M.

    1996-11-22

    Gaseous nitrogen oxides (NO and NO{sub 2}) involved as oxidizing agents in nuclear fuel reprocessing can be produced by electrochemical reduction of nitric acid. This is an interesting alternative to the existing process because no wastes are generated. voltammetric studies on a platinum electrode show that two reduction potential regions are observed in concentrated nitric acid solutions, between 0,05 V{sub SHE} and between 0,5 V{sub SHE} and 1 V{sub SHE}. The highest potential region reduction mechanism was studied by: classical micro-electrolysis methods, macro-electrolysis methods, infrared spectroscopy coupled to electrochemistry. It was determined that the origin of nitric acid reduction is the electrochemical reduction of nitrous acid in nitric oxide which chemically reduces nitric acid. This reaction produces nitrous acid back which indicate an auto-catalytic behaviour of nitric acid reduction mechanism. Nitrogen dioxide evolution during nitric reduction can also explained by an other chemical reaction. If the potential value of platinum electrode is above 0,8 V{sub SHE}, products of the indirect nitric acid reduction are nitrous acid, nitrogen oxide and nitrogen dioxide. Below this value nitric oxide can be reduced in nitrous oxide. Thus the potential value is the most important parameter for the nitrogen oxides production selectivity. However, owing to the auto-catalytic character of the reduction mechanism, potential value can be controlled during intentiostatic industrial electrolysis. (author). 91 refs.

  4. Recent trends in lactic acid biotechnology: A brief review on production to purification

    Directory of Open Access Journals (Sweden)

    Tayyba Ghaffar

    2014-04-01

    Full Text Available Lactic acid is one of the most important organic acid which is being extensively used around the globe in a range of industrial and biotechnological applications. From its very old history to date, many methods have been introduced to improve the optimization of lactic acid to get highest yields of the product of industrial interests. In serious consideration of the worldwide economic and lactic acid consumption issues there has been increasing research interest in the value of materials with natural origin, which are cheap, abundant and easily available all around the year. Recent trends showed that lactic acid production through fermentation is advantageous over chemical due to the environmental concerns of the modern world. The eco-friendly processing and fermentable capability of many of the agricultural and agro-industrial based raw materials or by-products respectively makes them attractive candidates in fermentation biotechnology to produce a value-added product with multiple applications. In fact, major advances have already been achieved in recent years in order to get pure lactic acid with optimal yield. The present review work is summarized on the multi-step processing technologies to produce lactic acid from different substances as a starting material potentially from various agro-industrial based biomasses. The information is also given on a purification through schematic representation of the product of quality interests.

  5. N,N-dialkyl-2-hydroxyacetamides for modifier-free separation of trivalent actinides from nitric acid medium

    Energy Technology Data Exchange (ETDEWEB)

    Prathibha, T.; Kumaresan, R.; Selvan, B. Robert; Venkatesan, K.A.; Antony, M.P.; Vasudeva Rao, P.R. [Indira Gandhi Centre for Atomic Research, Kalpakkam (India). Fuel Chemistry Div.

    2016-07-01

    The alkyl derivatives of N,N,-dialkyl-2-hydroxyacetamide (DAHyA), namely, N,N,-dihexyl-2-hydroxyacetamide (DHHyA), N,N,-dioctyl-2-hydroxyacetamide (DOHyA), N,N,-didecyl-2-hydroxyacetamide (DDHyA), were synthesized and characterized by FT-IR, and NMR spectroscopy. The extraction behaviour of Am(III) in a solution of DAHyA in n-dodecane was studied as a function of various parameters to evaluate the feasibility of using DAHyA for partitioning of trivalent actinides from high-level liquid waste (HLLW). The distribution ratio of Am(III) (D{sub Am(III)}) in 0.1 M DAHyA/n-DD increased from 10{sup -4} to > 200 with increase in nitric acid concentration from 1 M to 6 M. A D{sub Am(III)} value 10-70 was obtained in a nitric acid concentration range from 3-4 M. The extraction of Am(III) in 0.1 M DAHyA/n-dodecane decreased in the order DHHyA > DOHyA > DDHyA. The third-phase formation behaviour of nitric acid and neodymium (III) in 0.2 M DAHyA/n-dodecane was studied. Near stoichiometric amount of neodymium (III) can be loaded in octyl and decyl derivatives without any third-phase formation from 3-4 M nitric acid medium. Unlike other extractants, the loaded trivalent metal ion in DAHyA can be recovered even with 1 M nitric acid. Therefore, the study revealed that N,N,-dialkyl-2-hydroxyacetamides are promising candidates for partitioning the trivalent actinides from HLLW.

  6. Validation Testing of the Nitric Acid Dissolution Step Within the K Basin Sludge Pretreatment Process

    Energy Technology Data Exchange (ETDEWEB)

    AJ Schmidt; CH Delegard; KL Silvers; PR Bredt; CD Carlson; EW Hoppe; JC Hayes; DE Rinehart; SR Gano; BM Thornton

    1999-03-24

    The work described in this report involved comprehensive bench-scale testing of nitric acid (HNO{sub 3}) dissolution of actual sludge materials from the Hanford K East (KE) Basin to confirm the baseline chemical pretreatment process. In addition, process monitoring and material balance information was collected to support the development and refinement of process flow diagrams. The testing was performed by Pacific Northwest National Laboratory (PNNL)for the US Department of Energy's Office of Spent Fuel Stabilization (EM-67) and Numatec Hanford Corporation (NHC) to assist in the development of the K Basin Sludge Pretreatment Process. The baseline chemical pretreatment process for K Basin sludge is nitric acid dissolution of all particulate material passing a 1/4-in. screen. The acid-insoluble fraction (residual solids) will be stabilized (possibly by chemical leaching/rinsing and grouting), packaged, and transferred to the Hanford Environmental Restoration Disposal Facility (ERDF). The liquid fraction is to be diluted with depleted uranium for uranium criticality safety and iron nitrate for plutonium criticality safety, and neutralized with sodium hydroxide. The liquid fraction and associated precipitates are to be stored in the Hanford Tank Waste Remediation Systems (TWRS) pending vitrification. It is expected that most of the polychlorinated biphenyls (PCBs), associated with some K Basin sludges, will remain with the residual solids for ultimate disposal to ERDF. Filtration and precipitation during the neutralization step will further remove trace quantities of PCBs within the liquid fraction. The purpose of the work discussed in this report was to examine the dissolution behavior of actual KE Basin sludge materials at baseline flowsheet conditions and validate the.dissolution process step through bench-scale testing. The progress of the dissolution was evaluated by measuring the solution electrical conductivity and concentrations of key species in the

  7. Freezing of sulfuric and nitric acid solutions: Implications for polar stratospheric cloud formation

    Science.gov (United States)

    Salcedo Gonzalez, Dara

    2000-12-01

    Polar Stratospheric Clouds (PSCs) play an important role in ozone chemistry during the polar winter. The magnitude of their effect depends on their phase, composition and formation mechanism, which are not fully understood yet. In order to understand how liquid PSCs freeze, two apparatus were designed to study the freezing behavior of small drops using a Fourier transform infrared (FTIR) spectrometer and an optical microscope. Sulfuric acid aqueous drops with composition of 10 to 50 wt % were studied with the FTIR apparatus. The surface on which the drops stand caused heterogeneous nucleation of ice, but not of the sulfuric acid hydrates. The more concentrated solutions (>40 wt %) supercooled to 130 K without freezing. Below 150 K these solutions formed an amorphous solid, which liquefied upon warming. Drops with composition of 40 to 64 wt % HNO3 were prepared and their phase transitions were detected with the optical microscope apparatus. Freezing temperatures of the drops were determined and homogeneous nucleation rates of nitric acid dihydrate (JNAD) and nitric acid trihydrate (JNAT) between 170 and 190 K were calculated. JNAT and JNAD depend predominantly on the saturation of the solid in the liquid solution: higher saturation ratios correspond to higher nucleation rates. Classical nucleation theory was used to parameterize this relation. Since the saturation ratios of NAD and NAT vary with temperature and composition in different ways, NAT or NAD can form preferentially under different conditions. Evidence was found that NAD catalyzes the nucleation of NAT below ~183 K. Mullite, cristobalite and alumina were tested as possible heterogeneous nuclei of volcanic origin for PSCs. They catalyze freezing of NAD and NAT at temperatures below 179 K, which are too low to be stratospherically important. The results suggest that the largest drops in a PSC will freeze homogeneously if the stratospheric temperature remains below the NAT condensation temperature for more

  8. Purification of chlorogenic acid in Flos Lonicerae with system of polar ordered resins

    Institute of Scientific and Technical Information of China (English)

    XIANG Zhi-nan; ZHAN Yu; NING Zheng-xiang

    2007-01-01

    A system of polar ordered resins was established for purification of chlorogenic acid in Flos Lonicerae. It was composed of three reversed phase resins, AB-8, DM-130 and NKA-9, representative for their gradually increased polarity and selectivity. A method of RP-HPLC was used for determination of chlorogenic acid. And the performance of adsorption and desorption for chlorogenic acid with the system of polar ordered resins was studied. Furthermore, the effects of concentration, pH and flow rate of the adsorbate on adsorption ability were researched. It is indicated that the optimum parameters for chlorogenic acid are as follows:pH 3.5 with a flow rate of 2.5 BV/h, the concentration of extract solution at 0.50, 0.40, 0.30 g/L respectively for the adsorptive operation twice, and 6.93, 8.66, 10.39 mol/L ethanol used as gradient eluants. The purity of resulted product of chlorogenic acid arrives 70.20% with yield of 89.79%. With simple procedures, low costs and high purity product, the method of system of polar ordered resins followed by sequential reversed phase separations can be used to refine the chlorogenic acid in the extraction of Flos Lonicerae.

  9. Validation and scale-up of plasmid DNA purification by phenyl-boronic acid chromatography.

    Science.gov (United States)

    Gomes, A Gabriela; Azevedo, Ana M; Aires-Barros, M Raquel; Prazeres, D Miguel F

    2012-11-01

    This study addresses the feasibility of scaling-up the removal of host cell impurities from plasmid DNA (pDNA)-containing Escherichia coli lysates by phenyl-boronic (PB) acid chromatography using columns packed with 7.6 and 15.2 cm(3) of controlled porous glass beads (CPG) derivatized with PB ligands. Equilibration was performed with water at 10 cm(3) /min and no conditioning of the lysate feed was required. At a ratio of lysate feed to adsorbent volume of 1.3, 93-96% of pDNA was recovered in the flow through while 66-71% of impurities remained bound (~2.5-fold purification). The entire sequence of loading, washing, elution, and re-equilibration was completed in 20 min. Run-to-run consistency was observed in terms of chromatogram features and performance (yield, purification factor, agarose electrophoresis) across the different amounts of adsorbent (0.75-15.2 cm(3) ) by performing successive injections of lysates prepared independently and containing 3.7 or 6.1 kbp plasmids. The column productivity at large scale was 4 dm(3) of alkaline lysate per hour per dm(3) of PB-CPG resin. The method is rapid, reproducible, simple, and straightforward to scale-up. Furthermore, it is capable of handling heavily contaminated samples, constituting a good alternative to purification techniques such as isopropanol precipitation, aqueous two-phase systems, and tangential flow filtration. © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Purification and characterization of a chlorogenic acid hydrolase from Aspergillus niger catalysing the hydrolysis of chlorogenic acid.

    Science.gov (United States)

    Asther, Michèle; Estrada Alvarado, Maria Isabel; Haon, Mireille; Navarro, David; Asther, Marcel; Lesage-Meessen, Laurence; Record, Eric

    2005-01-12

    Among 15 Aspergillus strains, Aspergillus niger BRFM 131 was selected for its high chlorogenic acid hydrolase activity. The enzyme was purified and characterized with respect to its physico-chemical and kinetic properties. Four chromatographic steps were necessary to purify the protein to homogeneity with a recovery of 2%. Km of the chlorogenic acid hydrolase was estimated to be 10 microM against chlorogenic acid as substrate. Under native conditions, the protein presented a molecular mass of 170 kDa, and SDS-PAGE analysis suggested the presence of two identical 80 kDa subunits. Isoelectric point was 6.0; pH optimum for activity was determined to be 6.0 and temperature optima to be 55 degrees C. The N-terminal sequence did not present any homology with other cinnamoyl ester hydrolases previously described suggesting the purification of a new protein. The chlorogenic acid hydrolase was used successfully for the production of caffeic acid, which possesses strong antioxidant properties, from natural substrates specially rich in chlorogenic acid like apple marc and coffee pulp.

  11. Extraction, purification, methylation and GC-MS analysis of short-chain carboxylic acids for metabolic flux analysis.

    Science.gov (United States)

    Tivendale, Nathan D; Jewett, Erin M; Hegeman, Adrian D; Cohen, Jerry D

    2016-08-15

    Dynamic metabolic flux analysis requires efficient and effective methods for extraction, purification and analysis of a plethora of naturally-occurring compounds. One area of metabolism that would be highly informative to study using metabolic flux analysis is the tricarboxylic acid (TCA) cycle, which consists of short-chain carboxylic acids. Here, we describe a newly-developed method for extraction, purification, derivatization and analysis of short-chain carboxylic acids involved in the TCA cycle. The method consists of snap-freezing the plant material, followed by maceration and a 12-15h extraction at -80 °C. The extracts are then subject to reduction (to stabilize β-keto acids), purified by strong anion exchange solid phase extraction and methylated with methanolic HCl. This method could also be readily adapted to quantify many other short-chain carboxylic acids.

  12. Water-soluble nitric-oxide-releasing acetylsalicylic acid (ASA) prodrugs.

    Science.gov (United States)

    Rolando, Barbara; Lazzarato, Loretta; Donnola, Monica; Marini, Elisabetta; Joseph, Sony; Morini, Giuseppina; Pozzoli, Cristina; Fruttero, Roberta; Gasco, Alberto

    2013-07-01

    A series of water-soluble (benzoyloxy)methyl esters of acetylsalicylic acid (ASA), commonly known as aspirin, are described. The new derivatives each have alkyl chains containing a nitric oxide (NO)-releasing nitrooxy group and a solubilizing moiety bonded to the benzoyl ring. The compounds were synthesized and evaluated as ASA prodrugs. After conversion to the appropriate salt, most of the derivatives are solid at room temperature and all possess good water solubility. They are quite stable in acid solution (pH 1) and less stable at physiological pH. In human serum, these compounds are immediately metabolized by esterases, producing a mixture of ASA, salicylic acid (SA), and of the related NO-donor benzoic acids, along with other minor products. Due to ASA release, the prodrugs are capable of inhibiting collagen-induced platelet aggregation of human platelet-rich plasma. Simple NO-donor benzoic acids 3-hydroxy-4-(3-nitrooxypropoxy)benzoic acid (28) and 3-(morpholin-4-ylmethyl)-4-[3-(nitrooxy)propoxy]benzoic acid (48) were also studied as representative models of the whole class of benzoic acids formed following metabolism of the prodrugs in serum. These simplified derivatives did not trigger antiaggregatory activity when tested at 300 μM. Only 28 displays quite potent NO-dependent vasodilatatory action. Further in vivo evaluation of two selected prodrugs, {[2-(acetyloxy)benzoyl]oxy}methyl-3-[(3-[aminopropanoyl)oxy]-4-[3-(nitrooxy)propoxy]benzoate⋅HCl (38) and {[2-(acetyloxy)benzoyl]oxy}methyl 3-(morpholin-4-ylmethyl)-4-[3-(nitrooxy)propoxy]benzoate oxalate (49), revealed that their anti-inflammatory activities are similar to that of ASA when tested in the carrageenan-induced paw edema assay in rats. The gastrotoxicity of the two prodrugs was also determined to be lower than that of ASA in a lesion model in rats. Taken together, these results indicated that these NO-donor ASA prodrugs warrant further investigation for clinical application.

  13. A quantitative test of infrared optical constants for supercooled sulphuric and nitric acid droplet aerosols

    Directory of Open Access Journals (Sweden)

    R. Wagner

    2003-05-01

    Full Text Available In situ Fourier transform infrared (FTIR extinction spectra of supercooled H2SO4/H2O and HNO3/H2O solution droplets were recorded in the large coolable aerosol chamber AIDA (Aerosol Interactions and Dynamics in the Atmosphere of Forschungszentrum Karlsruhe for a range of aerosol compositions and at temperatures extending down to 192 K. The measured spectra were quantitatively analysed in terms of aerosol composition and mass concentration by using Mie theory in combination with published refractive index data as input parameters. Simultaneously, total sulphuric acid and nitric acid mass concentrations from filter analysis and total water concentrations measured with the Lyman-a hygrometer of Forschungszentrum Jülich were used to calculate the aerosol composition at thermodynamic equilibrium inside the aerosol chamber. By comparing these measured aerosol parameters with those retrieved from the analysis of the FTIR spectra, the accuracy of the literature data sets of refractive indices could be assessed. In summary, four data sets were tested in the H2SO4/H2O system as well as two data sets in the HNO3/H2O system, partly revealing significant discrepancies in the retrieved aerosol properties. Potential explanations for these differences are discussed in this paper.

  14. Hyaluronic acid abrogates nitric oxide-dependent stimulation of collagen degradation in cultured human chondrocytes.

    Science.gov (United States)

    Surazynski, Arkadiusz; Miltyk, Wojciech; Czarnomysy, Robert; Grabowska, Joanna; Palka, Jerzy

    2009-07-01

    Experimental inflammation induced in cultured chondrocytes by inflammatory cytokine IL-1 beta stimulates collagen degradation by metalloproteinases. We propose that nitric oxide (NO) may represent down stream signaling molecule of IL-1-induced collagen degradation in chondrocytes. It was found that IL-1 beta induced the activity of MMP-2 and MMP-9 during the 48 h time course of the experiment, especially after 24h incubation, while DETA/NO, donor of NO, stimulated the process at 12h incubation. The mechanism of IL-1-dependent stimulation of NO production was found at the level of iNOS expression and activation of NF-kappaB. We found that hyaluronic acid (HA) counteracted IL-induced degradation of collagen in chondrocytes. Although, HA by itself had no effect on the metaloproteinases activity, when added to IL-1 beta or DETA/NO treated chondrocytes it contributed to the restoration of the MMPs activity to the control level. The mechanism of this phenomenon involves inhibition of NF-kappaB activation. The data suggest that NO may represent a target molecule for protective effect of hyaluronic acid on interleukin-1-induced stimulation of metaloproteinases activity in cultured human chondrocytes.

  15. A safer and flexible method for the oxygen functionalization of carbon nanotubes by nitric acid vapors

    Energy Technology Data Exchange (ETDEWEB)

    Santangelo, Saveria, E-mail: saveria.santangelo@unirc.it [Dipartimento di Ingegneria Civile, dell’Energia, dell’Ambiente e dei Materiali (DICEAM), Università “Mediterranea”, 89122 Reggio Calabria (Italy); Piperopoulos, Elpida [Dipartimento di Ingegneria Eletronica, Chimica ed Ingegneria Industriale (DIECII), Università di Messina, 98166 Messina (Italy); Fazio, Enza [Dipartimento di Fisica e di Scienze della Terra (DFST), Università di Messina, 98166 Messina (Italy); Faggio, Giuliana [Dipartimento di Ingegneria dell’Informazione, delle Infrastrutture e dell’Energia Sostenibile (DIIES), Università “Mediterranea”, 89122 Reggio Calabria (Italy); Ansari, Shabana [Dipartimento di Ingegneria Eletronica, Chimica ed Ingegneria Industriale (DIECII), Università di Messina, 98166 Messina (Italy); Lanza, Maurizio [Istituto per i Processi Chimico Fisici (IPCF) del CNR, 98158 Messina (Italy); Neri, Fortunato [Dipartimento di Fisica e di Scienze della Terra (DFST), Università di Messina, 98166 Messina (Italy); Messina, Giacomo [Dipartimento di Ingegneria dell’Informazione, delle Infrastrutture e dell’Energia Sostenibile (DIIES), Università “Mediterranea”, 89122 Reggio Calabria (Italy); Milone, Candida [Dipartimento di Ingegneria Eletronica, Chimica ed Ingegneria Industriale (DIECII), Università di Messina, 98166 Messina (Italy)

    2014-06-01

    The functionalization by nitric acid vapors at azeotropic concentration has been recently proposed to eliminate drawbacks of the widely utilized liquid phase functionalization method. This work suggests to exploit the so-called “salt effect” to improve the vapor phase oxidation method in terms of safety and flexibility. Increasing the relative volatility of acid, the addition of Mg(NO{sub 3}){sub 2} salt to the HNO{sub 3} + H{sub 2}O solution allows (i) obtaining vapors with HNO{sub 3} at the azeotropic concentration from a more diluted liquid solution (i.e. operating under safer conditions), and (ii) varying the concentration of HNO{sub 3} in the vapor phase even above the azeotropic concentration limit (with improved process flexibility). High-resolution transmission electron microscopy, thermo-gravimetry, Raman spectroscopy and X-ray photoemission spectroscopy systematic analyses are carried out on pristine and oxidized nanotubes in order to assess their functionalization degree, surface chemistry and structural evolution. The most relevant finding of this preliminary study is that the nanotube functionalization extent increases linearly with the HNO{sub 3} vapor concentration.

  16. Foliar loading and metabolic assimilation of dry deposited nitric acid air pollutants by trees.

    Science.gov (United States)

    Padgett, Pamela E; Cook, Hillary; Bytnerowicz, Andrzej; Heath, Robert L

    2009-01-01

    Dry deposition of nitric acid vapor (HNO(3)) is a major contributor to eutrophication of natural ecosystems. Although soil fertilization by nitrogen deposition is considered to be the primary pathway for changes in plant nutrient status and shifts in ecological structure, the aerial portion of plants offer many times the surface area in which to collect atmospheric HNO(3). As much as 60% of deposited nitrogen may be retained in the canopy and not land on the soil surface below. Although uptake and assimilation appears to contribute to retention, only a small percentage of dry deposition is recovered in assimilated N pools. To test the importance of biological activity on the process and measurements of dry deposition, we used controlled environmental chambers to compare deposition to living and freeze-dried foliage of four tree species using (15)N-labeled HNO(3). In living trees, assimilation was determined by (15)N incorporation into free amino acids and proteins in leaves and roots. From 10% to 60% of the retained HNO(3) was incorporated into the biologically active nitrogen pool. The remainder was bound to foliar surfaces in an insoluble form in either living or freeze-dried foliage. The importance of the boundary layer conditions emerged as a primary factor controlling dry deposition characteristics and measurements.Trade names and commercial enterprises or products are mentioned solely for information. No endorsements by the U.S. Department of Agriculture are implied.

  17. Treatment process for a surface-active nitric acid solution used for rinsing nuclear installations

    Energy Technology Data Exchange (ETDEWEB)

    Celles, Caroline; Bisel, Isabelle; Gastaldi, Michel; Rudloff, David [CEA Valrho/DEN/VRH/DRCP/SCPS/LPCP, BP 17171, Bagnols sur Ceze cedex, 30207 (France)

    2008-07-01

    Full text of publication follows: The rinsing of the nuclear fuel reprocessing plants before their final shut-down and their dismantling is considered by the use of surface-active compounds in nitric acid medium. Before being vitrified, this solution must be mineralized and concentrated. Two treatments ways have been studied: The first was to act a direct concentration followed up by a mineralization through the Fenton reaction. The second way proposed to begin with the mineralization followed up by a concentration with denitration. The second way was not kept since laboratory tests showed organic phase demixion in distillate which is difficult to manage in industrial plants. The study presents the performance Fenton reaction with a new surface-active solution. In order to be representative of real solution in these nuclear installations to rinse, some hypothesis have been established concerning cations and TBP concentrations, likely to be present in the installation. Influences of parameters like temperature, the nature of the Fenton catalyst, the catalyst concentration, and the concentration of surface-active species were tested. The study highlight the kinetics of the mineralization, the H{sub 2}O{sub 2} consumption, the degradation products of surface-active compounds and TBP. Finally optimized operating conditions have been proposed and a reference test has been performed showing a mineralization out put of about 90% for 167 hours of reaction. Added H{sub 2}O{sub 2} leads to dilute the medium by a factor 2. The main degradation products obtained at the end of reaction are acetic, formic and phosphoric acids. Contrary to acetic and formic acid which will probably be destroyed during following concentration, phosphoric acid behaviour has to be studied in plutonium containing solutions. This study is still in progress. (authors)

  18. Diabetic HDL-associated myristic acid inhibits acetylcholine-induced nitric oxide generation by preventing the association of endothelial nitric oxide synthase with calmodulin.

    Science.gov (United States)

    White, James; Guerin, Theresa; Swanson, Hollie; Post, Steven; Zhu, Haining; Gong, Ming; Liu, Jun; Everson, William V; Li, Xiang-An; Graf, Gregory A; Ballard, Hubert O; Ross, Stuart A; Smart, Eric J

    2008-01-01

    In the current study, we examined whether diabetes affected the ability of HDL to stimulate nitric oxide (NO) production. Using HDL isolated from both diabetic humans and diabetic mouse models, we found that female HDL no longer induced NO synthesis, despite containing equivalent amounts of estrogen as nondiabetic controls. Furthermore, HDL isolated from diabetic females and males prevented acetylcholine-induced stimulation of NO generation. Analyses of both the human and mouse diabetic HDL particles showed that the HDLs contained increased levels of myristic acid. To determine whether myristic acid associated with HDL particles was responsible for the decrease in NO generation, myristic acid was added to HDL isolated from nondiabetic humans and mice. Myristic acid-associated HDL inhibited the generation of NO in a dose-dependent manner. Importantly, diabetic HDL did not alter the levels of endothelial NO synthase or acetylcholine receptors associated with the cells. Surprisingly, diabetic HDL inhibited ionomycin-induced stimulation of NO production without affecting ionomycin-induced increases in intracellular calcium. Further analysis indicated that diabetic HDL prevented calmodulin from interacting with endothelial NO synthase (eNOS) but did not affect the activation of calmodulin kinase or calcium-independent mechanisms for stimulating eNOS. These studies are the first to show that a specific fatty acid associated with HDL inhibits the stimulation of NO generation. These findings have important implications regarding cardiovascular disease in diabetic patients.

  19. Expression, solubilisation, and purification of a functional CMP-sialic acid transporter in Pichia pastoris.

    Science.gov (United States)

    Maggioni, Andrea; Hadley, Barbara; von Itzstein, Mark; Tiralongo, Joe

    2014-09-01

    Membrane proteins, including solute transporters play crucial roles in cellular function and have been implicated in a variety of important diseases, and as such are considered important targets for drug development. Currently the drug discovery process is heavily reliant on the structural and functional information discerned from high-resolution crystal structures. However, membrane protein structure determination is notoriously difficult, due in part to challenges faced in their expression, solubilisation and purification. The CMP-sialic acid transporter (CST) is considered to be an attractive target for drug discovery. CST inhibition reduces cancer cell sialylation and decreases the metastatic potential of cancer cells and to date, no crystal structure of the CST, or any other nucleotide sugar transporter exists. Here we describe the optimised conditions for expression in Pichia pastoris, solubilisation using n-nonyl β-d-maltopyranoside (NM) and single step purification of a functional CST. Importantly we show that despite being able to solubilise and purify the CST using a number of different detergents, only NM was able to maintain CST functionality.

  20. Deep Eutectic Solvents Modified Molecular Imprinted Polymers for Optimized Purification of Chlorogenic Acid from Honeysuckle.

    Science.gov (United States)

    Li, Guizhen; Wang, Wei; Wang, Qian; Zhu, Tao

    2016-02-01

    Deep eutectic solvents (DES) were synthesized with choline chloride (ChCl), and DES modified molecular imprinted polymers (DES-MIPs), DES modified non-imprinted polymers (DES-NIPs, without template), MIPs and NIPs were prepared in an identical procedure. Fourier transform infrared spectrometer (FT-IR) and field emission scanning electron microscopy (FE-SEM) were used to characterize the obtained polymers. Rebinding experiment and solid-phase extraction (SPE) were used to prove the high selectivity adsorption properties of the polymers. Box-Behnken design (BBD) with three factors was used to optimize the extraction condition of chlorogenic acid (CA) from honeysuckles. The optimum extraction conditions were found to be ultrasonic time optimized (20 min), the volume fraction of ethanol (60%) and ratio of liquid to material (15 mL g(-1)). Under these conditions, the mean extraction yield of CA was 12.57 mg g(-1), which was in good agreement with the predicted BBD model value. Purification of hawthorn extract was achieved by SPE process, and SPE recoveries of CA were 72.56, 64.79, 69.34 and 60.08% by DES-MIPs, DES-NIPs, MIPs and NIPs, respectively. The results showed DES-MIPs had potential for promising functional adsorption material for the purification of bioactive compounds.

  1. Expression, purification and crystallization of an atypical class C acid phosphatase from Mycoplasma bovis.

    Science.gov (United States)

    Singh, Harkewal; Reilly, Thomas J; Calcutt, Michael J; Tanner, John J

    2011-10-01

    Class C acid phosphatases (CCAPs) are 25-30 kDa bacterial surface proteins that are thought to function as broad-specificity 5',3'-nucleotidases. Analysis of the newly published complete genome sequence of Mycoplasma bovis PG45 revealed a putative CCAP with a molecular weight of 49.9 kDa. The expression, purification and crystallization of this new family member are described here. Standard purification procedures involving immobilized metal-ion affinity chromatography and ion-exchange chromatography yielded highly pure and crystallizable protein. Crystals were grown in sitting drops at room temperature in the presence of PEG 3350 and HEPES buffer pH 7.5 and diffracted to 2.3 Å resolution. Analysis of diffraction data suggested a primitive monoclinic space group, with unit-cell parameters a = 78, b = 101, c = 180 Å, β = 92°. The asymmetric unit is predicted to contain six molecules, which are likely to be arranged as three dimers.

  2. The effect of fatty acid surfactants on the uptake of nitric acid to deliquesced NaCl aerosol

    Directory of Open Access Journals (Sweden)

    M. Ammann

    2008-09-01

    Full Text Available Surface active organic compounds have been observed in marine boundary layer aerosol. Here, we investigate the effect such surfactants have on the uptake of nitric acid (HNO3, an important removal reaction of nitrogen oxides in the marine boundary layer. The uptake of gaseous HNO3 on deliquesced NaCl aerosol was measured in a flow reactor using HNO3 labelled with the short-lived radioactive isotope 13N. The uptake coefficient γ on pure deliquesced NaCl aerosol was γ=0.5±0.2 at 60% relative humidity and 30 ppb HNO3(g. The uptake coefficient was reduced by a factor of 5–50 when the aerosol was coated with saturated linear fatty acids with carbon chain lengths of 18 and 15 atoms in monolayer quantities. In contrast, neither shorter saturated linear fatty acids with 12 and 9 carbon atoms, nor coatings with the unsaturated oleic acid (C18, cis-double bond had a detectable effect on the rate of HNO3 uptake. It is concluded that it is the structure of the monolayers formed, which determines their resistance towards HNO3 uptake. Fatty acids (C18 and C15, which form a highly ordered film in the so-called liquid condensed state, represent a significant barrier towards HNO3 uptake, while monolayers of shorter-chain fatty acids (C9, C12 and of the unsaturated oleic acid form a less ordered film in the liquid expanded state and do not hinder the uptake. Similarly, high contents of humic acids in the aerosol, a structurally inhomogeneous, quite water soluble mixture of oxidised high molecular weight organic compounds did not affect HNO3 uptake. As surfactant films on naturally occurring aerosol are expected to be less structured due to their chemical inhomogeneity, it is likely that their inhibitory effect on HNO3 uptake is smaller than that observed here for the C15 and C18 fatty acid monolayers.

  3. Effect of ascorbic acid supplementation on nitric oxide metabolites and systolic blood pressure in rats exposed to lead.

    Science.gov (United States)

    Mohammad, Amani; Ali, Noroozzadeh; Reza, Badalzadeh; Ali, Khoshbaten

    2010-04-01

    Extended exposure to low levels of lead causes high blood pressure in human and laboratory animals. The mechanism is not completely recognized, but it is relatively implicated with generation of free radicals, oxidant agents such as ROS, and decrease of available nitric oxide (NO). In this study, we have demonstrated the effect of ascorbic acid as an antioxidant on nitric oxide metabolites and systolic blood pressure in rats exposed to low levels of lead. The adult male Wistar rats weighing 200-250 g were divided into four groups: control, lead acetate (receiving 100 ppm lead acetate in drinking water), lead acetate plus ascorbic acid (receiving 100 ppm lead acetate and 1 g/l ascorbic acid in drinking water), and ascorbic acid (receiving 1 g/l ascorbic acid in drinking water) groups. The animals were anesthetized with ketamin/xylazine (50 and 7 mg/kg, respectively, ip) and systolic blood pressure was then measured from the tail of the animals by a sphygmomanometer. Nitric oxide levels in serum were measured indirectly by evaluation of its stable metabolites (total nitrite and nitrate (NOchi)). After 8 and 12 weeks, systolic blood pressure in the lead acetate group was significantly elevated compared to the control group. Ascorbic acid supplementation could prevent the systolic blood pressure rise in the lead acetate plus ascorbic acid group and there was no significant difference relative to the control group. The serum NOchi levels in lead acetate group significantly decreased in relation to the control group, but this reduction was not significantly different between the lead acetate plus ascorbic acid group and the control group. Results of this study suggest that ascorbic acid as an antioxidant prevents the lead induced hypertension. This effect may be mediated by inhibition of NOchi oxidation and thereby increasing availability of NO.

  4. Effect of ascorbic acid supplementation on nitric oxide metabolites and systolic blood pressure in rats exposed to lead

    Directory of Open Access Journals (Sweden)

    Mohammad Amani

    2010-01-01

    Full Text Available Background: Extended exposure to low levels of lead causes high blood pressure in human and laboratory animals. The mechanism is not completely recognized, but it is relatively implicated with generation of free radicals, oxidant agents such as ROS, and decrease of available nitric oxide (NO. In this study, we have demonstrated the effect of ascorbic acid as an antioxidant on nitric oxide metabolites and systolic blood pressure in rats exposed to low levels of lead. Materials and Methods: The adult male Wistar rats weighing 200-250 g were divided into four groups: control, lead acetate (receiving 100 ppm lead acetate in drinking water, lead acetate plus ascorbic acid (receiving 100 ppm lead acetate and 1 g/l ascorbic acid in drinking water, and ascorbic acid (receiving 1 g/l ascorbic acid in drinking water groups. The animals were anesthetized with ketamin/xylazine (50 and 7 mg/kg, respectively, ip and systolic blood pressure was then measured from the tail of the animals by a sphygmomanometer. Nitric oxide levels in serum were measured indirectly by evaluation of its stable metabolites (total nitrite and nitrate (NOc. Results: After 8 and 12 weeks, systolic blood pressure in the lead acetate group was significantly elevated compared to the control group. Ascorbic acid supplementation could prevent the systolic blood pressure rise in the lead acetate plus ascorbic acid group and there was no significant difference relative to the control group. The serum NOc levels in lead acetate group significantly decreased in relation to the control group, but this reduction was not significantly different between the lead acetate plus ascorbic acid group and the control group. Conclusion: Results of this study suggest that ascorbic acid as an antioxidant prevents the lead induced hypertension. This effect may be mediated by inhibition of NOc oxidation and thereby increasing availability of NO.

  5. Evaluation of nitric and acetic acid resistance of cement mortars containing high-volume black rice husk ash.

    Science.gov (United States)

    Chatveera, B; Lertwattanaruk, P

    2014-01-15

    This paper presents the performance of cement mortar containing black rice husk ash (BRHA) under nitric and acetic acid attacks. The BRHA, collected from an electrical generating power plant that uses rice husk as fuel, was ground using a grinding machine. The compressive strength loss, weight loss, and expansion of mortars under nitric and acetic acid attack were investigated. The test results of BRHA properties in accordance with the ASTM C 618 standard found that the optimal grinding time was 4 h as this achieved a Blaine fineness of 5370 cm(2)/g. For parametric study, BRHA were used as a Portland cement Type 1 replacement at the levels of 0%, 10%, 20%, 30%, 40%, and 50% by weight of binder. The water-to-binder ratios were 0.55, 0.60, and 0.65. From test results, when the percentage replacements of BRHA in cement increased, it was observed that the strength loss and weight loss of mortars containing BRHA under acetic acid attack were higher than those of the mortars against nitric acid attack. It was found that, of the various BHRA mortars, the strength loss and weight loss due to nitric and acetic acid attacks were the lowest in the mortar with 10% BRHA replacement. For 10%, 20% and 30% BRHA replacements, the rate of expansion of the BRHA mortar decreased when compared with the control mortar. For the mortars with other percentage replacements of BRHA, the rate of expansion increased. Furthermore, the effective water-to-binder ratios of control and BRHA mortars were the primary factor for determining the durability of mortar mixed with BRHA.

  6. Fermentation and purification strategies for the production of betulinic acid and its lupane-type precursors in Saccharomyces cerevisiae

    DEFF Research Database (Denmark)

    Czarnotta, Eik; Dianat, Mariam; Korf, Marcel

    2017-01-01

    from the bark of plane tree or birch. Here, we reengineered the reported betulinic acid pathway into S. cerevisiae and used this novel strain to develop efficient fermentation and product purification methods. Fed-batch cultivations with ethanol excess, using either an ethanol-pulse feed or controlling....../L and total triterpenoid concentrations of 854 mg/L, the highest concentrations reported so far. Purification of lupane-type triterpenoids with high selectivity and yield was achieved by solid-liquid extraction without prior cell disruption using polar aprotic solvents such as acetone or ethyl acetate...

  7. Purification Techniques of Bacteriocins from Lactic Acid Bacteria and Other Gram-Positive Bacteria

    Science.gov (United States)

    Saavedra, Lucila; Sesma, Fernando

    The search for new antimicrobial peptides produced by lactic acid ­bacteria and other Gram-positive microorganisms has become an interesting field of research in the past decades. The fact that bacteriocins are active against numerous foodborne and human pathogens, are produced by generally regarded as safe (GRAS) microorganisms, and are readily degraded by proteolytic host systems makes them attractive candidates for biotechnological applications. However, before suggesting or choosing a new bacteriocin for future technology developments, it is necessary to elucidate its biochemical structure and its mode of action, which may be carried out once the bacteriocin is purified to homogeneity. This chapter focuses on describing the main strategies used for the purification of numerous bacteriocins.

  8. Involvement of nitric oxide in the signal transduction of salicylic acid regulating stomatal movement

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The effects and the relationship between salicylic acid (SA) and nitric oxide (NO) on Vicia faba L. stomatal movement were studied. The results here showed that exogenous SA and NO induced stomatal closure, 100 μmol/L SA induced a rapid and striking NO increase in the cytosol of guard cells. This phenomenon was largely pre-vented by 200 μmol/L 2-phenyl-4,4,5,5-tetramethylimida-zoline-1-oxyl-3-oxide (PTIO), a specific NO scavenger, and 25 μmol/L NG-nitro-L-Arg-methyl eater (L-NAME), an in-hibitor of NO synthase (NOS) in mammalian cells that also inhibits plant NOS. In addition, SA-induced stomatal closure was largely prevented by PTIO and L-NAME. These results provide evidence that guard cells generate NO in response to SA via NOS-like activity, and that such NO production is required for full stomatal closure in response to SA. H-(1,2,4)-oxadiazole-[4,3-α]quinoxalin-1-one (ODQ), an inhibitor of guanylate cyclase, and nicotinamide, an antago-nist of cADPR production, inhibited the effects of SA- and NO-induced stomatal closure. It suggests that both cGMP and cADPR might mediate the signal transduction of SA and NO-induced stomatal closure.

  9. Sphere of influence of indole acetic acid and nitric oxide in bacteria.

    Science.gov (United States)

    Koul, Vatsala; Adholeya, Alok; Kochar, Mandira

    2015-05-01

    Bacterial biosynthesis of the phytohormone, indole-3-acetic acid (IAA) is well established and along with the diffusible gaseous molecule, nitric oxide (NO) is known to positively regulate the developmental processes of plant roots. IAA and NO act as signaling molecules in plant-microbe interactions as they modulate the gene expression in both, plants and microorganisms. Although IAA and NO may not be required for essential bacterial physiological processes, numerous studies point towards a crosstalk between IAA and NO in the rhizosphere. In this review, we describe various IAA and NO-responsive or sensing genes/proteins/regulators. There is also growing evidence for the interaction of IAA and NO with other plant growth regulators and the involvement of NO with the quorum sensing system in biofilm formation and virulence. This interactive network can greatly impact the host plant-microbe interactions in the soil. Coupled with this, the specialized σ(54) -dependent transcription observed in some of the IAA and NO-influenced genes can confer inducibility to these traits in bacteria and may allow the expression of IAA and NO-influenced microbial genes in nutrient limiting or changing environmental conditions for the benefit of plants.

  10. Characteristic of wet method of phosphorus recovery from polish sewage sludge ash with nitric acid

    Directory of Open Access Journals (Sweden)

    Gorazda Katarzyna

    2016-01-01

    Full Text Available Sewage Sludge Ash (SSA is a concentrated source of phosphorus and can be successfully recycled via a number of different routes. This paper presents research results on phosphorus recovery from differently combusted sewage sludge with the use of nitric acid extraction. Different SSA forms from Polish thermal utilization stations were compared. It was revealed that sewage treatment technology as well as combustion technology influence many physical and chemical parameters of ashes that are crucial for further phosphorus recovery from such waste according to the proposed method. Presented research defines extraction efficiency, characterized extracts composition and verifies the possibility of using SSA as cheaper and alternative sources of phosphorus compounds. Gdynia, Kielce and Kraków SSA have the best properties for the proposed technology of phosphorus recovery with high extraction efficiency greater than 86%. Unsuitable results were obtained for Bydgoszcz, Szczecin Slag and Warszawa SSA. Extraction process for Łódź and Szczecin Dust SSA need to be improved for a higher phosphorus extraction efficiency greater than 80%.

  11. Effects of composite restorations on nitric oxide and uric acid levels in saliva

    Directory of Open Access Journals (Sweden)

    Nilgun Akgul

    2015-01-01

    Full Text Available Background and Aims: Dental materials that are used in dentistry should be harmless to oral tissues, and should, therefore, not contain any leachable toxic and diffusible substances capable of causing side effects. This study was intended to investigate the effects on salivary nitric oxide (NO and uric acid (UA levels after application of dental composite filling materials to healthy volunteers. Materials and Methods: A total of 52 individuals (32 female and 20 male participated in the study. Filtek Z250 composite filling material (3M ESPE, St Paul, MN, USA was applied to healthy volunteers. Saliva samples were collected before restoration (baseline and 1 h, 1-day, 7 days, and 30 days after restoration. NO concentrations were measured using the Griess reaction method, and UA was measured using an enzymatic method. Data were analyzed using repeated measures ANOVA and the Bonferroni post-hoc test (α =5%. Results: NO values increased statistically significant after 7 days (P 0.05. There was no correlation between NO and UA levels in saliva (P > 0.05. Conclusion: Composite resins activated the antioxidant system in saliva. However, further studies are now needed to confirm our findings and to permit a definitive conclusion.

  12. Ambient concentrations of atmospheric ammonia, nitrogen dioxide and nitric acid in an intensive agricultural region

    Science.gov (United States)

    Zbieranowski, Antoni L.; Aherne, Julian

    2013-05-01

    The spatial and temporal distribution of ambient atmospheric gaseous reactive nitrogen (Nr) species concentrations (ammonia [NH3], nitrogen dioxide [NO2] and nitric acid [HNO3]) were measured at the field scale in an intensive agricultural region in southern Ontario, Canada. Atmospheric concentrations were measured with the Willems badge diffusive passive sampler (18 sites for NH3, 9 sites for NO2 and HNO3) for one year (April 2010-March 2011; under a two week measurement frequency) within a 15 km × 15 km area. Dry deposition was calculated using the inferential method and estimated across the entire study area. The spatial distribution of emission sources associated with agricultural activity resulted in high spatial variability in annual average ambient NH3 concentrations (8 μg m-3 within a 2 km distance, coefficient of variation ˜50%) and estimated dry deposition (4-13 kg N ha-1 yr-1) between sample sites. In contrast, ambient concentrations and deposition of both NO2 (˜5.2->6.5 μg m-3; 1.0-1.5 kg N ha-1 yr-1) and HNO3 (0.6-0.7 μg m-3; 0.5-1 kg N ha-1 yr-1) had low variability (coefficient of variation mycorrhiza and ground vegetation within adjacent semi-natural ecosystems (estimated at ˜10% of the study area).

  13. Investigations of the inhibition of copper corrosion in nitric acid solutions by ketene dithioacetal derivatives

    Energy Technology Data Exchange (ETDEWEB)

    Fiala, A. [Laboratoire de chimie moleculaire du controle de l' environnement et des mesures physico-chimiques, faculte des sciences exactes, universite Mentouri-Constantine, route de Ain-El-Bey, Constantine (Algeria)], E-mail: abdelfiala@yahoo.fr; Chibani, A. [Laboratoire de chimie moleculaire du controle de l' environnement et des mesures physico-chimiques, faculte des sciences exactes, universite Mentouri-Constantine, route de Ain-El-Bey, Constantine (Algeria); Darchen, A. [Laboratoire d' electrochimie, ecole nationale superieure de chimie de Rennes, avenue du general-Leclerc, 35700 Rennes (France); Boulkamh, A.; Djebbar, K. [Laboratoire de chimie moleculaire du controle de l' environnement et des mesures physico-chimiques, faculte des sciences exactes, universite Mentouri-Constantine, route de Ain-El-Bey, Constantine (Algeria)

    2007-10-15

    Ketene dithioacetal derivatives, namely 3-[bis(methylthio)methylene] pentane-2,4-dione (1), 3-(1,3-dithian-2-ylidene) pentane-2,4-dione (2) and 3-(1,3-dithiolan-2-ylidene) pentane-2,4-dione (3) were synthesized and their respective capacity to inhibit copper corrosion in 3 M HNO{sub 3} was investigated by means of weight loss, potentiodynamic polarization, scanning electron microscopy (SEM) and energy dispersive X-ray fluorescence (XRF). The obtained results indicate that the addition of these compounds significantly decreases the corrosion rate. Potentiodynamic polarization studies clearly showed that the inhibition efficiency increases with increasing concentration of the investigated compounds at a fixed temperature, but decreases with increasing temperature. These results on the whole showed that the studied substances are good cathodic inhibitors for copper corrosion in nitric acid medium. SEM and energy dispersive X-ray (EDAX) examination of the copper surface revealed that these compounds prevented copper from corrosion by adsorption on its surface to form a protective film, which acts as a barrier to aggressive agents. The presence of these organic compounds adsorbed on the electrode surface was confirmed by XRF investigations.

  14. Heterogeneous formation of polar stratospheric clouds – Part 1: Nucleation of nitric acid trihydrate (NAT

    Directory of Open Access Journals (Sweden)

    C. R. Hoyle

    2013-09-01

    Full Text Available Satellite-based observations during the Arctic winter of 2009/2010 provide firm evidence that, in contrast to the current understanding, the nucleation of nitric acid trihydrate (NAT in the polar stratosphere does not only occur on preexisting ice particles. In order to explain the NAT clouds observed over the Arctic in mid-December 2009, a heterogeneous nucleation mechanism is required, occurring via immersion freezing on the surface of solid particles, likely of meteoritic origin. For the first time, a detailed microphysical modelling of this NAT formation pathway has been carried out. Heterogeneous NAT formation was calculated along more than sixty thousand trajectories, ending at Cloud Aerosol Lidar with Orthogonal Polarization (CALIOP observation points. Comparing the optical properties of the modelled NAT with these observations enabled a thorough validation of a newly developed NAT nucleation parameterisation, which has been built into the Zurich Optical and Microphysical box Model (ZOMM. The parameterisation is based on active site theory, is simple to implement in models and provides substantial advantages over previous approaches which involved a constant rate of NAT nucleation in a given volume of air. It is shown that the new method is capable of reproducing observed polar stratospheric clouds (PSCs very well, despite the varied conditions experienced by air parcels travelling along the different trajectories. In a companion paper, ZOMM is applied to a later period of the winter, when ice PSCs are also present, and it is shown that the observed PSCs are also represented extremely well under these conditions.

  15. Folic acid supplementation improves microvascular function in older adults through nitric oxide-dependent mechanisms.

    Science.gov (United States)

    Stanhewicz, Anna E; Alexander, Lacy M; Kenney, W Larry

    2015-07-01

    Older adults have reduced vascular endothelial function, evidenced by attenuated nitric oxide (NO)-dependent cutaneous vasodilatation. Folic acid and its metabolite, 5-methyltetrahydrofolate (5-MTHF), are reported to improve vessel function. We hypothesized that (i) local 5-MTHF administration and (ii) chronic folic acid supplementation would improve cutaneous microvascular function in ageing through NO-dependent mechanisms. There were two separate studies in which there were 11 young (Y: 22 ± 1 years) and 11 older (O: 71 ± 3 years) participants. In both studies, two intradermal microdialysis fibres were placed in the forearm skin for local delivery of lactated Ringer's solution with or without 5 mM 5-MTHF. Red cell flux was measured by laser-Doppler flowmetry. Cutaneous vascular conductance [CVC=red cell flux/mean arterial pressure] was normalized as percentage maximum CVC (%CVCmax) (28 mM sodium nitroprusside, local temperature 43°C). In study 1 after CVC plateaued during local heating, 20 mM NG-nitro-L-arginine methyl ester (L-NAME) was perfused at each site to quantify NO-dependent vasodilatation. The local heating plateau (%CVCmax: O = 82 ± 3 vs Y = 96 ± 1, P = 0.002) and NO-dependent vasodilatation (%CVCmax: O = 26 ± 6% vs Y = 49 ± 5, P = 0.03) were attenuated in older participants. 5-MTHF augmented the overall (%CVCmax = 91 ± 2, P = 0.03) and NO-dependent (%CVCmax = 43 ± 9%, P = 0.04) vasodilatation in older but not young participants. In study 2 the participants ingested folic acid (5 mg/day) or placebo for 6 weeks in a randomized, double-blind, crossover design. A rise in oral temperature of 1°C was induced using a water-perfused suit, body temperature was held and 20 mM L-NAME was perfused at each site. Older participants had attenuated reflex (%CVCmax: O = 31 ± 8 vs Y = 44 ± 5, P = 0.001) and NO-dependent (%CVCmax: O = 9 ± 2 vs Y = 21 ± 2, P = 0.003) vasodilatation. Folic acid increased CVC (%CVCmax = 47 ± 5%, P = 0.001) and NO

  16. 硝酸装置铂网中毒的处理及预防措施%Treatment and Precautionary Measures of Platinum Gauze Poisoning in Nitric Acid Unit

    Institute of Scientific and Technical Information of China (English)

    刘多恩

    2014-01-01

    The dual-pressure dilute nitric acid production process flow sheet and affected location of platinum gauze poisoning are introduced, process conditions and causes for platinum gauze iron poisoning, oil poisoning and ash poisoning are analyzed.In connection with platinum gauze poisoning happened in nitric acid unit, relevant precautionary measures are proposed, i.e., improvement of purification degree of air filter, addition of ammonia filter or update ammonia filter type, and reduction of iron impurities sources.%介绍了双加压法稀硝酸生产工艺流程及铂网中毒后的影响部位,分析了铂网铁中毒、油中毒和灰中毒的工艺状况及原因。针对硝酸装置出现过的铂网中毒现象,提出了相应的预防措施,即提高空气过滤器的净化度、增设氨过滤器或更新氨过滤器型式、减少铁杂质的来源。

  17. Corrosion investigations on zircaloy-4 and titanium dissolver materials for MOX fuel dissolution in concentrated nitric acid containing fluoride ions

    Energy Technology Data Exchange (ETDEWEB)

    Jayaraj, J.; Krishnaveni, P.; Krishna, D. Nanda Gopala; Mallika, C.; Mudali, U. Kamachi, E-mail: kamachi@igcar.gov.in

    2016-05-15

    Aqueous reprocessing of plutonium-rich mixed oxide fuels require fluoride as a dissolution catalyst in boiling nitric acid for an effective dissolution of the spent fuel. High corrosion rates were obtained for the candidate dissolver materials zircaloy-4 (Zr-4) and commercial pure titanium (CP-Ti grade 2) in boiling 11.5 M HNO{sub 3} + 0.05 M NaF. Complexing the fluoride ions either with Al(NO{sub 3}){sub 3} or ZrO(NO{sub 3}){sub 2} aided in decreasing the corrosion rates of Zr-4 and CP-Ti. From the obtained corrosion rates it is concluded that CP-Ti is a better dissolver material than Zr-4 for extended service life in boiling 11.5 M HNO{sub 3} + 0.05 M NaF, when complexed with 0.15 M ZrO(NO{sub 3}){sub 2}. XPS analysis confirmed the presence of TiO{sub 2} and absence of fluoride on the surface of CP-Ti samples, indicating that effective complexation had occurred in solution leading to passivation of the metal and imparting high corrosion resistance. - Highlights: • Zr-4 and CP-Ti exhibited high corrosion rate in boiling fluorinated nitric acid. • Corrosion rate decreased in fluorinated nitric acid containing ZrO(NO{sub 3}){sub 2} and Al(NO{sub 3}){sub 3}. • High inhibiting efficiency is exhibited by 0.15 M ZrO(NO{sub 3}){sub 2} when compared to Al(NO{sub 3}){sub 3}. • Corrosion rates of CP-Ti were negligible in complexed fluorinated nitric acid. • XPS analysis on CP-Ti confirmed the presence of TiO{sub 2} and absence of fluoride.

  18. Accurate quantification and transformation of arsenic compounds during wet ashing with nitric acid and microwave assisted heating.

    Science.gov (United States)

    Goessler, W; Pavkov, M

    2003-06-01

    Arsenous acid, dimethylarsinic acid (DMA), methylarsonic acid (MA), arsenic acid, arsenobetaine bromide (AB), trimethylarsine oxide (TMAO), arsenocholine iodide (AC), and tetramethylarsonium iodide (TETRA) were heated in a microwave autoclave with nitric acid to 100-300 degrees C. The arsenic compounds in the digests were separated with anion- and cation-exchange chromatography and determined with an inductively coupled plasma mass spectrometer as arsenic-specific detector. Arsenous acid was completely oxidized to arsenic acid at 100 degrees C. For a complete oxidation of MA and DMA to arsenic acid temperatures > 220 degrees C and > 280 degrees C were necessary. AB decomposed to arsenic acid via TMAO. Complete conversion was only obtained after heating the sample for 90 min to 300 degrees C. For a complete conversion of TMAO similar harsh conditions were necessary. AC was already substantially degraded to TMAO, TETRA and two unknown compounds at 100 degrees C. The unknown arsenic compounds were found only in the digests up to 160 degrees C. Quantitative conversion of AC to arsenic acid went also via TMAO. At temperatures above 220 degrees C TETRA started to convert to TMAO, which then was further converted to arsenic acid. To investigate whether the results obtained for the arsenic standards are transferable to real samples, the certified reference material DORM-2 was also heated in nitric acid with variable digestion temperatures and times. For an almost complete conversion of the AB present in DORM-2 90 min at 300 degrees C were necessary. Total organic carbon (TOC) was less or = 260 degrees C for 60 min. UV photo-oxidation of DORM-2 was investigated as an alternative sample decomposition. Only 6% of AB was converted to arsenic acid when DORM-2 was irradiated for 2 h at 1000 W. In contrast to microwave heating substantial amounts of MA were observed as degradation product.

  19. Thermal And Spectroscopic Analyses Of Next Generation Caustic Side Solvent Extraction Solvent Contacted With 3, 8, And 16 Molar Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. F.; Fink, S. D.

    2011-12-07

    A new solvent system referred to as Next Generation Solvent or NGS, has been developed at Oak Ridge National Laboratory for the removal of cesium from alkaline solutions in the Caustic Side Solvent Extraction process. The NGS is proposed for deployment at MCU{sup a} and at the Salt Waste Processing Facility. This work investigated the chemical compatibility between NGS and 16 M, 8 M, and 3 M nitric acid from contact that may occur in handling of analytical samples from MCU or, for 3 M acid, which may occur during contactor cleaning operations at MCU. This work shows that reactions occurred between NGS components and the high molarity nitric acid. Reaction rates are much faster in 8 M and 16 M nitric acid than in 3 M nitric acid. In the case of 16 M and 8 M nitric acid, the nitric acid reacts with the extractant to produce initially organo-nitrate species. The reaction also releases soluble fluorinated alcohols such as tetrafluoropropanol. With longer contact time, the modifier reacts to produce a tarry substance with evolved gases (NO{sub x} and possibly CO). Calorimetric analysis of the reaction product mixtures revealed that the organo-nitrates reaction products are not explosive and will not deflagrate.

  20. Cloning, purification and crystallization of Bacillus anthracis class C acid phosphatase

    Energy Technology Data Exchange (ETDEWEB)

    Felts, Richard L. [Department of Chemistry, University of Missouri-Columbia, Columbia, MO 65211 (United States); Reilly, Thomas J. [Department of Veterinary Pathobiology, University of Missouri-Columbia, Columbia, MO 65211 (United States); Veterinary Medical Diagnostic Laboratory, University of Missouri-Columbia, Columbia, MO 65211 (United States); Calcutt, Michael J. [Department of Veterinary Pathobiology, University of Missouri-Columbia, Columbia, MO 65211 (United States); Tanner, John J., E-mail: tannerjj@missouri.edu [Department of Chemistry, University of Missouri-Columbia, Columbia, MO 65211 (United States); Department of Biochemistry, University of Missouri-Columbia, Columbia, MO 65211 (United States)

    2006-07-01

    Crystallization of a surface-localized acid phosphatase from Bacillus anthracis is reported. Flash annealing increased the high-resolution limit of usable data from 1.8 to 1.6 Å. Cloning, expression, purification and crystallization studies of a recombinant class C acid phosphatase from the Category A pathogen Bacillus anthracis are reported. Large diffraction-quality crystals were grown in the presence of HEPES and Jeffamine ED-2001 at pH 7.0. The crystals belong to space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 53.4, b = 90.1, c = 104.2 Å. The asymmetric unit is predicted to contain two protein molecules with a solvent content of 38%. Two native data sets were collected from the same crystal before and after flash-annealing. The first data set had a mosaicity of 1.6° and a high-resolution limit of 1.8 Å. After flash-annealing, the apparent mosaicity decreased to 0.9° and the high-resolution limit of usable data increased to 1.6 Å. This crystal form is currently being used to determine the structure of B. anthracis class C acid phosphatase with experimental phasing techniques.

  1. Expression, purification and crystallization of class C acid phosphatases from Francisella tularensis and Pasteurella multocida

    Science.gov (United States)

    Singh, Harkewal; Felts, Richard L.; Ma, Li; Malinski, Thomas J.; Calcutt, Michael J.; Reilly, Thomas J.; Tanner, John J.

    2009-01-01

    Class C nonspecific acid phosphatases are bacterial enzymes that are secreted across the cytoplasmic membrane and hydrolyze a variety of phosphomono­esters at acidic pH. These enzymes are of interest for the development of improved vaccines and clinical diagnostic methods. In one case, the category A pathogen Francisella tularensis, the class C phosphatase plays a role in bacterial fitness. Here, the cloning, expression, purification and crystallization methods for the class C acid phosphatases from F. tularensis and Pasteurella multocida are reported. Crystals of the F. tularensis enzyme diffracted to 2.0 Å resolution and belonged to space group C2221, with one enzyme molecule in the asymmetric unit. Crystals of the P. multocida enzyme diffracted to 1.85 Å resolution and belonged to space group C2, with three molecules in the asymmetric unit. Diffraction patterns from crystals of the P. multocida enzyme exhibited multiple interpenetrating reciprocal-space lattices, indicating epitaxial twinning. Despite this aberrance, autoindexing was robust and the data could be satisfactorily processed to 1.85 Å resolution using MOSFLM and SCALA. PMID:19255471

  2. Remedial investigation report on the abandoned nitric acid pipeline at the Oak Ridge Y-12 Plant, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    1993-12-01

    Upper East Fork Poplar Creek OU-2 consists of the Abandoned Nitric Acid Pipeline. This pipeline was installed in 1951 to transport liquid wastes {approximately} 4,800 ft from Buildings 9212, 9215, and 9206 to the S-3 Ponds. Materials known to have been discharged through the pipeline include nitric acid, depleted and enriched uranium, various metal nitrates, salts, and lead skimmings. A total of nineteen locations were chosen to be investigated along the pipeline for the first phase of this Remedial Investigation. Sampling consisted of drilling down to obtain a soil sample at a depth immediately below the pipeline. Additional samples were obtained deeper in the subsurface depending upon the depth of the pipeline, the depth of the water table, and the point of auger refusal. The nineteen samples collected below the pipeline were analyzed by the Y-12 Plant laboratory for metals, nitrate/nitrite, and isotopic uranium. Samples collected from three boreholes were also analyzed for volatile organic compounds because these samples produced a response with organic vapor monitoring equipment. The results of the baseline human health risk assessment for the Abandoned Nitric Acid Pipeline contaminants of potential concern show no unacceptable risks to human health via incidental ingestion of soil, inhalation of dust, dermal contact with the soil, or external exposure to radionuclides in the ANAP soils, under the construction worker and/or the residential land-use scenarios.

  3. Study on reduction and back extraction of Pu(IV) by urea derivatives in nitric acid conditions

    Energy Technology Data Exchange (ETDEWEB)

    Ye, G.A.; Xiao, S.T.; Yan, T.H.; Lin, R.S.; Zhu, Z.W. [China Institute of Atomic Energy, P.O.Box 275(26), Beijing 102413 (China)

    2013-07-01

    The reduction kinetics of Pu(IV) by hydroxyl-semicarbazide (HSC), hydroxyurea (HU) and di-hydroxyurea (DHU) in nitric acid solutions were investigated separately with adequate kinetic equations. In addition, counter-current cascade experiments were conducted for Pu split from U in nitric acid media using three kinds of reductant, respectively. The results show that urea derivatives as a kind of novel salt-free reductant can reduce Pu(IV) to Pu(III) rapidly in the nitric acid solutions. The stripping experimental results showed that Pu(IV) in the organic phase can be stripped rapidly to the aqueous phase by the urea derivatives, and the separation factors of plutonium /uranium can reach more than 10{sup 4}. This indicates that urea derivatives is a kind of promising salt-free agent for uranium/plutonium separation. In addition, the complexing effect of HSC with Np(IV) was revealed, and Np(IV) can be back-extracted by HSC with a separation factor of about 20.

  4. Development of a Quantum Cascade Laser-Based Detector for Ammonia and Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Zahniser, Mark S.; Nelson, David D.; McManus, J. Barry; Shorter, Joanne H.; Herndon, Scott C.; Jimenez, Rodrigo

    2005-12-31

    We have developed a compact, robust, atmospheric trace gas detector based on mid-infrared absorption spectroscopy using pulsed quantum cascade (QC) lasers. The spectrometer is suitable for airborne measurements of ammonia, nitric acid, formaldehyde, formic acid, methane, nitrous oxide, carbon monoxide, nitrogen dioxide and other gases that have line-resolved absorption spectra in the mid-infrared spectral region. The QC laser light source operates near room temperature with thermal electric cooling instead of liquid nitrogen which has been previously required for semiconductor lasers in the mid-infrared spectral region. The QC lasers have sufficient output power so that thermal electric cooled detectors may be used in many applications with lower precision requirements. The instrument developed in this program has been used in several field campaigns from both the Aerodyne Mobile Laboratory and from the NOAA WP3 aircraft. The Phase II program has resulted in more than 10 archival publications describing the technology and its applications. Over 12 instruments based on this design have been sold to research groups in Europe and the United States making the program both a commercial as well as a technological success. Anticipated Benefits The development of a sensitive, cryogen-free, mid-infrared absorption method for atmospheric trace gas detection will have wide benefits for atmospheric and environmental research and broader potential commercial applications in areas such as medical diagnostic and industrial process monitoring of gaseous compounds. Examples include air pollution monitoring, breath analysis, combustion exhaust diagnostics, and plasma diagnostics for semi-conductor fabrication. The substitution of near-room temperature QC lasers for cryogenic lead salt TDLs and the resulting simplifications in instrument design and operation will greatly expand the range of applications.

  5. Fast and Simultaneous Determination of Pu(Ⅳ) and Nitric Acid in Spent Nuclear Fuel Reprocessing Sample by Near Infrared Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    LI; Ding-ming; ZHANG; Li-hua; WANG; Ling; GONG; Yan-ping; FAN; De-jun; YI; Bao-shan; CHEN; Qiang; JI; Yong-chao; WU; Ji-zong

    2013-01-01

    Determination of Pu(Ⅳ)and nitric acid plays significant role in nuclear fuel reprocessing plant to control process accurately and timely.Coupling C-T fixed-type grating with InGaAs detector,a new novel analytical system for simultaneous measurement of nitric acid and Pu(Ⅳ)was developed by our working group.After obtaining near infrared absorptive spectra by the spectroscopic instrument,the spectra data

  6. Interaction of plutonium(iv) with mono-n-butylphosphoric acid in nitric acid solutions and in the system 30% TBP + n-dodecane

    Energy Technology Data Exchange (ETDEWEB)

    Rovnyi, S.I.; Boikova, I.A.; Fedoseev, D.A.; Goncharuk, L.V.; Milovanova, A.S.; Sokhina, L.P.

    1986-03-01

    The methods of elementary and spectrophotometric analysis at the temperature 22 + or - 2 degrees C were used to investigate the interaction of mono-n-butylphosphoric acid (MBPA, H/sub 2/B) with Pu(IV) in nitric acid solutions and in the system 30% TBP + n-dodecane. The conditions of formatin, solubility, and composition of precipitates of MBPA with Pu(OV) were investigated; the effective stability constants K of complexes of Pu(IV) with MBPA of various compositions were determined. The results of the studies are discussed in comparison with the interaction of Zn(IV) with MBPA in nitric acid solutions and in the system 30% TBP + n-dodecane.

  7. Low Temperature Selective Catalytic Reduction of Nitrogen Oxides in Production of Nitric Acid by the Use of Liquid

    Directory of Open Access Journals (Sweden)

    Kabljanac, Ž.

    2011-11-01

    Full Text Available This paper presents the application of low-temperature selective catalytic reduction of nitrous oxides in the tail gas of the dual-pressure process of nitric acid production. The process of selective catalytic reduction is carried out using the TiO2/WO3 heterogeneous catalyst applied on a ceramic honeycomb structure with a high geometric surface area per volume. The process design parameters for nitric acid production by the dual-pressure procedure in a capacity range from 75 to 100 % in comparison with designed capacity for one production line is shown in the Table 1. Shown is the effectiveness of selective catalytic reduction in the temperature range of the tail gas from 180 to 230 °C with direct application of liquid ammonia, without prior evaporation to gaseous state. The results of inlet and outlet concentrations of nitrous oxides in the tail gas of the nitric acid production process are shown in Figures 1 and 2. Figure 3 shows the temperature dependence of the selective catalytic reduction of nitrous oxides expressed as NO2in the tail gas of nitric acid production with the application of a constant mass flow of liquid ammonia of 13,0 kg h-1 and average inlet mass concentration of the nitrous oxides expressed as NO2of 800,0 mgm-3 during 100 % production capacity. The specially designed liquid-ammonia direct-dosing system along with the effective homogenization of the tail gas resulted in emission levels of nitrous oxides expressed as NO2 in tail gas ranging from 100,0 to 185,0 mg m-3. The applied low-temperature selective catalytic reduction of the nitrous oxides in the tail gases by direct use of liquid ammonia is shown in Figure 4. It is shown that low-temperature selective catalytic reduction with direct application of liquid ammonia opens a new opportunity in the reduction of nitrous oxide emissions during nitric acid production without the risk of dangerous ammonium nitrate occurring in the process of subsequent energy utilization of

  8. A comparison of copper and acid site zeolites for the production of nitric oxide for biomedical applications.

    Science.gov (United States)

    Russell, Samantha E; González Carballo, Juan María; Orellana-Tavra, Claudia; Fairen-Jimenez, David; Morris, Russell E

    2017-03-21

    Copper-exchanged and acidic zeolites are shown to produce nitric oxide (NO) from a nitrite source in biologically active (nanomolar) concentrations. Four zeolites were studied; mordenite, ferrierite, ZSM-5 and SSZ-13, which had varying pore size, channel systems and Si/Al ratios. ZSM-5 and SSZ-13 produced the highest amounts of NO in both the copper and acid form. The high activity and regeneration of the copper active sites makes them good candidates for long-term NO production. Initial cytotoxicity tests have shown at least one of the copper zeolites (Cu-SSZ-13) to be biocompatible, highlighting the potential usage within biomedical applications.

  9. DISSOLUTION OF PLUTONIUM METAL USING NITRIC ACID SOLUTIONS CONTAINING POTASSIUM FLUORIDE

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.; Crowder, M.; Bronikowski, M.

    2007-10-15

    The deinventory and deactivation of the Savannah River Site's (SRS's) FB-Line facility required the disposition of approximately 2000 items from the facility's vaults. Plutonium (Pu) scraps and residues which do not meet criteria for conversion to a mixed oxide fuel will be dissolved and the solution stored for subsequent disposition. Some of the items scheduled for dissolution are composite materials containing Pu and tantalum (Ta) metals. The preferred approach for handling this material is to dissolve the Pu metal, rinse the Ta metal with water to remove residual acid, and burn the Ta metal. The use of a 4 M nitric acid (HNO{sub 3}) solution containing 0.2 M potassium fluoride (KF) was initially recommended for the dissolution of approximately 500 g of Pu metal. However, prior to the use of the flowsheet in the SRS facility, a new processing plan was proposed in which the feed to the dissolver could contain up to 1250 g of Pu metal. To evaluate the use of a larger batch size and subsequent issues associated with the precipitation of plutonium-containing solids from the dissolving solution, scaled experiments were performed using Pu metal and samples of the composite material. In the initial experiment, incomplete dissolution of a Pu metal sample demonstrated that a 1250 g batch size was not feasible in the HB-Line dissolver. Approximately 45% of the Pu was solubilized in 4 h. The remaining Pu metal was converted to plutonium oxide (PuO{sub 2}). Based on this work, the dissolution of 500 g of Pu metal using a 4-6 h cycle time was recommended for the HB-Line facility. Three dissolution experiments were subsequently performed using samples of the Pu/Ta composite material to demonstrate conditions which reduced the risk of precipitating a double fluoride salt containing Pu and K from the dissolving solution. In these experiments, the KF concentration was reduced from 0.2 M to either 0.15 or 0.175 M. With the use of 4 M HNO{sub 3} and a reduction in

  10. Metal chelate affinity precipitation: purification of BSA using poly(N-vinylcaprolactam-co-methacrylic acid) copolymers.

    Science.gov (United States)

    Ling, Yuan-Qing; Nie, Hua-Li; Brandford-White, Christopher; Williams, Gareth R; Zhu, Li-Min

    2012-06-01

    This investigation involves the metal chelate affinity precipitation of bovine serum albumin (BSA) using a copper ion loaded thermo-sensitive copolymer. The copolymer of N-vinylcaprolactam with methacrylic acid PNVCL-co-MAA was synthesized by free radical polymerization in aqueous solution, and Cu(II) ions were attached to provide affinity properties for BSA. A maximum loading of 48.1mg Cu(2+) per gram of polymer was attained. The influence of pH, temperature, BSA and NaCl concentrations on BSA precipitation and of pH, ethylenediaminetetraacetic acid (EDTA) and NaCl concentrations on elution were systematically probed. The optimum conditions for BSA precipitation occurred when pH, temperature and BSA concentration were 6.0, 10°C and 1.0 mg/ml, respectively and the most favorable elution conditions were at pH 4.0, with 0.2M NaCl and 0.06 M EDTA. The maximum amounts of BSA precipitation and elution were 37.5 and 33.7 mg BSA/g polymer, respectively. It proved possible to perform multiple precipitation/elution cycles with a minimal loss of polymer efficacy. The results show that PNVCL-co-MAA is a suitable matrix for the purification of target proteins from unfractionated materials.

  11. Cloning, purification and crystallization of Bacillus anthracis class C acid phosphatase

    Science.gov (United States)

    Felts, Richard L.; Reilly, Thomas J.; Calcutt, Michael J.; Tanner, John J.

    2006-01-01

    Cloning, expression, purification and crystallization studies of a recombinant class C acid phosphatase from the Category A pathogen Bacillus anthracis are reported. Large diffraction-quality crystals were grown in the presence of HEPES and Jeffamine ED-2001 at pH 7.0. The crystals belong to space group P212121, with unit-cell parameters a = 53.4, b = 90.1, c = 104.2 Å. The asymmetric unit is predicted to contain two protein molecules with a solvent content of 38%. Two native data sets were collected from the same crystal before and after flash-annealing. The first data set had a mosaicity of 1.6° and a high-resolution limit of 1.8 Å. After flash-annealing, the apparent mosaicity decreased to 0.9° and the high-resolution limit of usable data increased to 1.6 Å. This crystal form is currently being used to determine the structure of B. anthracis class C acid phosphatase with experimental phasing techniques. PMID:16820700

  12. Optimization of conditions to produce nitrous gases by electrochemical reduction of nitric acid; Optimisation des conditions operatoires de production de vapeurs nitreuses par reduction electrochimique d`acide nitrique

    Energy Technology Data Exchange (ETDEWEB)

    Lemaire, M. [CEA Centre d`Etudes Nucleaires de Saclay, 91 -Gif-sur-Yvette (France)]|[CEA Centre d`Etudes de la Vallee du Rhone, 30 -Marcoule (France). Direction du Cycle du Combustible

    1996-11-22

    Gaseous nitrogen oxides (NO and NO{sub 2}) involved as oxidizing agents in nuclear fuel reprocessing can be an produced by electrochemical reduction of nitric acid. This could be an interesting alternative to the usual process because no wastes are generated. Voltammetric studies on a platinum electrode show that two reduction potential regions are observed in concentrated nitric acid solutions, between 0.05 V{sub S}HE and 0.3 V{sub S}HE and O.5 V{sub S}HE and 1 V{sub S}HE. The highest potential region reduction mechanism was studies by: classical micro-electrolysis methods; macro-electrolysis methods; infra-red spectroscopy couplet to electrochemistry. It was determined that the origin of nitric acid reduction is the electrochemical reduction of nitrous acid in nitric oxide which chemically reduces nitric acid. This reaction produces nitrous acid back which indicate an auto-catalytic behaviour of nitric acid reduction mechanism. Nitrogen dioxide evolution during nitric acid reduction can also be explained by an other chemical reaction. In the potential value of platinum electrode is above 0.8 V{sub S}HE, products of the indirect nitric acid reduction are nitrous acid, nitrogen oxide and nitrogen dioxide. Below this value nitric oxide can be reduced in nitrous oxide. Thus the potential value is the most important parameter for the nitrogen oxides production selectivity. However, owing to the auto-catalytic character of the reduction mechanism, potential value can be controlled during intentiostatic industrial electrolysis. (author). 91 refs.

  13. Nitric oxide-releasing poly(lactic-co-glycolic acid)-polyethylenimine nanoparticles for prolonged nitric oxide release, antibacterial efficacy, and in vivo wound healing activity.

    Science.gov (United States)

    Nurhasni, Hasan; Cao, Jiafu; Choi, Moonjeong; Kim, Il; Lee, Bok Luel; Jung, Yunjin; Yoo, Jin-Wook

    2015-01-01

    Nitric oxide (NO)-releasing nanoparticles (NPs) have emerged as a wound healing enhancer and a novel antibacterial agent that can circumvent antibiotic resistance. However, the NO release from NPs over extended periods of time is still inadequate for clinical application. In this study, we developed NO-releasing poly(lactic-co-glycolic acid)-polyethylenimine (PEI) NPs (NO/PPNPs) composed of poly(lactic-co-glycolic acid) and PEI/diazeniumdiolate (PEI/NONOate) for prolonged NO release, antibacterial efficacy, and wound healing activity. Successful preparation of PEI/NONOate was confirmed by proton nuclear magnetic resonance, Fourier transform infrared spectroscopy, and ultraviolet/visible spectrophotometry. NO/PPNPs were characterized by particle size, surface charge, and NO loading. The NO/PPNPs showed a prolonged NO release profile over 6 days without any burst release. The NO/PPNPs exhibited potent bactericidal efficacy against methicillin-resistant Staphylococcus aureus (MRSA) and Pseudomonas aeruginosa concentration-dependently and showed the ability to bind on the surface of the bacteria. We also found that the NO released from the NO/PPNPs mediates bactericidal efficacy and is not toxic to healthy fibroblast cells. Furthermore, NO/PPNPs accelerated wound healing and epithelialization in a mouse model of a MRSA-infected wound. Therefore, our results suggest that the NO/PPNPs presented in this study could be a suitable approach for treating wounds and various skin infections.

  14. Modulation of Ionotropic Glutamate Receptors and Acid-Sensing Ion Channels by Nitric Oxide

    Directory of Open Access Journals (Sweden)

    John Q Wang

    2012-05-01

    Full Text Available Ionotropic glutamate receptors (iGluR are ligand-gated ion channels and are densely expressed in broad areas of mammalian brains. Like iGluRs, acid-sensing ion channels (ASIC are ligand (H+-gated channels and are enriched in brain cells and peripheral sensory neurons. Both ion channels are enriched at excitatory synaptic sites, functionally coupled to each other, and subject to the modulation by a variety of signaling molecules. Central among them is a gasotransmitter, nitric oxide (NO. Available data show that NO activity-dependently modulates iGluRs and ASICs via either a direct or an indirect pathway. The former involves a NO-based and cGMP-independent posttranslational modification (S-nitrosylation of extracellular cysteine residues in channel subunits or channel-interacting proteins. The latter is achieved by NO activation of soluble guanylyl cyclase, which in turn triggers an intracellular cGMP-sensitive cascade to indirectly modulate iGluRs and ASICs. The NO modification is usually dynamic and reversible. Modified channels undergo significant, interrelated changes in biochemistry and electrophysiology. Since NO synthesis is enhanced in various neurological disorders, the NO modulation of iGluRs and ASICs is believed to be directly linked to the pathogenesis of these disorders. This review summarizes the direct and indirect modifications of iGluRs and ASICs by NO and analyzes the role of the NO-iGluR and NO-ASIC coupling in cell signaling and in the pathogenesis of certain related neurological diseases.

  15. Ab initio aqueous thermochemistry: application to the oxidation of hydroxylamine in nitric acid solution.

    Science.gov (United States)

    Ashcraft, Robert W; Raman, Sumathy; Green, William H

    2007-10-18

    Ab initio molecular orbital calculations were performed and thermochemical parameters estimated for 46 species involved in the oxidation of hydroxylamine in aqueous nitric acid solution. Solution-phase properties were estimated using the several levels of theory in Gaussian03 and using COSMOtherm. The use of computational chemistry calculations for the estimation of physical properties and constants in solution is addressed. The connection between the pseudochemical potential of Ben-Naim and the traditional standard state-based thermochemistry is shown, and the connection of these ideas to computational chemistry results is established. This theoretical framework provides a basis for the practical use of the solution-phase computational chemistry estimates for real systems, without the implicit assumptions that often hide the nuances of solution-phase thermochemistry. The effect of nonidealities and a method to account for them is also discussed. A method is presented for estimating the solvation enthalpy and entropy for dilute aqueous solutions based on the solvation free energy from the ab initio calculations. The accuracy of the estimated thermochemical parameters was determined through comparison with (i) enthalpies of formation in the gas phase and in solution, (ii) Henry's law data for aqueous solutions, and (iii) various reaction equilibria in aqueous solution. Typical mean absolute deviations (MAD) for the solvation free energy in room-temperature water appear to be ~1.5 kcal/mol for most methods investigated. The MAD for computed enthalpies of formation in solution was 1.5-3 kcal/mol, depending on the methodology employed and the type of species (ion, radical, closed-shell) being computed. This work provides a relatively simple and unambiguous approach that can be used to estimate the thermochemical parameters needed to build detailed ab initio kinetic models of systems in aqueous solution. Technical challenges that limit the accuracy of the estimates are

  16. Densification of ∼5 nm-thick SiO2 layers by nitric acid oxidation

    Science.gov (United States)

    Choi, Jaeyoung; Joo, Soyeong; Park, Tae Joo; Kim, Woo-Byoung

    2017-08-01

    Low-temperature nitric acid (HNO3) oxidation of Si (NAOS) has been used to improve the interface and electrical properties of ∼5 nm-thick SiO2/Si layers produced by plasma-enhanced chemical vapor deposition (PECVD). Investigations of the physical properties and electrical characteristics of these thin films revealed that although their thickness is not changed by NAOS, the leakage current density at a gate bias voltage of -1 V decreases by about two orders of magnitude from 1.868 × 10-5 A/cm2. This leakage current density was further reduced by post-metallization annealing (PMA) at 250 °C for 10 min in a 5 vol.% hydrogen atmosphere, eventually reaching a level (5.2 × 10-8 A/cm2) approximately three orders of magnitude less than the as-grown SiO2 layer. This improvement is attributed to a decrease in the concentration of suboxide species (Si1+, Si2+ and Si3+) in the SiO2/Si interface, as well as a decrease in the equilibrium density of defect sites (Nd) and fixed charge density (Nf). The barrier height (Vt) generated by a Poole-Frenkel mechanism also increased from 0.205 to 0.371 eV after NAOS and PMA. The decrease in leakage current density is therefore attributed to a densification of the SiO2 layer in combination with the removal of OH species and increase in interfacial properties at the SiO2/Si interface.

  17. Rocket Performance of Red Fuming Nitric Acid with Blends of Norbornadiene, Carene and Cardanol

    Directory of Open Access Journals (Sweden)

    R. Chhibber

    1992-07-01

    Full Text Available The fuel blends of nornornadiene and carene (50:50 by weight and norbornadiene, carene and cardanol (40:40:20 by weight exhibit synergistic hypergolic ignition with red fuming nitric acid (RFNA as oxidiser. These fuel blends have been evaluated by theoretical calculations of performance parameters and subsequently verified by static firing in a 10 kg/sub f/ thruster at a chamber pressure of around 20 atm, using RFNA (with 21 per cent N/sub 2/O/sub 4/ by weight as oxidiser. The theoretical calculations show maximum specific impulse and C*values at the O/F, 3 to be 227.8 s and 1598.7 m/s respectively for the norbornadiene-carene blend. The corresponding values for the norbornadiene, carene and cardanol blend were found to be 226.8 s and 1586.0 m/s respectively at the O/F, 4. For theoretical calculations, the chamber pressure (P/sub c and the exit pressure (P/sub e/0 were assumed to be 20 and 1 atm, respectively. The static firing of the propellants in a 10 kg thruster exhibited smooth pressure-time curves with the experimental C* values in close agreement with those calculated and the non-deposition of carbon in the nozzle. This indicated low combustion instability and high combustion efficiency under rocket conditions (> 0.9. The fuel blends with their low cost and toxicity and relatively high density can replace G-fuel used in several Indian missiles without impairing the performance.

  18. Chronic exposure to ozone and nitric acid vapor results in increased levels of rat pulmonary putrescine

    Energy Technology Data Exchange (ETDEWEB)

    Sindhu, R.K.; Kikkawa, Yutaka [Department of Pathology, College of Medicine, University of California at Irvine, Irvine (United States); Mautz, W.J. [Department of Community and Environmental Medicine, University of California at Irvine, Irvine, CA (United States)

    1998-06-01

    In the past decade, there has been growing public concern for the human health effects of exposure to environmental pollutants. Ozone (O{sub 3}) is one of the most reactive components of photochemical air pollution. Despite extensive investigations by many laboratories on the functional, biochemical, and cellular effects of O{sub 3} exposure in humans, animals, and in vitro systems, questions remain concerning the potential adverse effects to human health represented by chronic near-ambient exposure to this environmental pollutant. In the present investigation, the influence of inhalation of O{sub 3} and nitric acid (HNO{sub 3}) vapor on polyamine levels was examined in rat lungs. Male F344/N rats were exposed nose-only to 0.15 ppm O{sub 3} and 50 {mu}g/m{sup 3} HNO{sub 3} vapor alone and in combination for 4 hours/day, 3 days/week for a total of 40 weeks. At this time the animals were sacrificed and their lungs were examined for polyamine contents. Exposure to O{sub 3} and O{sub 3} plus HNO{sub 3} vapor caused a significant increase in the putrescine content of the lung compared to the air-exposed controls (P < 0.05). The concentrations of pulmonary spermidine and spermine were not significantly increased by exposure to either O{sub 3} or HNO{sub 3} vapor alone or in combination compared to the air-exposed controls. The role of polyamines in repair and anti-inflammatory processes has been discussed. (orig.) (orig.) With 1 fig., 1 tab., 30 refs.

  19. Influence of Fe loadings on desulfurization performance of activated carbon treated by nitric acid.

    Science.gov (United States)

    Guo, Jia-Xiu; Shu, Song; Liu, Xiao-Li; Wang, Xue-Jiao; Yin, Hua-Qiang; Chu, Ying-Hao

    2017-02-01

    A series of Fe supported on activated carbon treated by nitric acid are prepared by incipient wetness impregnation with ultrasonic assistance and characterized by N2 adsorption-desorption, X-ray diffraction, Fourier transform infrared spectrum and X-ray photoelectron spectroscopy. It has shown that Fe loadings significantly influence the desulfurization activity. Fe/NAC5 exhibits an excellent removal ability of SO2, corresponding to breakthrough sulfur capacity of 323 mg/g. With the increasing Fe loadings, the generated Fe3O4 and Fe2SiO4 increase, but Fe2(SO4)3 is observed after desulfurization. Fe/NAC1 has a Brunauer-Emmett-Teller (BET) surface area of 925 m(2)/g with micropore surface area of 843 m(2)/g and total pore volume of 0.562 cm(3)/g including a micropore volume of 0.300 cm(3)/g. With the increasing Fe loadings, BET surface area and micropore volume decrease, and those of Fe/NAC10 decrease to 706 m(2)/g and 0.249 cm(3)/g. The Fe loadings influence the pore-size distribution, and SO2 adsorption mainly reacts in micropores at about 0.70 nm. C=O and C-O are observed for all samples before SO2 removal. After desulfurization, the C-O stretching is still detected, but the C=O stretching vibration of carbonyl groups disappears. The stretching of S-O or S=O in sulfate is observed at 592 cm(-1) for the used sample, proving that the existence of [Formula: see text].

  20. Intergranular corrosion testing of austenitic stainless steels in nitric acid solutions

    Energy Technology Data Exchange (ETDEWEB)

    Whillock, G.O.H.; Dunnett, B. F. [British Nuclear Fuels plc, BNFL, B170, Sellafield, Seascale, Cumbria CA20 1PG (United Kingdom)

    2004-07-01

    In hot strong nitric acid solutions, stainless steels exhibit intergranular corrosion. Corrosion rates are often measured from immersion testing of specimens manufactured from the relevant material (e.g. plate or pipe). The corrosion rates, measured from weight loss, are found to increase with time prior to reaching steady state, which can take thousands of hours to achieve. The apparent increase in corrosion rate as a function of time was found to be an artefact due to the surface area of the specimen's being used in the corrosion rate calculations, rather than that of the true area undergoing active corrosion i.e. the grain boundaries. The steady state corrosion rate coincided with the onset of stable grain dropping, where the use of the surface area of the specimen to convert the weight loss measurements to corrosion rates was found to be appropriate. This was confirmed by sectioning of the specimens and measuring the penetration depths. The rate of penetration was found to be independent of time and no induction period was observed. A method was developed to shorten considerably the testing time to reach the steady state corrosion rate by use of a pre-treatment that induces grain dropping. The long-term corrosion rates from specimens which were pre-treated was similar to that achieved after prolonged testing of untreated (i.e. initially ground) specimens. The presence of cut surfaces is generally unavoidable in the simple immersion testing of specimens in test solutions. However, inaccuracy in the results may occur as the measured corrosion rate is often influenced by the orientation of the microstructure, the highest rates typically being observed on the cut surfaces. Two methods are presented which allow deconvolution of the corrosion rates from immersion testing of specimens containing cut surfaces, thus allowing reliable prediction of the long-term corrosion rate of plate surfaces. (authors)

  1. Laboratory evaluation of the effect of nitric acid uptake on frost point hygrometer performance

    Directory of Open Access Journals (Sweden)

    T. Thornberry

    2010-08-01

    Full Text Available Chilled mirror hygrometers (CMH are widely used to measure water vapour in the troposphere and lower stratosphere from balloon-borne sondes. Systematic discrepancies among in situ water vapour instruments have been observed at low water vapour mixing ratios (<5 ppm in the upper troposphere and lower stratosphere (UT/LS. Understanding the source of the measurement discrepancies is important for a more accurate and reliable determination of water vapour abundance in this region. We have conducted a laboratory study to investigate the potential interference of gas-phase nitric acid (HNO3 with the measurement of frost point temperature, and consequently the water vapour mixing ratio, determined by CMH under conditions representative of operation in the UT/LS. No detectable interference in the measured frost point temperature was found for HNO3 mixing ratios of up to 4 ppb for exposure times up to 150 min. HNO3 was observed to co-condense on the mirror frost, with the adsorbed mass increasing linearly with time at constant exposure levels. Over the duration of a typical balloon sonde ascent (90–120 min, the maximum accumulated HNO3 amounts were comparable to monolayer coverage of the geometric mirror surface area, which corresponds to only a small fraction of the actual frost layer surface area. This small amount of co-condensed HNO3 is consistent with the observed lack of HNO3 interference in the frost point measurement because the CMH utilizes significant reductions (>10% in surface reflectivity by the condensate to determine H2O.

  2. Laboratory evaluation of the effect of nitric acid uptake on frost point hygrometer performance

    Directory of Open Access Journals (Sweden)

    T. Thornberry

    2011-02-01

    Full Text Available Chilled mirror hygrometers (CMH are widely used to measure water vapour in the troposphere and lower stratosphere from balloon-borne sondes. Systematic discrepancies among in situ water vapour instruments have been observed at low water vapour mixing ratios (<5 ppm in the upper troposphere and lower stratosphere (UT/LS. Understanding the source of the measurement discrepancies is important for a more accurate and reliable determination of water vapour abundance in this region. We have conducted a laboratory study to investigate the potential interference of gas-phase nitric acid (HNO3 with the measurement of frost point temperature, and consequently the water vapour mixing ratio, determined by CMH under conditions representative of operation in the UT/LS. No detectable interference in the measured frost point temperature was found for HNO3 mixing ratios of up to 4 ppb for exposure times up to 150 min. HNO3 was observed to co-condense on the mirror frost, with the adsorbed mass increasing linearly with time at constant exposure levels. Over the duration of a typical balloon sonde ascent (90–120 min, the maximum accumulated HNO3 amounts were comparable to monolayer coverage of the geometric mirror surface area, which corresponds to only a small fraction of the actual frost layer surface area. This small amount of co-condensed HNO3 is consistent with the observed lack of HNO3 interference in the frost point measurement because the CMH utilizes significant reductions (>10% in surface reflectivity by the condensate to determine H2O.

  3. Microbiological titration of proteins and of single amino acid content in biological materials without purification and hydrolysis.

    Science.gov (United States)

    Puppo, S; Morpurgo, G; Nardi, S; Conti, G

    1978-04-01

    A method is described for the microbiological determination of the protein content of biological materials. This method can also be adopted to titrate the concentration of a single amino acid in the protein and has the following advantages: (1) titration can be done without purification and hydrolysis of proteins; (2) the titration graph is a straight line between 25 and 800 microgram/ml; (3) protein values agree with those obtained using the Kjeldhal method; and (4) each mutant requiring one amino acid may be used to titrate the concentration of a single amino acid of the protein. The leucine content of various kinds of flour was measured with this system.

  4. Synthesis of 14C-labeled perfluorooctanoic and perfluorodecanoic acids; Purification of perfluorodecanoic acid

    Energy Technology Data Exchange (ETDEWEB)

    Reich, I.L.; Reich, H.J.; Menahan, L.A.; Peterson, R.E.

    1987-01-01

    Perfluorooctanoic and -decanoic acids are representative of a series of perfluorinated acids that have been used for a variety of industrial purposes primarily due to their surfactant properties. The toxicity of these compounds is being investigated in a number of laboratories. 14C-labeled materials would be useful in these studies but are not commercially available. Johncock prepared unlabeled PFOA in low yield by carbonation of the unstable perfluoroheptyllithium at -90 degrees Centigrade. We anticipated several problems in applying this procedure to the synthesis of the 14C-labeled material. Johncock's procedure was run on a fairly large scale (10 mmol) with excess CO2.

  5. Current state of purification, isolation and analysis of bacteriocins produced by lactic acid bacteria.

    Science.gov (United States)

    Kaškonienė, Vilma; Stankevičius, Mantas; Bimbiraitė-Survilienė, Kristina; Naujokaitytė, Gintarė; Šernienė, Loreta; Mulkytė, Kristina; Malakauskas, Mindaugas; Maruška, Audrius

    2017-02-01

    The scientific interest for the search of natural means of microbial inhibitors has not faded for several years. A search of natural antibiotics, so-called bacteriocins which are produced by lactic acid bacteria (LAB), gains a huge attention of the scientists in the last century, in order to reduce the usage of synthetic food additives. Pure bacteriocins with wide spectra of antibacterial activity are promising among the natural biopreservatives. The usage of bacteriocin(s) producing LAB as starter culture for the fermentation of some food products, in order to increase their shelf-life, when synthetic preservatives are not allowable, is also possible. There are a lot of studies focusing on the isolation of new bacteriocins from traditional fermented food, dairy products and other foods or sometimes even from unusual non-food matrices. Bacteriocins producing bacteria have been isolated from different sources with the different antibacterial activity against food-borne microorganisms. This review covers the classification of bacteriocins, diversity of sources of bacteriocin(s) producing LAB, antibacterial spectra of isolated bacteriocins and analytical methods for the bacteriocin purification and analysis within the last 15 years.

  6. Separation and purification of γ-aminobutyric acid from fermentation broth by flocculation and chromatographic methodologies.

    Science.gov (United States)

    Gao, Qiang; Duan, Qiang; Wang, Depei; Zhang, Yunze; Zheng, Chunyang

    2013-02-27

    To date, the multifunctional γ-aminobutyric acid (GABA) is mainly produced by microbial fermentation in industry. The purpose of this study was to find an effective method for separation and purification of 31.2 g/L initial GABA from the fermentation broth of Enterococcus raffinosus TCCC11660. To remove the impurities from fermentation broth, flocculation pretreatment using chitosan and sodium alginate was first implemented to facilitate subsequent filtration. Ultrafiltration followed two discontinuous diafiltration steps to effectively remove proteins and macromolecular pigments, and the resulting permeate was further decolored by DA201-CII resin at a high decoloration ratio and GABA recovery. Subsequently, ion exchange chromatography (IEC) with Amberlite 200C resin and gradient elution were applied for GABA separation from glutamate and arginine. Finally, GABA crystals of 99.1% purity were prepared via warm ethanol precipitation twice. Overall, our results reveal that the successive process including flocculation, filtration, ultrafiltration, decoloration, IEC, and crystallization is promising for scale-up GABA extraction from fermentation broth.

  7. The Significance of Lewis Acid Sites for the Selective Catalytic Reduction of Nitric Oxide on Vanadium-Based Catalysts.

    Science.gov (United States)

    Marberger, Adrian; Ferri, Davide; Elsener, Martin; Kröcher, Oliver

    2016-09-19

    The long debated reaction mechanisms of the selective catalytic reduction (SCR) of nitric oxide with ammonia (NH3 ) on vanadium-based catalysts rely on the involvement of Brønsted or Lewis acid sites. This issue has been clearly elucidated using a combination of transient perturbations of the catalyst environment with operando time-resolved spectroscopy to obtain unique molecular level insights. Nitric oxide reacts predominantly with NH3 coordinated to Lewis sites on vanadia on tungsta-titania (V2 O5 -WO3 -TiO2 ), while Brønsted sites are not involved in the catalytic cycle. The Lewis site is a mono-oxo vanadyl group that reduces only in the presence of both nitric oxide and NH3 . We were also able to verify the formation of the nitrosamide (NH2 NO) intermediate, which forms in tandem with vanadium reduction, and thus the entire mechanism of SCR. Our experimental approach, demonstrated in the specific case of SCR, promises to progress the understanding of chemical reactions of technological relevance.

  8. Peptide nucleic acid probe for protein affinity purification based on biotin-streptavidin interaction and peptide nucleic acid strand hybridization.

    Science.gov (United States)

    Tse, Jenny; Wang, Yuanyuan; Zengeya, Thomas; Rozners, Eriks; Tan-Wilson, Anna

    2015-02-01

    We describe a new method for protein affinity purification that capitalizes on the high affinity of streptavidin for biotin but does not require dissociation of the biotin-streptavidin complex for protein retrieval. Conventional reagents place both the selectively reacting group (the "warhead") and the biotin on the same molecule. We place the warhead and the biotin on separate molecules, each linked to a short strand of peptide nucleic acid (PNA), synthetic polymers that use the same bases as DNA but attached to a backbone that is resistant to attack by proteases and nucleases. As in DNA, PNA strands with complementary base sequences hybridize. In conditions that favor PNA duplex formation, the warhead strand (carrying the tagged protein) and the biotin strand form a complex that is held onto immobilized streptavidin. As in DNA, the PNA duplex dissociates at moderately elevated temperature; therefore, retrieval of the tagged protein is accomplished by a brief exposure to heat. Using iodoacetate as the warhead, 8-base PNA strands, biotin, and streptavidin-coated magnetic beads, we demonstrate retrieval of the cysteine protease papain. We were also able to use our iodoacetyl-PNA:PNA-biotin probe for retrieval and identification of a thiol reductase and a glutathione transferase from soybean seedling cotyledons. Copyright © 2014 Elsevier Inc. All rights reserved.

  9. INVESTIGATION OF THE OPTIMUM DISSOLUTION TEMPERATURES OF PHOSPHORUS IN SULPHURIC, NITRIC AND OXALIC ACID SOLUTIONS DURING LEACHING OF IRON OXIDE ORE

    Directory of Open Access Journals (Sweden)

    C. I. NWOYE

    2009-12-01

    Full Text Available Studies were carried out to determine the optimum dissolution temperatures of phosphorus in oxalic, nitric and sulphuric acid solutions during leaching of iron oxide ore. Phosphorus dissolution rates and dissolution per unit rise in temperature were determined and compared to ascertain the preferred acid in terms of effective dephosphorization of iron oxide ore using leaching process. The results of the investigation show that the optimum dissolution temperatures of phosphorus in these acids were found to be 45, 55 and 70ºC respectively. Phosphorus dissolutions per unit rise in temperature in these acid solutions during the increasing and decreasing stage of dissolution were 9.4 and -3.07 mg/kg/ºC 2.88 and -4.7 mg/kg/ºC and also 2.16 and -7.95 mg/kg/ºC respectively. Phosphorus dissolution rates in these acid solutions during the increasing and decreasing stage of dissolution were also determined as 0.67 and -0.13 mg/kg/s, 0.14 and -0.19 mg/kg/s and also 0.1 and 0.44 mg/kg/s for oxalic, nitric and sulphuric acid solutions respectively. This confers to oxalic acid a better dissolution power on phosphorus over nitric and sulphuric acid, followed by nitric acid.

  10. A laboratory study of the heterogeneous reaction of nitric acid on calcium carbonate particles

    Science.gov (United States)

    Goodman, A. L.; Underwood, G. M.; Grassian, V. H.

    2000-12-01

    It has been postulated that the reaction of nitric acid with calcium carbonate, namely, CaCO3(s) + 2HNO3(g) → Ca(NO3)2(s) + CO2(g) + H2O(g), plays an important role in the atmosphere. In this study, transmission FTIR spectroscopy, diffuse reflectance UV-visible spectroscopy, transmission electron microscopy and a Knudsen cell reactor coupled to a quadrupole mass spectrometer have been used to investigate the heterogeneous reactivity of HNO3 on CaCO3 at 295 K as a function of relative humidity. Transmission FTIR spectroscopy was used to probe both gas-phase and adsorbed products and showed that the reaction of HNO3 and CaCO3 is limited to the surface of the CaCO3 particle in the absence of adsorbed water. However, in the presence of water vapor, the reaction is greatly enhanced and is not limited to the surface of the particle producing both solid calcium nitrate and gaseous carbon dioxide. The enhanced reactivity of the particles is attributed to the presence of a layer of adsorbed water on the particle surface. The amount of adsorbed water on the particle surface is strongly dependent on the extent of the reaction. This can be understood in terms of the increased hydrophilicity of calcium nitrate as compared to calcium carbonate. Data from experiments using a mass-calibrated Knudsen cell reactor showed the stoichiometry for the reaction determined from gas-phase species deviated from that expected from the balanced equation. Water adsorption on the particle surface and gases dissolved into the water layer appear to be the cause of this discrepancy. The measured uptake coefficient accounting for the BET area of the sample is determined to be 2.5±0.1×10-4 for HNO3 on CaCO3 under dry conditions and is found to increase in the presence of water vapor. Atmospheric implications of the results presented here are discussed.

  11. Nitric acid in the stratosphere based on Odin observations from 2001 to 2009 – Part 1: A global climatology

    Directory of Open Access Journals (Sweden)

    J. Urban

    2009-09-01

    Full Text Available The Sub-Millimetre Radiometer (SMR on board the Odin satellite, launched in February 2001, observes thermal emissions of stratospheric nitric acid (HNO3 originating from the Earth limb in a band centred at 544.6 GHz. Height-resolved measurements of the global distribution of nitric acid in the stratosphere were performed approximately on two observation days per week. An HNO3 climatology based on more than 7 years of observations from August 2001 to April 2009 covering the vertical range between typically ~19 and 45 km (~1.5–60 hPa or ~500–1800 K in terms of potential temperature was created. The study highlights the spatial and seasonal variation of nitric acid in the stratosphere, characterised by a pronounced seasonal cycle at middle and high latitudes with maxima during late fall and minima during spring, strong denitrification in the lower stratosphere of the Antarctic polar vortex during winter (the irreversible removal of NOy by the sedimentation of cloud particles containing HNO3, as well as large quantities of HNO3 formed every winter at high-latitudes in the middle and upper stratosphere. A strong inter-annual variability is observed in particular at high latitudes. A comparison with a stratospheric HNO3 climatology, based on over 7 years of UARS/MLS (Upper Atmosphere Research Satellite/Microwave Limb Sounder measurements from the 1990s, shows good consistency and agreement of the main morphological features in the potential temperature range ~465 to ~960 K, if the different characteristics of the data sets such as the better altitude resolution of Odin/SMR as well as the slightly different altitude ranges are considered. Odin/SMR reaches higher up and UARS/MLS lower down in the stratosphere. An overview from 1991 to 2009 of stratospheric nitric acid is provided (with a short gap between 1998 and 2001, if the global measurements of both experiments are taken together.

  12. Influence of gas-particle partitioning on ammonia and nitric acid fluxes above a deciduous forest in the Midwestern USA

    DEFF Research Database (Denmark)

    Hansen, Kristina; Sørensen, Lise Lotte; Hornsby, Karen E.

    Quantifying the atmosphere-biosphere exchange of reactive nitrogen gasses (including ammonia (NH3) and nitric acid (HNO3)) is crucial to assessing the impact of anthropogenic activities on natural and semi-natural ecosystems. However, measuring the deposition of reactive nitrogen is challenging due...... are measured above the deciduous forest, Morgan Monroe State Forest (MMSF) in south-central Indiana (39°53’N, 86°25’W) during a field campaign. Two relaxed eddy accumulation (REA) systems are used to measure fluxes and concentrations of NH3 and HNO3 at 44 m. The NH3 REA system operates based on wet effluent...

  13. Effect of Nitric Acid on the Low Fluorescing Performance of Drilling Fluid Lubricant Based Animal and Vegetable Oils

    Directory of Open Access Journals (Sweden)

    Feng-shan Zhou

    2013-01-01

    Full Text Available After synthesis of mixed fatty acid triethanolamine ester surfactant based on animal and vegetable mixed oils, the reaction solution was added into 4% (wt/wt liquid nitric acid or 9% (wt/wt solid nitric acid as eliminating fluorescent agent continuing to react from 1 to 2 hours. The low fluorescence lubricant named E167 for drilling fluid was prepared, in which maximum fluorescence intensity (Fmax was less than 10 in three-dimensional fluorescence spectra of excitation wavelength range. When the E167 was added into fresh water based drilling fluid at the dosage of 0.5% (wt/wt, the sticking coefficient reduced rate (ΔKf is 78% and the extreme pressure (E-P friction coefficient reduced rate (Δf is 79%. In the case of 4% brine mud with 0.5% (wt/wt E167 in it, the ΔKf and Δf are 75% and 62%, respectively. After the hot rolling ageing test 180°C × 16 h with the E167 was added into fresh water based drilling fluid at the dosage of 1% (wt/wt, the ΔKf and Δf are greater than 70%, which shows a much better lubrication properties of strong resistance to high temperature. The fresh water based drilling fluid which contains 1% (wt/wt E167 is almost nonfoaming even after hot rolling ageing 120°C × 16 h.

  14. Comparative analysis of the effect of pretreating aspen wood with aqueous and aqueous-organic solutions of sulfuric and nitric acid on its reactivity during enzymatic hydrolysis

    DEFF Research Database (Denmark)

    Dotsenko, Gleb; Osipov, D. O.; Zorov, I. N.;

    2016-01-01

    The effect of aspen wood pretreatment methods with the use of both aqueous solutions of sulfuric and nitric acids and aqueous-organic solutions (ethanol, butanol) of sulfuric acid (organosolv) on the limiting degree of conversion of this type of raw material into simple sugars during enzymatic...... of ground wood by 300–400%, compared to the initial raw material. Pretreatment with a 4.8% aqueous solution of nitric acid (125°C, 1.8 MPa, 10 min) is shown to be most effective, as it increases the reactivity of the ground aspen wood by more than 500%....

  15. FAME Production from Jatropha curcas Seed Oil via Calcium Oxide Catalyzed Transesterification and its Purification using Acid Activated Bentonite

    Directory of Open Access Journals (Sweden)

    Novizar Nazir

    2013-01-01

    Full Text Available This paper presents the study of transesterification of Jatropha curcas oil (JCO via environmentally benign process using calcium oxide as heterogeneous catalyst.  Response surface methodology (RSM based on central composite design (CCD was performed to optimize three reaction variables in this study.  The transesterification process variables were reaction time, x1 (60 minutes-120 minutes,   molar ratio of methanol: oil, x2 (5:1 – 13:1, and amount of catalyst,  x3 (0.5 % –1.50 % of mass fraction.  Since water washing method is not suitable to purify CaO synthesized fatty acid methyl esters (FAME,   the purification of as-synthesized FAME with acid-activated bentonites to eliminate the remaining calcium was also investigated.   It was found that the yield of JCO FAME could reach up to 94.35 % using the following reaction conditions: 79.33 minutes reaction time, 10.41:1 methanol:oil molar ratio and 0.99 %  catalyst at reaction temperature 65oC.  Among bentonites used in the purification,   2.5% of H2SO4-activated bentonite shows a good performance as decalcifying agent for FAME purification.  The properties of purified jatropha FAME were comparable to those of diesel and satisfied the international standard.

  16. [Effects of exogenous nitric oxide on physiological characteristics of longan (Dimocarpus longana) seedlings under acid rain stress].

    Science.gov (United States)

    Liu, Jian-fu; Wang, Ming-yuan; Yang, Chen; Zhu, Ai-jun

    2013-08-01

    This paper studied the effects of exogenous nitric oxide donor sodium nitroprusside (SNP) on the chlorophyll content, antioxidant enzyme activities, and osmotic regulation substances of longan (Dimocarpus longana 'Fuyan') seedlings under acid rain (pH 3.0) stress. Under the acid rain stress, the seedling leaf superoxide dismutase (SOD), peroxidase (POD) and catalase (CAT) activities and chlorophyll, soluble protein and soluble sugar contents decreased obviously, while the leaf malondialdedyde content had a remarkable increase, suggesting the toxic effect of the acid rain on the seedlings. Exogenous nitric oxide had dual nature on the physiological characteristics of longan seedlings under acid rain stress. Applying 0.1-0.5 mmol x L(-1) of SNP improved the SOD, POD and CAT activities and the chlorophyll, soluble protein and soluble sugar contents significantly, and decreased the malondialdedyde content. Low concentrations SNP reduced the oxidative damage caused by the acid rain stress, and 0.5 mmol x L(-1) of SNP had the best effect. Under the application of 0.5 mmol x L(-1) of SNP, the total chlorophyll, soluble protein, and soluble sugar contents and the SOD, POD and CAT activities increased by 76.0%, 107.0%, 216.1%, 150. 0%, 350.9% and 97.1%, respectively, and the malondialdedyde content decreased by 46.4%. It was suggested that low concentration (0.1-0.5 mmol x L(-1)) SNP could alleviate the toxic effect of acid rain stress on longan seedlings via activating the leaf antioxidant enzyme activities and reducing oxidative stress, while high concentration SNP (1.0 mmol x L(-1)) lowered the mitigation effect.

  17. Role of calcium signaling in the activation of mitochondrial nitric oxide synthase and citric acid cycle.

    Science.gov (United States)

    Traaseth, Nathaniel; Elfering, Sarah; Solien, Joseph; Haynes, Virginia; Giulivi, Cecilia

    2004-07-23

    An apparent discrepancy arises about the role of calcium on the rates of oxygen consumption by mitochondria: mitochondrial calcium increases the rate of oxygen consumption because of the activation of calcium-activated dehydrogenases, and by activating mitochondrial nitric oxide synthase (mtNOS), decreases the rates of oxygen consumption because nitric oxide is a competitive inhibitor of cytochrome oxidase. To this end, the rates of oxygen consumption and nitric oxide production were followed in isolated rat liver mitochondria in the presence of either L-Arg (to sustain a mtNOS activity) or N(G)-monomethyl-L-Arg (NMMA, a competitive inhibitor of mtNOS) under State 3 conditions. In the presence of NMMA, the rates of State 3 oxygen consumption exhibited a K(0.5) of 0.16 microM intramitochondrial free calcium, agreeing with those required for the activation of the Krebs cycle. By plotting the difference between the rates of oxygen consumption in State 3 with L-Arg and with NMMA at various calcium concentrations, a K(0.5) of 1.2 microM intramitochondrial free calcium was obtained, similar to the K(0.5) (0.9 microM) of the dependence of the rate of nitric oxide production on calcium concentrations. The activation of dehydrogenases, followed by the activation of mtNOS, would lead to the modulation of the Krebs cycle activity by the modulation of nitric oxide on the respiratory rates. This would ensue in changes in the NADH/NAD and ATP/ADP ratios, which would influence the rate of the cycle and the oxygen diffusion.

  18. Uric acid attenuates nitric oxide production by decreasing the interaction between endothelial nitric oxide synthase and calmodulin in human umbilical vein endothelial cells: a mechanism for uric acid-induced cardiovascular disease development.

    Science.gov (United States)

    Park, Jung-Hyun; Jin, Yoon Mi; Hwang, Soojin; Cho, Du-Hyong; Kang, Duk-Hee; Jo, Inho

    2013-08-01

    The elevated level of uric acid in the body is associated with increased risk of cardiovascular diseases, which is mediated by endothelial dysfunction. However, its underlying mechanism is not fully understood, although dysregulation of endothelial nitric oxide (NO) production is likely to be involved. Using human umbilical vascular endothelial cells (HUVEC), we explored the molecular mechanism of uric acid on endothelial NO synthase (eNOS) activity and NO production. Although high dose of uric acid (12mg/dl for 24h treatment) significantly decreased eNOS activity and NO production, it did not alter eNOS expression and phosphorylations at eNOS-Ser(1177), eNOS-Thr(495) and eNOS-Ser(114). Under this condition, we also found no alterations in the dimerization and acetylation of eNOS, compared with the control. Furthermore, uric acid did not change the activity of arginase II, an enzyme degrading l-arginine, a substrate of eNOS, and intracellular level of calcium, a cofactor for eNOS activation. We also found that uric acid did not alter xanthine oxidase activity, suggesting no involvement of xanthine oxidase-derived O2(-) production in the observed inhibitory effects. In vitro and in cell coimmunoprecipitation studies, however, revealed that uric acid significantly decreased the interaction between eNOS and calmodulin (CaM), an eNOS activator, although it did not change the intracellular CaM level. Like in HUVEC, uric acid also decreased eNOS-CaM interaction in bovine aortic EC. Finally, uric acid attenuated ionomycin-induced increase in the interaction between eNOS and CaM. This study suggests firstly that uric acid decreased eNOS activity and NO production through reducing the binding between eNOS and CaM in EC. Our result may provide molecular mechanism by which uric acid induces endothelial dysfunction.

  19. Ozone, nitric acid, and ammonia air pollution is unhealthy for people and ecosystems in southern Sierra Nevada, California

    Energy Technology Data Exchange (ETDEWEB)

    Cisneros, Ricardo, E-mail: rcisneros@fs.fed.u [USDA Forest Service, Pacific Southwest Region, 1600 Tollhouse Road, Clovis, CA 93611 (United States); Bytnerowicz, Andrzej, E-mail: abytnerowicz@fs.fed.u [USDA Forest Service, Pacific Southwest Research Station, 4955 Canyon Crest Dr., Riverside, CA 92507 (United States); Schweizer, Donald, E-mail: dschweizer@fs.fed.u [USDA Forest Service, Pacific Southwest Region, 1600 Tollhouse Road, Clovis, CA 93611 (United States); Zhong, Sharon, E-mail: zhongs@msu.ed [Department of Geography, Michigan State University, 116 Geography Building East, Lansing, MI 48824-1117 (United States); Traina, Samuel, E-mail: straina@ucmerced.ed [Environmental Systems Graduate Group, University of California Merced, 5200 North Lake Road, Merced, CA 95343 (United States); Bennett, Deborah H., E-mail: dhbennett@ucdavis.ed [Department of Public Health Sciences, University of California Davis, One Shields Avenue, TB 169 Davis, CA 95616 (United States)

    2010-10-15

    Two-week average concentrations of ozone (O{sub 3}), nitric acid vapor (HNO{sub 3}) and ammonia (NH{sub 3}) were measured with passive samplers during the 2002 summer season across the central Sierra Nevada Mountains, California, along the San Joaquin River drainage. Elevated concentrations of the pollutants were determined with seasonal means for individual sites ranging between 62 and 88 ppb for O{sub 3}, 1.0-3.8 {mu}g m{sup -3} for HNO{sub 3}, and 2.6-5.2 {mu}g m{sup -3} for NH{sub 3}. Calculated O{sub 3} exposure indices were very high, reaching SUM00-191 ppm h, SUM60-151 ppm h, and W126-124 ppm h. Calculated nitrogen (N) dry deposition ranged from 1.4 to 15 kg N ha{sup -1} for maximum values, and 0.4-8 kg N ha{sup -1} for minimum values; potentially exceeding Critical Loads (CL) for nutritional N. The U.S., California, and European 8 h O{sub 3} human health standards were exceeded during 104, 108, and 114 days respectively, indicating high risk to humans from ambient O{sub 3}. - Ozone concentrations remained unchanged while those of nitric acid vapor and ammonia decreased along the river drainage crossing the Sierra Nevada Mountains.

  20. New monolith technology for automated anion-exchange purification of nucleic acids.

    Science.gov (United States)

    Thayer, J R; Flook, K J; Woodruff, A; Rao, S; Pohl, C A

    2010-04-15

    Synthetic nucleic acid analysis often employs pellicular anion-exchange (AE) chromatography because it supports very high efficiency separations while offering means to control secondary structure, retention and resolution by readily modifiable chromatographic conditions. However, these pellicular anion-exchange (pAE) phases do not offer capacity sufficient for lab-scale oligonucleotide (ON) purification. In contrast, monolithic phases produce fast separations at capacities exceeding their pellicular counterparts, but do not exhibit capacities typical of fully porous, bead-based, anion-exchangers. In order to further increase monolith capacity and obtain the selectivity and mass transfer characteristics of pellicular phases, a surface-functionalized monolith was coated with pAE nanobeads (latexes) usually employed on the pellicular DNAPac phase. The nanobead-coated monolith exhibited chromatographic behaviors typical of polymer AE phases. Based on this observation the monolithic substrate surface porosity and latex diameters were co-optimized to produce a hybrid monolith harboring capacity similar to that of fully porous bead-based phases and peak shape approaching that of the pAE phases. We tested the hybrid monolith on a variety of previously developed pAE capabilities including control of ON selectivity, resolution of derivatized ONs, the ability to resolve RNA ONs harboring aberrant linkages at different positions in a single sequence and separation of phosphorothioate diastereoisomers. We compared the yield and purity of an 8 mg ON sample purified on both the new hybrid monolith and a benchmark AE column based on fully porous monodisperse beads. This comparison included an assessment of the relative selectivities of both columns. Finally, we demonstrated the ability to couple AE ON separations with ESI-MS using an automated desalting protocol. This protocol is also useful for preparing ONs for other assays, such as enzyme treatments, that may be sensitive to

  1. Bacteriocins from lactic acid bacteria: purification, properties and use as biopreservatives

    Directory of Open Access Journals (Sweden)

    José Luis Parada

    2007-05-01

    Full Text Available Biopreservation systems in foods are of increasing interest for industry and consumers. Bacteriocinogenic lactic acid bacteria and/or their isolated bacteriocins are considered safe additives (GRAS, useful to control the frequent development of pathogens and spoiling microorganisms in foods and feed. The spreading of bacterial antibiotic resistance and the demand for products with fewer chemicals create the necessity of exploring new alternatives, in order to reduce the abusive use of therapeutic antibiotics. In this context, bacteriocins are indicated to prevent the growth of undesirable bacteria in a food-grade and more natural way, which is convenient for health and accepted by the community. According to their properties, structure, molecular weight (MW, and antimicrobial spectrum, bacteriocins are classified in three different groups: lantibiotics and non-lantibiotics of low MW, and those of higher MW. Several strategies for isolation and purification of bacteriocins from complex cultivation broths to final products were described. Biotechnological procedures including salting-out, solvent extraction, ultrafiltration, adsorption-desortion, ion-exchange, and size exclusion chromatography are among the most usual methods. Peptide structure-function studies of bacteriocins and bacterial genetic advances will help to understand the molecular basis of their specificity and mode of action. Nisin is a good example of commercial success, and a good perspective is open to continue the study and development of new bacteriocins and their biotechnological applications. These substances in appropriate concentrations may be used in veterinary medicine and as animal growth promoter instead usual antibiotics, as well as an additional hurdle factor for increasing the shelf life of minimal processed foods.

  2. Solvent extraction of uranium(VI) and thorium(IV) in nitric acid solution by N,N,N‘,N’—tetrabutyladipicamide

    Institute of Scientific and Technical Information of China (English)

    WangYou-Shao; BaoBo-Rong; 等

    1997-01-01

    N,N,N'N'-tetrabutyladipicamide(TBAA) has been synthesized,and applied to the extraction of U(VI) and Th(IV) from nitric acid solutions in a diluent composed of 0.50 volume fraction 1,2,4-trimethyl benzene (TMA) and 0.50 volume fraction kerosene(OK),The effects of the aueous nitric acid concentration,extractant concentration,slating-out agent (LiNO3) and temperature on extraction ability of TBAA for U(VI) and Th(IV) have been studied.Back Extraction of U(VI) and Th (IV) from organic phases were performed by dilute nitric acid.The compositions of extracted complexes,equilibrium constants and enthalpies of extraction reactions have also been estimated.The IR spectra of extraction of U(VI) and Th(IV) have been studied.

  3. Direct tandem mass spectrometric analysis of amino acids in plasma using fluorous derivatization and monolithic solid-phase purification.

    Science.gov (United States)

    Tamashima, Erina; Hayama, Tadashi; Yoshida, Hideyuki; Imakyure, Osamu; Yamaguchi, Masatoshi; Nohta, Hitoshi

    2015-11-10

    In this study, we developed a novel direct tandem mass spectrometric method for rapid and accurate analysis of amino acids utilizing a fluorous derivatization and purification technique. Amino acids were perfluoroalkylated with 2H,2H,3H,3H-perfluoroundecan-1-al in the presence of 2-picoline borane via reductive amination. The derivatives were purified by perfluoroalkyl-modified silica-based monolithic solid-phase extraction (monolithic F-SPE), and directly analyzed by tandem mass spectrometry using electrospray ionization without liquid chromatographic separation. The perfluoroalkyl derivatives could be sufficiently distinguished from non-fluorous compounds, i.e. the biological matrix, due to their fluorous interaction. Thus, rapid and accurate determination of amino acids was accomplished. The method was validated with human plasma samples and applied to the analysis of amino acids in the plasma of mice with maple syrup urine disease or phenylketonuria.

  4. Plasma levels of nitric oxide related amino acids in demented subjects with Down syndrome are related to neopterin concentrations.

    Science.gov (United States)

    Coppus, A M W; Fekkes, D; Verhoeven, W M A; Tuinier, S; van Duijn, C M

    2010-03-01

    Subjects with Down syndrome (DS) have abnormalities in virtually all aspects of the immune system and almost all will be affected with Alzheimer's disease (AD). It is thought that nitric oxide (NO) is involved in the pathophysiology of AD. In the present study, including a total of 401 elderly DS subjects, the spectrum of plasma amino acids and neopterin was investigated and related to development of AD. Concentrations of nearly all amino acids in DS subjects differed significantly from those of healthy controls. Neopterin was increased in DS subjects, especially in dementia. The production of NO as reflected by an increased citrulline/arginine ratio (Cit/Arg ratio) was enhanced during development of clinical dementia. Neopterin concentrations correlated to the Cit/Arg ratio only in the group of prevalent demented subjects (rho = 0.48, P = 0.006). The results of this study are suggestive for an increase in oxidative processes in DS subjects with AD.

  5. Purification of carbon nanotubes grown by thermal CVD

    Science.gov (United States)

    Porro, S.; Musso, S.; Vinante, M.; Vanzetti, L.; Anderle, M.; Trotta, F.; Tagliaferro, A.

    2007-03-01

    We show the results of a set of purifications on carbon nanotubes (CNT) by acid and basic treatments. CNTs were obtained by thermal decomposition of camphor at 850 °C in a CVD growth system, by means of a growth process catalyzed by iron clusters originating from the addition of ferrocene in the precursors mixture. The purification procedures involved HNO 3, H 2SO 4, HSO 3Cl and NaOH for different process temperatures. As-grown CNTs showed a consistent presence of metal catalyst (about 6 wt%), evidenced by TGA. The purification treatments led to a certain amount of opening of the CNT tips, with a consequent loss of metal catalyst encapsulated in tips. This is also confirmed by BET analysis, which showed an increase of the surface area density of CNT after the purification. FT-IR and XPS revealed the presence of carboxylic groups on the CNT surface chemically modified by the harsh environment of the purification process. Among the various treatments that have been tested, the 1:3 solution of nitric and sulphuric acid was the most effective in modifying the CNT surface and inducing the formation of functional groups.

  6. GLYCOLIC-NITRIC ACID FLOWSHEET DEMONSTRATION OF THE DWPF CHEMICAL PROCESSING CELL WITH MATRIX SIMULANTS AND SUPERNATE

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, D.; Stone, M.; Newell, J.; Best, D.

    2012-05-07

    Savannah River Remediation (SRR) is evaluating changes to its current DWPF flowsheet to improve processing cycle times. This will enable the facility to support higher canister production while maximizing waste loading. Higher throughput is needed in the CPC since the installation of the bubblers into the melter has increased melt rate. Due to the significant maintenance required for the DWPF gas chromatographs (GC) and the potential for production of flammable quantities of hydrogen, reducing or eliminating the amount of formic acid used in the CPC is being developed. Earlier work at Savannah River National Laboratory has shown that replacing formic acid with an 80:20 molar blend of glycolic and formic acids has the potential to remove mercury in the SRAT without any significant catalytic hydrogen generation. This report summarizes the research completed to determine the feasibility of processing without formic acid. In earlier development of the glycolic-formic acid flowsheet, one run (GF8) was completed without formic acid. It is of particular interest that mercury was successfully removed in GF8, no formic acid at 125% stoichiometry. Glycolic acid did not show the ability to reduce mercury to elemental mercury in initial screening studies, which is why previous testing focused on using the formic/glycolic blend. The objective of the testing detailed in this document is to determine the viability of the nitric-glycolic acid flowsheet in processing sludge over a wide compositional range as requested by DWPF. This work was performed under the guidance of Task Technical and Quality Assurance Plan (TT and QAP). The details regarding the simulant preparation and analysis have been documented previously.

  7. GLYCOLIC-NITRIC ACID FLOWSHEET DEMONSTRATION OF THE DWPF CHEMICAL PROCESS CELL WITH SLUDGE AND SUPERNATE SIMULANTS

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, D.; Stone, M.; Newell, J.; Best, D.; Zamecnik, J.

    2012-08-28

    Savannah River Remediation (SRR) is evaluating changes to its current Defense Waste Processing Facility (DWPF) flowsheet to improve processing cycle times. This will enable the facility to support higher canister production while maximizing waste loading. Higher throughput is needed in the Chemical Process Cell (CPC) since the installation of the bubblers into the melter has increased melt rate. Due to the significant maintenance required for the DWPF gas chromatographs (GC) and the potential for production of flammable quantities of hydrogen, reducing or eliminating the amount of formic acid used in the CPC is being developed. Earlier work at Savannah River National Laboratory has shown that replacing formic acid with an 80:20 molar blend of glycolic and formic acids has the potential to remove mercury in the SRAT without any significant catalytic hydrogen generation. This report summarizes the research completed to determine the feasibility of processing without formic acid. In earlier development of the glycolic-formic acid flowsheet, one run (GF8) was completed without formic acid. It is of particular interest that mercury was successfully removed in GF8, no formic acid at 125% stoichiometry. Glycolic acid did not show the ability to reduce mercury to elemental mercury in initial screening studies, which is why previous testing focused on using the formic/glycolic blend. The objective of the testing detailed in this document is to determine the viability of the nitric-glycolic acid flowsheet in processing sludge over a wide compositional range as requested by DWPF. This work was performed under the guidance of Task Technical and Quality Assurance Plan (TT&QAP). The details regarding the simulant preparation and analysis have been documented previously.

  8. New Inducible Nitric Oxide Synthase and Cyclooxygenase-2 Inhibitors, Nalidixic Acid Linked to Isatin Schiff Bases via Certain l-Amino Acid Bridges.

    Science.gov (United States)

    Naglah, Ahmed M; Ahmed, Atallah F; Wen, Zhi-Hong; Al-Omar, Mohamed A; Amr, Abd El-Galil E; Kalmouch, Atef

    2016-04-15

    A series of new Schiff bases were synthesized by condensation of isatins with the nalidixic acid-l-amino acid hydrazides. Prior to hydrazide formation, a peptide linkage has been prepared via coupling of nalidixic acid with appropriate l-amino acid methyl esters to yield 3a-c. The chemical structures of the new Schiff bases (5b and 5d-h) were confirmed by means of IR, NMR, mass spectroscopic, and elemental analyses. The anti-inflammatory activity of these Schiff bases was evaluated via measurement of the expressed inducible nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) in the lipopolysaccharide (LPS)-stimulated RAW264.7 macrophage cells model. The Schiff bases exhibited significant dual inhibitory effect against the induction of the pro-inflammatory iNOS and COX-2 proteins with variable potencies. However, they strongly down-regulated the iNOS expression to the level of 16.5% ± 7.4%-42.2% ± 19.6% compared to the effect on COX-2 expression (bases, relative to that of COX-2, seems to be a reflection of the combined suppressive effects exerted by their nalidixic acid, isatins (4a-c), and l-amino acid moieties against iNOS expression. These synthesized nalidixic acid-l-amino acid-isatin conjugates can be regarded as a novel class of anti-inflammatory antibacterial agents.

  9. Affinity purification of the voltage-sensitive sodium channel from electroplax with resins selective for sialic acid

    Energy Technology Data Exchange (ETDEWEB)

    James, W.M.; Emerick, M.C.; Agnew, W.S. (Yale Univ. School of medicine, New Haven, CT (USA))

    1989-07-11

    The voltage-sensitive sodium channel present in the eel (Electrophorus electricus) has an unusually high content of sialic acid, including {alpha}-(2{yields}8)-linked polysialic acid, not found in other electroplax membrane glycopeptides. Lectins from Limax flavus (LFA) and wheat germ (WGA) proved the most effective of 11 lectin resins tried. The most selective resin was prepared from IgM antibodies against Neisseria meningitidis {alpha}-(2{yields}8)-polysialic acid which were affinity purified and coupled to Sepharose 4B. The sodium channel was found to bind to WGA, LFA, and IgM resins and was readily eluted with the appropriate soluble carbohydrates. Experiments with LFA and IgM resins demonstrated binding and unbinding rates and displacement kinetics, which suggest highly specific binding at multiple sites on the sodium channel protein. In preparative-scale purification of protein previously fractionated by anion-exchange chromatography, without stabilizing TTX, high yields were reproducibly obtained. Further, when detergent extracts were prepared from electroplax membranes fractionated by low-speed sedimentation, a single step over the IgM resin provided a 70-fold purification, yielding specific activities of 3,200 pmol of ({sup 3}H)TTX-binding sites/mg of protein and a single polypeptide of {approximately}285,000 Da on SDS-acrylamide gels. No small peptides were observed after this 5-h isolation. The authors describe a cation-dependent stabilization with millimolar levels of monovalent and micromolar levels of divalent species.

  10. Membrane protein extraction and purification using styrene-maleic acid (SMA) copolymer: effect of variations in polymer structure.

    Science.gov (United States)

    Morrison, Kerrie A; Akram, Aneel; Mathews, Ashlyn; Khan, Zoeya A; Patel, Jaimin H; Zhou, Chumin; Hardy, David J; Moore-Kelly, Charles; Patel, Roshani; Odiba, Victor; Knowles, Tim J; Javed, Masood-Ul-Hassan; Chmel, Nikola P; Dafforn, Timothy R; Rothnie, Alice J

    2016-12-01

    The use of styrene-maleic acid (SMA) copolymers to extract and purify transmembrane proteins, while retaining their native bilayer environment, overcomes many of the disadvantages associated with conventional detergent-based procedures. This approach has huge potential for the future of membrane protein structural and functional studies. In this investigation, we have systematically tested a range of commercially available SMA polymers, varying in both the ratio of styrene and maleic acid and in total size, for the ability to extract, purify and stabilise transmembrane proteins. Three different membrane proteins (BmrA, LeuT and ZipA), which vary in size and shape, were used. Our results show that several polymers, can be used to extract membrane proteins, comparably to conventional detergents. A styrene:maleic acid ratio of either 2:1 or 3:1, combined with a relatively small average molecular mass (7.5-10 kDa), is optimal for membrane extraction, and this appears to be independent of the protein size, shape or expression system. A subset of polymers were taken forward for purification, functional and stability tests. Following a one-step affinity purification, SMA 2000 was found to be the best choice for yield, purity and function. However, the other polymers offer subtle differences in size and sensitivity to divalent cations that may be useful for a variety of downstream applications. © 2016 The Author(s); published by Portland Press Limited on behalf of the Biochemical Society.

  11. Synergistic Action between Jasmonic Acid and Nitric Oxide in Inducing Matrine Accumulation of Sophora flavescens Suspension Cells

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Secondary metabolites not only play important ecological roles in plants but also are important pharmaceutical and source compounds for derivative synthesis. Production of plant secondary metabolites is believed to be controlled by the endogenous signal network of plants. However, the molecular basis is still largely unknown. Here we show that matrine production of Sophora flavescens Ait. cells treated with low levels of jasmonic acid (JA) and nitric oxide (NO) is significantly increased although treatment with low concentrations of JA or NO alone has no effects on matrine production, showing that JA and NO may act synergistically in triggering matrine production. Moreover, treatment with NO triggers lipoxygenase(LOX) activity and enhances JA levels of the cells, showing that NO may activate the endogenous JA biosynthesis of S.flavescens cells. External application of JA induces nitric oxide synthase-like activities and stimulates NO generation of S. flavescens cells, which suggests that JA may trigger NO generation of the cells. Thus, the results reveal a mutually amplifying reaction between JA and NO in S. flavescens cells. Furthermore, JA and NO inhibitors suppress not only the mutually amplifying reaction between JA and NO but also the synergistic effects of NO and JA on matrine production.Therefore, the data demonstrate that the synergistic action of JA and NO in inducing matrine production might be due to the mutually amplifying reaction between JA and NO in the cells.

  12. Measurement of inorganic arsenic species in rice after nitric acid extraction by HPLC-ICPMS: verification using XANES.

    Science.gov (United States)

    Maher, W; Foster, S; Krikowa, F; Donner, E; Lombi, E

    2013-06-04

    The measurement of As species in rice is normally accomplished by extraction followed by HPLC-ICPMS analysis. This method, however, has not been comprehensively validated by comparing these speciation results with XANES, which does not require sample extraction, due to the challenge of conducting XANES analysis at very low As concentrations. In this study As speciation data using nitric acid extraction/HPLC-ICPMS and XANES are compared to verify the efficacy of using 2% v/v nitric acid extraction and HPLC-ICPMS to measure inorganic As, DMA, and MA in reference rice materials and common rice varieties obtainable in Australia. Total As and As species (As(III), As(V), DMA, and MA) concentrations measured in 8 reference materials were in agreement with published values. XANES analysis was performed on 5 samples having total As concentrations ranging from 0.198 to 0.335 μg g(-1). XANES results gave similar proportions of total As(III), As(V), and DMA to HPLC-ICPMS. XANES was able to distinguish two forms of As(III): As(III) and As(III)GSH. Total As concentrations in rice samples varied from 0.006 to 0.45 μg g(-1) As (n = 47) with a mean ± std of 0.127 ± 0.112 μg g(-1) As with most As present as inorganic species (63 ± 26%). DMA was found in nearly all the rice samples with the majority of samples containing concentrations below 0.05 μg g(-1) As while MA concentrations were negligible (<0.003 μg g(-1) As). Six rice varieties produced in Australia, China, and Spain all had elevated DMA concentrations (0.170-0.399 μg g(-1) As) that were correlated with total As concentrations (r(2) = 0.7518). In conclusion, comparison of As speciation by HPLC-ICPMS and XANES showed that similar As species were detected indicating the appropriateness of using 2% v/v nitric acid for extraction of rice prior to speciation. Common rice varieties obtainable in Australia generally have low As concentrations with most As present as inorganic As.

  13. A simple procedure for the isolation and purification of protamine messenger ribonucleic acid from trout testis.

    Science.gov (United States)

    Gedamu, L; Iatrou, K; Dixon, G H

    1978-06-01

    Preparation of milligram quantities of purified poly(A)+ (polyadenylated) protamine mRNA from trout testis tissue was accomplished by a simple procedure using gentle conditions. This involves chromatography of the total nucleic acids isolated by dissociation of polyribosomes with 25 mM-EDTA to release messenger ribonucleoprotein particles and deproteinization of the total postmitochondrial supernatant with 0.5% sodium dodecyl sulphate in 0.25 M-NaCl by binding it to a DEAE-cellulose column. Total RNA was bound under these conditions, and low-molecular-weight RNA, lacking 18S and 28S RNA, could be eluted with 0.5 M-NaCl and chromatographed on oligo(dT)-cellulose columns to select for poly(A)+ RNA. Further purification of both the unbound poly(A)- RNA and the bound poly(A)+ mRNA on sucrose density gradients showed that both 18S and 28S rRNA were absent, being removed during the DEAE-cellulose chromatography step. Poly(A)- RNA sedimented in the 4S region whereas the bound poly(A)+ RNA fraction showed a main peak at 6S [poly(A+) protamine mRNA] and a shoulder in the 3-4S region. Analysis of the main peak and the shoulder on a second gradient showed that most of the main peak sedimented at 6S, whereas the shoulder sedimented slower than 4S. The identity of the poly(A)+ protamine mRNA was established by the following criteria: (1) purified protamine mRNA migrated as a set of four bands on urea/polyacrylamide-gel electrophoresis; (2) analysis of the polypeptides synthesized in the wheat-germ extract by starch-gel electrophoresis showed a single band of radioactivity which co-migrated exactly with the carrier trout testis protamine standard; and (3) chromatography of the polypeptide products on CM-cellulose (CM-52) showed the presence of three or four radioactively labelled protamine components that were co-eluted with the unlabelled trout testis protamine components added as carrier. The availability of large quantities of purified protamine mRNA should now permit a more

  14. The Meteorology and Chemistry of High Nitric-Acid Episodes at the South Pole

    Science.gov (United States)

    Neff, William; Davis, Douglas

    2016-04-01

    Between 1998 and 2007, a series of field experiments carried out at the South Pole and with aircraft over a wider area revealed a very chemically active boundary layer overlying the east Antarctic ice sheet during the Austral summer. An early discovery was unexpectedly high concentrations of nitric acid (NO) at the South Pole. These were argued to be a result of the UV pholoysis of reactive nitrogen in surface and/or near-surface snow followed by subsequent confinement and non-linear HOx/NOx chemistry within a thin stable atmospheric boundary layer. The concentrations of NO also demonstrated daily, intraseasonal, as well as interannual variability as seen in the four field programs. This paper seeks to elucidate the interplay of large-to-small scale meteorology and chemistry at the South Pole that leads to highly variable NO concentrations and to examine boundary layer depth effects on NO in years when no direct measurements were available, in particular during the latest field program in 2006-2007. The importance of the South Pole is that it, unlike other high-latitude sites, has no diurnal cycle to disturb the evolution of the mostly stable boundary layer and its physics and chemistry. In the spring, as the solar elevation angle increases, nitrate photolysis rates increase. At the same time, the stratospheric vortex warms and with its breakup, the total column ozone increases leading to decreased photolysis rates. In addition, following the formation of the thermal tropopause in early spring, the tropospheric circulation over Antarctica changes dramatically, affecting the transport and dominant source regions for warm air and clouds arriving at the South Pole. The timing of the final warming ranged from early-November to mid-December for the four field experiment years. During the 30 days prior to the final increase in column ozone, as the thermal tropopause forms (~100 hPa), the winds at 300 hPa become bimodal, either along the eastern side of the Weddell Sea

  15. Laboratory Investigation of the Growth and Crystal Structure of Nitric Acid Hydrates by Transmission Electron Microscopy (TEM)

    Science.gov (United States)

    Blake, David F.; Chang, Sherwood (Technical Monitor)

    1994-01-01

    A great deal of recent laboratory work has focussed on the characterization of the nitric acid hydrates, thought to be present in type I Polar Stratospheric Clouds (PSCs). Phase relationships and vapor pressure measurements (1-3) and infrared characterizations (4-5) have been made. However, the observed properties of crystalline solids (composition, melting point, vapor pressure, surface reactivity, thermodynamic stability, extent of solid solution with other components, etc.) are controlled by their crystal structure. The only means of unequivocal structural identification for crystalline solids is diffraction (using electrons, X-rays, neutrons, etc.). Other observed properties of crystalline solids, such as their infrared spectra, their vapor pressure as a function of temperature, etc. yield only indirect information about what phases are present, their relative proportions, or whether they are crystalline or amorphous.

  16. Nitric-phosphoric acid etching effects on the surface chemical composition of CdTe thin film.

    Science.gov (United States)

    Irfan, Irfan; Ding, Huanjun; Xia, Wei; Lin, Hao; Tang, Ching W.; Gao, Yongli

    2009-03-01

    Nitric-phosphoric (NP) acid etching has been regarded as one of the most successful methods for the formation of low resistance back contact with the metal electrode in CdTe based solar cells. We report back surface chemical composition for eight different durations of NP etching of CdTe polycrystalline thin film. We studied the surfaces with x-ray photoemission spectroscopy (XPS), ultraviolet photoemission spectroscopy (UPS), inverse photoemission spectroscopy (IEPS) and atomic force microscopy (AFM). Etching dependence on the back surface composition and electronic structure was observed. Valence and conduction band shifts relative to the Fermi level of the system with different etching duration were analyzed. The sample was left in open ambient condition for three weeks and XPS data were obtained again in order to study the difference in surface chemical composition with the pristine CdTe film. Unetched and highly etched part of the sample were sputtered and the depth profile analyzed.

  17. Soft cutting of single-wall carbon nanotubes by low temperature ultrasonication in a mixture of sulfuric and nitric acids

    Science.gov (United States)

    Shuba, M. V.; Paddubskaya, A. G.; Kuzhir, P. P.; Maksimenko, S. A.; Ksenevich, V. K.; Niaura, G.; Seliuta, D.; Kasalynas, I.; Valusis, G.

    2012-12-01

    To decrease single-wall carbon nanotube (SWCNT) lengths to a value of 100-200 nm, aggressive cutting methods, accompanied by a high loss of starting material, are frequently used. We propose a cutting approach based on low temperature intensive ultrasonication in a mixture of sulfuric and nitric acids. The method is nondestructive with a yield close to 100%. It was applied to cut nanotubes produced in three different ways: gas-phase catalysis, chemical vapor deposition, and electric-arc-discharge methods. Raman and Fourier transform infrared spectroscopy were used to demonstrate that the cut carbon nanotubes have a low extent of sidewall degradation and their electronic properties are close to those of the untreated tubes. It was proposed to use the spectral position of the far-infrared absorption peak as a simple criterion for the estimation of SWCNT length distribution in the samples.

  18. Microstructure and Corrosion Behavior of Hf-40 Wt Pct Ti Alloy in Nitric Acid Medium for Reprocessing Applications

    Science.gov (United States)

    Jayaraj, J.; Ravi, K. R.; Mallika, C.; Kamachi Mudali, U.

    2016-09-01

    The Hf-40 wt pct Ti (Hf-Ti) alloy was developed for neutron poison application in the spent nuclear fuel reprocessing plant. The furnace-cooled Hf-Ti sample exhibited the microstructure comprising equiaxed-α, lamellar-α, and feathery-α. The water-quenched Hf-Ti sample confirmed the presence of lath and internally twinned martensite. In comparison to the furnace-cooled sample, low corrosion current density and passivation current density values obtained for the water-quenched Hf-Ti in 6 M HNO3 at 298 K (25 °C) indicated better passivation ability. The martensitic structure exhibited high hardness (660 HV) and negligible corrosion rate in 6 M nitric acid at 298 K (25 °C). X-ray photoelectron spectroscopic (XPS) analysis confirmed that passivation behavior of this alloy was due to the protective passive film composed of TiO2 and HfO2.

  19. Hydrofluoric-nitric-sulphuric-acid surface treatment of tungsten for carbon fibre-reinforced composite hybrids in space applications

    Science.gov (United States)

    Kanerva, M.; Johansson, L.-S.; Campbell, J. M.; Revitzer, H.; Sarlin, E.; Brander, T.; Saarela, O.

    2015-02-01

    Hybrid material systems, such as combinations of tungsten foils and carbon fibre-reinforced plastic (CFRP), are replacing metal alloy concepts in spacecraft enclosures. However, a good adhesion between the tungsten oxide scale and the epoxy resin used is required. Here, the effects of a hydrofluoric-nitric-sulphuric-acid (HFNS) treatment on tungsten oxides and subsequent adhesion to CFRP are analysed using atomic force microscopy (AFM), X-ray photoelectron spectroscopy (XPS) and fracture testing. The work shows that HFNS treatment results in decreased oxygen content, over 50% thinner tungsten trioxide (WO3) layer and increased nano-roughness on thin tungsten foils. Fracture testing established a 39% increase in the average critical strain for tungsten-CFRP specimens after HFNS treatment was carried out on tungsten. The effect of the oxide scale modification regarding the critical strain energy release rate was ΔGc≈ 8.4 J/m2.

  20. Gene expression profiles of inducible nitric oxide synthase and cytokines in Leishmania major-infected macrophage-like RAW 264.7 cells treated with gallic acid

    NARCIS (Netherlands)

    Radtke, O.A.; Kiderlen, A.F.; Kayser, Oliver; Kolodziej, H

    2004-01-01

    The effects of gallic acid on the gene expressions of inducible nitric oxide synthase (iNOS) and the cytokines interleukin (IL)-1, IL-10, IL-12, IL-18, TNF-alpha, and interferon (IFN)-gamma were investigated by reverse-transcription polymerase chain reaction (RT-PCR). The experiments were performed

  1. Electrical and physicochemical properties of atomic-layer-deposited HfO{sub 2} film on Si substrate with interfacial layer grown by nitric acid oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung Hyun [Department of Advanced Materials Engineering, Hanyang University, Ansan 15588 (Korea, Republic of); Seok, Tae Jun; Jin, Hyun Soo [Department of Materials Science & Chemical Engineering, Hanyang University, Ansan 15588 (Korea, Republic of); Kim, Woo-Byoung, E-mail: woo7838@dankook.ac.kr [Department of Energy Engineering, Dankook University, Cheonan 330-714 (Korea, Republic of); Park, Tae Joo, E-mail: tjp@hanyang.ac.kr [Department of Advanced Materials Engineering, Hanyang University, Ansan 15588 (Korea, Republic of); Department of Materials Science & Chemical Engineering, Hanyang University, Ansan 15588 (Korea, Republic of)

    2016-03-01

    Graphical abstract: - Highlights: • Ultrathin SiO{sub 2} interfacial layers grown using nitric acid oxidation and O{sub 3} oxidation were adopted at the interface of HfO{sub 2}/Si. • Higher physical density of interfacial layer grown using nitric acid oxidation resulted in the suppressed Si diffusion from substrate into the film. • The interface properties as well as permittivity of the film were improved by adoption of interfacial layer grown using nitric acid oxidation. - Abstract: The ultrathin SiO{sub 2} interfacial layer (IL) was adopted at the interface between atomic-layer-deposited HfO{sub 2} gate dielectric film and a Si substrate, which was grown using nitric acid oxidation (NAO) and O{sub 3} oxidation (OZO) prior to HfO{sub 2} film deposition. X-ray photoelectron spectroscopy result revealed that Si diffusion from the substrate into the film was suppressed for the film with NAO compared to that with OZO, which was attributed to the higher physical density of IL. The electrical measurement using metal–insulator–semiconductor devices showed that the film with NAO exhibited higher effective permittivity and lower densities of fixed charge and slow state at the interface. Furthermore, the leakage current density at an equivalent electrical thickness was lower for the film with NAO than OZO.

  2. Highly active and stable ion-exchanged Fe-Ferrierite catalyst for N2O decomposition under nitric acid tail gas conditions

    NARCIS (Netherlands)

    Melian Cabrera, Ignacio; Mentruit, C; Pieterse, JAZ; van den Brink, RW; Mul, G; Kapteijn, F; Moulijn, JA

    2005-01-01

    This communication reports on the excellent performance and durability of a wet ion-exchanged Fe-Ferrierite catalysts for N2O decomposition under conditions of nitric acid plants, especially in the presence of water (0.5% vol) and at a high space time W/F-0(N2O) = 900 kg(cat) s mol(-1). In contrast

  3. Highly active and stable ion-exchanged Fe–Ferrierite catalyst for N2O decomposition under nitric acid tail gas conditions

    NARCIS (Netherlands)

    Melián-Cabrera, I.; Mentruit, C.; Pieterse, J.A.Z.; Brink, R.W. van den; Mul, G.; Kapteijn, F.; Moulijn, J.A.

    2005-01-01

    This communication reports on the excellent performance and durability of a wet ion-exchanged Fe–Ferrierite catalysts for N2O decomposition under conditions of nitric acid plants, especially in the presence of water (0.5% vol) and at a high space time W/F0(N2O) = 900 kgcat s mol-1. In contrast to io

  4. Runaway behavior and thermally safe operation of multiple liquid–liquid reactions in the semi-batch reactor: The nitric acid oxidation of 2-octanol

    NARCIS (Netherlands)

    Woezik, van B.A.A.; Westerterp, K.R.

    2002-01-01

    The thermal runaway behavior of an exothermic, heterogeneous, multiple reaction system has been studied in a cooled semi-batch reactor. The nitric acid oxidation of 2-octanol has been used to this end. During this reaction, 2-octanone is formed, which can be further oxidized to unwanted carboxylic a

  5. Response of marine and freshwater algae to nitric acid and elevated carbon dioxide levels simulating environmental effects of bolide impact

    Science.gov (United States)

    Boston, P. J.

    1988-01-01

    One of the intriguing facets of the Cretaceous-Tertiary extinction is the apparently selective pattern of mortality amongst taxa. Some groups of organisms were severely affected and some remained relatively unscathed as they went through the K/T boundary. While there is argument concerning the exact interpretation of the fossil record, one of the best documented extinctions at the Cretaceous-Tertiary boundary is that of the calcareous nannoplankton. These organisms include coccolithic algae and foraminiferans. Attempts to explain their decline at the K/T boundary center around chemistry which could affect their calcium carbonate shells while leaving their silica-shelled cousins less affected or unaffected. Two environmental consequences of an extraterrestrial body impact which were suggested are the production of large quantities of nitrogen oxides generated by the shock heating of the atmosphere and the possible rise in CO2 from the dissolution of CaCO3 shells. Both of these phenomena would acidify the upper layers of the oceans and bodies of freshwater not otherwise buffered. The effects of nitric acid, carbon dioxide, or both factors on the growth and reproduction of calcareous marine coccoliths and non-calcareous marine and freshwater species of algae were considered. These experiments demonstrate that nitric acid and carbon dioxide have significant effects on important aspects of the physiology and reproduction of modern algae representative of extinct taxa thought to have suffered significant declines at the Cretaceous-Tertiary boundary. Furthermore, calcareous species showed more marked effects than siliceous species and marine species tested were more sensitive than freshwater species.

  6. Inhibition of nitric oxide synthase lowers fatty acid oxidation in preeclampsia-like mice at early gestational stage

    Institute of Scientific and Technical Information of China (English)

    MA Rui-qiong; SUN Min-na; YANG Zi

    2011-01-01

    Background Preeclampsia is one of hypertensive disorders in pregnancy. It is associated with abnormal lipid metabolism, including fatty acid oxidation metabolism. Long chain 3-hydroxyacyI-CoA dehydrogenase (LCHAD) plays an indispensable role in the oxidation of fatty acids. It has been reported that nitric oxide (NO) is one of the regulatory factors of the fatty acid oxidation pathway. The aim of this research was to investigate whether the nitric oxide synthase (NOS)inhibitor L-NAME may cause down-regulation of LCHAD in the pathogenesis of preeclampsia.Methods Pregnant wild-type (WT) mice were treated with L-NAME or normal saline (NS) during gestation days 7-18 (early group), days 11-18 (mid group) and days 16-18 (late group), and apoE-/- mice served as a control. Systolic blood pressure (SBP), urine protein, feto-placental outcome, plasma lipid levels and NO concentrations were measured, and the expression of mRNA and protein for LCHAD in placental tissue were determined by real-time polymerase chain reaction (RT-PCR) and Western blotting, respectively.Results In WT and apoE-/- mice, SBP and urinary protein increased following L-NAME injection. Fetal and placental weights and NO concentrations were reduced and total cholesterol, triglycerides and free fatty acid levels were increased in early and mid L-NAME groups in WT and apoE-/- mice, compared with the NS group. There was no significant difference between the late L-NAME group and NS group. RT-PCR and Western blotting analysis showed that the mRNA and protein levels of LCHAD expression were significantly down-regulated in the early and mid L-NAME groups but not in the late L-NAME group in the WT and apoE-/- mice compared with the corresponding NS groups.Conclusions Inhibition of NO in early and mid gestation in mice may cause hyperlipidemia and suppression of fatty acid oxidation, whereas preeclampsia-like conditions in late gestation may be a maternal vascular response to inhibition of NO.

  7. Diazeniumdiolate-Doped Poly(lactic-co-glycolic acid)-Based Nitric Oxide Releasing Films as Antibiofilm Coatings

    Science.gov (United States)

    Cai, Wenyi; Wu, Jianfeng; Xi, Chuanwu; Meyerhoff, Mark, E.

    2012-01-01

    Nitric oxide (NO) releasing films with a bilayer configuration are fabricated by doping dibutyhexyldiamine diazeniumdiolate (DBHD/N2O2) in a poly(lactic-co-glycolic acid) (PLGA) layer and further encapsulating this base layer with a silicone rubber top coating. By incorporating pH sensitive dyes within the films, pH changes in the PLGA layer are visualized and correlated with the NO release profiles (flux vs. time). It is demonstrated that PLGA acts as both a promoter and controller of NO release from the coating by providing protons through its intrinsic acid residues (both end-groups and monomeric acid impurities) and hydrolysis products (lactic acid and glycolic acid). Control of the pH changes within the PLGA layer can be achieved by adjusting the ratio of DBHD/N2O2 and utilizing PLGAs with different hydrolysis rates. Coatings with a variety of NO release profiles are prepared with lifetimes of up to 15 d at room temperature (23 °C) and 10 d at 37 °C. When incubated in a CDC flow bioreactor for a one-week period at RT or 37 °C, all the NO releasing films exhibit considerable antibiofilm properties against gram-positive S. aureus and gram-negative E. coli. In particular, compared to the silicone rubber surface alone, an NO releasing film with a base layer of 30 wt% DBHD/N2O2 mixed with poly(lactic acid) exhibits an ~98.4% reduction in biofilm biomass of S. aureus and ~ 99.9% reduction for E. coli at 37 °C. The new diazeniumdiolate-doped PLGA-based NO releasing coatings are expected to be useful antibiofilm coatings for a variety of indwelling biomedical devices (e.g., catheters). PMID:22841918

  8. Design of aqueous two-phase systems for purification of hyaluronic acid produced by metabolically engineered Lactococcus lactis.

    Science.gov (United States)

    Rajendran, Vivek; Puvendran, Kirubhakaran; Guru, Bharath Raja; Jayaraman, Guhan

    2016-02-01

    Hyaluronic acid has a wide range of biomedical applications and its commercial value is highly dependent on its purity and molecular weight. This study highlights the utility of aqueous two-phase separation as a primary recovery step for hyaluronic acid and for removal of major protein impurities from fermentation broths. Metabolically engineered cultures of a lactate dehydrogenase mutant strain of Lactococcus lactis (L. lactis NZ9020) were used to produce high-molecular-weight hyaluronic acid. The cell-free fermentation broth was partially purified using a polyethylene glycol/potassium phosphate system, resulting in nearly 100% recovery of hyaluronic acid in the salt-rich bottom phase in all the aqueous two-phase separation experiments. These experiments were optimized for maximum removal of protein impurities in the polyethylene glycol rich top phase. The removal of protein impurities resulted in substantial reduction of membrane fouling in the subsequent diafiltration process, carried out with a 300 kDa polyether sulfone membrane. This step resulted in considerable purification of hyaluronic acid, without any loss in recovery and molecular weight. Diafiltration was followed by an adsorption step to remove minor impurities and achieve nearly 100% purity. The final hyaluronic acid product was characterized by Fourier-transform IR and NMR spectroscopy, confirming its purity.

  9. Solvent extraction of nitric acid,uranium(VI) and thorium(IV) by N,N,N',N'-tetrahexylsuccinylamide

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    A new kind of diamideN,N,N',N'-tetrahexylsuccinylamide (THSA)wassynthesized,characterized and used for the extraction of HNO3,U(VI) and Th(IV)in a diluent composed of 0.5 volume fraction1,2,4-trimethy benzene(TMB) and 0.5 volume fraction kerosene(OK).Extraction distribution coefficients of U(VI) and Th(IV) as functionsof aqueous nitric acid concentration, extractant concentration,temperature and salting-out agent (LiNO3) have been studied, and it is found that THSA as an extractant is superior to TBP for extraction ofU(VI) and Th(IV).Back extraction was also studied.At low acidity, themain adduct of THSA and HNO3 is HNO3.THSA.THSA.(HNO3)2 and THSA.(HNO3)3 are also found at high acidity.The compositions of extracted species, apparent equilibrium constants and enthalpies ofextraction reactions have also been calculated.

  10. Purification and H-1 NMR spectroscopic characterization of phase II metabolites of tolfenamic acid

    DEFF Research Database (Denmark)

    Sidelmann, U. G.; Christiansen, E.; Krogh, L.

    1997-01-01

    )-anthranilic acid (T), N-(2-hydroxymethyl-3-chlorophenyl)-anthranilic acid (1), N-(2-hydroxymethyl-3-chloro-4-hydroxyphenyl)-anthranilic acid (2), N-(2-formyl-3-chlorophenyl) anthranilic acid (3), N-(2-methyl-3-chloro-4-hydroxyphenyl)-anthranilic acid (4), N-(2-methyl-3-chloro-5-hydroxyphenyl)-anthranilic acid (5...

  11. Diglycolic acid modified zirconium phosphate and studies on the extraction of Am(III) and Eu(III) from dilute nitric acid medium

    Energy Technology Data Exchange (ETDEWEB)

    Selvan, B. Robert; Suneesh, A.S.; Venkatesan, K.A.; Antony, M.P. [Indira Gandhi Centre for Atomic Research, Kalpakkam (India). Fuel Chemistry Division; Dasthaiah, K.; Gardas, R.L. [Indian Institute of Technology - Madras, Chennai (India). Dept. of Chemistry

    2017-06-01

    Diglycolic acid modified zirconium phosphate (ZrP-DGA) was prepared and studied for the extraction of Am(III) and Eu(III) from dilute nitric acid medium. The distribution coefficient (K{sub d}, mL.g{sup -1}) of Am(III) and Eu(III) was measured as a function of time, pH and concentration of Eu(III) ion etc. The K{sub d} of Am(III) and Eu(III) increased with increase of pH, reached a maximum value of distribution coefficient at pH 1.5 - 2, followed by decrease in K{sub d} values. Rapid extraction of Am(III) and Eu(III) in ZrP-DGA was observed followed by the establishment of equilibrium occurred in 100 min. Kinetics of extraction was fitted in to pseudo second order rate equation. The amount of Eu(III) loaded in ZrP-DGA increased with increase in the concentration of Eu(III) ion in aqueous phase and the isotherm was fitted in to Langmuir and Freundlich adsorption models. The extraction of Am(III) in ZrP-DGA was higher as compared to Eu(III) and the interference of Eu(III) on the extraction of Am(III) was studied. The distribution coefficient of some lanthanides in ZrP-DGA was measured and the K{sub d} of lanthanides increased across the lanthanide series. The extracted trivalent metal ions were recovered in three contacts of loaded ZrP-DGA with 0.5 M nitric acid.

  12. Optimizing Conditions for the Purification of Omega-3 Fatty Acids from the By-product of Tuna Canning Processing

    Directory of Open Access Journals (Sweden)

    Teti Estiasih

    2013-05-01

    Full Text Available This research studied the optimization conditions for separation and purification of omega-3 (&omega-3 fatty acids from the by-product of tuna canning processing by urea crystallization. Crystallization reaction conditions of urea inclusion (urea to fatty acid ratio (X1 and crystallization time(X2 were optimized using the Response Surface Methodology (RSM and a model was developed. Optimization results showed a quadratic polynomial regression equation of Y = 24.44X1+5.65X2-8.71XX1 2-0.19X22+1.171X1X2- 12.95. The maximum response was obtained at an urea to fatty acid ratio of 2.99:1 and a crystallization time of 23.64 h and predicted response of 90.44%. Analysis of variance showed that the urea to fatty acid ratio and crystallization time affected the response. Verification under optimal conditions showed that the purity of &omega-3 fatty acids was 89.64% and the enrichment was 2.85 fold. Verification result revealed that the predicted value from this model was reasonably close to the experimentally observed value. The urea crystallization process changed oil quality parameters including oxidation level (peroxide, anisidin, and totox values, Fe, Cu and P concentrations and moisture content and this were mostly due to the saponification process before urea crystallization.

  13. Ascorbic acid improves brachial artery vasodilation during progressive handgrip exercise in the elderly through a nitric oxide-mediated mechanism.

    Science.gov (United States)

    Trinity, Joel D; Wray, D Walter; Witman, Melissa A H; Layec, Gwenael; Barrett-O'Keefe, Zachary; Ives, Stephen J; Conklin, Jamie D; Reese, Van; Zhao, Jia; Richardson, Russell S

    2016-03-15

    The proposed mechanistic link between the age-related attenuation in vascular function and free radicals is an attractive hypothesis; however, direct evidence of free radical attenuation and a concomitant improvement in vascular function in the elderly is lacking. Therefore, this study sought to test the hypothesis that ascorbic acid (AA), administered intra-arterially during progressive handgrip exercise, improves brachial artery (BA) vasodilation in a nitric oxide (NO)-dependent manner, by mitigating free radical production. BA vasodilation (Doppler ultrasound) and free radical outflow [electron paramagnetic resonance (EPR) spectroscopy] were measured in seven healthy older adults (69 ± 2 yr) during handgrip exercise at 3, 6, 9, and 12 kg (∼13-52% of maximal voluntary contraction) during the control condition and nitric oxide synthase (NOS) inhibition via N(G)-monomethyl-L-arginine (L-NMMA), AA, and coinfusion of l-NMMA + AA. Baseline BA diameter was not altered by any of the treatments, while L-NMMA and L-NMMA + AA diminished baseline BA blood flow and shear rate. AA improved BA dilation compared with control at 9 kg (control: 6.5 ± 2.2%, AA: 10.9 ± 2.5%, P = 0.01) and 12 kg (control: 9.5 ± 2.7%, AA: 15.9 ± 3.7%, P vasodilation compared with control and when combined with AA eliminated the AA-induced improvement in BA vasodilation. Free radical outflow increased with exercise intensity but, interestingly, was not attenuated by AA. Collectively, these results indicate that AA improves BA vasodilation in the elderly during handgrip exercise through an NO-dependent mechanism; however, this improvement appears not to be the direct consequence of attenuated free radical outflow from the forearm.

  14. Cross-talk between calcium-calmodulin and nitric oxide in abscisic acid signaling in leaves of maize plants

    Institute of Scientific and Technical Information of China (English)

    Jianrong Sang; Aying Zhang; Fan Lin; Mingpu Tan; Mingyi Jiang

    2008-01-01

    Using pharmacological and biochemical approaches,the signaling pathways between hydrogen peroxide (H2O2),calcium (Ca2+)-calmodulin (CAM),and nitric oxide (NO) in abscisic acid (ABA)-induced antioxidant defense were investigated in leaves of maize (Zea mays L.) plants.Treatments with ABA,H2O2,and CaCI2 induced increases in the generation of NO in maize mesophyll cells and the activity of nitric oxide synthase (NOS) in the cytosolic and microsomal fractions of maize leaves.However,such increases were blocked by the pretreatments with Ca2+ inhibitors and CaM antagonists.Meanwhile,pretreatments with two NOS inhibitors also suppressed the Ca2+-induced increase in the production of NO.On the other hand,treatments with ABA and the NO donor sodium nitroprusside (SNP) also led to increases in the concentration of cytosolic Ca2+ in protoplasts of mesophyll cells and in the expression of calmodulin 1 (CaMI) gene and the contents of CaM in leaves of maize plants,and the increases induced by ABA were reduced by the pretreatments with a NO scavenger and a NOS inhibitor.Moreover,SNP-induced increases in the expression of the antioxidant genes superoxide dismutase 4 (SOD4),cytosolic ascorbate peroxidase (cAPX),and glutathione reductase 1 (GRI) and the activities of the chloroplastic and cytosolic antioxidant enzymes were arrested by the pretreatments with Ca2+ inhibitors and CaM antagonists.Our results suggest that Ca2+-CaM functions both upstream and downstream of NO production,which is mainly from NOS,in ABA- and H2O2-induced antioxidant defense in leaves of maize plants.

  15. New Inducible Nitric Oxide Synthase and Cyclooxygenase-2 Inhibitors, Nalidixic Acid Linked to Isatin Schiff Bases via Certain l-Amino Acid Bridges

    Directory of Open Access Journals (Sweden)

    Ahmed M. Naglah

    2016-04-01

    Full Text Available A series of new Schiff bases were synthesized by condensation of isatins with the nalidixic acid-l-amino acid hydrazides. Prior to hydrazide formation, a peptide linkage has been prepared via coupling of nalidixic acid with appropriate l-amino acid methyl esters to yield 3a–c. The chemical structures of the new Schiff bases (5b and 5d–h were confirmed by means of IR, NMR, mass spectroscopic, and elemental analyses. The anti-inflammatory activity of these Schiff bases was evaluated via measurement of the expressed inducible nitric oxide synthase (iNOS and cyclooxygenase-2 (COX-2 in the lipopolysaccharide (LPS-stimulated RAW264.7 macrophage cells model. The Schiff bases exhibited significant dual inhibitory effect against the induction of the pro-inflammatory iNOS and COX-2 proteins with variable potencies. However, they strongly down-regulated the iNOS expression to the level of 16.5% ± 7.4%–42.2% ± 19.6% compared to the effect on COX-2 expression (<56.4% ± 3.1% inhibition at the same concentration (10 μM. The higher iNOS inhibition activity of the tested Schiff bases, relative to that of COX-2, seems to be a reflection of the combined suppressive effects exerted by their nalidixic acid, isatins (4a–c, and l-amino acid moieties against iNOS expression. These synthesized nalidixic acid-l-amino acid-isatin conjugates can be regarded as a novel class of anti-inflammatory antibacterial agents.

  16. Reactions between water-soluble organic acids and nitrates in atmospheric aerosols: Recycling of nitric acid and formation of organic salts

    Science.gov (United States)

    Wang, Bingbing; Laskin, Alexander

    2014-03-01

    Atmospheric particles often include a complex mixture of nitrate and secondary organic materials accumulated within the same individual particles. Nitrate as an important inorganic component can be chemically formed in the atmosphere. For instance, formation of sodium nitrate (NaNO3) and calcium nitrate (Ca(NO3)2) occurs when nitrogen oxides and nitric acid (HNO3) react with sea salt and calcite, respectively. Organic acids contribute a significant fraction of photochemically formed secondary organics that can condense on the preexisting nitrate-containing particles. Here we present a systematic microanalysis study on chemical composition of laboratory-generated particles composed of water-soluble organic acids and nitrates (i.e., NaNO3 and Ca(NO3)2) using computer-controlled scanning electron microscopy with energy-dispersive X-ray microanalysis and Fourier transform infrared microspectroscopy. The results show that water-soluble organic acids can react with nitrates and release gaseous HNO3 during the dehydration process. These reactions are attributed to acid displacement of nitrate with weak organic acids driven by the evaporation of HNO3 into gas phase because of its relatively high volatility. The reactions result in significant nitrate depletion and formation of organic salts in mixed organic acids/nitrate particles that, in turn, may affect their physical and chemical properties relevant to atmospheric environment and climate. Airborne nitrate concentrations are estimated by thermodynamic calculations corresponding to various nitrate depletions in selected organic acids of atmospheric relevance. The results indicate a potential mechanism of HNO3 recycling that may further affect concentrations of gas and condensed phase species in the atmosphere and the heterogeneous reaction chemistry between them.

  17. Purification and amino acid sequence of a bacteriocins produced by Lactobacillus salivarius K7 isolated from chicken intestine

    Directory of Open Access Journals (Sweden)

    Kenji Sonomoto

    2006-03-01

    Full Text Available A bacteriocin-producing strain, Lactobacillus K7, was isolated from a chicken intestine. The inhibitory activity was determined by spot-on-lawn technique. Identification of the strain was performed by morphological, biochemical (API 50 CH kit and molecular genetic (16S rDNA basis. Bacteriocin purification processes were carried out by amberlite adsorption, cation exchange and reverse-phase high perform- ance liquid chromatography. N-terminal amino acid sequences were performed by Edman degradation. Molecular mass was determined by electrospray-ionization (ESI mass spectrometry (MS. Lactobacillus K7 showed inhibitory activity against Lactobacillus sakei subsp. sakei JCM 1157T, Leuconostoc mesenteroides subsp. mesenteroides JCM 6124T and Bacillus coagulans JCM 2257T. This strain was identified as Lb. salivarius. The antimicrobial substance was destroyed by proteolytic enzymes, indicating its proteinaceous structure designated as a bacteriocin type. The purification of bacteriocin by amberlite adsorption, cation exchange, and reverse-phase chromatography resulted in only one single active peak, which was designated FK22. Molecular weight of this fraction was 4331.70 Da. By amino acid sequence, this peptide was homology to Abp 118 beta produced by Lb. salivarius UCC118. In addition, Lb. salivarius UCC118 produced 2-peptide bacteriocin, which was Abp 118 alpha and beta. Based on the partial amino acid sequences of Abp 118 beta, specific primers were designed from nucleotide sequences according to data from GenBank. The result showed that the deduced peptide was high homology to 2-peptide bacteriocin, Abp 118 alpha and beta.

  18. Tangential Flow Ultrafiltration Allows Purification and Concentration of Lauric Acid-/Albumin-Coated Particles for Improved Magnetic Treatment

    Directory of Open Access Journals (Sweden)

    Jan Zaloga

    2015-08-01

    Full Text Available Superparamagnetic iron oxide nanoparticles (SPIONs are frequently used for drug targeting, hyperthermia and other biomedical purposes. Recently, we have reported the synthesis of lauric acid-/albumin-coated iron oxide nanoparticles SEONLA-BSA, which were synthesized using excess albumin. For optimization of magnetic treatment applications, SPION suspensions need to be purified of excess surfactant and concentrated. Conventional methods for the purification and concentration of such ferrofluids often involve high shear stress and low purification rates for macromolecules, like albumin. In this work, removal of albumin by low shear stress tangential ultrafiltration and its influence on SEONLA-BSA particles was studied. Hydrodynamic size, surface properties and, consequently, colloidal stability of the nanoparticles remained unchanged by filtration or concentration up to four-fold (v/v. Thereby, the saturation magnetization of the suspension can be increased from 446.5 A/m up to 1667.9 A/m. In vitro analysis revealed that cellular uptake of SEONLA-BSA changed only marginally. The specific absorption rate (SAR was not greatly affected by concentration. In contrast, the maximum temperature Tmax in magnetic hyperthermia is greatly enhanced from 44.4 °C up to 64.9 °C by the concentration of the particles up to 16.9 mg/mL total iron. Taken together, tangential ultrafiltration is feasible for purifying and concentrating complex hybrid coated SPION suspensions without negatively influencing specific particle characteristics. This enhances their potential for magnetic treatment.

  19. Purification of gamma-amino butyric acid (GABA) from fermentation of defatted rice bran extract by using ion exchange resin

    Science.gov (United States)

    Tuan Nha, Vi; Phung, Le Thi Kim; Dat, Lai Quoc

    2017-09-01

    Rice bran is one of the significant byproducts of rice processing with 10 %w/w of constitution of whole rice grain. It is rich in nutrient compounds, including glutamic acid. Thus, it could be utilized for the fermentation with Lactobateria for synthesis of GABA, a valuable bioactive for antihypertensive effects. However, the concentration and purity of GABA in fermentation broth of defatted rice bran extract is low for production of GABA drug. This research focused on the purification of GABA from the fermentation broth of defatted rice bran extract by using cation exchange resin. The results indicate that, the adsorption isotherm of GABA by Purelite C100 showed the good agreement with Freundlich model, with high adsorption capacity. The effects of pH and concentration of NaCl in eluent on the elution were also investigated. The obtained results show that, at the operating conditions of elution as follows: pH 6.5, 0.8 M of NaCl in eluent, 0.43 of bed volume; concentration of GABA in accumulative eluent, the purity and recovery yield of GABA were 743.8 ppm, 44.0% and 84.2%, respectively. Results imply that, it is feasible to apply cation exchange resin for purification of GABA from fermentation broth of defatted rice bran extract.

  20. Tangential Flow Ultrafiltration Allows Purification and Concentration of Lauric Acid-/Albumin-Coated Particles for Improved Magnetic Treatment.

    Science.gov (United States)

    Zaloga, Jan; Stapf, Marcus; Nowak, Johannes; Pöttler, Marina; Friedrich, Ralf P; Tietze, Rainer; Lyer, Stefan; Lee, Geoffrey; Odenbach, Stefan; Hilger, Ingrid; Alexiou, Christoph

    2015-08-14

    Superparamagnetic iron oxide nanoparticles (SPIONs) are frequently used for drug targeting, hyperthermia and other biomedical purposes. Recently, we have reported the synthesis of lauric acid-/albumin-coated iron oxide nanoparticles SEON(LA-BSA), which were synthesized using excess albumin. For optimization of magnetic treatment applications, SPION suspensions need to be purified of excess surfactant and concentrated. Conventional methods for the purification and concentration of such ferrofluids often involve high shear stress and low purification rates for macromolecules, like albumin. In this work, removal of albumin by low shear stress tangential ultrafiltration and its influence on SEON(LA-BSA) particles was studied. Hydrodynamic size, surface properties and, consequently, colloidal stability of the nanoparticles remained unchanged by filtration or concentration up to four-fold (v/v). Thereby, the saturation magnetization of the suspension can be increased from 446.5 A/m up to 1667.9 A/m. In vitro analysis revealed that cellular uptake of SEON(LA-BSA) changed only marginally. The specific absorption rate (SAR) was not greatly affected by concentration. In contrast, the maximum temperature Tmax in magnetic hyperthermia is greatly enhanced from 44.4 °C up to 64.9 °C by the concentration of the particles up to 16.9 mg/mL total iron. Taken together, tangential ultrafiltration is feasible for purifying and concentrating complex hybrid coated SPION suspensions without negatively influencing specific particle characteristics. This enhances their potential for magnetic treatment.

  1. Sequence-specific purification of DNA oligomers in hydrophobic interaction chromatography using peptide nucleic acid amphiphiles: extended dynamic range.

    Science.gov (United States)

    Savard, Jeffrey M; Schneider, James W

    2007-06-01

    We present improvements on a previously reported method (Vernille JP, Schneider JW. 2004. Biotechnol Prog 20(6):1776-1782) to purify DNA oligomers by attachment of peptide nucleic acid amphiphiles (PNAA) to particular sequences on the oligomers, followed by their separation from unbound oligomers using hydrophobic interaction chromatography (HIC). Use of alkyl-modified HIC media (butyl and octyl sepharose) over phenyl-modified media (phenyl sepharose) reduced the elution time of unbound DNA while not affecting the elution time of the PNAA/DNA complex. Modifying the alkane tail length for PNAA from C(12) to C(18) increased slightly the retention of PNAA/DNA duplexes. By combining these two refinements, we show that sequence-specific purifications of DNA oligomers 60 bases in length or more can be achieved with high resolution, even when the PNAA alkane is attached to the center of the target strand. The insensitivity of the PNAA/DNA duplex binding to choice of HIC media appears to be due to a surface-induced aggregation phenomenon that does not occur in the case of untagged DNA. We also report on the use of batch HIC as an adequate predictor of elution profiles in linear gradient HIC, and its potential to considerably reduce purification times by applying step gradients. (c) 2006 Wiley Periodicals, Inc.

  2. Efficient purification of lysozyme from egg white by 2-mercapto-5-benzimidazolesulfonic acid modified Fe3O4/Au nanoparticles.

    Science.gov (United States)

    Zhu, Xinjun; Zhang, Lianying; Fu, Aiyun; Yuan, Hao

    2016-02-01

    2-Mercapto-5-benzimidazolesulfonic acid (MBISA) modified Fe3O4/Au nanoparticles were synthesized in aqueous solution and characterized by photo correlation spectroscopy (PCS) and vibrating sample magnetometer (VSM). The so-obtained Fe3O4/Au-MBISA nanoparticles were capable of specific adsorbing lysozyme. The maximum amount of lysozyme adsorbed on 1.0mg Fe3O4/Au-MBISA nanoparticles was 346μg. The lysozyme desorption behavior was studied and the lysozyme recovery from Fe3O4/Au-MBISA nanoparticles approached 100% under optimal conditions, and the reusability studies showed that the nanoparticles could maintain about 91% of the initial lysozyme adsorption capacity after 7 repeated adsorption-elution cycles. The Fe3O4/Au-MBISA nanoparticles were used in the purification of lysozyme from chicken egg white, which was verified by a single SDS-PAGE band. Therefore, the obtained Fe3O4/Au-MBISA nanoparticles exhibited excellent performance in the direct purification of lysozyme from egg white.

  3. Production of 15N-enriched nitric acid (H15NO3

    Directory of Open Access Journals (Sweden)

    C. R. Sant Ana Filho

    2008-12-01

    Full Text Available Techniques that employ 15N have proved to be an important tool in many areas of the agronomic and biomedical sciences. Nevertheless, their use is limited by methodological difficulties and by the price of compounds in the international market. Nitric compounds (15NO3- have attracted the interest of researchers. However, these compounds are not currently produced in Brazil. Thus, in the present work H15NO3 was obtained from the oxidation of anhydrous 15NH3. The method we used differs from the industrial process in that the absorption tower is replaced with a polytetrafluoroethylene-lined, stainless-steel hydration reactor. The process output was evaluated based on the following parameters: reaction temperature; ratio of reagents; pressure and flow of 15NH3(g through the catalyst (Pt/Rh. The results showed that, at the best conditions (500 ºC; 50 % excess O2; 0.4 MPa; and 3.39 g.min-1 of 15NH3, a conversion percentage (N-15NH3 to N-15NO3- of 62.2 %, an overall nitrogen balance (N-15NH3 + N-15NO3- of 86.8 %, and purity higher than 99 % could be obtained.

  4. Macroscopic, thermodynamic, kinetic and microscopic study of nitric acid pickling of Elektron 21 (EV31A magnesium alloy

    Directory of Open Access Journals (Sweden)

    Benjamin Mouls

    2014-12-01

    Full Text Available The study of pickling of the EL21T6 substrate in a nitric acid bath firstly provided knowledge of the influence of the different experimental parameters (concentration of acid, temperature and stirring of the solution in relation to the etching rate. This experimental part led to the choice of standard pickling (Tbath = 25 °C, moderate stirring (250 rpm, [HNO3] = 1.20 mol/L, duration of 2 min so as to obtain constant removal of material, even after several uses of the pickling bath. SEM observations also confirmed that in these operating conditions, pickling concerns both the grains of the matrix and the precipitates of type Mg3(Nd, Gd, leading to uniform removal of material from the surface. Working from a number of assumptions, thermodynamic and chemical kinetic studies then allowed a pickling mechanism to be proposed and led to obtaining values for the corresponding kinetic parameters (order of reaction, constant of mean rate, activation energy to be obtained.

  5. Solution extraction of several lanthanides from nitric acid with isohexyl-BTP in [Cnmim][NTf2] ionic liquid

    Institute of Scientific and Technical Information of China (English)

    赵龙; 董珍; 马国龙; 袁威津

    2015-01-01

    The extraction behavior of several lanthanides (La3+, Eu3+, Lu3+) from nitric acid (HNO3) solution was studied using a novel extraction system based on 2,6-bis(5,6-dihexyl-1,2,4-triazin-3-yl) pyridine (isohexyl-BTP) as extractant in 1-alkyl-3-me-thylimidazolium bis(trifluoromethylsufonyl)imide ([Cnmim][NTf2]) ionic liquid. Isohexyl-BTP in ionic liquids exhibited remarkably better extraction performance for lanthanides than that in octanol-dodecane (3:7 v/v) system. Lower HNO3 concentration and short alkyl chain length of [Cnmim]+were more favourable for removal of lanthanides. Besides, it was confirmed that isohexyl-BTP in ILs formed a 1:3 complex [Ln(BTP)3(NO3)n](3–n)+(n=0, 1) by slope analysis. In addition, [C2mim][NTf2] preferred to extract lanthanides via a cation exchange mechanism at lower acidity, which was proved via UV-Vis measurement. It was speculated that extraction mechanism shifted from cation exchange to neutral species extraction with increase in HNO3 concentration and alkyl chain length of [Cnmim]+due to the H+completion, NO3–inhibition and hydrophobicity of IL.

  6. The influence of oxidation with nitric acid on the preparation and properties of active carbon enriched in nitrogen

    Energy Technology Data Exchange (ETDEWEB)

    Pietrzak, Robert [Laboratory of Coal Chemistry and Technology, Faculty of Chemistry, Adam Mickiewicz University, Grunwaldzka 6, 60-780 Poznan (Poland)], E-mail: pietrob@amu.edu.pl; Nowicki, Piotr; Wachowska, Helena [Laboratory of Coal Chemistry and Technology, Faculty of Chemistry, Adam Mickiewicz University, Grunwaldzka 6, 60-780 Poznan (Poland)

    2009-01-01

    The effect of oxidation by 20% nitric acid on the properties and performance of active carbons enriched with nitrogen by means of the reaction with urea in the presence of air has been studied. The study has been made on demineralised orthocoking coal and the carbonisates obtained from it at 600 or 700 deg. C, subjected to the processes of nitrogenation, oxidation and activation with KOH in different sequences. The amount of nitrogen introduced into the carbon with the aid of urea has been found to depend on the stage at which the process of nitrogenation was performed. The process of oxidation of the demineralised coal and the active carbon obtained from the former has been found to favour nitrogen introduction into the carbon structure. In the process of nitrogenation of the carbonisates the amount of nitrogen introduced has inversely depended on the temperature of carbonisation. The modifications of the processes permitted obtaining materials of different textural parameters, different acid-base character of the surface and different iodine sorption capacity.

  7. The Arabidopsis aleurone layer responds to nitric oxide, gibberellin, and abscisic acid and is sufficient and necessary for seed dormancy.

    Science.gov (United States)

    Bethke, Paul C; Libourel, Igor G L; Aoyama, Natsuyo; Chung, Yong-Yoon; Still, David W; Jones, Russell L

    2007-03-01

    Seed dormancy is a common phase of the plant life cycle, and several parts of the seed can contribute to dormancy. Whole seeds, seeds lacking the testa, embryos, and isolated aleurone layers of Arabidopsis (Arabidopsis thaliana) were used in experiments designed to identify components of the Arabidopsis seed that contribute to seed dormancy and to learn more about how dormancy and germination are regulated in this species. The aleurone layer was found to be the primary determinant of seed dormancy. Embryos from dormant seeds, however, had a lesser growth potential than those from nondormant seeds. Arabidopsis aleurone cells were examined by light and electron microscopy, and cell ultrastructure was similar to that of cereal aleurone cells. Arabidopsis aleurone cells responded to nitric oxide (NO), gibberellin (GA), and abscisic acid, with NO being upstream of GA in a signaling pathway that leads to vacuolation of protein storage vacuoles and abscisic acid inhibiting vacuolation. Molecular changes that occurred in embryos and aleurone layers prior to germination were measured, and these data show that both the aleurone layer and the embryo expressed the NO-associated gene AtNOS1, but only the embryo expressed genes for the GA biosynthetic enzyme GA3 oxidase.

  8. Determination of Uranyl Nitrate and Nitric Acid Based on Density and Conductivity Measurements

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>Measurement of the uranium and acidity plays an important role in process control of spent fuel reprocessing. The main chemical compositions including a mount of U solution in spent fuel reprocessing

  9. Interannual variations of early winter Antarctic polar stratospheric cloud formation and nitric acid observed by CALIOP and MLS

    Science.gov (United States)

    Lambert, Alyn; Santee, Michelle L.; Livesey, Nathaniel J.

    2016-12-01

    We use satellite-borne measurements collected over the last decade (2006-2015) from the Aura Microwave Limb Sounder (MLS) and the Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) to investigate the nitric acid distribution and the properties of polar stratospheric clouds (PSCs) in the early winter Antarctic vortex. Frequently, at the very start of the winter, we find that synoptic-scale depletion of HNO3 can be detected in the inner vortex before the first lidar detection of geophysically associated PSCs. The generation of "sub-visible" PSCs can be explained as arising from the development of a solid particle population with low number densities and large particle sizes. Assumed to be composed of nitric acid trihydrate (NAT), the sub-visible PSCs form at ambient temperatures well above the ice frost point, but also above the temperature at which supercooled ternary solution (STS) grows out of the background supercooled binary solution (SBS) distribution. The temperature regime of their formation, inferred from the simultaneous uptake of ambient HNO3 into NAT and their Lagrangian temperature histories, is at a depression of a few kelvin with respect to the NAT existence threshold, TNAT. Therefore, their nucleation requires a considerable supersaturation of HNO3 over NAT, and is consistent with a recently described heterogeneous nucleation process on solid foreign nuclei immersed in liquid aerosol. We make a detailed investigation of the comparative limits of detection of PSCs and the resulting sequestration of HNO3 imposed by lidar, mid-infrared, and microwave techniques. We find that the temperature history of air parcels, in addition to the local ambient temperature, is an important factor in the relative frequency of formation of liquid/solid PSCs. We conclude that the initiation of NAT nucleation and the subsequent development of large NAT particles capable of sedimentation and denitrification in the early winter do not emanate from an ice

  10. Development of a Technology for Treating Wastewater Contaminated with Nitric Acid

    Directory of Open Access Journals (Sweden)

    Liz Mabel Ríos Hidalgo

    2013-01-01

    Full Text Available The production process of nitroaromatic hazardous compounds, with the generation of acidic wastewater, represents a significant danger for the health and safety of the workers and the environment. The present study is focused on the development of an efficient installation to treat acidic wastewater resulting from the synthesis process of nitroaromatic compound, considering workers safety and environmental criteria. In this research, a detailed study of the different alternatives that can be used for effective and safe treatment of acidic wastewater was performed. The analysis of several technological schemes for the acidic wastewaters neutralization and the selection of the most feasible alternative from a technical-economic point of view were carried out. The simulation and mathematical modeling developed in this research represent a significant advance in the knowledge of this process for working in a much more secure form. The technological scheme of the process was defined, and the design of the main and auxiliary equipment as well as the piping system was carried out using different computational programs. Finally, this paper proposes a technological design for the treatment of acidic wastewater generated by the production process of nitroaromatic compound, which represents the basic criteria for the further design, construction, and equipment installation of the plant.

  11. Interactions of Gas-Phase Nitric/Nitrous Acids and Primary Organic Aerosol in the Atmosphere of Houston, TX

    Science.gov (United States)

    Ziemba, L. D.; Griffin, R. J.; Dibb, J. E.; Anderson, C. H.; Whitlow, S. I.; Lefer, B. L.; Flynn, J.; Rappenglück, B.

    2007-12-01

    Concentrations of aerosol and gas-phase pollutants were measured on the roof of an 18-story building during the Texas Air Quality Study II Radical and Aerosol Measurement Project (TRAMP) from August 15 through September 28, 2006. Aerosol measurements included size-resolved, non-refractory mass concentrations of ammonium, nitrate, sulfate, chloride, and organic aerosol in submicron particles using an Aerodyne quadrupole aerosol mass spectrometer (Q-AMS). Particulate water-soluble organic carbon (PWSOC) was quantified using a mist chamber/total organic carbon analysis system. Concentration data for gas-phase pollutants included those for nitric acid (HNO3), nitrous acid (HONO), and hydrochloric acid (HCl) collected using a mist chamber/ion chromatographic technique, oxides of nitrogen (NOx) collected using a chemiluminescent method, and carbon monoxide (CO) collected using an infrared gas correlation wheel instrument. Coincident increases in nitrate and organic aerosol mass concentrations were observed on many occasions throughout the measurement campaign, most frequently during the morning rush hour. Based on the lack of organic aerosol processing (defined by the ratio of m/z = 44/57 in the Q-AMS spectra), strong correlation with NOx and CO, and a lack of significant increase in PWSOC concentration, the spikes in organic aerosol were likely associated with primary organic aerosol (POA). During these events, gas-phase HNO3 concentration decreases were observed simultaneously with increases in gas-phase HONO concentrations. These data likely indicate uptake of HNO3 and subsequent heterogeneous conversion to HONO involving POA. Preliminary calculations show that HNO3 partitioning could account for the majority of the observed HONO and aerosol nitrate concentrations during these events. Q-AMS chloride and HCl data also indicate uptake of chloride by particles during these events. This phenomenon was also observed during the night, but these nocturnal events were less

  12. Improvement effect on corrosion under heat flux in nitric acid solutions of anti-IGC stainless steel and high Cr-W-Si Ni base RW alloy

    Energy Technology Data Exchange (ETDEWEB)

    Doi, Masamitsu; Kiuchi, Kiyoshi; Yano, Masaya; Sekiyama, Yoshio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2001-03-01

    In the advanced purex reprocessing equipment, the higher corrosion resistance is required for materials because of the high corrosive environment caused from the thermodynamic decomposition of boiling nitric acid. The authors group has been developed the two types of new corrosion resistant materials for application to the reprocessing equipment. One is the type 304ULC stainless steel with controlled microstructure and decreased minor elements (EB-SAR). The other is the nickel base alloy with the ability of forming stable oxide film by addition of Cr, W and Si (RW alloy). In this study, the heat transfer tubes applied in diminished pressure was postulated. In addition to the dominant factors of heat conducting corrosion by the nitric acid solution, the effect of the heat flux and the concentration of the corrosive vanadium ions were investigated. (author)

  13. Kinetics study on the dissolution of UO2 particles by microwave and conventional heating in 4 mol/L nitric acid

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The dissolution of UO2 particles in 4 mol·L-1 nitric acid medium at temperatures of 90-110℃ by mi- crowave heating and conventional heating has been investigated, respectively. It is found that the dissolution ratios of UO2 particles by microwave heating were 10%-40% higher than that by conven- tional heating. Kinetics research shows that the dissolution of UO2 particles in 4 mol·L-1 nitric acid is controlled by the diffusion control model for microwave heating and by the surface reaction control model for conventional heating. The diffusion control model for the dissolution of UO2 particles by mi- crowave heating could be explained by the diffuseness on the surface of UO2 particles.

  14. [Determination of nine hazardous elements in textiles by inductively coupled plasma optical emission spectrometer after microwave-assisted dilute nitric acid extraction].

    Science.gov (United States)

    Chen, Fei; Xu, Dian-dou; Tang, Xiao-ping; Cao, Jing; Liu, Ya-ting; Deng, Jian

    2012-01-01

    Textiles are easily contaminated by heavy metals in the course of processing. In order to monitor the quality of textiles, a new method was developed for simultaneous determination of arsenic, antimony, lead, cadmium, chromium, cobalt, copper, nickel and mercury in textiles by inductively coupled plasma optical emission spectrometry (ICP-OES) after microwave-assisted dilute nitric acid extraction. After optimizing extraction conditions, we ultimately selected 5% nitric acid as extractant and 5 min as extraction time with the extraction temperature of 120 degrees C and instrument power of 400W in the microwave-assisted extraction procedure. Nine hazardous elements were detected sequentially by ICP-OES. The results showed that the detection limits were 0.3-15 microg x L(-1) and the recoveries 73.6%-105% with the RSDs (n = 3) of 0.1%-3%. The proposed method was successfully used to determine nine elements in cotton, wool, terylene and acrylic.

  15. 我国湿法磷酸净化技术及其工业化进展%Development in Technology and Industry of Purification of Wet-process Phosphoric Acid in China

    Institute of Scientific and Technical Information of China (English)

    温倩

    2012-01-01

    分析了湿法磷酸净化的主要技术及特点,介绍了我国湿法磷酸净化技术的产业化情况,提出了湿法磷酸净化技术的发展趋势和展望。%Main technical characteristics about purification of wet-process phosphoric acid were analyzed. The industrializations of wet-process phosphoric acid purification in China were introduced. Development trends and recommendations about the industry of wet-process acid purification were given.

  16. Corrosion investigations on zircaloy-4 and titanium dissolver materials for MOX fuel dissolution in concentrated nitric acid containing fluoride ions

    Science.gov (United States)

    Jayaraj, J.; Krishnaveni, P.; Krishna, D. Nanda Gopala; Mallika, C.; Mudali, U. Kamachi

    2016-05-01

    Aqueous reprocessing of plutonium-rich mixed oxide fuels require fluoride as a dissolution catalyst in boiling nitric acid for an effective dissolution of the spent fuel. High corrosion rates were obtained for the candidate dissolver materials zircaloy-4 (Zr-4) and commercial pure titanium (CP-Ti grade 2) in boiling 11.5 M HNO3 + 0.05 M NaF. Complexing the fluoride ions either with Al(NO3)3 or ZrO(NO3)2 aided in decreasing the corrosion rates of Zr-4 and CP-Ti. From the obtained corrosion rates it is concluded that CP-Ti is a better dissolver material than Zr-4 for extended service life in boiling 11.5 M HNO3 + 0.05 M NaF, when complexed with 0.15 M ZrO(NO3)2. XPS analysis confirmed the presence of TiO2 and absence of fluoride on the surface of CP-Ti samples, indicating that effective complexation had occurred in solution leading to passivation of the metal and imparting high corrosion resistance.

  17. Nitric oxide involved in signal transduction of Jasmonic acid-induced stomatal closure of Vicia faba L.

    Institute of Scientific and Technical Information of China (English)

    LIU Xin; SHI Wuliang; ZHANG Shuqiu; LOU Chenghou

    2005-01-01

    Nitric oxide (NO) and Jasmonic acid (JA) are two key signaling molecules involved in many and diverse biological pathways in plants. Growing evidence suggested that NO signaling interacts with JA signaling. In this work, Our experiment showed that NO exists in guard cell of Vicia faba L., and NO is involved in signal transduction of JA- induced stomata closuring: (ⅰ) JA enhances NO synthesis in guard cell; (ⅱ) both JA and NO induced stomatal closure, and had dose response to their effects; (ⅲ) there are synergetic correlation between JA and lower NO concentration in regulation of stomatal movement; (ⅳ) JA-induced stomatal closure was largely prevented by 2-phenyl-4,4,5,5-tetrame- thylimidazoline-1-oxyl-3-oxide (PTIO), a specific NO scavenger. An inhibitor of NO synthase (NOS) in mammalian cells, NG-nitro-L-Arg-methyl eater (L-NAME) also inhibits plant NOS, repressing JA-induced NO generation and JA-induced stomatal closure. We presumed that NO mainly comes from NOS after JA treatment.

  18. Improvement of microwave-assisted digestion of milk powder with diluted nitric acid using oxygen as auxiliary reagent

    Energy Technology Data Exchange (ETDEWEB)

    Bizzi, Cezar A. [Departamento de Quimica, Universidade Federal de Santa Maria, 97105-900, Santa Maria, RS (Brazil); Instituto Nacional de Ciencia e Tecnologia de Bioanalitica, Campinas, SP (Brazil); Barin, Juliano S. [Departamento de Tecnologia e Ciencia dos Alimentos, Universidade Federal de Santa Maria, 97105-900, Santa Maria, RS (Brazil); Garcia, Edivaldo E. [Departamento de Quimica, Universidade Estadual de Maringa, 87100-900, Maringa, PR (Brazil); Nobrega, Joaquim A. [Departamento de Quimica, Universidade Federal de Sao Carlos, 13565-905, Sao Carlos, SP (Brazil); Dressler, Valderi L. [Departamento de Quimica, Universidade Federal de Santa Maria, 97105-900, Santa Maria, RS (Brazil); Instituto Nacional de Ciencia e Tecnologia de Bioanalitica, Campinas, SP (Brazil); Flores, Erico M.M., E-mail: ericommf@gmail.com [Departamento de Quimica, Universidade Federal de Santa Maria, 97105-900, Santa Maria, RS (Brazil); Instituto Nacional de Ciencia e Tecnologia de Bioanalitica, Campinas, SP (Brazil)

    2011-05-15

    The feasibility of using diluted HNO{sub 3} solutions under oxygen pressure for decomposition of whole and non-fat milk powders and whey powder samples has been evaluated. Digestion efficiency was evaluated by determining the carbon content in solution (digests) and the determination of Ca, Cd, Cu, Fe, K, Mg, Mn, Mo, Na, Pb and Zn was performed by inductively coupled plasma optical emission spectrometry and Hg by chemical vapor generation coupled to inductively coupled plasma mass spectrometry. Samples (up to 500 mg) were digested using HNO{sub 3} solutions (1 to 14 mol L{sup -1}) and the effect of oxygen pressure was evaluated between 2.5 and 20 bar. It was possible to perform the digestion of 500 mg of milk powder using 2 mol L{sup -1} HNO{sub 3} with oxygen pressure ranging from 7.5 to 20 bar with resultant carbon content in digests lower than 1700 mg L{sup -1}. Using optimized conditions, less than 0.86 mL of concentrated nitric acid (14 mol L{sup -1}) was enough to digest 500 mg of sample. The accuracy was evaluated by determination of metal concentrations in certified reference materials, which presented an agreement better than 95% (Student's t test, P < 0.05) for all the analytes.

  19. Recovery of Nickel from Reformer Catalysts of Direct Reduction, Using the Pressurized Dissolving Method in Nitric Acid

    Directory of Open Access Journals (Sweden)

    B. Abrar

    2016-10-01

    Full Text Available In the process of direct reduction of iron pellet and production of sponge iron, NiO/Al2O3 act as a catalyst for the generation of carbon monoxide and hydrogen by vapor and natural gas. As an expensive material used in MIDREX method for steel units, this type of catalyst has major environmental problems after accumulation. The steel industry in Iran hopes to employ the MIDREX technique for the 80 percent of the 50 million tons of steel. Thus, the problem of spent catalysts will become a serious environmental challenge. Through the hydrometallurgy method, the present study investigates a possible solution to the problem of catalyst depot (due to heavy metals such as nickel via nickel recovery, which may increase the possibility of selling or re-using the precious and expensive metal. The present research studied the Nickel recovery from spent catalysts of NiO/Al2O¬3 used in reduction gas reliefs of the production of sponge iron unit. In this study, the parameters of temperature, concentration, time and Rpm were studied using pressurized dissolving method. 100% efficiency was achieved at 140 °C for 120 minutes, nitric acid concentration of 1.5 mm, Rpm of 600 and 40 s/l 40 grams per liter.

  20. Synergistic extraction of U(VI) and Th(IV) from nitric acid media with HBMPPT and TBP in toluene

    Institute of Scientific and Technical Information of China (English)

    YUShaoning; BAOBorong

    1999-01-01

    The sysnergistic extraction of U(VI)and Th(IV) from nitric acid solution by HBMPPT(4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione) and TBP( tributylphosphate)in toluene was studied.The extraction ability of HBMPPT for U(VI) and Th(IV) was not so high.but when a little TBP was added in,the ability to extract U(VI) and Th(IV) was improved.The extracted complexes may be presented as UO2NO3.BMPPT.TBP and UO2(BMPPT)2.TBP for U(VI).and Th(NO3)3.BMPPT.TBP and Th(NO3)2(BMPPT)2.TBP for Th(IV),respectively,in the synergistic extraction system.The synergistic effect of HBMPPT and TBP makes the separation cofeeicient of U(VI)/Th (IV) or U(VI)/Eu(Ⅲ) reach a high value.

  1. Development of a chemical process using nitric acid-cerium(IV) for decontamination of high-level waste canisters

    Energy Technology Data Exchange (ETDEWEB)

    Bray, L.A.

    1988-06-01

    A simple and effective method was developed for contamination of high-level waste containers. This method of chemical decontamination is applicable to a wide variety of contaminated equipment found in the nuclear industry. The process employs a oxidant system (Ce(IV)) in nitric acid (HNO/sub 3/) solution to chemically mill a thin layer from the canister surface. Contaminated canisters are simply immersed in the solution at a controlled temperature and Ce(IV) concentration level. The spent solution is discarded to the high-level waste stream and added to subsequent glass batches. The Ce(IV)/HNO/sub 3/ solution has been shown to be effective in chemically milling the surface of stainless steel, similar to the electropolishing process, but without the need for an applied electrical current. West Valley (WV) staff had previously evaluated several canister decontamination methods, including electropolishing, liquid abrasive blast, high-pressure water wash, and ultrasonic cleaning, before the Ce(IV)/HNO/sub 3/ redox solution on treatment was selected. The initial concept involved continuous electrochemical regeneration of the ceric ion. Extensive in-cell pumping and close-coupled heat transfer and electrochemical equipment were required. The objective of this study, was to simplify the original concept. 2 refs., 16 figs., 4 tabs.

  2. 硝酸乙醇法测定纤维素含量%Determination the content of cellulose by nitric acid-ethanol method

    Institute of Scientific and Technical Information of China (English)

    王林风; 程远超

    2011-01-01

    根据秸秆乙醇的工艺特点,对硝酸乙醇法测定玉米秸秆、小麦秸秆、稻草及其预处理后物料的纤维素含量进行了研究.优化了粉碎时长、硝酸-乙醇混合液处理遍数、试样粒度及抽滤漏斗孔径四个参数.确定了优化后的测定方法:秸秆试样粉碎时长15 s,硝酸-乙醇混合液处理4遍,粒度40~60目,使用G2玻璃砂芯漏斗.秸秆预处理后物料试样粉碎时长3 s,硝酸-乙醇混合液处理3遍,粒度40~60目,使用G3玻璃砂芯漏斗.%The contents of cellulose of corn stalk, wheat straw, rice straw and the pretreated sample of straws have been researched by nitric acid-ethanol methodology according to the characteristics of straws biofuel ethanol. Four parameters as the duration of comminuting sample, the times of treating sample by nitric acid-ethanol liquid mixture, the particle size of sample and the aperture of tundish for sucking filtration have been optimized. The optimized pev-rameters: for straw sample, comminut 15 s, treat by nitric acid-ethanol liquid mixture 4 times, sample aperture 40 - 60 mesh, use G2 glass sand core tundish. For pretreated sample, comminut 3 s, treat by nitric acid-ethanol liquid mixture 3 times, sample aperture 40 - 60 mesh, use G3 glass sand core tundish.

  3. Determination of plutonium oxidation states in dilute nitric acid by complementary tristimulus colorimetry.

    Science.gov (United States)

    Silver, G L

    1967-06-01

    The preparation of reference standards for use in complementary tristimulus colorimetry for plutonium is described. Plutonium(III) and (VI) are prepared by hydrazine reduction and silver(II) oxidation, respectively, of plutonium(IV). Plutonium(V) is prepared by reduction of plutonium(VI) with ascorbic or sulphurous acid. A method for computerizing tristimulus colorimetry is presented, and the technique is extended to three dimensions ("quadristimulus colorimetry").

  4. Interaction of Polyamines, Abscisic Acid, Nitric Oxide, and Hydrogen Peroxide under Chilling Stress in Tomato (Lycopersicon esculentum Mill.) Seedlings.

    Science.gov (United States)

    Diao, Qiannan; Song, Yongjun; Shi, Dongmei; Qi, Hongyan

    2017-01-01

    Polyamines (PAs) play a vital role in the responses of higher plants to abiotic stresses. However, only a limited number of studies have examined the interplay between PAs and signal molecules. The aim of this study was to elucidate the cross-talk among PAs, abscisic acid (ABA), nitric oxide (NO), and hydrogen peroxide (H2O2) under chilling stress conditions using tomato seedlings [(Lycopersicon esculentum Mill.) cv. Moneymaker]. The study showed that during chilling stress (4°C; 0, 12, and 24 h), the application of spermidine (Spd) and spermine (Spm) elevated NO and H2O2 levels, enhanced nitrite reductase (NR), nitric oxide synthase (NOS)-like, and polyamine oxidase activities, and upregulated LeNR relative expression, but did not influence LeNOS1 expression. In contrast, putrescine (Put) treatment had no obvious impact. During the recovery period (25/15°C, 10 h), the above-mentioned parameters induced by the application of PAs were restored to their control levels. Seedlings pretreated with sodium nitroprusside (SNP, an NO donor) showed elevated Put and Spd levels throughout the treatment period, consistent with increased expression in leaves of genes encoding arginine decarboxylase (LeADC. LeADC1), ornithine decarboxylase (LeODC), and Spd synthase (LeSPDS) expressions in tomato leaves throughout the treatment period. Under chilling stress, the Put content increased first, followed by a rise in the Spd content. Exogenously applied SNP did not increase the expression of genes encoding S-adenosylmethionine decarboxylase (LeSAMDC) and Spm synthase (LeSPMS), consistent with the observation that Spm levels remained constant under chilling stress and during the recovery period. In contrast, exogenous Put significantly increased the ABA content and the 9-cis-epoxycarotenoid dioxygenase (LeNCED1) transcript level. Treatment with ABA could alleviate the electrolyte leakage (EL) induced by D-Arg (an inhibitor of Put). Taken together, it is concluded that, under chilling

  5. 六硝基茋在硝酸中的溶解度测定及关联%Solubility Measurement and Correlation of Hexanitrostilbene in Nitric Acid

    Institute of Scientific and Technical Information of China (English)

    许元刚; 李冬雪

    2014-01-01

    The solubility of 2 ,2',4 ,4',6 ,6'-Hexanitrostilbene , varied with concentration of nitric acid under 25℃, was measured using the laser monitor technique.The experimental data were correlated with the ( CNIBS )/Redlich -Kister empirical equation.The results showed that the solubility of HNS in nitric acid increased with concentration of nitric acid, and the predicted data by empirical equation had good agreement with the experiment data.%采用激光监测技术,测定了25℃下六硝基茋在不同浓度硝酸中的溶解度,用( CNIBS)/Redlich-Kister经验方程对实验数据进行了关联。结果表明六硝基茋在硝酸中的溶解度随硝酸浓度的增大而增加,用( CNIBS )/Redlich-Kister方程预测的溶解度值与实验值有较好的吻合。

  6. Nitro-fatty acids in plant signaling: New key mediators of nitric oxide metabolism

    Directory of Open Access Journals (Sweden)

    Capilla Mata-Pérez

    2017-04-01

    Full Text Available Recent studies in animal systems have shown that NO can interact with fatty acids to generate nitro-fatty acids (NO2-FAs. They are the product of the reaction between reactive nitrogen species and unsaturated fatty acids, and are considered novel mediators of cell signaling based mainly on a proven anti-inflammatory response. Although these signaling mediators have been described widely in animal systems, NO2-FAs have scarcely been studied in plants. Preliminary data have revealed the endogenous presence of free and protein-adducted NO2-FAs in extra-virgin olive oil (EVOO, which appear to be contributing to the cardiovascular benefits associated with the Mediterranean diet. Importantly, new findings have displayed the endogenous occurrence of nitro-linolenic acid (NO2-Ln in the model plant Arabidopsis thaliana and the modulation of NO2-Ln levels throughout this plant's development. Furthermore, a transcriptomic analysis by RNA-seq technology established a clear signaling role for this molecule, demonstrating that NO2-Ln was involved in plant-defense response against different abiotic-stress conditions, mainly by inducing the chaperone network and supporting a conserved mechanism of action in both animal and plant defense processes. Thus, NO2-Ln levels significantly rose under several abiotic-stress conditions, highlighting the strong signaling role of these molecules in the plant-protection mechanism. Finally, the potential of NO2-Ln as a NO donor has recently been described both in vitro and in vivo. Jointly, this ability gives NO2-Ln the potential to act as a signaling molecule by the direct release of NO, due to its capacity to induce different changes mediated by NO or NO-related molecules such as nitration and S-nitrosylation, or by the electrophilic capacity of these molecules through a nitroalkylation mechanism. Here, we describe the current state of the art regarding the advances performed in the field of NO2-FAs in plants and their

  7. Lactic Acid Yield Using Different Bacterial Strains, Its Purification, and Polymerization through Ring-Opening Reactions

    Directory of Open Access Journals (Sweden)

    F. G. Orozco

    2014-01-01

    Full Text Available Laboratory-scale anaerobic fermentation was performed to obtain lactic acid from lactose, using five lactic acid bacteria: Lactococcus lactis, Lactobacillus bulgaricus, L. delbrueckii, L. plantarum, and L. delbrueckii lactis. A yield of 0.99 g lactic acid/g lactose was obtained with L. delbrueckii, from which a final concentration of 80.95 g/L aqueous solution was obtained through microfiltration, nanofiltration, and inverse osmosis membranes. The lactic acid was polymerized by means of ring-opening reactions (ROP to obtain poly-DL-lactic acid (PDLLA, with a viscosity average molecular weight (Mv of 19,264 g/mol.

  8. Liquid-liquid extraction of palladium(II) from nitric acid by bis(2-ethylhexyl) sulphoxide

    Energy Technology Data Exchange (ETDEWEB)

    Shukla, J.P. (Radiochemistry Division, Bhabha Atomic Research Centre, Trombay, Bombay 400085 (India)); Singh, R.K.; Sawant, S.R.; Varadarajan, N. (Power Reactor Fuel Reprocessing Plant, Bhabha Atomic Research Centre, Trombay, Bombay 400085 (India))

    1993-04-15

    The extraction of palladium(II) nitrate by bis(2-ethylhexyl) sulphoxide (BESO) was evaluated over a wide range of acidity, and BESO was shown to have a strong extraction ability toward this thiophilic 'soft' metal. Essentially quantitative extraction of trace and macro amounts of palladium is easily accomplished from about 8 M HNO 8 M HNO[sub 3] down to pH 2 solutions by 0.2 M BESO into toluene. Optimum conditions such as aqueous phase acidity, solvent, period of equilibration, aqueous to organic phase ratios, reagent concentration and strippant were established for the selective and reversible extraction and separation of palladium. Slope analyses applied to Pd(II) distribution experiments from nitrate solutions showed a predominant formation of the solvated organic phase complex Pd(NO[sub 3])[sub 2].2BESO. Recovery of the extractant from loaded palladium is easily accomplished by using sodium thiosulphate or a mixture of 2 M sodium carbonate+0.5 M ammonia solution. The extracted complex was characterized by elemental analysis and IR and UV-visible spectrometry, and its composition was confirmed to be Pd(NO[sub 3])[sub 2].2BESO

  9. Green Design on the Reaction of Copper and Nitric Acid%铜与硝酸反应的绿色化设计

    Institute of Scientific and Technical Information of China (English)

    张玉贞; 李先栓

    2011-01-01

    To achieve green ideas on chemical experiment teaching has to hold two critical points: One is that chemical reactions of harmful volatile materials must be carried out in completely sealed condition; The other is that products need harmlessly be treated for environment. In this paper, using U pipe, the reaction of copper and concentrated/dilute nitric acid can be guaranteed in sealed surroundings and the tail gas was harmlessly treated. The reaction of nitric oxide and concentrated nitric acid demonstrated that the gas product of the reaction of copper and concentrated nitric acid was nitrogen dioxide, which can provide strong criterion for correcting students' wrong ideas.%化学实验教学实现绿色化思想的关键有两点:一是挥发有害物质的化学反应在完全密封状态下进行;二是实验产物的无害化处理.利用U型管巧妙设计,可使铜与浓、稀硝酸反应的毒气实验在密闭环保中进行,同时达到了绿色化尾气处理利用NO与浓HNO3反应,可证明铜与浓硝酸反应为什么生成的是NO2而不是NO,从事实上为学生纠错提供了有力判据.

  10. Synthesis, Purification, and Quantification of Fatty Acid Ethyl Esters After trans-Esterification of Large Batches of Tobacco Seed Oil

    Directory of Open Access Journals (Sweden)

    Ashraf-Khorassani Mehdi

    2015-03-01

    Full Text Available L'objectif de la présente étude était de quantifier les esters éthyliques d'acides gras (FAEE produits à partir de deux grands lots d'huile de graines de tabac soumis à une transéstérification éthanolique en présence d'un catalyseur d'acide sulfurique. La purification des produits combinés de la réaction des esters éthyliques visait la suppression, autant que faire se peut, de la couleur et de l'odeur du produit final et fut accomplie via une chromatographie sur colonne conventionnelle avec silice sublimée et une élution en tandem de l'hexane, dans un premier temps et de l'alcool éthylique, dans un deuxième temps, en guise de phase mobile. La chromatographie en phase gazeuse fut utilisée afin de quantifier les esters éthyliques des acides gras spécifiques dans la matière purifiée. Le pourcentage d'esters éthyliques d'acides gras purs récupérés dans le lot n°1 s'éleva à près de 87% tandis que le pourcentage d'esters éthyliques d'acides gras purs récupérés dans le lot n°2 fut supérieur à 89% avec des rendements à la préparation supérieurs à 400 g d'esters éthyliques par essai d'estérification. Les esters éthyliques d'acides gras ne possédaient pas d'arome détectable et ne présentaient qu'une légère coloration jaune à l'issue de ce traitement chromatographique. Pour caractériser la pureté de chaque lot d'esters éthyliques d'acides gras produits, une chromatographie en phase supercritique dont la phase mobile était un fluide composé de dioxyde de carbone modifié au méthanol/acétonitrile et une phase fixe composée d'une silice greffée avec groupement fonctionnel octadécyle furent utilisées. Aucune impureté liée au glycérol ou à des acides gras libres ne fut détectée dans le produit transestérifié purifié. Notre article est le premier rapport décrivant la transestérification optimisée de l'huile de graines de tabac à une échelle relativement grande, ladite transest

  11. Concentration and purification of plutonium or thorium

    Science.gov (United States)

    Hayden, John A.; Plock, Carl E.

    1976-01-01

    In this invention a first solution obtained from such as a plutonium/thorium purification process or the like, containing plutonium (Pu) and/or thorium (Th) in such as a low nitric acid (HNO.sub.3) concentration may have the Pu and/or Th separated and concentrated by passing an electrical current from a first solution having disposed therein an anode to a second solution having disposed therein a cathode and separated from the first solution by a cation permeable membrane, the Pu or Th cation permeating the cation membrane and forming an anionic complex within the second solution, and electrical current passage affecting the complex formed to permeate an anion membrane separating the second solution from an adjoining third solution containing disposed therein an anode, thereby effecting separation and concentration of the Pu and/or Th in the third solution.

  12. Use of biotin-labeled nucleic acids for protein purification and agarose-based chemiluminescent electromobility shift assays.

    Science.gov (United States)

    Rodgers, J T; Patel, P; Hennes, J L; Bolognia, S L; Mascotti, D P

    2000-01-15

    We have employed biotin-labeled RNA to serve two functions. In one, the biotin tethers the RNA to streptavidin-agarose beads, creating an affinity resin for protein purification. In the other, the biotin functions as a label for use in a modified chemiluminescent electromobility shift assay (EMSA), a technique used to detect the formation of protein-RNA complexes. The EMSA that we describe avoids the use not only of radioactivity but also of neurotoxic acrylamide by using agarose as the gel matrix in which the free nucleic acid is separated from protein-nucleic acid complexes. After separation of free from complexed RNA in agarose, the RNA is electroblotted to positively charged nylon. The biotin-labeled RNA is readily bound by a streptavidin-alkaline phosphatase conjugate, allowing for very sensitive chemiluminescent detection ( approximately 0.1-1.0 fmol limit). Using our system, we were able to purify both known iron-responsive proteins (IRPs) from rat liver and assess their binding affinity to RNA containing the iron-responsive element (IRE) using the same batch of biotinylated RNA. We show data indicating that agarose is especially useful for cases when large complexes are formed, although smaller complexes are even better resolved.

  13. The ν_3 and ν_4 Bands of Nitric Acid (HNO_3) at 7.6 μm for Atmospheric Studies

    Science.gov (United States)

    Perrin, A.; Flaud, J. M.; Ridolfi, M.; Carlotti, M.

    2012-06-01

    Nitric acid (HNO_3) plays an important role as a reservoir molecule of the NO_x (nitrogen oxides) species in the stratosphere. The three strongest infrared bands of nitric acid are located at 11 μm (ν_5 and 2ν_9 bands), 7.6 μm (the ν_3 and ν_4 bands at 1326 and 1303 cm-1) and 5.8 μm (ν_2 band). Although two times weaker than those located at 7.6 and 5.8 μm, the 11 μm region is the only one which is used for nitric acid retrievals in the atmosphere by several satellite instruments like MIPAS (Michelson Interferometer for Passive Atmospheric Sounding on ENVISAT) or ACE-FTS (ACE Fourier transform spectrometer on SCISAT). This is because the available spectroscopic parameters for HNO_3 in the HITRAN and GEISA databases are of very good quality in this spectral region. Of the two remaining bands, the 7.6 μm one is only partly masked by water, and therefore can be used also for nitric acid retrievals in the upper stratosphere. Moreover, because of their large difference in band intensity, combining measurements at 11 μm and 7.6 μm could maximize informations on the vertical distribution of HNO_3 in the atmosphere. However at 7.6 μm the spectroscopic parameters available in the HITRAN and GEISA databases are are not so good. Indeed, these parameters originate from a list generated more than 20 years ago. The low quality of the list at 7.6 μm prevents HNO_3 retrievals and severely affects the retrievals of several species absorbing in the 7.5-7.7 μm region, like SO_2. This work is a new and more accurate investigation of the line positions and intensities for the ν_3 and ν_4 bands of nitric acid located at 1326.187 and 1303.074 cm-1). For this task, we used new infrared laboratory data combined with a new theoretical model. Examples showing substantial improvements will be given. [1] Rothman et al. J. Quant. Spectrosc. Radiat. Transf., 110, 533-572, 2009 [2] Jacquinet et al. J. Quant. Spectrosc. Radiat. Transf., 112, 2395-2445, 2011 [3] A. Perrin, O. Lado

  14. [Separation, purification and structural characterization of acidic polysaccharide from Microcystic aeruginosa].

    Science.gov (United States)

    Wang, Xida; Wu, Guorong; Chen, Jingyao; Wang, Jian'an

    2003-12-01

    Acidic polysccharide was extracted by boiling water from Microcystic aeruginosa, isolated and purified by DEAE-52 gel column. IR, UV, HPLC and 13C-NMR were used for the structural analysis. Results showed that MAAP was a new acidic polysaccharide, it's molecular weigh was 2.0028 x 10(5), and it's chain was composed of a-glycoside linkage. The component of MAAP was identified as rhamnose, xylose, arabinose, galactose and galacturonic acid.

  15. Impact of sulfuric and nitric acids on carbonate dissolution, and the associated deficit of CO2 uptake in the upper-middle reaches of the Wujiang River, China

    Science.gov (United States)

    Huang, Qi-bo; Qin, Xiao-qun; Liu, Peng-yu; Zhang, Lian-kai; Su, Chun-tian

    2017-08-01

    Carbonate weathering and the CO2 consumption in karstic area are extensive affected by anthropogenic activities, especially sulfuric and nitric acids usage in the upper-middle reaches of Wujiang River, China. The carbonic acid would be substituted by protons from sulfuric and nitric acids which can be reduce CO2 absorption. Therefore, The goal of this study was to highlight the impacts of sulfuric and nitric acids on carbonate dissolution and the associated deficit of CO2 uptaking during carbonate weathering. The hydrochemistries and carbon isotopic signatures of dissolved inorganic carbon from groundwater were measured during the rainy season (July; 41 samples) and post-rainy season (October; 26 samples). Our results show that Ca2 + and Mg2 + were the dominant cations (55.87-98.52%), and HCO3- was the dominant anion (63.63-92.87%). The combined concentrations of Ca2 + and Mg2 + commonly exceeded the equivalent concentration of HCO3-, with calculated [Ca2 + + Mg2 +]/[HCO3-] equivalent ratios of 1.09-2.12. The mean measured groundwater δ13CDIC value (- 11.38‰) was higher than that expected for carbonate dissolution mediated solely by carbonic acid (- 11.5‰), and the strong positive correlation of these values with [SO42 - + NO3-]/HCO3- showed that additional SO42 - and NO3- were required to compensate for this cation excess. Nitric and sulfuric acids are, therefore, suggested to have acted as the additional proton-promoted weathering agents of carbonate in the region, alongside carbonic acid. The mean contribution of atmospheric/pedospheric CO2 to the total aquatic HCO3- decreased by 15.67% (rainy season) and 14.17% (post-rainy season) due to the contributions made by these acids. The annual mean deficit of soil CO2 uptake by carbonate weathering across the study area was 14.92%, which suggests that previous workers may have overestimated the absorption of CO2 by carbonate weathering in other karstic areas worldwide.

  16. Purification, molecular cloning, and expression of 2-hydroxyphytanoyl- CoA lyase, a peroxisomal thiamine pyrophosphate-dependent enzyme that catalyzes the carbon-carbon bond cleavage during à-oxidation of 3- methyl-branched fatty acids

    CERN Document Server

    Foulon, V; Croes, K; Waelkens, E

    1999-01-01

    Purification, molecular cloning, and expression of 2-hydroxyphytanoyl- CoA lyase, a peroxisomal thiamine pyrophosphate-dependent enzyme that catalyzes the carbon-carbon bond cleavage during à-oxidation of 3- methyl-branched fatty acids

  17. Kinetics of Acid-Catalyzed Dehydration of Cyclic Hemiacetals in Organic Aerosol Particles in Equilibrium with Nitric Acid Vapor.

    Science.gov (United States)

    Ranney, April P; Ziemann, Paul J

    2016-04-28

    Previous studies have shown that 1,4-hydroxycarbonyls, which are often major products of the atmospheric oxidation of hydrocarbons, can undergo acid-catalyzed cyclization and dehydration in aerosol particles to form highly reactive unsaturated dihydrofurans. In this study the kinetics of dehydration of cyclic hemiacetals, the rate-limiting step in this process, was investigated in a series of environmental chamber experiments in which secondary organic aerosol (SOA) containing cyclic hemiacetals was formed from the reaction of n-pentadecane with OH radicals in dry air in the presence of HNO3. A particle beam mass spectrometer was used to monitor the formation and dehydration of cyclic hemiacetals in real time, and SOA and HNO3 were quantified in filter samples by gravimetric analysis and ion chromatography. Measured dehydration rate constants increased linearly with increasing concentration of HNO3 in the gas phase and in SOA, corresponding to catalytic rate constants of 0.27 h(-1) ppmv(-1) and 7.0 h(-1) M(-1), respectively. The measured Henry's law constant for partitioning of HNO3 into SOA was 3.7 × 10(4) M atm(-1), ∼25% of the value for dissolution into water, and the acid dissociation constant was estimated to be water. The results indicate that HNO3 was only weakly dissociated in the SOA and that dehydration of cyclic hemiacetals was catalyzed by molecular HNO3 rather than by H(+). The Henry's law constant and kinetics relationships measured here can be used to improve mechanisms and models of SOA formation from the oxidation of hydrocarbons in dry air in the presence of NOx, which are conditions commonly used in laboratory studies. The fate of cyclic hemiacetals in the atmosphere, where the effects of higher relative humidity, organic/aqueous phase separation, and acid catalysis by molecular H2SO4 and/or H(+) are likely to be important, is discussed.

  18. Identification of Patchouli-Oil Physical Properties on Oil Purification by Using Acid-Activated Bentonite

    Directory of Open Access Journals (Sweden)

    Netty Sri Indeswari

    2013-01-01

    Full Text Available This research is aimed at obtaining patchouli-oil physical properties on purification that include clearness, specific gravity, refractive index and optical rotation. The method of research used is Complete Randomized Design (CRD with factorial design. Two factors that have been examined are 1 bentonite activations with 3 levels: inactivated bentonite, H2SO4-activated bentonite, and HCl-activated bentonite; and 2 the number of bentonite applications with 5 levels: 1%, 2%, 3%, 4% and 5%.   An analysis of oil color is made by using UV spectrophotometer to see clearness or its transmittance percentage. The results of experiment indicate that percentage of transmittance increases from 69% to 70.80 – 81.55%; specific gravity and optical rotation are in accordance with Indonesian National Standard (SNI 06-2385-2006; and refractive index is 0.0044 – 0.0086 points above the standard. The H2SO4-activated bentonite with 2% application is the best outcome. This is shown with the highest clearness and transmittance percentage of 81.55%, specific gravity of 0.9284, refractive index of 1.5186 and optical rotation of (- 49oC.

  19. A-train CALIOP and MLS observations of early winter antarctic polar stratospheric clouds and nitric acid in 2008

    Directory of Open Access Journals (Sweden)

    A. Lambert

    2011-10-01

    Full Text Available A-train Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP and Microwave Limb Sounder (MLS observations are used to investigate the development of polar stratospheric clouds (PSCs and the gas phase nitric acid distribution in the early 2008 Antarctic winter. Observational evidence of gravity-wave activity is provided by Atmospheric Infrared Sounder (AIRS radiances and infrared spectroscopic detection of nitric acid trihydrate (NAT in PSCs is obtained from the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS. Goddard Earth Observing System Data Assimilation System (GEOS-5 DAS analyses are used to derive Lagrangian trajectories and to determine temperature-time histories of air parcels. We use CALIOP backscatter and depolarization measurements to classify PSCs and the MLS measurements to determine the corresponding gas phase HNO3 as a function of temperature. For liquid PSCs the uptake of HNO3 follows the theoretical equilibrium curve for supercooled ternary solutions (STS, but at temperatures about 1 K lower as determined from GEOS-5. In the presence of solid phase PSCs, above the ice frost-point, the HNO3 depletion occurs over a wider range of temperatures (+2 to −7 K distributed about the NAT equilibrium curve. Rapid gas phase HNO3 depletion is first seen by MLS from from 23–25 May 2008, consisting of a decrease in the volume mixing ratio (parts per billion by volume from 14 ppbv to 7 ppbv on the 46–32 hPa (hectopascal pressure levels and accompanied by a 2–3 ppbv increase by renitrification at the 68 hPa pressure level. Temperature-time histories of air parcels demonstrate that the depleted HNO3 region is more clearly correlated with prior low temperature exposure of a few kelvin above the frost-point than with either the region bounded by the NAT existence temperature threshold or the region of minimum temperatures. From the combined data we infer the

  20. A-train CALIOP and MLS observations of early winter Antarctic polar stratospheric clouds and nitric acid in 2008

    Directory of Open Access Journals (Sweden)

    A. Lambert

    2012-03-01

    Full Text Available A-train Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP and Microwave Limb Sounder (MLS observations are used to investigate the development of polar stratospheric clouds (PSCs and the gas-phase nitric acid distribution in the early 2008 Antarctic winter. Observational evidence of gravity-wave activity is provided by Atmospheric Infrared Sounder (AIRS radiances and infrared spectroscopic detection of nitric acid trihydrate (NAT in PSCs is obtained from the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS. Goddard Earth Observing System Data Assimilation System (GEOS-5 DAS analyses are used to derive Lagrangian trajectories and to determine temperature-time histories of air parcels. We use CALIOP backscatter and depolarization measurements to classify PSCs and the MLS measurements to determine the corresponding gas-phase HNO3 as a function of temperature. For liquid PSCs the uptake of HNO3 follows the theoretical equilibrium curve for supercooled ternary solutions (STS, but at temperatures about 1 K lower as determined from GEOS-5. In the presence of solid phase PSCs, above the ice frost-point, the HNO3 depletion occurs over a wider range of temperatures (+2 to −7 K distributed about the NAT equilibrium curve. Rapid gas-phase HNO3 depletion is first seen by MLS from from 23–25 May 2008, consisting of a decrease in the volume mixing ratio from 14 ppbv (parts per billion by volume to 7 ppbv on the 46–32 hPa (hectopascal pressure levels and accompanied by a 2–3 ppbv increase by renitrification at the 68 hPa pressure level. The observed region of depleted HNO3 is substantially smaller than the region bounded by the NAT existence temperature threshold. Temperature-time histories of air parcels demonstrate that the depletion is more clearly correlated with prior exposure to temperatures a few kelvin above the frost-point. From the combined data we infer the presence

  1. Purification and characterization of acid phosphatase from a germinating black gram (Vigna mungo L. seedling

    Directory of Open Access Journals (Sweden)

    Asaduzzaman A.K.M.

    2011-01-01

    Full Text Available An acid phosphatase has been isolated and purified from an extract of a germinating black gram seedling. The method was accomplished by gel filtration of a germinating black gram seedling crude extract on sephadex G-75 followed by ion exchange chromatography on DEAE cellulose. The acid phosphatase gave a single band on SDS-polyacrylamide slab gel electrophoresis. The molecular weight of the acid phosphatase determined by SDS-polyacrylamide slab gel electrophoresis was estimated to be 25 kDa. The purified enzyme showed maximum activity at pH 5 and at temperature of 55°C. Mg2+, Zn2+ and EDTA had an inhibitory effect on the activity of the acid phosphatase. Black gram seedling acid phosphatase was activated by K+, Cu2+ and Ba2+. The Km value of the enzyme was found to be 0.49 mM for pNPP as substrate.

  2. Gibberellic acid alleviates cadmium toxicity by reducing nitric oxide accumulation and expression of IRT1 in Arabidopsis thaliana

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Xiao Fang [State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China); Jiang, Tao [Key Laboratory of Conservation Biology for Endangered Wildlife of the Ministry of Education, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China); Wang, Zhi Wei [State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China); Lei, Gui Jie [Key Laboratory of Conservation Biology for Endangered Wildlife of the Ministry of Education, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China); Shi, Yuan Zhi [The Key Laboratory of Tea Chemical Engineering, Ministry of Agriculture, Yunqi Road 1, Hangzhou 310008 (China); Li, Gui Xin, E-mail: guixinli@zju.edu.cn [College of Agronomy and Biotechnology, Zhejiang University, Hangzhou 310058 (China); Zheng, Shao Jian [State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China); Key Laboratory of Conservation Biology for Endangered Wildlife of the Ministry of Education, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China)

    2012-11-15

    Highlights: Black-Right-Pointing-Pointer Cd reduces endogenous GA levels in Arabidopsis. Black-Right-Pointing-Pointer GA exogenous applied decreases Cd accumulation in plant. Black-Right-Pointing-Pointer GA suppresses the Cd-induced accumulation of NO. Black-Right-Pointing-Pointer Decreased NO level downregulates the expression of IRT1. Black-Right-Pointing-Pointer Suppressed IRT1 expression reduces Cd transport across plasma membrane. - Abstract: Gibberellic acid (GA) is involved in not only plant growth and development but also plant responses to abiotic stresses. Here it was found that treating the plants with GA concentrations from 0.1 to 5 {mu}M for 24 h had no obvious effect on root elongation in the absence of cadmium (Cd), whereas in the presence of Cd{sup 2+}, GA at 5 {mu}M improved root growth, reduced Cd content and lipid peroxidation in the roots, indicating that GA can partially alleviate Cd toxicity. Cd{sup 2+} increased nitric oxide (NO) accumulation in the roots, but GA remarkably reduced it, and suppressed the up-regulation of the expression of IRT1. In contrary, the beneficial effect of GA on alleviating Cd toxicity was not observed in an IRT1 knock-out mutant irt1, suggesting the involvement of IRT1 in Cd{sup 2+} absorption. Furthermore, the GA-induced reduction of NO and Cd content can also be partially reversed by the application of a NO donor (S-nitrosoglutathione [GSNO]). Taken all these together, the results showed that GA-alleviated Cd toxicity is mediated through the reduction of the Cd-dependent NO accumulation and expression of Cd{sup 2+} uptake related gene-IRT1 in Arabidopsis.

  3. Polymeric beads containing Cyanex 923 for actinide uptake from nitric acid medium: Studies with uranium and plutonium.

    Science.gov (United States)

    Gujar, R B; Lakshmi, D Shanthana; Figoli, A; Mohapatra, P K

    2013-08-30

    Conventional phase inversion technique has been successfully applied for the preparation of the solid phase extractant (SPE), Cyanex 923 loaded polymer beads. Two types of polymer beads prepared by blending Polyetherether ketone with card (PEEKWC)/DMF with 5% Cyanex 923 (SPE-I, av bead size: 900μm) and 10% Cyanex 923(SPE-II, av. bead size: 1100μm) were evaluated for the uptake of actinide ions. The polymer beads were characterized by various physical methods such as thermal analysis, surface morphology analysis by SEM, EDAX techniques, etc. The polymer beads were used for the experiments involving the uptake of both U(VI) and Pu(IV) at tracer scale and U(VI) at milli molar concentrations from nitric acid feeds. The actinide ion uptake studies involved kinetics of metal ion sorption, adsorption isotherms, and column studies. The metal sorption capacities for U(VI) at 3M HNO3 were found to be 38.8±1.9mg and 54.5±1.7mg per g of SPE-I and SPE-II, respectively. The sorption isotherm analysis with Langmuir, D-R and Freundlisch isotherms indicated chemisorption monolayer mechanism. Column studies were also carried out using 4.5mL bed volume columns containing about 0.4 and 0.45g of SPE-I and SPE-II, respectively. The breakthrough profiles were obtained for U(VI) and the elution profiles were obtained using 1M Na2CO3 as the eluent.

  4. Spatial and temporal distribution of ambient nitric acid and ammonia in the Athabasca Oil Sands Region, Alberta

    Directory of Open Access Journals (Sweden)

    Diane ALEXANDER

    2010-08-01

    Full Text Available Monthly average ambient concentrations of gaseous nitric acid (HNO3 and ammonia (NH3 were monitored at the Athabasca Oils Sands Region (AOSR, Alberta, Canada, between May 2005 and September 2008. Generally, concentrations of both pollutants were elevated and highly variable in space and time. The highest atmospheric concentrations occurred in the vicinity of the major mining and oil extraction activities of Fort Murray and Fort McKay. Maximum monthly average concentrations of HNO3 decreased from >6 μg m–3 2005 and 2006 to <4 μg m–3 in 2007 and 2008. While the HNO3 summer seasonal averages in 2005 and 2006 approached ~2 μg m–3 at some sites, in the subsequent summers and during winter seasons it rarely exceeded 1 μg m–3 and no clear differences between summer and winter occurred. Concentrations of NH3 were elevated during the entire study and frequently reached 6 μg m–3. Generally, NH3 stayed higher in summer than in winter; the summer seasonal averages often exceeded 4 μg m–3 while those for winter only on two occasions were above 3 μg m–3. In summer 2008, an expansion of the area with elevated NH3 levels was observed extending to remote locations. Ammonia is of a much higher concern from a perspective of possible biological effects, because of its potential for direct toxic effect on lichens and its contribution to the elevated N dry deposition with possible negative consequences for forests and other ecosystems.

  5. The partitioning of Nitric Acid between the gas phase and condensed phase of aqueous sulfate aerosols.

    Science.gov (United States)

    Mentel, T. F.; Folkers, M.; Sebald, H.; Wahner, A.

    2001-12-01

    The heterogeneous hydrolysis of N2O_5 on aqueous aerosol surfaces is an important source of atmospheric HNO3. We generated HNO3 by heterogeneous hydrolysis of N2O_5 on aqueous ammonium and sodium sulfate aerosols and studied its partitioning between the gas phase and the aerosol phase. The experiments were performed in the large aerosol chamber at the FZ-Jülich at several relative humidities. Gas phase processes and the composition of the aerosols were monitored on-line simultaneously by FTIR spectroscopy and by Steam Jet Aerosol Collection/Ion Chromatography. The aerosol size distributions in the range of 20 nm to 5 μ m were measured by differential electromobility classification and by aerodynamic particle sizing. In the presence of aqueous bisulfate and sulfate aerosols a fast heterogeneous formation HNO3 is observed. (The reaction probability of N2O_5 is about 0.02.) In the case of the acidic bisulfate aerosols the major fraction of heterogeneously formed HNO3 resides in the gas phase. For neutral sulfate aerosols a significant fraction of HNO3 is taken up by the condensed phase of the aerosols. This leads to a distinctive growth of the aerosol population during the heterogeneous hydrolysis of N2O_5, which is observable in the number size distribution as well as in IR extinction measurements. The observed partitioning of HNO3 between gas phase and aqueous aerosol phase can be quantitatively understood by a Pitzer based thermodynamic model for salt solutions of high ionic strength. The model calculations and low resolution FTIR spectroscopy demonstrate that protonation of sulfate to bisulfate is the driving force for the uptake of HNO3 in neutral sulfate aerosols.

  6. Leaching and selective copper recovery from acidic leachates of Três Marias zinc plant (MG, Brazil) metallurgical purification residues.

    Science.gov (United States)

    Sethurajan, Manivannan; Huguenot, David; Lens, Piet N L; Horn, Heinrich A; Figueiredo, Luiz H A; van Hullebusch, Eric D

    2016-07-15

    Zinc plant purification residue (ZPR), a typical Zn-hydrometallurgical waste, was collected from the Três Marias Zn plant (MG, Brazil). ZPR was characterized for its metal content and fractionation, mineralogy, toxicity and leachability. Toxicity characteristics leaching procedure (TCLP) and European Community Bureau of Reference (BCR) sequential extraction results revealed that this ZPR displays high percentages of metals (Cd, Cu, Zn and Pb) in the highly mobilizable fractions, increasing its hazardous potential. Bulk chemical analysis, pH dependent leaching and acid (H2SO4) leaching studies confirm that the ZPR is polymetallic, rich in Cd, Cu and Zn. The sulfuric acid concentration (1 M), agitation speed (450 rpm), temperature (40 °C) and pulp density (20 g L(-1)) were optimized to leach the maximum amount of heavy metals (Cd, Cu and Zn). Under optimum conditions, more than 50%, 70% and 60% of the total Cd, Cu and Zn present in the ZPR can be leached, respectively. The metals in the acid leachates were investigated for metal sulfide precipitation with an emphasis on selective Cu recovery. Metal sulfide precipitation process parameters such as initial pH and Cu to sulfide ratio were optimized as pH 1.5 and 1:0.5 (Cu:sulfide) mass ratio, respectively. Under optimum conditions, more than 95% of Cu can be selectively recovered from the polymetallic ZPR leachates. The Cu precipitates characterization studies reveal that they are approximately 0.1 μm in diameter and mainly consist of Cu and S. XRD analysis showed covellite (CuS), chalcanthite (CuSO4·5H2O) and natrochalcite (NaCu2(SO4)2(OH)·H2O) as the mineral phases. ZPRs can thus be considered as an alternative resource for copper production.

  7. [Nitric oxide].

    Science.gov (United States)

    Rovira, I

    1995-01-01

    Nitric oxide was identified as the relaxing factor derived from the endothelium in 1987. Nitric oxide synthesis allows the vascular system to maintain a state of vasodilation, thereby regulating arterial pressure. Nitric oxide is also found in platelets, where it inhibits adhesion and aggregation; in the immune system, where it is responsible for the cytotoxic action of macrophages; and in the nervous system, where it acts as neurotransmitter. A deficit in endogenous synthesis of nitric oxide contributes to such conditions as essential arterial hypertension, pulmonary hypertension and heart disease. An excess of nitrous oxide induced by endotoxins and cytokinins, meanwhile, is believed to be responsible for hypotension in septic shock and for hyperdynamic circulatory state in cirrhosis of the liver. Nitric oxide has also been implicated in the rejection of transplanted organs and in cell damage after reperfusion. Inhaled nitrous oxide gas reduces pulmonary hypertension without triggering systemic hypotension in both experimental and clinical conditions. It also produces selective vasodilation when used to ventilate specific pulmonary areas, thereby improving the ventilation/perfusion ratio and, hence, oxygenation. Nitric oxide inhalation is effective in pulmonary hypertension-coincident with chronic obstructive lung disease, in persistent neonatal pulmonary hypertension and in pulmonary hypertension with congenital or acquired heart disease. Likewise, it reduces intrapulmonary shunt in acute respiratory failure and improves gas exchange. Under experimental conditions nitric oxide acts as a bronchodilator, although it seems to be less effective for this purpose in clinical use.(ABSTRACT TRUNCATED AT 250 WORDS)

  8. Extraction, partial purification and characterization of acidic peroxidase from cabbage leaves (Brasicca olearacea var. capitata

    Directory of Open Access Journals (Sweden)

    Aniruddha Bhalchandra Pandit

    2012-08-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 The present work deals with extraction of cabbage peroxidase (CP from fresh cabbage leaves and subsequent purification using ammonium sulphate (80% w/v precipitation. The peroxidase extraction has been carried out by screening two different cabbage and then different parameters like different buffer systems, strength of buffers, buffer volumes, grinding time and cabbage leaves weight ratio to buffer volumes were optimized. The purified peroxidase showed maximum activity at pH 5.5 and at temperature 55 °C. The enzyme action followed the Michelis–Menton kinetics and gave a Km of 0.7018 mg/ml for Guaiacol oxidation over different concentrations (0 – 10 mg/ml at pH 5.0 and Vmax was obtained as 0.6498 mg/min.ml. The molecular weight of the partially purified enzyme was found to be about 67,000 Daltons using SDS-PAGE and zymogram method. /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

  9. Purification and characterization of gamma poly glutamic acid from newly Bacillus licheniformis NRC20.

    Science.gov (United States)

    Tork, Sanaa E; Aly, Magda M; Alakilli, Saleha Y; Al-Seeni, Madeha N

    2015-03-01

    γ-poly glutamic acid (γ-PGA) has received considerable attention for pharmaceutical and biomedical applications. γ-PGA from the newly isolate Bacillus licheniformis NRC20 was purified and characterized using diffusion distance agar plate, mass spectrometry and thin layer chromatography. All analysis indicated that γ-PGA is a homopolymer composed of glutamic acid. Its molecular weight was determined to be 1266 kDa. It was composed of L- and D-glutamic acid residues. An amplicon of 3050 represents the γ-PGA-coding genes was obtained, sequenced and submitted in genbank database. Its amino acid sequence showed high similarity with that obtained from B. licheniformis strains. The bacterium NRC 20 was independent of L-glutamic acid but the polymer production enhanced when cultivated in medium containing L-glutamic acid as the sole nitrogen source. Finally we can conclude that γ-PGA production from B. licheniformis NRC20 has many promised applications in medicine, industry and nanotechnology.

  10. Influence of gas-particle partitioning on ammonia and nitric acid fluxes above a deciduous forest in the Midwestern USA

    Science.gov (United States)

    Hansen, K.; Sørensen, L. L.; Hornsby, K. E.; Boegh, E.; Pryor, S. C.

    2013-12-01

    Quantifying the atmosphere-biosphere exchange of reactive nitrogen gasses (including ammonia (NH3) and nitric acid (HNO3)) is crucial to assessing the impact of anthropogenic activities on natural and semi-natural ecosystems. However, measuring the deposition of reactive nitrogen is challenging due to bi-directionality of the flux, and the dynamics of the chemical gas/aerosol equilibrium of NH3 and HNO3 (or other atmospheric acids) with aerosol-phase ammonium (NH4+) and nitrate (NO3-). NH3 and HNO3 are both very reactive and typically exhibit higher deposition velocities than aerosol NH4+. Therefore, the phase partitioning between gas and aerosol phases can have a significant effect on local budgets and atmospheric transport distances (Nemitz et al., Atmos. Chem. Phys., 2004). In this study, fluxes of NH3, HNO3 and carbon dioxide (CO2) along with size-resolved N-aerosol concentrations are measured above the deciduous forest, Morgan Monroe State Forest (MMSF) in south-central Indiana (39°53'N, 86°25'W) during a field campaign. Two relaxed eddy accumulation (REA) systems are used to measure fluxes and concentrations of NH3 and HNO3 at 44 m. The NH3 REA system operates based on wet effluent diffusion denuders with detection by florescence and half-hourly flux measurements are calculated. HNO3 REA system is based on gas capture on sodium chloride (NaCl) coated denuders with subsequent analysis by ion-chromatography, and the resulting fluxes have a resolution of 3-4 hours. CO2 fluxes are measured by eddy covariance using a closed-path Licor LI-7500, while two MSP MOUDI-110 impactors are used to measure the 24-hourly average inorganic and 48 hourly averaged organic ion concentrations in 11 size bins, respectively, just above the canopy level (28 m). The results of this field campaign are used to quantify the fluxes of NH3, HNO3, CO2 to/from the forest during the transition towards senescence, and to investigate process-level controls (e.g. the role of phase

  11. Improvement of oxygen-containing functional groups on olive stones activated carbon by ozone and nitric acid for heavy metals removal from aqueous phase.

    Science.gov (United States)

    Bohli, Thouraya; Ouederni, Abdelmottaleb

    2016-08-01

    Recently, modification of surface structure of activated carbons in order to improve their adsorption performance toward especial pollutants has gained great interest. Oxygen-containing functional groups have been devoted as the main responsible for heavy metal binding on the activated carbon surface; their introduction or enhancement needs specific modification and impregnation methods. In the present work, olive stones activated carbon (COSAC) undergoes surface modifications in gaseous phase using ozone (O3) and in liquid phase using nitric acid (HNO3). The activated carbon samples were characterized using N2 adsorption-desorption isotherm, SEM, pHpzc, FTIR, and Boehm titration. The activated carbon parent (COSAC) has a high surface area of 1194 m(2)/g and shows a predominantly microporous structure. Oxidation treatments with nitric acid and ozone show a decrease in both specific surface area and micropore volumes, whereas these acidic treatments have led to a fixation of high amount of surface oxygen functional groups, thus making the carbon surface more hydrophilic. Activated carbon samples were used as an adsorbent matrix for the removal of Co(II), Ni(II), and Cu(II) heavy metal ions from aqueous solutions. Adsorption isotherms were obtained at 30 °C, and the data are well fitted to the Redlich-Peterson and Langmuir equation. Results show that oxidized COSACs, especially COSAC(HNO3), are capable to remove more Co(II), Cu(II), and Ni(II) from aqueous solution. Nitric acid-oxidized olive stones activated carbon was tested in its ability to remove metal ions from binary systems and results show an important maximum adsorbed amount as compared to single systems.

  12. Comparative analysis of production and purification of homo- and hetero-polysaccharides produced by lactic acid bacteria.

    Science.gov (United States)

    Notararigo, Sara; Nácher-Vázquez, Montserrat; Ibarburu, Idoia; Werning, Ma Laura; de Palencia, Pilar Fernández; Dueñas, Ma Teresa; Aznar, Rosa; López, Paloma; Prieto, Alicia

    2013-03-01

    Lactic acid bacteria (LAB) produce homopolysaccharides (HoPS) and heteropolysaccharides (HePS) with potential functional properties. In this work, we have performed a comparative analysis of production and purification trials of these biopolymers from bacterial culture supernatants. LAB strains belonging to four different genera, both natural as well as recombinant, were used as model systems for the production of HoPS and HePS. Two well characterized strains carrying the gft gene were used for β-glucan production, Pediococcus parvulus 2.6 (P. parvulus 2.6) isolated from cider, and the recombinant strain Lactococcus lactis NZ9000[pGTF] (L. lactis NZ9000[pGTF]). In addition, another cider isolate, Lactobacillus suebicus CUPV225 (L. suebicus CUPV225), and Leuconostoc mesenteroides RTF10 (L. mesenteroides RTF10), isolated from meat products were included in the study. Chemical analysis of the EPS revealed that L. mesenteroides produces a dextran, L. suebicus a complex heteropolysaccharide, and the β-glucan producing-strains the expected 2-substituted (1,3)-β-glucan. Copyright © 2012 Elsevier Ltd. All rights reserved.

  13. Hydrogen Peroxide and Nitric Oxide are Involved in Salicylic Acid-Induced Salvianolic Acid B Production in Salvia miltiorrhiza Cell Cultures

    Directory of Open Access Journals (Sweden)

    Hongbo Guo

    2014-05-01

    Full Text Available Hydrogen peroxide (H2O2 and nitric oxide (NO are key signaling molecules in cells whose levels are increased in response to various stimuli and are involved in plant secondary metabolite synthesis. In this paper, the roles of H2O2 and NO on salvianolic acid B (Sal B production in salicylic acid (SA-induced Salvia miltiorrhiza cell cultures were investigated. The results showed that H2O2 could be significantly elicited by SA, even though IMD (an inhibitor of NADPH oxidase or DMTU (a quencher of H2O2 were employed to inhibit or quench intracellular H2O2. These elicited H2O2 levels significantly increased NO production by 1.6- and 1.46 fold in IMD+SA and DMTU+SA treatments, respectively, and induced 4.58- and 4.85-fold Sal B accumulation, respectively. NO was also markedly elicited by SA, in which L-NNA (an inhibitor of NO synthase and cPTIO (a quencher of NO were used to inhibit or quench NO within cells, and the induced NO could significantly enhance H2O2 production by 1.92- and 1.37-fold in L-NNA+SA and cPTIO+SA treatments, respectively, and 3.27- and 1.50-fold for Sal B accumulation, respectively. These results indicate that elicitation of SA for either H2O2 or NO was independent, and the elicited H2O2 or NO could act independently or synergistically to induce Sal B accumulation in SA-elicited cells.

  14. Nitric oxide-releasing poly(lactic-co-glycolic acid-polyethylenimine nanoparticles for prolonged nitric oxide release, antibacterial efficacy, and in vivo wound healing activity

    Directory of Open Access Journals (Sweden)

    Nurhasni H

    2015-04-01

    Full Text Available Hasan Nurhasni,1 Jiafu Cao,1 Moonjeong Choi,1 Il Kim,2 Bok Luel Lee,1 Yunjin Jung,1 Jin-Wook Yoo11College of Pharmacy, Pusan National University, Busan, South Korea; 2Department of Polymer Science and Engineering, Pusan National University, Busan, South KoreaAbstract: Nitric oxide (NO-releasing nanoparticles (NPs have emerged as a wound healing enhancer and a novel antibacterial agent that can circumvent antibiotic resistance. However, the NO release from NPs over extended periods of time is still inadequate for clinical application. In this study, we developed NO-releasing poly(lactic-co-glycolic acid-polyethylenimine (PEI NPs (NO/PPNPs composed of poly(lactic-co-glycolic acid and PEI/diazeniumdiolate (PEI/NONOate for prolonged NO release, antibacterial efficacy, and wound healing activity. Successful preparation of PEI/NONOate was confirmed by proton nuclear magnetic resonance, Fourier transform infrared spectroscopy, and ultraviolet/visible spectrophotometry. NO/PPNPs were characterized by particle size, surface charge, and NO loading. The NO/PPNPs showed a prolonged NO release profile over 6 days without any burst release. The NO/PPNPs exhibited potent bactericidal efficacy against methicillin-resistant Staphylococcus aureus (MRSA and Pseudomonas aeruginosa concentration-dependently and showed the ability to bind on the surface of the bacteria. We also found that the NO released from the NO/PPNPs mediates bactericidal efficacy and is not toxic to healthy fibroblast cells. Furthermore, NO/PPNPs accelerated wound healing and epithelialization in a mouse model of a MRSA-infected wound. Therefore, our results suggest that the NO/PPNPs presented in this study could be a suitable approach for treating wounds and various skin infections.Keywords: nitric oxide-releasing nanoparticles, PLGA, PEI, antimicrobial, wound healing

  15. Partial purification and characterization of an inducible indole-3-acetyl-L-aspartic acid hydrolase from Enterobacter agglomerans

    Energy Technology Data Exchange (ETDEWEB)

    Chou, Jyh-Ching [Department of Agriculture, Beltsville, MD (United States)]|[Univ. of Maryland, College Park, MD (United States); Cohen, J.D.; Mulbry, W.W. [Department of Agriculture, Beltsville, MD (United States)] [and others

    1996-11-01

    Indole-3-acetyl-amino acid conjugate hydrolases are believed to be important in the regulation of indole-3-acetic acid (IAA) metabolism in plants and therefore have potential uses for the alteration of plant IAA metabolism. To isolate bacterial strains exhibiting significant indole-3-acetyl-aspartate (IAA-Asp) hydrolase activity, a sewage sludge inoculation was cultured under conditions in which IAA-Asp served as the sole source of carbon and nitrogen. One isolate, Enterobacter agglomerans, showed hydrolase activity inducible by IAA-L-Asp or N-acetyl-L-Asp but not by IAA, (NH{sub 4}){sub 2}SO{sub 4}, urea, or indoleacetamide. Among a total of 17 IAA conjugates tested as potential substrates, the enzyme had an exclusively high substrate specificity for IAA-L-Asp of 13.5 mM. The optimal pH for this enzyme was between 8.0 and 8.5. In extraction buffer containing 0.8 mM Mg{sup 2+} the hydrolase activity was inhibited to 80% by 1 mM dithiothreitol and to 60% by 1 mm CuSO{sub 4}; the activity was increased by 40% with 1mM MnSO{sub 4}. However, in extraction buffer with no trace elements, the hydrolase activity was inhibited to 50% by either 1 mM dithiothreitol or 1% Triton X-100 (Sigma). These results suggest that disulfide bonding might be essential for enzyme activity. Purification of the hydrolase by hydroxyapatite and TSK-phenyl (HP-Genenchem, South San Francisco, CA) preparative high-performance liquid chromatography yielded a major 45-kD polypeptide as shown by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. 45 refs., 5 figs., 3 tabs.

  16. Lipolytic enzymes in bovine thyroid tissue. I. Subcellular localization, purification and characterization of acid phospholipase A1.

    Science.gov (United States)

    De Wolf, M; Lagrou, A; Hilderson, H J; Dierick, W

    1978-12-01

    In mammalian cells the catabolism of membrane phosphoglycerides proceeds probably entirely through a deacylation pathway catalysed by phospholipase A and lysophospholipase (Wise & Elwyn, 1965). In the initial attack of diacylphosphoglycerides by phospholipase A two enzymatic activities with different positional specificities have been distinguished: phospholipase A1 (phosphatidate 1-acyl hydrolase EN 3.1.1.32) and phospholipase A2 (phosphatidate 2-acyl hydrolase EN 3.1.1.4) (Van Deenen & De Haas, 1966). Studies on these intracellular phospholipases were mainly concerned with their subcellular localization. Only occasionally more detailed enzymatic investigations have been conducted on them, in contrast to export phospholipases e.g. from snake venom, bee venom and porcine pancreas, which have been extensively investigated (Brockerhoff & Jensen 1974a). In a previous paper (De Wolf et al., 1976a), the presence of phospholipase A1 and phospholipase A2 activities in bovine thyroid was demonstrated, using 1-[9, 10-3H] stearoyl-2-[1-14C] linoleyl-sn-glycero-3-phosphocholine as a substrate. Optimal activity was observed in both instances at pH 4. Addition of the anionic detergent sodium taurocholate increased the A2 type activity and decreased the A1 type activity suggesting the presence of different enzymes. The lack of influence of Ca2+-ions and EDTA and the acid pH optima could suggest lysosomal localization. In this paper the subcellular distribution of both acid phospholipase activities is described as well as a purification scheme for phospholipase A1. Some characteristics of the purified enzyme preparation are discussed.

  17. Purification and characterization of hyaluronic acid produced by Streptococcus zooepidemicus strain 3523-7

    Directory of Open Access Journals (Sweden)

    K. Jagadeeswara Reddy

    2013-01-01

    Full Text Available Hyaluronic acid (HA is a hydrated gel and comprises repeating units of glucuronic acid and N-acetylglucosamine. Production and recovery of HA has gained great importance due to its vast clinical applications. In pursuit of obtaining highly pure HA, we have developed a fed-batch fermentation process using Streptococcus zooepidemicus in a 25 L bioreactor that resulted in a maximum yield of 2.3 g/L HA. In addition, we have devised an efficient method for separation and recovery of hyaluronic acid from a highly viscous broth by treating with trichloroacetic acid (0.1% and charcoal (1-2%, passing through filtration (0.45 μm and ultrafiltration that resulted in recovery of 72.2% of clinical grade HA with molecular weight of 2.5×106 Da. We have also characterized our purified HA using FTIR and NMR spectroscopy. These studies revealed the similarity in both the FTIR spectrum as well as NMR spectrum of both reference standard and purified HA from S. zooepidemicus indicating that the reported process is more efficient in terms of better yield and high quality (99.2%.

  18. Purification and H-1 NMR spectroscopic characterization of phase II metabolites of tolfenamic acid

    DEFF Research Database (Denmark)

    Sidelmann, U. G.; Christiansen, E.; Krogh, L.;

    1997-01-01

    acid; the study shows the applicability of H-1 NMR for the identification of drug metabolites in biological fluids. In addition to NMR analysis, two metabolites were also identified by mass spectrometry (MS), The glucuronides of the following parent compounds, N-(2-methyl-3-chlorophenyl...

  19. Purification and characterization of a novel acid phosphatase from the split gill mushroom Schizophyllum commune.

    Science.gov (United States)

    Zhang, Guo-Qing; Chen, Qing-Jun; Sun, Jian; Wang, He-Xiang; Han, Chun-Hua

    2013-10-01

    A monomeric acid phosphatase (ACP) with a molecular mass of 72.5 kDa was purified from fresh fruiting bodies of cultured Schizophyllum commune mushroom. The isolation procedure entailed ion exchange chromatography on DEAE-cellulose, CM-cellulose, and Q-sepharose, and gel filtration by fast protein liquid chromatography on Superdex 75. It demonstrated a unique N-terminal amino acid sequence of NAPWAQIDEV, which exhibited 60% amino acid identity to that of S. commune hypothetical histidine ACP based on its genome sequence, but less than 30% amino acid identity to that of other fungal ACPs previously reported. The ACP exhibited an optimum temperature at 50 °C, an optimum pH at pH 4.6, and was considerably stable at a pH range of 4.0 to 9.0, and a temperature range of 20-40 °C. The Km of the purified enzyme for ρ-nitrophenyl phosphate (ρNPP) was 0.248 mM and the Vmax was 9.093 × 10(-3)  μM/min. ACP activity was strongly inhibited by Al(3+) and Fe(3+) , but enhanced by Co(2+) , Mg(2+) , and Ca(2+) at a concentration of 0.5 mM. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Purification, characterization, and bioinformatics studies of phosphatidic acid phosphohydrolase from Lagenaria siceraria

    Science.gov (United States)

    Phosphatidic acid phosphohydrolase (PAP), EC 3.1.3.4, is the penultimate step in the Kennedy pathway of triacyl glycerol (TAG) synthesis leading to the formation of diacyl glycerol (DAG), which is a key intermediate in TAG synthesis. We partially purified a soluble PAP from mid maturing seeds of bot...

  1. Determination of malic Acid using a malate dehydrogenase reactor after purification and immobilization in non-denaturing conditions and staining with ponceau S.

    Science.gov (United States)

    Shimazaki, Youji; Sakikawa, Takahiro

    2010-08-01

    Mouse liver cytosolic malate dehydrogenase was separated by non-denaturing two-dimensional electrophoresis and identified. Furthermore, the activity of the enzyme was preserved even after separation, electroblotting onto a membrane and staining with Ponceau S in acidic buffer solution (pH 5.1). Using the membrane-immobilized enzyme, the malic acid content was estimated by measuring absorbance changes due to the conversion of nicotinamide adenine dinucleotide (NAD) to NADH. These results indicate that enzyme reactors can be systematically produced after purification, immobilization and staining with Ponceau S.

  2. Improvements in the profiles and distributions of nitric acid and nitrogen dioxide with the LIMS version 6 dataset

    Directory of Open Access Journals (Sweden)

    E. Remsberg

    2010-05-01

    Full Text Available The quality of the Nimbus 7 Limb Infrared Monitor of the Stratosphere (LIMS nitric acid (HNO3 and nitrogen dioxide (NO2 profiles and distributions of 1978/1979 are described after their processing with an updated, Version 6 (V6 algorithm and subsequent archival in 2002. Estimates of the precision and accuracy of both of those species are developed and provided herein. The character of the V6 HNO3 profiles is relatively unchanged from that of the earlier LIMS Version 5 (V5 profiles, except in the upper stratosphere where the interfering effects of CO2 are accounted for better with V6. The accuracy of the retrieved V6 NO2 is also significantly better in the middle and upper stratosphere, due to improvements in its spectral line parameters and in the reduced biases for the accompanying V6 temperature and water vapor profiles. As a result of these important updates, there is better agreement with theoretical calculations for profiles of the HNO3/NO2 ratio, day-to-night NO2 ratio, and with estimates of the production of NO2 in the mesosphere and its descent to the upper stratosphere during polar night. In particular, the findings for middle and upper stratospheric NO2 should also be more compatible with those obtained from more recent satellite sensors because the effects of the spin-splitting of the NO2 lines are accounted for now with the LIMS V6 algorithm. The improved precisions and more frequent retrievals of the LIMS profiles along their orbit tracks provide for better continuity and detail in map analyses of these two species on pressure surfaces. It is judged that the chemical effects of the oxides of nitrogen on ozone can be studied quantitatively throughout the stratosphere with the LIMS V6 data.

  3. Bacteriocins from lactic acid bacteria: purification, properties and use as biopreservatives

    OpenAIRE

    José Luis Parada; Carolina Ricoy Caron; Medeiros,Adriane Bianchi P.; Carlos Ricardo Soccol

    2007-01-01

    Biopreservation systems in foods are of increasing interest for industry and consumers. Bacteriocinogenic lactic acid bacteria and/or their isolated bacteriocins are considered safe additives (GRAS), useful to control the frequent development of pathogens and spoiling microorganisms in foods and feed. The spreading of bacterial antibiotic resistance and the demand for products with fewer chemicals create the necessity of exploring new alternatives, in order to reduce the abusive use of therap...

  4. Purification of wet process phosphoric acid by decreasing iron and uranium using white silica sand

    Energy Technology Data Exchange (ETDEWEB)

    El-Bayaa, A.A., E-mail: amina.elbayaa@yahoo.com [Chemistry Department, Faculty of Science, Al-Azhar University (Girls), Nasr City, Cairo (Egypt); Badawy, N.A.; Gamal, A.M.; Zidan, I.H.; Mowafy, A.R. [Chemistry Department, Faculty of Science, Al-Azhar University (Girls), Nasr City, Cairo (Egypt)

    2011-06-15

    Natural white silica sand as an adsorbent has been developed to reduce the concentration of iron and uranium ions as inorganic impurities in crude Egyptian phosphoric acid. Several parameters such as adsorbate concentration, adsorbent dose, volume to weight ratio and temperature, were investigated. Equilibrium isotherm studies were used to evaluate the maximum sorption capacity of adsorbent. Thermodynamic parameters showed the exothermic nature of the process and the negative entropy reflects the affinity of the adsorbent material towards each metal ion.

  5. Violent explosion after inadvertent mixing of nitric acid and isopropanol – Review 15 years later finds basic accident data corrupted, no evidence of broad learning

    DEFF Research Database (Denmark)

    Hedlund, Frank Huess; Folmer Nielsen, Merete; Hagen Mikkelsen, Sonja

    2014-01-01

    steel tank disintegrated with such force that fragments lodged in walls of concrete. The explosion ravaged the cellar, destroyed equipment, blew out a masonry wall and released large amounts of nitrous oxide fumes. Likely, 62% nitric acid (CAS 7697-37-2) and isopropanol (2-propanol, CAS 67-63-0) reacted...... the brewery to court for negligence, they did not report or investigate the accident, or attempt to disseminate information available to them. Today, the general literature is silent on the explosion hazards of mixing the two chemicals. The paper argues that without institutional support, learning...

  6. Partial Purification and Properties of an Acid Phosphatase from Pearl Oyster Pinctada Fucata

    Institute of Scientific and Technical Information of China (English)

    柴云峰; 谢莉萍; 张荣庆

    2003-01-01

    Acid phosphatases (ACPs) are marker enzymes for the detection of lysosomes in cell fractions.However, ACPs in sea creatures are less studied than those on land.An acid phosphatase was partially purified from pearl oyster Pinctada fucata by chromatography on Sephadex G-150 and Con A-Sepharose 4B.The specific activity was 1719 U*mg-1 and with optimum pH (5.0) and temperature (60℃).The enzyme was strongly inhibited competitively by product analog WO3-4 and MoO3-4, but less inhibited by product analog AsO3-4.The enzyme could also be strongly inhibited by heavy metal ions, such as Ag+ and Cu2+, but was not affected by Pb2+.High concentrations of ethanol (64%) and NaF (10-3 mol·L-1) could inhibit the enzyme while low concentration of NaF (<10-4 mol·L-1) could slightly activate the enzyme.Other haloids (Cl-, Br-, I-) and EDTA did not have any effect on this enzyme, while tartrate and some chemical modification reagents (bromoacetic acid, formaldehyde and dithiothreitol) could inhibit the enzyme.It is concluded that the properties of the enzyme are different from many fresh water mollusks.

  7. Free fatty acids degradation in grease trap purification using ozone bubbling and sonication

    Science.gov (United States)

    Piotr Kwiatkowski, Michal; Satoh, Saburoh; Fukuda, Shogo; Yamabe, Chobei; Ihara, Satoshi; Nieda, Masanori

    2013-02-01

    The oil and fat were treated at first by only ozone bubbling and it was confirmed that the collection efficiency of them became 98.4% when the aeration was used. It showed that the aeration method in a grease trap cleared the standard value of 90% and there was no worry on the oil and fat outflow from a grease trap. The characteristics of sonication process were studied for free fatty acids degradation. The free saturated fatty acids are the most hard-degradable compounds of the fats, oils and greases (FOGs) in the grease trap. The influence of various parameters such as immersion level of an ultrasound probe in the liquid and bubbling of various gases (Ar, O2, air, O3) on the sonochemical and energy efficiency of the sonication process was investigated. The most effective degradation treatment method for saturated free fatty acids was the combination of sonication and low flow rate argon bubbling. Contribution to the Topical Issue "13th International Symposium on High Pressure Low Temperature Plasma Chemistry (Hakone XIII)", Edited by Nicolas Gherardi, Henryca Danuta Stryczewska and Yvan Ségui.

  8. Aliphatic amidase of Rhodococcus rhodochrous PA-34: Purification, characterization and application in synthesis of acrylic acid.

    Science.gov (United States)

    Thakur, Neerja; Kumar, Vijay; Sharma, Nirmal Kant; Thakur, Shikha; Bhalla, Tek Chand

    2016-01-01

    An intracellular aliphatic amide degrading inducible amidase produced by Rhodococcus rhodochrous PA-34 was characterized and acrylic acid synthesis from acrylamide was carried out using whole cell amidase. A bioprocess was developed at 50 ml fed batch reaction using 400 mM acrylamide feeding at an interval of 30 min resulted in the production of 4 g acrylic acid with volumetric and catalytic productivity of 80 g/l and 19 g/g/h respectively. The amidase of this organism had molecular weight of 40 kDa and was purified to 8.5 fold with 8% yield. This enzyme was active within the temperature range of 30 to 60 °C, with optimum temperature 45 °C and pH 7.5. The Vmax, Km, and kcat of purified amidase were calculated as 250 U/mg protein, 4.5 mM, and 166 sec-1 for acrylamide. The enzyme showed tolerance to metal chelating agent (EDTA) and was strongly inhibited by heavy metal ions Hg2+, Ag2+, Cu2+ and Co2+. R. rhodochrous PA-34 amidase preferentially hydrolyzed small aliphatic toxic amide such as acrylamide. Thus, the amidase of R. rhodochrous PA-34 is promising biocatalyst for the synthesis of industrially important acids and biodegradation of toxic amides.

  9. Improving the technology for sulfuric acid purification of BTK fraction at the Makeyevsk Coke Chemical Plant. Sovershenstvovaniye tekhnologii sernokislotnoy ochistki fraktsii BTK na Makeyevskom koksokhimzavode

    Energy Technology Data Exchange (ETDEWEB)

    Korobchanskiy, V.I.; Dobrovolskaya, L.Ye.; Dzekunov, S.N.; Grebennikova, S.S.; Korobchanskiy, Yu.V.

    1983-01-01

    Data are cited about a study of the operation of an installation for sulfuric acid purification of a BTK fraction at the Makeyevsk Coke Chemical Plant (KKhZ). The purification is performed in a radiator mixer with the addition of unsaturated compounds, a piperylene fraction. The capability is shown of producing benzene for nitration of a high quality in existing equipment with an unchanged expenditure of raw material and secondary materials. The following ways for improvement are recommended: reduce the final boiling point of the fraction to 125 to 130 degrees; feed the piperylene fraction in two stages: behind the mixer pump and in the central part of the radiator mixer; and reduce the process length to 6 to 8 minutes.

  10. Formation of nitric oxide, ethyl nitrite and an oxathiolone derivative of caffeic acid in a mixture of saliva and white wine.

    Science.gov (United States)

    Takahama, Umeo; Tanaka, Mariko; Hirota, Sachiko

    2010-03-01

    Reactions of salivary nitrite with components of wine were studied using an acidic mixture of saliva and wine. The formation of nitric oxide (NO) in the stomach after drinking wine was observed. The formation of NO was also observed in the mixture (pH 3.6) of saliva and wine, which was prepared by washing the oral cavity with wine. A part of the NO formation in the stomach and the oral cavity was due to the reduction of salivary nitrite by caffeic and ferulic acids present in wine. Ethyl nitrite produced by the reaction of salivary nitrite and ethyl alcohol in wine also contributed to the formation of NO. In addition to the above reactions, caffeic acid in wine could be transformed to the oxathiolone derivative, which might have pharmacological functions. The results obtained in this study may help in understanding the effects of drinking wine on human health.

  11. Fabrication process for sintered mixed oxides soluble in nitric acid from nitrate solutions. [nuclear fuels]. Procede d'obtention d'oxydes mixtes frittes solubles dans l'acide nitrique a partir de solutions de nitrates

    Energy Technology Data Exchange (ETDEWEB)

    Bachelard, R.; Germanaz, P.

    1987-10-02

    Mixed oxide nuclear fuels are obtained by mixing the nitrate solutions, concentration, heat treatment for an intermediary mixed oxide containing U(VI) and Pu(IV or VI), calcination to obtain U/sub 3/O/sub 8/, reduction in U(IV) and Pu(IV), pelletizing, sintering and machining. Less wastes are produced and the fuel pellets are soluble in nitric acid.

  12. 加快产业结构调整与建设大型硝酸装置的思考%Accelerate Industrial Restructure and Build Large Nitric Acid Plants

    Institute of Scientific and Technical Information of China (English)

    唐文骞; 杨同莲

    2012-01-01

    引入原料与资源量、能源量的概念,分析了各种硝酸生产方法中的吨酸比氨耗值和比能源值.通过产业结构调整的分析可知,双加压法硝酸具有无可争议的优势,该法应成为我国硝酸工业发展的主流工艺.同时指出建设大型或特大型双加压法硝酸装置在我国已具备设计、制造、运行的条件和经验,并将取得十分可观的经济效益.%By introducing the concept of feedstock, amount of resource and energy, the specific ammonia consumption per ton of nitric acid and the specific energy consumption per ton of nitric acid through different nitric acid production processes were analyzed. The result of specific energy consumption comparisons shows that the dual pressure process has the indisputable advantage against other processes. It should become the mainstream process in the development of nitric acid industry in China. The paper also pointed out that China has already the ability and experience in engineering design, manufacture and operation of large and super-large nitric acid plants adopting the dual pressure process and has obtained considerable economic benefits.

  13. Purification, enzymatic properties, and active site environment of a novel manganese(III)-containing acid phosphatase.

    Science.gov (United States)

    Sugiura, Y; Kawabe, H; Tanaka, H; Fujimoto, S; Ohara, A

    1981-10-25

    A new manganese-containing acid phosphatase has been isolated and crystallized from sweet potato tubers. The pure enzyme contains one atom of manganese per Mr = 110,000 polypeptide and shows phosphatase activity toward various phosphate substrates. The pH optimum of the enzyme was 5.8 and the enzyme activity was inhibited by Cu2+, Zn2+, Hg2+, AsO43-, and MoO42-. This stable metalloenzyme is red-violet in color with an intense absorption band at 515 nm (epsilon - 2460). Our electronic, circular dichroism, and electron spin resonance findings strongly indicate that the Mn-valence state of the native enzyme is trivalent. When the Mn-enzyme is excited by the 5145 A line of Ar+ laser, prominent Raman lines at 1230, 1298, 1508, and 1620 cm-1 were detected. This Raman spectrum can probably be interpreted in terms of internal vibration of a coordinated tyrosine phenolate anion. The tryptophan-modified enzyme showed a positive Raman band at 370 cm-1, which is preferentially assigned to a Mn(III)-S streching mode. The modification of the Mn-enzyme by N-bromosuccinimide led to a large decrease in the fluorescence intensity of 335 nm which was dominated by its tryptophan residues within a considerable hydrophobic environment. The acid phosphatase activity was significantly decreased by the tryptophan modification. With respect to the active site donor sets, the Mn(III)-containing acid phosphatase is distinctly different from the Zn(II)-containing alkaline phosphatase. Of interest is also the appreciable similarity of some enzymatic and spectroscopic properties between the present enzyme and uteroferrin.

  14. Heterodimeric l-amino acid oxidase enzymes from Egyptian Cerastes cerastes venom: Purification, biochemical characterization and partial amino acid sequencing

    Directory of Open Access Journals (Sweden)

    A.E. El Hakim

    2015-12-01

    Full Text Available Two l-amino acid oxidase enzyme isoforms, Cc-LAAOI and Cc-LAAOII were purified to apparent homogeneity from Cerastes cerastes venom in a sequential two-step chromatographic protocol including; gel filtration and anion exchange chromatography. The native molecular weights of the isoforms were 115 kDa as determined by gel filtration on calibrated Sephacryl S-200 column, while the monomeric molecular weights of the enzymes were, 60, 56 kDa and 60, 53 kDa for LAAOI and LAAOII, respectively. The tryptic peptides of the two isoforms share high sequence homology with other snake venom l-amino acid oxidases. The optimal pH and temperature values of Cc-LAAOI and Cc-LAAOII were 7.8, 50 °C and 7, 60 °C, respectively. The two isoenzymes were thermally stable up to 70 °C. The Km and Vmax values were 0.67 mM, 0.135 μmol/min for LAAOI and 0.82 mM, 0.087 μmol/min for LAAOII. Both isoenzymes displayed high catalytic preference to long-chain, hydrophobic and aromatic amino acids. The Mn2+ ion markedly increased the LAAO activity for both purified isoforms, while Na+, K+, Ca2+, Mg2+ and Ba2+ ions showed a non-significant increase in the enzymatic activity of both isoforms. Furthermore, Zn2+, Ni2+, Co2+, Cu2+ and AL3+ ions markedly inhibited the LAAOI and LAAOII activities. l-Cysteine and reduced glutathione completely inhibited the LAAO activity of both isoenzymes, whereas, β-mercaptoethanol, O-phenanthroline and PMSF completely inhibited the enzymatic activity of LAAOII. Furthermore, iodoacitic acid inhibited the enzymatic activity of LAAOII by 46% and had no effect on the LAAOI activity.

  15. Purification and characterization of the oxygen-sensitive acetohydroxy acid synthase from the archaebacterium Methanococcus aeolicus.

    OpenAIRE

    Xing, R.; Whitman, W B

    1994-01-01

    Acetohydroxy acid synthase (EC 4.1.3.18) of the archaebacterium Methanococcus aeolicus was purified 1,150-fold to homogeneity. The molecular weight of the purified enzyme was 125,000, and it contained only one type of subunit (M(r) = 58,000). The amino-terminal sequence had 46 to 57% similarity to those of the large subunits of the eubacterial anabolic enzymes and 37 to 43% similarity to those of the yeast and plant enzymes. The methanococcal enzyme had a pH optimum of 7.6. The pI, estimated ...

  16. Bidentate organophosphorus extractants: purification, properties and applications to removal of actinides from acidic waste solutions

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.; McIsaac, L.D.

    1977-05-01

    At both Hanford and Idaho, DHDECMP (dihexyl-N, N-diethylcarbamylmethylene phosphonate) continuous counter-current solvent extraction processes are being developed for removal of americium, plutonium, and, in some cases, other actinides from acidic wastes generated at these locations. Bench and, eventually, pilot and plant-scale testing and application of these processes have been substantially enhanced by the discovery of suitable chemical and physical methods of removing deleterious impurities from technical-grade DHDECMP. Flowsheet details, as well as various properties of purified DHDECMP extractants, are enumerated.

  17. Purification, Gene Cloning and Expression of an Acidic Phospholipase A2 from Agkistrodon shedaoensis Zhao

    Institute of Scientific and Technical Information of China (English)

    Qian JIN; Li-Xia YANG; Hao-Mang JIAO; Bin LU; Yu-Qun WU; Yuan-Cong ZHOU

    2004-01-01

    A protein with the activity of phospholipase A2 named asAPLA2 was purified to homogeneity from the venom of Agkistrodon shedaoensis Zhao through DEAE-Sepharose CL-6B anion exchange column,Source S and Mono Q FPLC. Its molecular weight was estimated as 19 kD by SDS-PAGE and its pI was about 3.5 by IEF analysis. It inhibits the platelet aggregation that was induced by 1 μmol/L ADP, and the IC50 was determined to be 6 μmol/L. Degenerate primer was designed and synthesized according to the Nterminal amino acid sequence of asAPLA2. Its full-length cDNA was cloned by RT-PCR from the total RNA extracted from the snake venom gland. According to the deduced amino acid sequence, its molecular weight and pI are determined to be 13,649 and 4.39 respectively as calculated by DNAclub and DNAstar softwares.The gene was then cloned into the expression plasmid pET-40b(+) and expressed in E. Coli BL21(DE3).Western blot analysis indicated that the expressed protein cross-reacted with the antibody against the nativeenzyme.

  18. Purification, Gene Cloning and Expression of an Acidic Phospholipase A2 from Agkistrodon shedaoensis Zhao

    Institute of Scientific and Technical Information of China (English)

    QianJIN; Li-XiaYANG; Hao-MangJIAO; BinLU; Yu-QunWU; Yuan-CongZHOU

    2004-01-01

    A protein with the activity of phospholipase A2 named asAPLA2 was pmified to homogeneity from the venom of Agkistrodon shedaoensis Zhao through DEAE-Sepharose CL-6B anion exchange column,Source S and Mono Q FPLC. Its molecular weight was estimated as 19kD by SDS-PAGE and its pI was about 3.5 by IEF analysis. It inhibits the platelet aggregation that was induced by 1μmol/L ADP, and the IC50 was determined to be 6μmol/L. Degenerate primer was designed and synthesized according to the Nterminal amino acid sequence of asAPLA2. Its full-length cDNA was cloned by RT-PCR from the total RNA extracted from the snake venom gland. According to the deduced amino acid sequence, its molecular weight and pI are determined to be 13,649 and 4.39 respectively as calculated by DNAclub and DNAstar softwares.The gene was then cloned into the expression plasmid pET-40b(+) and expressed in E.coli BL21(DE3).Western blot analysis indicated that the expressed protein cross-reacted with the antibc dy against the native enzyme.

  19. Overexpression, purification, crystallization and preliminary structural studies of p-coumaric acid decarboxylase from Lactobacillus plantarum

    Energy Technology Data Exchange (ETDEWEB)

    Rodríguez, Héctor; Rivas, Blanca de las; Muñoz, Rosario [Instituto de Fermentaciones Industriales, CSIC, Juan de la Cierva 3, 28006 Madrid (Spain); Mancheño, José M., E-mail: xjosemi@iqfr.csic.es [Grupo de Cristalografía Macromolecular y Biología Estructural, Instituto Rocasolano, CSIC, Serrano 119, 28006 Madrid (Spain); Instituto de Fermentaciones Industriales, CSIC, Juan de la Cierva 3, 28006 Madrid (Spain)

    2007-04-01

    The enzyme p-coumaric acid decarboxylase (PDC) from L. plantarum has been recombinantly expressed, purified and crystallized. The structure has been solved at 2.04 Å resolution by the molecular-replacement method. The substrate-inducible p-coumaric acid decarboxylase (PDC) from Lactobacillus plantarum has been overexpressed in Escherichia coli, purified and confirmed to possess decarboxylase activity. The recombinant His{sub 6}-tagged enzyme was crystallized using the hanging-drop vapour-diffusion method from a solution containing 20%(w/v) PEG 4000, 12%(w/v) 2-propanol, 0.2 M sodium acetate, 0.1 M Tris–HCl pH 8.0 with 0.1 M barium chloride as an additive. Diffraction data were collected in-house to 2.04 Å resolution. Crystals belonged to the tetragonal space group P4{sub 3}, with unit-cell parameters a = b = 43.15, c = 231.86 Å. The estimated Matthews coefficient was 2.36 Å{sup 3} Da{sup −1}, corresponding to 48% solvent content, which is consistent with the presence of two protein molecules in the asymmetric unit. The structure of PDC has been determined by the molecular-replacement method. Currently, the structure of PDC complexed with substrate analogues is in progress, with the aim of elucidating the structural basis of the catalytic mechanism.

  20. Purification and characterisation of an acidic and antifungal chitinase produced by a Streptomyces sp.

    Science.gov (United States)

    Karthik, Narayanan; Binod, Parameswaran; Pandey, Ashok

    2015-01-01

    An extremely acidic extracellular chitinase produced by a Streptomyces sp. was purified 12.44-fold by ammonium sulphate precipitation, ion-exchange chromatography and gel-permeation chromatography and further characterised. The molecular mass of the enzyme was estimated to be about 40 kDa by SDS-PAGE. The optimum pH and temperature of the purified enzyme were pH 2 and 6, and 50 °C respectively. The enzyme showed high stability in the acidic pH range of 2-6 and temperature stability of up to 50 °C. Additionally, the effect of some cations and other chemical compounds on the chitinase activity was studied. The activity of the enzyme was considerably retained under salinity conditions of up to 3%. The Km and Vmax values of the enzyme were determined to be 6.74 mg mL(-1) and 61.3 U mg(-1) respectively using colloidal chitin. This enzyme exhibited antifungal activity against phytopathogens revealing a potential biocontrol application in agriculture.

  1. A novel Method for the selective recovery and purification of gamma-polyglutamic acid from Bacillus licheniformis fermentation broth.

    Science.gov (United States)

    Manocha, Bhavik; Margaritis, Argyrios

    2010-01-01

    Microbially produced gamma-polyglutamic acid (gamma-PGA) is a commercially important biopolymer with many applications in biopharmaceutical, food, cosmetic and waste-water treatment industries. Owing to its increasing demand in various industries, production of gamma-PGA is well documented in the literature, however very few methods have been reported for its recovery. In this paper, we report a novel method for the selective recovery and purification of gamma-PGA from cell-free fermentation broth of Bacillus licheniformis. The cell-free fermentation broth was treated with divalent copper ions, resulting in the precipitation of gamma-PGA, which was collected as a pellet by centrifugation. The pellet was resolubilized and dialyzed against de-ionized water to obtain the purified gamma-PGA biopolymer. The efficiency and selectivity of gamma-PGA recovery was compared with ethanol precipitation method. We found that 85% of the original gamma-PGA content in the broth was recovered by copper sulfate-induced precipitation, compared to 82% recovery by ethanol precipitation method. Since ethanol is a commonly used solvent for protein precipitation, the purity of gamma-PGA precipitate was analyzed by measuring proteins that co-precipitated with gamma-PGA. Of the total proteins present in the broth, 48% proteins were found to be co-precipitated with gamma-PGA by ethanol precipitation, whereas in copper sulfate-induced precipitation, only 3% of proteins were detected in the final purified gamma-PGA, suggesting that copper sulfate-induced precipitation offers better selectivity than ethanol precipitation method. Total metal content analysis of the purified gamma-PGA revealed the undetectable amount of copper ions, whereas other metal ions detected were in low concentration range. The purified gamma-PGA was characterized using infrared spectroscopy. Copyright 2010 American Institute of Chemical Engineers

  2. Pimaradienoic Acid Inhibits Carrageenan-Induced Inflammatory Leukocyte Recruitment and Edema in Mice: Inhibition of Oxidative Stress, Nitric Oxide and Cytokine Production.

    Directory of Open Access Journals (Sweden)

    Sandra S Mizokami

    Full Text Available Pimaradienoic acid (PA; ent-pimara-8(14,15-dien-19-oic acid is a pimarane diterpene found in plants such as Vigueira arenaria Baker (Asteraceae in the Brazilian savannas. Although there is evidence on the analgesic and in vitro inhibition of inflammatory signaling pathways, and paw edema by PA, its anti-inflammatory effect deserves further investigation. Thus, the objective of present study was to investigate the anti-inflammatory effect of PA in carrageenan-induced peritoneal and paw inflammation in mice. Firstly, we assessed the effect of PA in carrageenan-induced leukocyte recruitment in the peritoneal cavity and paw edema and myeloperoxidase activity. Next, we investigated the mechanisms involved in the anti-inflammatory effect of PA. The effect of PA on carrageenan-induced oxidative stress in the paw skin and peritoneal cavity was assessed. We also tested the effect of PA on nitric oxide, superoxide anion, and inflammatory cytokine production in the peritoneal cavity. PA inhibited carrageenan-induced recruitment of total leukocytes and neutrophils to the peritoneal cavity in a dose-dependent manner. PA also inhibited carrageenan-induced paw edema and myeloperoxidase activity in the paw skin. The anti-inflammatory mechanism of PA depended on maintaining paw skin antioxidant activity as observed by the levels of reduced glutathione, ability to scavenge the ABTS cation and reduce iron as well as by the inhibition of superoxide anion and nitric oxide production in the peritoneal cavity. Furthermore, PA inhibited carrageenan-induced peritoneal production of inflammatory cytokines TNF-α and IL-1β. PA presents prominent anti-inflammatory effect in carrageenan-induced inflammation by reducing oxidative stress, nitric oxide, and cytokine production. Therefore, it seems to be a promising anti-inflammatory molecule that merits further investigation.

  3. Purification and biological effects of L-amino acid oxidase isolated from Bothrops insularis venom.

    Science.gov (United States)

    Braga, Marcus Davis Machado; Martins, Alice Maria Costa; Amora, Daniela Nascimento; de Menezes, Dalgimar Beserra; Toyama, Marcos Hikari; Toyama, Daniela Oliveira; Marangoni, Sergio; Alves, Claudênio Diógenes; Barbosa, Paulo Sérgio Ferreira; de Sousa Alves, Renata; Fonteles, Manassés Claudino; Monteiro, Helena Serra Azul

    2008-02-01

    Bothrops insularis is a snake from Ilha da Queimada Grande, an island located about 20 miles away from the Southeastern coast of Brazil. Compared with other Brazilian species of Bothrops, the toxinology of B. insularis is still poorly understood, and so far, no fraction from this venom with amino acid oxidase activity had been isolated or its biological activity tested. We investigated the biochemical and biological effects of one l-amino acid oxidase enzyme isolated from B. insularis snake venom (BiLAO), which was purified using HPLC and sequence grade. We also evaluated the renal effects induced by BiLAO. Chromatographic profile of B. insularis whole venom disclosed seven main fractions (I, II, III, IV, V, VI and VII) and the main LAO enzymatic activity was detected in fraction II. The group treated with BiLAO showed a decrease in perfusion pressure (C(120)=110.28+/-3.69; BiLAO(120)=82.2+/-5.6 mmHg*); renal vascular resistance (C(120)=5.48+/-0.53; BiLAO(120)=4.12+/-0.42 mmHg/mL/g/min*), urinary flow (C(120)=0.160+/-0.020; BiLAO(120)=0.064+/-0.012 mL/g/min*), glomerular filtration rate (C(120)=0.697+/-0.084; BiLAO(120)=0.176+/-0.017 mL/g/min*), sodium (C(120)=79.76+/-0.56; BiLAO(120)=65.39+/-6.19%*), potassium (C(120)=69.94+/-6.86; BiLAO(120)=60.26+/-2.24%*) and chloride tubular reabsortion (C(120)=78.53+/-2.33; BiLAO(120)=64.58+/-6.68%*). Acute tubular necrosis foci were observed in the group treated with the LAO fraction of the B. insularis snake venom. Some findings have the same morphological aspect of apoptosis, more evident cortically; otherwise, reversible degenerative phenomena represented by hydropic ballooning with extensive cytoplasmic vacuolization and discontinuity of the cell brush borders in the proximal tubular epithelium were observed; furthermore, necrotic detachment of these cells into the tubular lumina, and increased amount of protein deposits in the distal and proximal tubules were observed. In conclusion, the slowness of blood flow and of

  4. Quantification of false positive reduction in nucleic acid purification on hemorrhagic fever DNA.

    Energy Technology Data Exchange (ETDEWEB)

    James, Conrad D.; Pohl, Kenneth Roy; Derzon, Mark Steven; McClain, Jaime; Achyuthan, Komandoor

    2006-11-01

    Columbia University has developed a sensitive highly multiplexed system for genetic identification of nucleic acid targets. The primary obstacle to implementing this technology is the high rate of false positives due to high levels of unbound reporters that remain within the system after hybridization. The ability to distinguish between free reporters and reporters bound to targets limits the use of this technology. We previously demonstrated a new electrokinetic method for binary separation of kb pair long DNA molecules and oligonucleotides. The purpose of this project 99864 is to take these previous demonstrations and further develop the technique and hardware for field use. Specifically, our objective was to implement separation in a heterogeneous sample (containing target DNA and background oligo), to perform the separation in a flow-based device, and to develop all of the components necessary for field testing a breadboard prototype system.

  5. Production, Purification, Stability and Efficacy of Bacteriocin from Isolates of Natural Lactic Acid Fermentation of Vegetables

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Joshi

    2006-01-01

    Full Text Available The antimicrobial activity of partially purified bacteriocin produced during natural lactic acid fermentation of carrot, radish and cucumber was assessed and characterized. Out of ten strains, the isolated strain CA 44 of Lactobacillus genus from carrot fermentation produced bacteriocin with maximum antimicrobial activity against Escherichia coli, Staphylococcus aureus and Bacillus cereus, though it was more effective against E. coli than others. Bacteriocin was stable at up to 100 °C but its activity declined compared to that at 68 °C and was completely lost at 121 °C. The maximum antimicrobial activity was retained within the pH range of 4–5, but it was adversely affected by the addition of papain. Bacteriocin was also effective against B. cereus in different fruit products (pulp, juice and wine indicating its potential application as a biopreservative in fruit products.

  6. Purification, amino acid sequence, and some properties of rabbit kidney lysozyme.

    Science.gov (United States)

    Ito, Y; Yamada, H; Nakamura, S; Imoto, T

    1990-02-01

    The lysozyme (rabbit kidney lysozyme) from the homogenate of rabbit kidney (Japanese white) was purified by repeated cation-exchange chromatography on Bio-Rex 70. The amino acid sequence was determined by automated gas-phase Edman degradation of the peptides obtained from the digestion of reduced and S-carboxymethylated rabbit lysozyme with Achromobacter protease I (lysyl endopeptidase). The sequence thus determined was KIYERCELARTLKKLGLDGYKGVSLANWMCLAKWESSYNTRATNYNPGDKSTDYGIFQ INSRYWCNDGKTPRAVNACHIPCSDLLKDDITQAVACAKRVVSDPQGIRAWVAWRNHCQ NQDLTPYIRGCGV, indicating 25 amino acid substitutions from human lysozyme. The lytic activity of rabbit lysozyme against Micrococcus lysodeikticus at pH 7, ionic strength of 0.1, and 30 degrees C was found to be 190 and 60% of those of hen and human lysozymes, respectively. The lytic activity-pH profile of rabbit lysozyme was slightly different from those of hen and human lysozymes. While hen and human lysozymes had wide optimum activities at around pH 5.5-8.5, the optimum activity of rabbit lysozyme was at around pH 5.5-7.0. The high proline content (five residues per molecule compared with two prolines per molecule in hen or human lysozyme) is one of the interesting features of rabbit lysozyme. The transition temperatures for the unfolding of rabbit, human, and hen lysozymes in 3 M guanidine hydrochloride at pH 5.5 were 51.2, 45.5, and 45.4 degrees C, respectively, indicating that rabbit lysozyme is stabler than the other two lysozymes. The high proline content may be responsible for the increased stability of rabbit lysozyme.

  7. Catalase purification from rat liver with iron-chelated poly(hydroxyethyl methacrylate-N-methacryloyl-(l)-glutamic acid) cryogel discs.

    Science.gov (United States)

    Göktürk, Ilgım; Perçin, Işık; Denizli, Adil

    2016-08-17

    In this study, iron-chelated poly(hydroxyethyl methacrylate-N-methacryloyl-(l)-glutamic acid) (PHEMAGA/Fe(3+)) cryogel discs were prepared. The PHEMAGA/Fe(3+) cryogel discs were characterized by elemental analysis, scanning electron microscopy, Fourier transform infrared spectroscopy, swelling tests, and surface area measurements. The PHEMAGA/Fe(3+) cryogel discs had large pores ranging from 10 to 100 µm with a swelling degree of 9.36 g H2O/g cryogel. Effects of pH, temperature, initial catalase concentration, and flow rate on adsorption capacity of the PHEMAGA/Fe(3+) cryogel discs were investigated. Maximum catalase adsorption capacity (62.6 mg/g) was obtained at pH 7.0, 25°C, and 3 mg/ml initial catalase concentration. The PHEMAGA/Fe(3+) cryogel discs were also tested for the purification of catalase from rat liver. After tissue homogenization, purification of catalase was performed using the PHEMAGA/Fe(3+) cryogel discs and catalase was obtained with a yield of 54.34 and 16.67 purification fold.

  8. Development of a chamber system for rapid, high yield and cost-effective purification of deoxyribonucleic acid fragments from agarose gel

    Directory of Open Access Journals (Sweden)

    Gilda Eslami

    2014-01-01

    Full Text Available Background: There are several methods commonly practicing for deoxyribonucleic acid (DNA purification from agarose gel. In most laboratories, especially in developing countries, present methods for recovering of DNA fragments from the gel are mostly involved organic solvents. However, manual purification using organic solvents are toxic, labor intensive, time consuming and prone to contamination owing to several handling steps. The above mentioned burdens as well as cost and long time to import them, especially in developing countries, prompted us to design and develop a chamber system for rapid, non-toxic, cost-effective and user friendly device for polymerase chain reaction (PCR products purification from agarose gel. Materials and Methods: The device was made from plexiglass plates. After amplification of two fragments of 250 and 850 bp, PCR products were electrophoresed. Subsequently, the desired bands were excised and purified with three method: HiPer Mini chamber, phenol extraction method and spin column procedure. To assess the suitability of the purified DNAs, restriction digestion was applied. Results: Results showed that the yield of recovered DNA in our method was above 95%, whereas the yields obtained with conventional phenol extraction and spin column methods were around 60%. Conclusion: In conclusion, the current method for DNA elution is quick, inexpensive and robust and it does not require the use of toxic organic solvents. In addition, the purified DNA was well has suited for further manipulations such as restriction digestion, ligation, cloning, sequencing and hybridization.

  9. Purification of free arginine from chickpea (Cicer arietinum) seeds.

    Science.gov (United States)

    Cortés-Giraldo, Isabel; Megías, Cristina; Alaiz, Manuel; Girón-Calle, Julio; Vioque, Javier

    2016-02-01

    Chickpea is a grain legume widely consumed in the Mediterranean region and other parts of the world. Chickpea seeds are rich in proteins but they also contain a substantial amount of free amino acids, especially arginine. Hence chickpea may represent a useful source of free amino acids for nutritional or pharmaceutical purposes. Arginine is receiving great attention in recent years because it is the substrate for the synthesis of nitric oxide, an important signaling molecule involved in numerous physiological and pathological processes in mammals. In this work we describe a simple procedure for the purification of arginine from chickpea seeds, using nanofiltration technology and an ion-exchange resin, Amberlite IR-120. Arginine was finally purified by precipitation or crystallization, yielding preparations with purities of 91% and 100%, respectively. Chickpea may represent an affordable green source of arginine, and a useful alternative to production by fermentation or protein hydrolysis. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Purification of apyrase from yellow lupin cotyledons after extraction with perchloric acid.

    Science.gov (United States)

    Guranowski, A; Starzyńska, E; Rataj-Guranowska, M; Günther Sillero, M A

    1991-08-01

    Neutralized 1 M perchloric acid (PCA) extracts of yellow lupin (Lupinus luteus) seedling cotyledons contain considerable amounts of apyrase (EC 3.6.1.5). Investigators who use PCA extraction for the estimation of nucleotide levels, particularly in plant tissues, should be aware of this danger. Only when the material is treated with 1.8-2 M PCA are the extracts obtained free of apyrase activity. Chromatography of neutralized 1 M extracts obtained from 7-day-old seedling cotyledons on DEAE-Sephacel and Sephadex G-100 yields almost homogeneous apyrase that shows a band of M(r) 51,000 on sodium dodecyl sulfate-polyacrylamide gel electrophoresis gels. The molecular weight of the native enzyme is also about 51,000. The apyrase preparation is free of nonspecific phosphatases, nucleotidases, and adenosine nucleosidase, as well as dinucleoside polyphosphate-degrading enzymes. The apyrase exhibits a broad pH optimum between 6 and 8. Mg2+ and Ca2+ are required for maximum activity; Zn2+ and Mn2+ are less effective and Co2+, Ni2+, and Cd2+ are without effect. The Km values for ATP and ADP are about 20 microM. All common 5'-nucleoside tri- and diphosphates as well as adenosine 5'-tetraphosphate are substrates.

  11. Purification and molecular characterization of a sialic acid specific lectin from the phytopathogenic fungus Macrophomina phaseolina.

    Science.gov (United States)

    Bhowal, Jayati; Guha, Arun Kumar; Chatterjee, Bishnu Pada

    2005-09-05

    A lectin was isolated and purified from the culture filtrate of the plant pathogenic fungus Macrophomina phaseolina by a combination of ammonium sulfate precipitation, affinity chromatography on fetuin-Sepharose 4B and ion-exchange chromatography on DEAE-A 50. The lectin designated MPL was homogeneous by PAGE and HPLC and a monomeric protein with a molecular weight of approximately 34 kDa as demonstrated by SDS-PAGE. It is a glycoprotein and agglutinated human erythrocytes regardless of the human blood type. Neuraminidase treatment of erythrocytes reduced the agglutination activity of the lectin. It is thermally stable and exhibits maximum activity between pH 6 and 7.2. Its carbohydrate binding specificity was investigated both by hapten inhibition of hemagglutination and by enzyme-conjugated lectin inhibition assay. Although, M. phaseolina lectin bound sialic acid, it exhibited binding affinity towards neuraminyl oligosaccharides of N-linked glycoproteins, alpha-Neu5Ac-(2-->3)-beta-Gal-(1-->4)-GlcNAc being maximum.

  12. Purification of telluric acid for SNO+ neutrinoless double-beta decay search

    Energy Technology Data Exchange (ETDEWEB)

    Hans, S.; Rosero, R.; Hu, L. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Chkvorets, O. [Laurentian University, Sudbury (Canada); Chan, W.T.; Guan, S.; Beriguete, W. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Wright, A. [Queen University, Kingston (Canada); Ford, R. [SNOLAB, Creighton Mine, Sudbury (Canada); Chen, M.C. [Queen University, Kingston (Canada); Biller, S. [University of Oxford, Oxford OX1 3RH (United Kingdom); Yeh, M., E-mail: yeh@bnl.gov [Brookhaven National Laboratory, Upton, NY 11973 (United States)

    2015-09-21

    Tellurium-130 has the highest natural abundance of any double-beta decay isotopes. Recently it has been developed as a promising candidate for loading in liquid scintillator to explore the Majorana or Dirac nature of the neutrino through a search for neutrinoless double beta decay (0νββ). To this end, procedures have been developed to transfer tellurium ions into the organic liquid by a water-based loading technology. However, traces of naturally occurring radioactivity and cosmic-ray induced isotopes introduced into the scintillator with tellurium could produce undesirable contaminations in the {sup 130}Te 0νββ region. Measurements using various elemental spikes prepared from different chemical forms indicate that the uses of self-scavenging as well as acid and thermal recrystallization prior to the preparation of a tellurium-loaded liquid scintillator can deplete U and Th and several cosmic-activated isotopes from Te feedstock by a factor of 10{sup 2}–10{sup 3} in a single pass. The process is also found to improve the optical transmission in the blue region, sensible to the photomultiplier tube, by removing traces of colored impurities. In addition to the scintillator-based experiments, this cleansing scheme has potential applications to the production of radiopure tellurium crystals for other rare-event experiments.

  13. 1, 4-alpha-Glucan phosphorylase from Klebsiella pneumoniae purification, subunit structure and amino acid composition.

    Science.gov (United States)

    Linder, D; Kurz, G; Bender, H; Wallenfels, K

    1976-11-01

    1. A 1,4-alpha-glucan phosphorylase from Klebsiella pneumoniae has been purified about 80-fold with an over-all yield greater than 35%. The purified enzyme has been shown to be homogeneous by gel electrophoresis at different pH-values, by isoelectric focusing, by dodecylsulfate electrophoresis and by ultracentrifugation. 2. The molecular weight of the native enzyme has been determined to be 180 000 by ultra-centrifugation studies, in good agreement with the value of 189 000 estimated by gel permeation chromatography. 3. The enzyme dissociates in the presence of 0.1% dodecylsulfate or 5 M guanidine hydrochloride into polypeptide chains. The molecular weight of these polypeptide chains has been found to be 88 000 by dodecylsulfate polyacrylamide gel electrophoresis and 99 000 by sedimentation equilibrium studies, indicating that the native enzyme is composed of two polypeptide chains. 4. The enzyme contains pyridoxalphosphate with a stoichiometry of two moles per 180 000 g protein, confirming that the 1,4-alpha-glucan phosphorylase from Klebsiella pneumoniae is a dimeric enzyme. 5. The amino acid composition of the enzyme has been determined, and its correspondence to that of 1,4-alpha-glucan phosphorylases from other sources is discussed. 6. The pI of the enzyme has been shown to be 5.3 and its pH-optimum to be about pH 5.9. The enzyme is stable in the range from pH 5.9 to 10.5.

  14. Effects of abscisic acid and nitric oxide on trap formation and trapping of nematodes by the fungus Drechslerella stenobrocha AS6.1.

    Science.gov (United States)

    Xu, Ling-Ling; Lai, Yi-Ling; Wang, Lin; Liu, Xing-Zhong

    2011-02-01

    The in vitro effects of abscisic acid (ABA) and nitric oxide (NO) on the nematode-trapping fungus Drechslerella stenobrocha AS6.1 were examined. The average number of traps (constricting rings) per colony and the percentage of nematodes (Caenorhabditis elegans) trapped were greatly increased by addition of ABA but greatly suppressed by addition of sodium nitroprusside (SNP, an NO donor) to corn meal agar. The suppressive effect of SNP was not negated by addition of an NO synthase competitive inhibitor (l-naphthylacetic acid, L-NNA) or an NO-specific scavenger [2-(4-carboxyphenyl)-4,4, 5,5-tetramethylimidazoline-1-oxyl-3-oxide, cPTIO]. When added without SNP, however, L-NNA and cPTIO caused moderate increases in trap number and trapping. The results indicate that the trap formation and nematode-trapping ability of D. stenobrocha were enhanced by ABA but decreased by exogenous NO.

  15. Caprylic acid-induced impurity precipitation from protein A capture column elution pool to enable a two-chromatography-step process for monoclonal antibody purification.

    Science.gov (United States)

    Zheng, Ji; Wang, Lu; Twarowska, Barbara; Laino, Sarah; Sparks, Colleen; Smith, Timothy; Russell, Reb; Wang, Michelle

    2015-01-01

    This article presents the use of caprylic acid (CA) to precipitate impurities from the protein A capture column elution pool for the purification of monoclonal antibodies (mAbs) with the objective of developing a two chromatography step antibody purification process. A CA-induced impurity precipitation in the protein A column elution pool was evaluated as an alternative method to polishing chromatography techniques for use in the purification of mAbs. Parameters including pH, CA concentrations, mixing time, mAb concentrations, buffer systems, and incubation temperatures were evaluated on their impacts on the impurity removal, high-molecular weight (HMW) formation and precipitation step yield. Both pH and CA concentration, but not mAb concentrations and buffer systems, are key parameters that can affect host-cell proteins (HCPs) clearance, HMW species, and yield. CA precipitation removes HCPs and some HMW species to the acceptable levels under the optimal conditions. The CA precipitation process is robust at 15-25°C. For all five mAbs tested in this study, the optimal CA concentration range is 0.5-1.0%, while the pH range is from 5.0 to 6.0. A purification process using two chromatography steps (protein A capture column and ion exchange polishing column) in combination with CA-based impurity precipitation step can be used as a robust downstream process for mAb molecules with a broad range of isoelectric points. Residual CA can be effectively removed by the subsequent polishing cation exchange chromatography.

  16. Comparative effects of sulfuric and nitric acid rain on litter decomposition and soil microbial community in subtropical plantation of Yangtze River Delta region.

    Science.gov (United States)

    Liu, Xin; Zhang, Bo; Zhao, Wenrui; Wang, Ling; Xie, Dejin; Huo, Wentong; Wu, Yanwen; Zhang, Jinchi

    2017-12-01

    Acid rain is mainly caused by dissolution of sulfur dioxide and nitrogen oxides in the atmosphere, and has a significant negative effect on ecosystems. The relative composition of acid rain is changing gradually from sulfuric acid rain (SAR) to nitric acid rain (NAR) with the rapidly growing amount of nitrogen deposition. In this study, we investigated the impact of simulated SAR and NAR on litter decomposition and the soil microbial community over four seasons since March 2015. Results first showed that the effects of acid rain on litter decomposition and soil microbial were positive in the early period of the experiment, except for SAR on soil microbes. Second, soil pH with NAR decreased more rapidly with the amount of acid rain increased in summer than with SAR treatments. Only strongly acid rain (both SAR and NAR) was capable of depressing litter decomposition and its inhibitory effect was stronger on leaf than on fine root litter. Meanwhile, NAR had a higher inhibitory effect on litter decomposition than SAR. Third, in summer, autumn and winter, PLFAs were negatively impacted by the increased acidity level resulting from both SAR and NAR. However, higher acidity level of NAR (pH=2.5) had the strongest inhibitory impact on soil microbial activity, especially in summer. In addition, Gram-negative bacteria (cy19:0) and fungi (18:1ω9) were more sensitive to both SAR and NAR, and actinomycetes was more sensitive to SAR intensity. Finally, soil total carbon, total nitrogen and pH were the most important soil property factors affecting soil microbial activity, and high microbial indices (fungi/bacteria) with high soil pH. Our results suggest that the ratio of SO4(2-) to NO3(-) in acid rain is an important factor which could affect litter decomposition and soil microbial in subtropical forest of China. Copyright © 2017. Published by Elsevier B.V.

  17. Effect of a purification step and the type of internal standard used on fatty acid determination of grass and maize silages.

    Science.gov (United States)

    Alves, Susana P; Cabrita, Ana R J; Fonseca, António J M; Bessa, Rui J B

    2009-11-25

    The fatty acid (FA) analysis of grass and maize silages was studied by application of a direct transesterification method (DT) followed by purification by solid-phase extraction (SPE). The choice of the internal standard (IS) for quantification of FA by gas-liquid chromatography (GLC) was also studied. The acidic DT method applied to grass silage samples produced a high amount of non-fatty acid methyl ester compounds (non-FAME) compared with those formed in maize silages. The application of the SPE cleanup step reduced significantly the amount of non-FAME compounds in both samples. Five FAs were tested as IS; among them, 3 were naturally present in all silages, however their use as IS did not affect quantification of total FA composition. Nevertheless, some minor FAs present in silages were significantly affected by the IS used. Additionally, application of corrections to the GLC peak areas did not significantly influence quantification of total FA composition of silages.

  18. Preparation of hybrid molecularly imprinted polymer with double-templates for rapid simultaneous purification of theophylline and chlorogenic acid in green tea.

    Science.gov (United States)

    Tang, Weiyang; Li, Guizhen; Row, Kyung Ho; Zhu, Tao

    2016-05-15

    A novel double-templates technique was adopted for solid-phase extraction packing agent, and the obtained hybrid molecularly imprinted polymers with double-templates (theophylline and chlorogenic acid) were characterized by fourier transform infrared and field emission scanning electron microscope. The molecular recognition ability and binding capability for theophylline and chlorogenic acid of polymers was evaluated by static absorption and dynamic adsorption curves. A rapid and accurate approach was established for simultaneous purification of theophylline and chlorogenic acid in green tea by coupling hybrid molecularly imprinted solid-phase extraction with high performance liquid chromatography. With optimization of SPE procedure, a reliable analytical method was developed for highly recognition towards theophylline and chlorogenic acid in green tea with satisfactory extraction recoveries (theophylline: 96.7% and chlorogenic acid: 95.8%). The limit of detection and limit of quantity of the method were 0.01 μg/mL and 0.03 μg/mL for theophylline, 0.05 μg/mL and 0.17 μg/mL for chlorogenic acid, respectively. The recoveries of proposed method at three spiked levels analysis were 98.7-100.8% and 98.3-100.2%, respectively, with the relative standard deviation less than 1.9%. Hybrid molecularly imprinted polymers with double-templates showed good performance for two kinds of targets, and the proposed approach with high affinity of hybrid molecularly imprinted polymers might offer a novel method for the purification of complex samples.

  19. Recovery of nitric acid and hydrofluoric acid from passivation solution of steels by diffusion dialysis%扩散渗析法回收不锈钢钝化液中HNO3和HF

    Institute of Scientific and Technical Information of China (English)

    王昆; 刘飞; 邢卫红

    2012-01-01

    Recovery of nitric acid and hydrofluoric acid produced in passivation process of steels by diffusion dialysis was studied. The recovery rates of one-component nitric acid and hydrofluoric acid were investigated. Effects of flow rate, temperature and concentration of iron ion on mixed acid solution diffusion dialysis were analyzed. The results showed that it was an effective way to separate mixed acid solution by diffusion dialysis. The recovery rate decreased with the increase of the flow rate. Increasing the temperature was beneficial to the acid diffusion through the membrane. Under the operating condition of flow rate of 170 mL/h at normal temperature, the retention rate of iron ions was more than 95% ,the recovery rate of total acid was more than 85% with nitric acid 90% and hydrofluoric acid 40%.%采用扩散渗析法回收不锈钢钝化废液中的HNO3和HF,考察单组分酸、混合酸的回收率和废酸流量、温度、金属离子浓度等因素对扩散渗析过程的影响.结果表明:扩散渗析过程中HNO3回收率大于HF ;酸回收率随着废酸流量增大而减小 ;温度升高有利于酸扩散透过膜 ;Fe3+浓度对截留率影响不大.对于不锈钢钝化废酸液体系,扩散渗析对于H+和Fe3+具有良好的分离效果,常温下,废酸流量为170 mL/h时,总酸回收率为85%,其中HNO3回收率为90%,HF回收率为40%,Fe3+的截留率达到95%以上.

  20. Hydroxycarboxylic acids and salts

    Energy Technology Data Exchange (ETDEWEB)

    Kiely, Donald E; Hash, Kirk R; Kramer-Presta, Kylie; Smith, Tyler N

    2015-02-24

    Compositions which inhibit corrosion and alter the physical properties of concrete (admixtures) are prepared from salt mixtures of hydroxycarboxylic acids, carboxylic acids, and nitric acid. The salt mixtures are prepared by neutralizing acid product mixtures from the oxidation of polyols using nitric acid and oxygen as the oxidizing agents. Nitric acid is removed from the hydroxycarboxylic acids by evaporation and diffusion dialysis.

  1. Adsorption of sulfur dioxide by active carbon treated by nitric acid: I. Effect of the treatment on adsorption of SO{sub 2} and extractability of the acid formed

    Energy Technology Data Exchange (ETDEWEB)

    Lisovskii, A.; Semiat, R.; Aharoni, C. [Technion-Israle Institute of Technology, Haifa (Israel). Chemical Engineering Dept.

    1997-12-31

    Activated carbon is used as an adsorbent in flue gas cleaning. The process of adsorptive-catalytic cleaning of gas from sulfur dioxide using active carbon, treated by concentrated nitric acid, was studied. After oxidative treatment the acidity of the carbon increases and the basicity decreases. This results in an increase of the SO{sub 2} adsorption and its oxidation to SO{sub 3}, and in weaker retention of the sulfuric acid formed. This facilitates the removal of H{sub 2}SO{sub 4} by washing of the carbon and allows to obtain a more concentrated acid. The efficiency of the treated carbon is also higher in the process of SO{sub 2} removal from a gas similar in composition to stack gases. 13 refs., 1 fig., 7 tabs.

  2. 乳酸提纯反应精馏新工艺非平衡级稳态模拟%Non-equilibrium stage static simulation of lactic acid purification reactive distillation process

    Institute of Scientific and Technical Information of China (English)

    张猛; 马利; 杨基础; 徐用懋

    2005-01-01

    Purification of lactic acid by reactive distillation (RD) is a novel technology which has many excellent characteristics compared with traditional technologies. This paper presented a non-equilibrium model for lactic acid purification RD pilot column. An Improved Separation Efficiency Function (ISEF) was proposed based on de-coupling and pseudo-homogenous assumptions, which greatly improved the solving efficiency and made this model suitable for practical application. Simulation results were consistent with the experiments in different conditions, and the simulation results outperformed the simulator ASPEN PLUS in which the equilibrium stage assumptions were adopted. The static characteristics of the pilot setup were also investigated. The analysis result could help to accelerate the commercialization of the lactic acid purification RD technology.

  3. Enrichment of nitrogen-15 by nitrox system. Part 1: countercorrent column of aqueous nitric acid and nitrogen oxides in gaseous phase; Enriquecimento de nitrogenio-15 pelo sistema Nitrox. Parte 1: coluna de contracorrente entre solucao de acido nitrico e oxidos de nitrogenio na fase gasosa

    Energy Technology Data Exchange (ETDEWEB)

    Ducatti, Carlos [UNESP, Botucatu, SP (Brazil). Inst. de Biociencias. Dept. de Fisica e Biofisica; Bonassi, Jose A.; Matsui, Eichii [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil)

    1997-12-01

    In this paper described the operational mode of countercurrent column of aqueous nitric acid and nitrogen oxides (Nitrox System) for the production of nitric acid in the concentration of 5% atoms of {sup 15} N in laboratory. (author). 8 refs., 2 tabs., 1 fig.

  4. Americium(III) oxidation by copper(III) periodate in nitric acid solution as compared with the action of Bi(V) compounds of sodium, lithium, and potassium

    Energy Technology Data Exchange (ETDEWEB)

    Sinkov, Sergey I.; Lumetta, Gregg J. [Pacific Northwest National Laboratory, Radiochemical Processing Lab., Richland, WA (United States)

    2015-07-01

    The oxidative action of a Cu(III) periodate compound toward Am(III) in nitric acid was studied. The extent of oxidation of Am(III) to Am(VI) was investigated using a constant initial Cu(III)-to-Am(III) molar ratio of 10:1 and varying nitric acid concentrations from 0.25 to 3.5 mol/L. From 0.25 to 3 mol/L HNO3, more than 98% of the Am(III) was oxidized to Am(VI); however, at 3.5 mol/L HNO{sub 3}, the conversion to Am(VI) was only 80%. Increasing the Cu(III)-to-Am(III) molar ratio to 20:1 in 3.5 mol/L HNO{sub 3} resulted in 98% conversion to Am(VI). For comparison, oxidation of Am(III) with NaBiO{sub 3} was studied at 3.5 mol/L HNO{sub 3} and the same stoichiometric excess of Bi(V) oxidant over Am(III) (stoichiometric ratio of 3.33:1). With NaBiO{sub 3}, the extent of Am(III) conversion to Am(VI) was only 19%, while with the Cu(III) compound this value was found to be about 4 times higher under otherwise identical conditions. Similar results were obtained with other Bi(V) salts. These results show that the Cu(III) periodate compound is a superior oxidant to NaBiO{sub 3}, yielding rapid conversion to Am(VI) in a homogeneous acidic solution, and is, therefore, an excellent candidate for further development of Am separation systems.

  5. A theoretical study of nitric oxide adsorption and dissociation on copper-exchanged zeolites SSZ-13 and SAPO-34: the impact of framework acid-base properties.

    Science.gov (United States)

    Uzunova, Ellie L; Mikosch, Hans

    2016-04-28

    The adsorption of nitric oxide as dinitrosyls and the deNOx proton-mediated reaction mechanism are assessed using electronic structure methods and transition state theory. Dinitrosyls bind to copper cations either via a N-atom or via an O-atom, with N-binding being more stable. In their ground states, dinitrosyls reach a planar configuration with the metal cation. The two nitric oxide molecules are kept together in O-bonded dinitrosyls by the N-N bond and the adsorption complex obtains a cyclic planar structure, while N-bonded dinitrosyls have out-of-plane conformations with low energy barriers. An asymmetric structure ZCu(ON)(NO) with one N-bonded nitrosyl and the other O-bonded is of the lowest stability. The cyclic hyponitrite ZCu(ON)2 adsorption complex undergoes O-N bond breaking upon protonation of one oxygen atom and this lowers the energy barrier of the first reaction step of nitric oxide dissociation to yield N2O and a hydroxylated copper site ZCu(OH) by 45 kJ mol(-1) for Cu-SAPO-34 and by 46 kJ mol(-1) for Cu-SSZ-13. The more stable N-bonded dinitrosyl ZCu(NO)2 provides less favorable reaction which passes through the asymmetric ZCu(ON)(NO) intermediate structure. Brønsted acid sites facilitate the reversal of one nitrosyl group. The role of proton transfer from a Brønsted acid site to dinitrosyls is not limited to the initial step of facilitating the N-O bond cleavage, but it also contributes to the stabilization of intermediate oxygen species formed at the copper site as hydroxide ZCu(OH) and hydroperoxide, ZCuOOH. Without protonation, the unstable ZCuO intermediate causes structural deformation with strongly lengthened T-O bonds in the framework. The rate determining step is N2O decomposition to N2 and O2, whether starting with a ZCu(NO)2 or a ZCu(ON)2 adsorption complex, and Cu-SSZ-13 has a clear advantage with an energy barrier of 195 kJ mol(-1)vs. 265 kJ mol(-1) for Cu-SAPO-34. In the final step the Brønsted acid site is restored by proton

  6. Purification and dispersibility of multi-walled carbon nanotubes in aqueous solution

    Science.gov (United States)

    Chen, Yuanzhao; Li, Zhenxia; Zhao, Yang

    2016-12-01

    In this paper, the pristine multi-walled carbon nanotubes (P-MWCNTs) were purified either by the high temperature treatment (HT-MWCNTs) or by concentrated acid treatment (CA-MWCNTs). The HT-MWCNTs were prepared by heating at 500°C, while the CA-MWCNTs were treated by the mixture of concentrated nitric and sulfuric acids taken in a volume ratio of 3: 1. Ultrasonic processing and surfactants were utilized to achieve homogenous MWCNTs suspensions. The HT-MWCNTs and CA-MWCNTs were characterized by thermogravimetric analysis (TGA) and Fourier transform infrared spectroscopy (FT-IR). Among these three MWCNTs, the prepared homogeneously dispersed MWCNTs suspensions were characterized by UV-Vis absorbency and transmission electron microscopy (TEM). Finally, the dispersion mechanism was discussed. The results showed that both high temperature treatment and concentrated acid treatment can be used for purification of the P-MWCNTs, removing the amorphous carbon and other impurities. In these suspensions, the purified MWCNTs showed a better dispersibility in aqueous solution. The high temperature treatment was a kind of physical purification treatment method and it just burned the amorphous carbon away and strengthened the structure of MWCNTs, while the concentrated acid treatment was a chemical purification treatment method and this chemical treatment method grafted more effective groups to improve the dispersibility of MWCNTs.

  7. 论电子级氢氟酸的纯化技术及其发展%On Electronic-Grade Hydrofluoric Acid Purification Technology and its Development

    Institute of Scientific and Technical Information of China (English)

    陈林; 邵勇; 朱龙

    2016-01-01

    After due phosphate rock as the main raw material for the production of fluorine by the national limit for fluoride products have a certain influence.With the rapid development of the international economy,the semiconductor industry has developed rapidly. Electronic grade hydrofluoric acid is the main chemical raw materials and a half monomers.From the current situation of electronic-grade hydrofluoric acid purification technology and the future development of two aspects of the research is intended to explore the development of purification technology,and produce the fluorite strategic conservation to create greater benefits for the economy and society.%磷矿石作为氟生产的主要原料,受到国家限制后,对于氟产品有了一定的影响。随着国际经济的快速发展,半导体产业也迅速发展。电子级氢氟酸是半单体的主要化学原料。从电子级氢氟酸纯化技术的现状和未来发展两个方面展开了研究,意在探索纯化技术的发展,以及对于萤石产生战略性保护,为经济和社会创造更大的效益。

  8. Insights into the mechanism of extraction of uranium (VI) from nitric acid solution into an ionic liquid by using tri-n-butyl phosphate.

    Science.gov (United States)

    Gaillard, Dr Clotilde; Boltoeva, Maria; Billard, Isabelle; Georg, Sylvia; Mazan, Valérie; Ouadi, Ali; Ternova, Dariia; Hennig, Christoph

    2015-08-24

    We present new results on the liquid-liquid extraction of uranium (VI) from a nitric acid aqueous phase into a tri-n-butyl phosphate/1-butyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide (TBP/[C4 mim][Tf2 N]) phase. The individual solubilities of the ionic-liquid ions in the upper part of the biphasic system are measured over the whole acidic range and as a function of the TBP concentration. New insights into the extraction mechanism are obtained through the in situ characterization of the extracted uranyl complexes by coupling UV/Vis and extended X-ray absorption fine structure (EXAFS) spectroscopy. We propose a chemical model to explain uranium (VI) extraction that describes the data through a fit of the uranyl distribution ratio DU . In this model, at low acid concentrations uranium (VI) is extracted as the cationic complex [UO2 (TBP)2 ](2+) , by an exchange with one proton and one C4 mim(+) . At high acid concentrations, the extraction proceeds through a cationic exchange between [UO2 (NO3 )(HNO3 )(TBP)2 ](+) and one C4 mim(+) . As a consequence of this mechanism, the variation of DU as a function of TBP concentration depends on the C4 mim(+) concentration in the aqueous phase. This explains why noninteger values are often derived by analysis of DU versus [TBP] plots to determine the number of TBP molecules involved in the extraction of uranyl in an ionic-liquid phase.

  9. Nitric Acid Particles in Cold Thick Ice Clouds Observed at Global Scale: Link with Lightning, Temperature, and Upper Tropospheric Water Vapor

    Science.gov (United States)

    Chepfer, H.; Minnis, P.; Dubuisson, P.; Chiriaco, M.; Sun-Mack, S.; Riviere, E. D.

    2007-01-01

    Signatures of nitric acid particles (NAP) in cold thick ice clouds have been derived from satellite observations. Most NAP are detected in the Tropics (9 to 20% of clouds with T less than 202.5 K). Higher occurrences were found in the rare mid-latitudes very cold clouds. NAP occurrence increases as cloud temperature decreases and NAP are more numerous in January than July. Comparisons of NAP and lightning distributions show that lightning is the main source of the NOx, which forms NAP in cold clouds. Qualitative comparisons of NAP with upper tropospheric humidity distributions suggest that NAP play a role in the dehydration of the upper troposphere when the tropopause is colder than 195K.

  10. REACT-Mod: a mathematical model for transient calculation of chemical reactions with U-Pu-Np-Tc in the aqueous nitric acid solution

    Energy Technology Data Exchange (ETDEWEB)

    Tachimori, Shoichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kitamura, Tatsuaki

    1996-10-01

    A computer code REACT-Mod which simulates various chemical reactions in an aqueous nitric acid solution involving uranium, plutonium, neptunium, technetium etc. e.g., redox, radiolytic and disproportionation reactions of 68, was developed based on the kinetics model. The numerical solution method adopted in the code are two, a kinetics model totally based on the rate law of which differential equations are solved by the modified Porsing method, and a two-step model based on both the rate law and equilibrium law. Only the former treats 27 radiolytic reactions. The latter is beneficially used to have a quick and approximate result by economical computation. The present report aims not only to explain the concept, chemical reactions treated and characteristics of the model but also to provide details of the program for users of the REACT-Mod code. (author)

  11. Determination of plutonium in nitric acid solutions using energy dispersive L X-ray fluorescence with a low power X-ray generator

    Energy Technology Data Exchange (ETDEWEB)

    Py, J. [Laboratoire Chrono-Environnement, UMR CNRS 6249, Université de Franche-Comté, 16 route de Gray, F-25030 Besançon (France); Commissariat à l’Énergie Atomique, Centre de Valduc, F-21120 Is-sur-Tille (France); Groetz, J.-E., E-mail: jegroetz@univ-fcomte.fr [Laboratoire Chrono-Environnement, UMR CNRS 6249, Université de Franche-Comté, 16 route de Gray, F-25030 Besançon (France); Hubinois, J.-C.; Cardona, D. [Commissariat à l’Énergie Atomique, Centre de Valduc, F-21120 Is-sur-Tille (France)

    2015-04-21

    This work presents the development of an in-line energy dispersive L X-ray fluorescence spectrometer set-up, with a low power X-ray generator and a secondary target, for the determination of plutonium concentration in nitric acid solutions. The intensity of the L X-rays from the internal conversion and gamma rays emitted by the daughter nuclei from plutonium is minimized and corrected, in order to eliminate the interferences with the L X-ray fluorescence spectrum. The matrix effects are then corrected by the Compton peak method. A calibration plot for plutonium solutions within the range 0.1–20 g L{sup −1} is given.

  12. Synergistic extraction of U(VI) and Th(IV) from nitric acid media withHBMPPT and TBP in toluene

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    The synergistic extraction of U(VI) and Th(IV) from nitric acid solutionby HBMPPT (4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione) andTBP (tributylphosphate ) in toluene was studied. The extraction abilityof HBMPPT for U(VI) and Th(IV) was not so high, but when a little TBP was added in, theability to extract U(VI) and Th(IV) was improved. The extracted complexes may be presented as UO2NO3.BMPPT.TBP and UO2(BMPPT)2 .TBP for U(VI), and Th(NO3)3.BMPPT.TBP andTh(NO3)2 (BMPPT)2.TBP for Th(IV),respectively, in the synergisticextraction system. The synergistic effect of HBMPPT and TBP makes the separationcoefficient of U(VI) /Th(IV) or U(VI)/Eu(III) reach a high value.

  13. The use of Liquid Smoke as A Substitute for Nitric Acid for Extraction of Amorphous silica from Rice husk through Sol-Gel Route

    Directory of Open Access Journals (Sweden)

    Wasinton Simanjuntak

    2016-08-01

    Full Text Available This study assessed the potential of liquid smoke as substitute for nitric acid for production of rice husk silica using sol-gel method. The efficacy of liquid smoke was compared to that of 10% HNO3 solution in terms of the volume required and the mass of silica obtained. Further evaluation was made by comparing the characteristics of the silica as revealed by several characterization techniques include Fourier infrared spectroscopy, x-ray diffraction, scanning electron microscopy, and particle size analysis. No significant difference between the volume of the liquid smoke and the HNO3 solution required, as well as between the mass of silica obtained. Both samples display practically similar functionality and structure. The most interesting finding is that the silica obtained using liquid smoke exhibits more homogeneous surface morphology and narrower particle size distribution. Considering its environmentally friendly nature, it was concluded that liquid smoke is more advantageous than HNO3 solution.

  14. Structure of the oxide film on Ti–6Ta alloy after immersion test in 8 mol/L boiling nitric acid medium

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Dizi, E-mail: diziguo@126.com; Yang, Yingli; Wu, Jinping; Zhao, Bin; Zhao, Hengzhang; Su, Hangbiao; Lu, Yafeng

    2013-08-15

    Highlights: •Structure of the oxide film on Ti–6Ta alloy is studied by depth profile XPS. •TiO{sub 2} and Ta{sub 2}O{sub 5} are found in the top layer of the oxide film. •High valence oxide evolutes form Ti{sub 2}O{sub 3} and TaO. •Shielding effect of Ta{sub 2}O{sub 5} leads to the enhanced corrosion resistance of Ti–Ta alloy. -- Abstract: By using X-ray photoelectron spectroscopy (XPS), X-ray diffractometer (XRD) and scanning electron microscopy (SEM), we investigate the corrosion behavior and the structure of the oxide film of Ti–6Ta alloy that is subjected to the immersion corrosion test in 8 mol/L boiling nitric acid for 432 h. Based on the phase constitution indentified by depth profile XPS, the oxide film could be divided into three sub-layers along its thickness direction: the chemical stable TiO{sub 2} and Ta{sub 2}O{sub 5} are present in layer I; the sub-oxide Ti{sub 2}O{sub 3} and TaO are present in the layer II and layer III, and the high valence oxide evolutes from their sub-oxide gradually. Owing to the shielding effect of Ta{sub 2}O{sub 5}, the corrosion rate of the Ti–6Ta alloy decreases from 0.051 mm/y to 0.014 mm/y with increasing immersion time, showing an excellent corrosion resistance in 8 mol/L boiling nitric acid.

  15. Microstructures of Al7.5Cr22.5Fe35Mn20Ni15 High-Entropy Alloy and Its Polarization Behaviors in Sulfuric Acid, Nitric Acid and Hydrochloric Acid Solutions

    Directory of Open Access Journals (Sweden)

    Chun-Huei Tsau

    2016-08-01

    Full Text Available This paper investigates the microstructures and the polarization behaviors of Al7.5Cr22.5Fe35Mn20Ni15 high-entropy alloy in 1M (1 mol/L deaerated sulfuric acid (H2SO4, nitric acid (HNO3, and hydrochloric acid (HCl solutions at temperatures of 30–60 °C. The three phases of the Al7.5Cr22.5Fe35Mn20Ni15 high-entropy alloy are body-centered cubic (BCC dendrites, face-centered cubic (FCC interdendrites, and ordered BCC precipitates uniformly dispersed in the BCC dendrites. The different phases were corroded in different acidic solutions. The passivation regions of the Al7.5Cr22.5Fe35Mn20Ni15 alloy are divided into three and two sub-regions in the solutions of H2SO4 and HNO3 at 30–60 °C, respectively. The passivation region of the Al7.5Cr22.5Fe35Mn20Ni15 alloy is also divided into two sub-domains in 1M deaerated HCl solution at 30 °C. The Al7.5Cr22.5Fe35Mn20Ni15 alloy has almost equal corrosion resistance in comparison with 304 stainless steel (304SS in both the 1M H2SO4 and 1M HCl solutions. The polarization behaviors indicated that the Al7.5Cr22.5Fe35Mn20Ni15 alloy possessed much better corrosion resistance than 304SS in 1M HNO3 solution. However, in 1M NaCl solution, the corrosion resistance of the Al7.5Cr22.5Fe35Mn20Ni15 alloy was less than 304SS.

  16. Chlorogenic acid protection of neuronal nitric oxide synthase-positive neurons in the hippocampus of mice with impaired learning and memory

    Institute of Scientific and Technical Information of China (English)

    Qiuyun Tu; Xiangqi Tang; Zhiping Hu

    2008-01-01

    BACKGROUND: Clinical practice and modern pharmacology have confirmed that ehlorogenic acid can ameliorate learning and memory impairments. OBJECTIVE: To observe the effects of chlorogenic acid on neuronal nitric oxide synthase (nNOS)-positive neurons in the mouse hippocampus, and to investigate the mechanisms underlying the beneficial effects of chlorogenic acid on learning and memory. DESIGN, TIME AND SETTING: The present randomized, controlled, neural cell morphological observation was performed at the Institute of Neurobiology, Central South University between January and May 2005.MATERIALS: Forty-eight female, healthy, adult, Kunming mice were included in this study. Learning and memory impairment was induced with an injection of 0.5 μL kainic acid (0.4 mg/mL) into the hippocampus.METHODS: The mice were randomized into three groups (n = 16): model, control, and chlorogenic acid-treated. At 2 days following learning and memory impairment induction, intragastric administration of physiological saline or chlorogenic acid was performed in the model and chlorogenic acid-treated groups, respectively. The control mice were administered 0.5 μ L physiological saline into the hippocampus, and 2 days later, they received an intragastric administration of physiological saline. Each mouse received two intragastric administrations (1 mL solution once) per day, for a total of 35 days. MAIN OUTCOME MEASURES: Detection of changes in hippocampal and cerebral cortical nNOS neurons by immunohistochemistry; determination of spatial learning and memory utilizing the Y-maze device.RESULTS: At day 7 and 35 after intervention, there was no significant difference in the number of nNOS-positive neurons in the cerebral cortex between the model, chlorogenic acid, and control groups (P > 0.05). Compared with the control group, the number of nNOS-positive neurons in the hippocampal CA1-4 region was significantly less in the model group (P 0.05). At day 7 following intervention, the number

  17. Purification of Phosphoric Acid Hemihydrate Crystal by Dry-sweating%干法发汗提纯半水磷酸晶体的实验研究

    Institute of Scientific and Technical Information of China (English)

    王保明; 李军; 贾旭宏; 齐亚兵; 罗建洪

    2013-01-01

    采用干法发汗提纯半水磷酸晶体制备高纯磷酸.考察了发汗过程中发汗温度、冷却速率、酸浓度、发汗时间等参数对Mg和Sb脱除及净化效率的影响.结果表明:发汗温度越高,杂质脱除越快,净化效率越低,而且所得产品杂质含量也越少;结晶过程中的冷却速率越大,所得晶体中杂质含量也越多,杂质在发汗过程中脱除也越快,净化效率也越低,但是最终产品杂质含量越高;半水磷酸晶体中初始杂质含量越少,发汗所得产品纯度也越高,因此干法发汗可以用来精制磷酸.%A method of dry-sweating was applied to-purify phosphoric acid hemihydrate crystals to obtain high purity phosphoric acid. The effects of operating parameters, such as sweating temperature, cooling rate, phosphoric acid concentration and sweating time on the removal and purification efficiency of Mg and Sb were investigated. The experimental results showed that the content and purification efficiency of impurities decrease with the increase of sweating temperature, the content of impurities in the product obtained at higher sweating temperature are lower. The content of impurities in the crystals formed at higher cooling rate during crystallization are more, and the impurities can be removed easily during dry-sweating, moreover the purification efficiency of impurities are lower, however the content of impurities in the final product are more. The less the initial content of impurities in the crystals is, the higher the purity of product is. Therefore, dry-sweating can be used to fine phosphoric acid.

  18. Polyphenol fraction of extra virgin olive oil protects against endothelial dysfunction induced by high glucose and free fatty acids through modulation of nitric oxide and endothelin-1

    Directory of Open Access Journals (Sweden)

    Carolina Emilia Storniolo

    2014-01-01

    Full Text Available Epidemiological and clinical studies have reported that olive oil reduces the incidence of cardiovascular disease. However, the mechanisms involved in this beneficial effect have not been delineated. The endothelium plays an important role in blood pressure regulation through the release of potent vasodilator and vasoconstrictor agents such as nitric oxide (NO and endothelin-1 (ET-1, respectively, events that are disrupted in type 2 diabetes. Extra virgin olive oil contains polyphenols, compounds that exert a biological action on endothelial function. This study analyzes the effects of olive oil polyphenols on endothelial dysfunction using an in vitro model that simulates the conditions of type 2 diabetes. Our findings show that high glucose and linoleic and oleic acids decrease endothelial NO synthase phosphorylation, and consequently intracellular NO levels, and increase ET-1 synthesis by ECV304 cells. These effects may be related to the stimulation of reactive oxygen species production in these experimental conditions. Hydroxytyrosol and the polyphenol extract from extra virgin olive oil partially reversed the above events. Moreover, we observed that high glucose and free fatty acids reduced NO and increased ET-1 levels induced by acetylcholine through the modulation of intracellular calcium concentrations and endothelial NO synthase phosphorylation, events also reverted by hydroxytyrosol and polyphenol extract. Thus, our results suggest a protective effect of olive oil polyphenols on endothelial dysfunction induced by hyperglycemia and free fatty acids.

  19. Hamiltonian purification

    Energy Technology Data Exchange (ETDEWEB)

    Orsucci, Davide [Scuola Normale Superiore, I-56126 Pisa (Italy); Burgarth, Daniel [Department of Mathematics, Aberystwyth University, Aberystwyth SY23 3BZ (United Kingdom); Facchi, Paolo; Pascazio, Saverio [Dipartimento di Fisica and MECENAS, Università di Bari, I-70126 Bari (Italy); INFN, Sezione di Bari, I-70126 Bari (Italy); Nakazato, Hiromichi; Yuasa, Kazuya [Department of Physics, Waseda University, Tokyo 169-8555 (Japan); Giovannetti, Vittorio [NEST, Scuola Normale Superiore and Istituto Nanoscienze-CNR, I-56126 Pisa (Italy)

    2015-12-15

    The problem of Hamiltonian purification introduced by Burgarth et al. [Nat. Commun. 5, 5173 (2014)] is formalized and discussed. Specifically, given a set of non-commuting Hamiltonians (h{sub 1}, …, h{sub m}) operating on a d-dimensional quantum system ℋ{sub d}, the problem consists in identifying a set of commuting Hamiltonians (H{sub 1}, …, H{sub m}) operating on a larger d{sub E}-dimensional system ℋ{sub d{sub E}} which embeds ℋ{sub d} as a proper subspace, such that h{sub j} = PH{sub j}P with P being the projection which allows one to recover ℋ{sub d} from ℋ{sub d{sub E}}. The notions of spanning-set purification and generator purification of an algebra are also introduced and optimal solutions for u(d) are provided.

  20. The Roles of Reactive Oxygen Species and Nitric Oxide in Perfluorooctanoic Acid-Induced Developmental Cardiotoxicity and l-Carnitine Mediated Protection

    Directory of Open Access Journals (Sweden)

    Meng Zhao

    2017-06-01

    Full Text Available Perfluorooctanoic acid (PFOA is an environmental contaminant that could induce developmental cardiotoxicity in a chicken embryo, which may be alleviated by l-carnitine. To explore the roles of reactive oxygen species (ROS and nitric oxide (NO in such changes and the potential effects of l-carnitine, fertile chicken eggs were exposed to PFOA via an air cell injection, with or without l-carnitine co-treatment. The ROS and NO levels in chicken embryo hearts were determined with electron spin resonance (ESR, and the protein levels of the nuclear factor κ-light chain-enhancer of activated B cells (NF-κB p65 and inducible nitric oxide synthase (iNOS in chicken embryo hearts were assessed with western blotting. The results of ESR indicated that PFOA exposure induced an elevation in the ROS levels in ED19 chicken embryo hearts and hatchling chicken hearts, while l-carnitine could alleviate such changes. Meanwhile, increased NO levels were observed in ED19 embryo hearts and hatchling hearts following PFOA exposure, while l-carnitine co-treatment exerted modulatory effects. Western blotting revealed that p65 translocation in ED19 embryo hearts and hatchling hearts was enhanced by PFOA, while l-carnitine co-treatment alleviated such changes. iNOS expression levels in ED19 embryo hearts followed the same pattern as NO levels, while a suppression of expression was observed in hatchling hearts exposed to PFOA. ROS/NF-κB p65 and iNOS/NO seem to be involved in the late stage (ED19 and post hatch of PFOA-induced developmental cardiotoxicity in a chicken embryo. l-carnitine could exert anti-oxidant and NO modulatory effects in the developing chicken embryo hearts, which likely contribute to its cardioprotective effects.

  1. The Roles of Reactive Oxygen Species and Nitric Oxide in Perfluorooctanoic Acid-Induced Developmental Cardiotoxicity and l-Carnitine Mediated Protection.

    Science.gov (United States)

    Zhao, Meng; Jiang, Qixiao; Wang, Wencheng; Geng, Min; Wang, Meng; Han, Yantao; Wang, Chunbo

    2017-06-08

    Perfluorooctanoic acid (PFOA) is an environmental contaminant that could induce developmental cardiotoxicity in a chicken embryo, which may be alleviated by l-carnitine. To explore the roles of reactive oxygen species (ROS) and nitric oxide (NO) in such changes and the potential effects of l-carnitine, fertile chicken eggs were exposed to PFOA via an air cell injection, with or without l-carnitine co-treatment. The ROS and NO levels in chicken embryo hearts were determined with electron spin resonance (ESR), and the protein levels of the nuclear factor κ-light chain-enhancer of activated B cells (NF-κB) p65 and inducible nitric oxide synthase (iNOS) in chicken embryo hearts were assessed with western blotting. The results of ESR indicated that PFOA exposure induced an elevation in the ROS levels in ED19 chicken embryo hearts and hatchling chicken hearts, while l-carnitine could alleviate such changes. Meanwhile, increased NO levels were observed in ED19 embryo hearts and hatchling hearts following PFOA exposure, while l-carnitine co-treatment exerted modulatory effects. Western blotting revealed that p65 translocation in ED19 embryo hearts and hatchling hearts was enhanced by PFOA, while l-carnitine co-treatment alleviated such changes. iNOS expression levels in ED19 embryo hearts followed the same pattern as NO levels, while a suppression of expression was observed in hatchling hearts exposed to PFOA. ROS/NF-κB p65 and iNOS/NO seem to be involved in the late stage (ED19 and post hatch) of PFOA-induced developmental cardiotoxicity in a chicken embryo. l-carnitine could exert anti-oxidant and NO modulatory effects in the developing chicken embryo hearts, which likely contribute to its cardioprotective effects.

  2. Vapor pressures and calculated heats of vaporization of concentrated nitric acid solutions in the composition range 71 to 89 percent nitrogen dioxide, 1 to 10 percent water, and in the temperature range 10 to 60 degrees C

    Science.gov (United States)

    Mckeown, A B; Belles, Frank E

    1954-01-01

    Total vapor pressures were measured for 16 acid mixtures of the ternary system nitric acid, nitrogen dioxide, and water within the temperature range 10 degrees to 60 degrees Celsius, and with the composition range 71 to 89 weight percent nitric acid, 7 to 20 weight percent nitrogen dioxide, and 1 to 10 weight percent water. Heats of vaporization were calculated from the vapor pressure measurements for each sample for the temperatures 25, 40, and 60 degrees Celsius. The ullage of the apparatus used for the measurements was 0.46. Ternary diagrams showing isobars as a function of composition of the system were constructed from experimental and interpolated data for the temperatures 25, 40, 45, and 60 degrees C and are presented herein.

  3. A trans-Hyponitrite Intermediate in the Reductive Coupling and Deoxygenation of Nitric Oxide by a Tricopper-Lewis Acid Complex.

    Science.gov (United States)

    Lionetti, Davide; de Ruiter, Graham; Agapie, Theodor

    2016-04-20

    The reduction of nitric oxide (NO) to nitrous oxide (N2O) is a process relevant to biological chemistry as well as to the abatement of certain environmental pollutants. One of the proposed key intermediates in NO reduction is hyponitrite (N2O2(2-)), the product of reductive coupling of two NO molecules. We report the reductive coupling of NO by an yttrium-tricopper complex generating a trans-hyponitrite moiety supported by two μ-O-bimetallic (Y,Cu) cores, a previously unreported coordination mode. Reaction of the hyponitrite species with Brønsted acids leads to the generation of N2O, demonstrating the viability of the hyponitrite complex as an intermediate in NO reduction to N2O. The additional reducing equivalents stored in each tricopper unit are employed in a subsequent step for N2O reduction to N2, for an overall (partial) conversion of NO to N2. The combination of Lewis acid and multiple redox active metals facilitates this four electron conversion via an isolable hyponitrite intermediate.

  4. Gibberellic acid nitrite stimulates germination of two species of light-requiring seeds via the nitric oxide pathway.

    Science.gov (United States)

    Jovanović, Vladan; Giba, Zlatko; Djoković, Dejan; Milosavljević, Slobodan; Grubisić, Dragoljub; Konjević, Radomir

    2005-06-01

    We used two species of light-requiring seeds, Paulownia tomentosa, which have absolute light requirement (no germination in darkness), and Stellaria media seeds, which germinate in darkness to a certain extent because of presence of preformed active phytochrome, to obtain results strongly suggesting that gibberellic acid nitrite stimulates seed germination via its capability as a functional NO donor. Exogenous application of gibberellic acid nitrite stimulates gibberellin-insensitive Stellaria media seed germination in darkness as do a wide variety of NO donors. Pure gibberellic acid could replace the light requirement of P. tomentosa seeds, thus enabling them to germinate in darkness. Gibberellic acid nitrite did not have this effect. A stimulative effect from gibberellic acid nitrite could be detected only after exposure of these seeds to short, 10 min, pulse of red light. Taken together, these results suggest that gibberellic activity of gibberellic acid nitrite is lost after nitrosation but, regarding to the presence of -O-NO moiety in the molecule, gibberellic acid nitrite shares stimulative properties in seed germination with other compounds with NO-releasing properties.

  5. Fermentative production of poly (γ-glutamic acid) from renewable carbon source and downstream purification through a continuous membrane-integrated hybrid process.

    Science.gov (United States)

    Kumar, Ramesh; Pal, Parimal

    2015-02-01

    Experimental investigations were carried out on continuous and direct production of poly-(γ-glutamic acid) in a hybrid reactor system that integrated conventional fermentative production step with membrane-based downstream separation and purification. Novelty of the integrated system lies in high degree of purity, conversion, yield and productivity of poly-(γ-glutamic acid) through elimination of substrate-product inhibitions of traditional batch production system. This new system is compact, flexible, eco-friendly and largely fouling-free ensuring steady and continuous production of poly-(γ-glutamic acid) directly from a renewable carbon source at the rate of 0.91 g/L/h. Cross-flow microfiltration membrane modules ensured almost complete separation and recycle of cells without much fouling problem. Well-screened ultrafiltration membrane module helped to concentrate poly-(γ-glutamic acid) while ensuring recovery and recycle of 96% unconverted carbon source resulting in yield of 0.6g/g along with high product purity.

  6. Purification of omega-3 polyunsaturated fatty acids from fish oil using silver-thiolate chromatographic material and high performance liquid chromatography.

    Science.gov (United States)

    Dillon, James T; Aponte, José C; Tarozo, Rafael; Huang, Yongsong

    2013-10-18

    Omega-3 polyunsaturated fatty acids (ω-3 PUFAs) have become increasingly popular in dietary supplements worldwide and global demand for higher purity ω-3 PUFAs in clinical applications has been rising rapidly in the recent years. Traditional methods for isolating ω-3 PUFAs however, generally require multiple, cumbersome steps to obtain high purity (>95%) products. In this study, we report an efficient liquid chromatography method for purifying individual omega-3 fatty acid ethyl esters (FAEEs), eicosapentaenoic acid (EPA, C20:5) and docosahexaenoic acid (DHA, C22:6), at >95% purity using a silver(I)-mercaptopropyl stationary phase, otherwise known as silver-thiolate chromatographic material (AgTCM). We demonstrate the key variables controlling separation of FAEEs with a silver(I)-thiolate stationary phase and examine important similarities and differences between silver-thiolate and silver-ion chromatography in regards to the separation mechanism taking place. We demonstrate the separation behavior of FAEEs under various conditions such as mobile phase composition, flow rate and sample injection amount. Purification of EPA and DHA was carried out on an analytical and semi-preparative scale and the resulting purity was determined by GC-FID. We report high attainable purity for EPA (>95%) and DHA (>99%) from a single isocratic separation of fish oil FAEEs within 5-10min using a mobile phase of heptane/acetone (95:5, % v/v). Copyright © 2013 Elsevier B.V. All rights reserved.

  7. Investigation into the structure of natural and regenerated humic-acid of high purity obtained from Hungarian brown coals

    Energy Technology Data Exchange (ETDEWEB)

    Korbuly, J.; Lakatos, B.; Sipos, S.

    1977-01-01

    Examines the purification of natural humic-acids obtained from lignites of Gyongyosvisonta and Varpalota, from brown coal of Dudar and that of regenerated humic-acid arising from the nitric acid treatment of lignite of Varpalota and gives detailed investigation into raw materials, intermediate products and purified humic-acids free of metal traces. On the basis of the average molecular weight, of the molecular weight distribution and of the chemical and physico-chemical characteristics significant structural differences of certain purified humic-acid sample can be experienced. These differences can be explained in case of natural humic-acids by the conditions of coalification and by the circumstances of formation of marsh and in case of regenerated humic-acids by the nitric acid treatment of lignite.

  8. Fatty acid transduction of nitric oxide signaling: multiple nitrated unsaturated fatty acid derivatives exist in human blood and urine and serve as endogenous peroxisome proliferator-activated receptor ligands.

    Science.gov (United States)

    Baker, Paul R S; Lin, Yiming; Schopfer, Francisco J; Woodcock, Steven R; Groeger, Alison L; Batthyany, Carlos; Sweeney, Scott; Long, Marshall H; Iles, Karen E; Baker, Laura M S; Branchaud, Bruce P; Chen, Yuqing E; Freeman, Bruce A

    2005-12-23

    Mass spectrometric analysis of human plasma and urine revealed abundant nitrated derivatives of all principal unsaturated fatty acids. Nitrated palmitoleic, oleic, linoleic, linolenic, arachidonic and eicosapentaenoic acids were detected in concert with their nitrohydroxy derivatives. Two nitroalkene derivatives of the most prevalent fatty acid, oleic acid, were synthesized (9- and 10-nitro-9-cis-octadecenoic acid; OA-NO2), structurally characterized and determined to be identical to OA-NO2 found in plasma, red cells, and urine of healthy humans. These regioisomers of OA-NO2 were quantified in clinical samples using 13C isotope dilution. Plasma free and esterified OA-NO2 concentrations were 619 +/- 52 and 302 +/- 369 nm, respectively, and packed red blood cell free and esterified OA-NO2 was 59 +/- 11 and 155 +/- 65 nm. The OA-NO2 concentration of blood is approximately 50% greater than that of nitrated linoleic acid, with the combined free and esterified blood levels of these two fatty acid derivatives exceeding 1 microm. OA-NO2 is a potent ligand for peroxisome proliferator activated receptors at physiological concentrations. CV-1 cells co-transfected with the luciferase gene under peroxisome proliferator-activated receptor (PPAR) response element regulation, in concert with PPARgamma, PPARalpha, or PPARdelta expression plasmids, showed dose-dependent activation of all PPARs by OA-NO2. PPARgamma showed the greatest response, with significant activation at 100 nm, while PPARalpha and PPARdelta were activated at approximately 300 nm OA-NO2. OA-NO2 also induced PPAR gamma-dependent adipogenesis and deoxyglucose uptake in 3T3-L1 preadipocytes at a potency exceeding nitrolinoleic acid and rivaling synthetic thiazo-lidinediones. These data reveal that nitrated fatty acids comprise a class of nitric oxide-derived, receptor-dependent, cell signaling mediators that act within physiological concentration ranges.

  9. 我国硝酸、硝酸铵行业现状及发展趋势——在2011年硝酸硝铵行业工作会上的讲话%Present Status of Nitric Acid and Ammonium Nitrate Industry in China and Development Trend——A Speech at Working Conference on Nitric Acid and Ammonium Nitrate Industry in 2011

    Institute of Scientific and Technical Information of China (English)

    靳小桂

    2011-01-01

    我国硝酸生产以双加压法工艺为主.2010年,我国硝酸产能9 600 kt,产量7 923 kt(实物量),浓硝酸产量2 356 kt;硝酸铵产能6000 kt,产量4 200 kt.硝酸主要下游产品在今后几年内将保持稳定增长,预计未来5年对硝酸的需求年均增长率为7.7%,至2015年用于工业生产的硝酸量将达3 600 kt;随着我国民爆行业产品升级、化肥复合化率提高、硝基复合肥所占比重增大,对硝酸铵的需求也将有较大增长,至2015年磷酸铵产能将达到10 000 kt/a,需硝酸7 900 kt/a.预计3年内我国硝酸产能将达15 000 kt/a,在淘汰落后产能的条件下,仍将有2 000 kt/a产能富余,为此提出了促进硝酸、硝酸铵行业健康发展的建议.%The production of nitric acid in China is mainly based on the dual pressure process. In 2010 the capacity of nitric acid in China was 9 600 kt, the output 7 923 kt (product), and the output of concentrated nitric acid 2 356 kt. The capacity of ammonium nitrate was 6 000 kt, and its output 4 200 kt. The chief downstream products of nitric acid will continue to grow steadily in the next few years, and it is expected that in the next 5 years the demand for nitric acid will increase by 7. 7% a year on the average. By 2015 nitric acid for industrial production will reach 3 600 kt. With the upgrading of the products from the industry for explosives for civil use, increase in the output of compound fertilizers, and rise in the proportion of nitro compound fertilizers, the demand for ammonium nitrate will grow by a large margin. By 2015 the capacity of ammonium nitrate will attain 10 000 kt/a, requiring 7 900 kt/a of nitric acid. In three years the capacity of nitric acid in China will be 15 000 kt/a. Under the conditions of elimination of backward capacity, there is still a surplus of 2 000 kt/a, so suggestions are proposed for the promotion of the sound development of the nitric acid and ammonium nitrate industry.

  10. Single-reagent one-step procedures for the purification of ovine IgG, F(ab')2 and Fab antivenoms by caprylic acid.

    Science.gov (United States)

    Al-Abdulla, Ibrahim; Casewell, Nicholas R; Landon, John

    2014-01-15

    Antivenoms are typically produced in horses or sheep and often purified using salt precipitation of immunoglobulins or F(ab')2 fragments. Caprylic (octanoic) acid fractionation of antiserum has the advantage of not precipitating the desired antibodies, thereby avoiding potential degradation that can lead to the formation of aggregates, which may be the cause of some adverse reactions to antivenoms. Here we report that when optimising the purification of immunoglobulins from ovine antiserum raised against snake venom, caprylic acid was found to have no effect on the activity of the enzymes pepsin and papain, which are employed in antivenom manufacturing to digest immunoglobulins to obtain F(ab')2 and Fab fragments, respectively. A "single-reagent" method was developed for the production of F(ab')2 antivenom whereby whole ovine antiserum was mixed with both caprylic acid and pepsin and incubated for 4h at 37°C. For ovine Fab antivenom production from whole antiserum, the "single reagent" comprised of caprylic acid, papain and l-cysteine; after incubation at 37°C for 18-20h, iodoacetamide was added to stop the reaction. Caprylic acid facilitated the precipitation of albumin, resulting in a reduced protein load presented to the digestion enzymes, culminating in substantial reductions in processing time. The ovine IgG, F(ab')2 and Fab products obtained using these novel caprylic acid methods were comparable in terms of yield, purity and specific activity to those obtained by multi-step conventional salt fractionation with sodium sulphate.

  11. 萃取净化盐酸法制备磷酸工艺研究%Study of Preparation Phosphoric Acid Process by Extraction and Purification of Hydrochloric Acid Process

    Institute of Scientific and Technical Information of China (English)

    杨站平; 闫小玲; 张树帜; 王长锐

    2014-01-01

    Based on preparation crude phosphoric acid by acid hydrolysis of ground phosphate rocks with hydrochloric acid , using process of combination of tributyl phosphate and kerosene mixed solvent extraction with chemical precipitation process to carry out purification treatment for crude phosphoric acid , after refine , concentration , removal of impurities and decolorization , food grade phosphoric product is obtained . Research results show that mass fraction of prepared product phosphoric acid is 85.2%, all indicators achieved not only meet standard requirements of industrial grade phosphoric acid , but also reach qualifications of food grade phosphoric acid .%以盐酸酸解磷矿粉制得粗磷酸为基础,采用磷酸三丁酯和煤油混合溶剂萃取与化学沉淀法相结合的工艺对粗磷酸进行净化处理,通过精制、浓缩、除杂、脱色后可制得食品级磷酸产品。研究结果表明:试验制得的产品磷酸质量分数为85.2%,各项指标不仅达到了工业级磷酸标准要求,而且达到了食品级磷酸标准要求。

  12. Purification of Peptide Components including Melittin from Bee Venom using gel filtration chromatography and propionic acid/urea polyacrylamide gel electrophoresis

    Directory of Open Access Journals (Sweden)

    Young Chon Choi

    2006-06-01

    Full Text Available Objectives : This study was conducted to carry out Purification of Melittin and other peptide components from Bee Venom using gel filtration chromatography and propionic acid/urea polyacrylamide gel electrophoresis Methods : Melittin and other peptide components were separated from bee venom by using gel filtration chromatography on Sephadex G-50 column in 0.05M ammonium acetate buffer. Results : Melittin and other peptide components were separated from bee venom by using gel filtration chromatography on Sephadex G-50 column in 0.05M ammonium acetate buffer. The fractions obtained from gel filtration chromatography was analyzed by using SDS-PAGE and propionic acid/urea polyacrylamide gel electrophoresis. The melittin obtained from the gel filtration contained residual amount of phospholipase A2 and a protein with molecular weight of 6,000. The contaminating proteins were removed by the second gel filtration chromatography. Conclusion : Gel filtration chromatography and propionic acid/urea polyacrylamide gel electrophoresis are useful to separate peptide components including melittin from bee venom.

  13. Simple preparation of new [(18) F]F-labeled synthetic amino acid derivatives with two click reactions in one-pot and SPE purification.

    Science.gov (United States)

    Yook, Cheol-Min; Lee, Sang Ju; Oh, Seung Jun; Ha, Hyun-Joon; Lee, Jong Jin

    2015-06-30

    New [(18) F]fluorinated 1,2,3-triazolyl amino acid derivatives were efficiently prepared from Huisgen 1,3-dipolar cycloaddition reactions, well known as click reaction. We developed two simultaneous click reactions in one-pot with a simple solid-phase extraction (SPE) purification method. [(18) F]fluoro-1-propyne was obtained at a 45% non-decay corrected radiochemical yield based on the [(18) F]fluoride ion. The one-pot and simultaneous two click reactions were performed with unprotected azido-alkyl amino acid, [(18) F]fluoro-1-propyne, and lipophilic additive alkyne to produce three synthetic amino acid derivatives, AMC-101 ([(18) F]-6a), AMC-102 ([(18) F]-6b), and AMC-103 ([(18) F]-6c) with 29%, 28%, and 24% of non-decay corrected radiochemical yields, respectively. All radiotracers indicated that radiochemical purities were >95% without any residual organic solvent. Our new method involving two click reactions in one-pot showed high radiochemical and chemical purity by easy removal of the residual precursor from the simultaneous two click reactions. Copyright © 2015 John Wiley & Sons, Ltd.

  14. Purification of Two Novel Sugar Acid-binding Lectins from Haplomitrium Mnioides (bryophyte, Plantae) and their Preliminary Characterization.

    Science.gov (United States)

    Masuzaki, Hiroaki; Hosono, Masahiro; Nitta, Kazuo

    2017-01-01

    Two novel sugar acid-binding lectins were purified from Haplomitrium mnioides (Lindb.) Schust. using a procedure consisting of ammonium sulfate precipitation, G-50 gel filtration, hydroxyapatite chromatography, and HW-50 gel filtration. We reported their partial physicochemical properties: molecular weight, affinity for carbohydrates and organic acids, pH stability, and dependence of their hemagglutination activity on metal ions. We also determined their N-terminal amino acid sequences. H. mnioides lectins (HMLs) were monomers (one with a molecular weight of approximately 27 kDa, and the other with a molecular weight of approximately 105 kDa) under both nonreducing and reducing conditions. They were named HML27 and HML105, respectively. Both HMLs had an affinity for N-acetylneuraminic acid, D-glucuronic acid, D-glucaric acid, bovine submaxillary mucin, heparin, and organic acids, such as citrate, 2-oxoglutaric acid, and D-2-hydroxyglutarate. Furthermore, HML27 had an affinity for α-D-galacturonic acid, D-malate, L-malate, and pyruvate, while HML105 had an affinity for D-gluconic acid. HML27 and HML105 are novel plant lectins: they have an affinity for sugar acids and organic acids and specifically recognize the carboxyl group, and there is no homology between their N-terminal amino acid sequences and those of the previously described lectins and agglutinins.

  15. Research on Separation and Purification of Chlorogenic Acid from Extraction of Eucommia Ulmoides%绿原酸的分离纯化工艺研究

    Institute of Scientific and Technical Information of China (English)

    刘畅; 苟建敏; 何珺

    2011-01-01

    The paper aims to study the separation and purification process of Chlorogenic acid from the Extraction of Eucommia ulmoide. Using 15% alcohol-water could wash chlorogenic acid effectively. The PH of the concen trated solution was adjusted to 1 or 2 and was put it in shade for crystallization. The 85% chlorogenic acid crys tals can be obtained by crystallizing in extraction layer, the 97% white needle-like crystals of chlorogenic acid was obtained through recrystallizing rough crystals in methanol-water system. This technique can be used to puri fy the chlorogenic acid of Extraction of Eucommia from 20% to 97% , which suitable for industrial production.%研究从杜仲提取物中分离纯化绿原酸的工艺,确定其分离纯化参数.采用料液比1∶20水超声提取,上聚酰胺柱分离,4BV15%乙醇洗脱,洗脱浓缩液调pH为1-2静置结晶,可得85%以上的绿原酸粗晶,再甲醇重结晶,可得97%绿原酸白色针状晶体.采用此工艺可以将杜仲提取物中绿原酸由20%分离纯化至97%,工艺适合工业化生产.

  16. Efficient Purification of Ginkgolic Acids from Ginkgo biloba Leaves by Selective Adsorption of Fe3O4 Magnetic Nanoparticles

    NARCIS (Netherlands)

    Li, R.; Shen, Y.; Zhang, X.; Ma, M.; Chen, B.; Beek, van T.A.

    2014-01-01

    Ginkgolic acids (GAs; anacardic acids; 6-alkylsalicylic acids) are both unwanted constituents in standardized Ginkgo biloba (Ginkgo) extracts and desirable constituents for pharmacological assays. Thus, for the quality control of Ginkgo extracts, the availability of pure GAs is important. In this in

  17. Efficient Purification of Ginkgolic Acids from Ginkgo biloba Leaves by Selective Adsorption of Fe3O4 Magnetic Nanoparticles

    NARCIS (Netherlands)

    Li, R.; Shen, Y.; Zhang, X.; Ma, M.; Chen, B.; Beek, van T.A.

    2014-01-01

    Ginkgolic acids (GAs; anacardic acids; 6-alkylsalicylic acids) are both unwanted constituents in standardized Ginkgo biloba (Ginkgo) extracts and desirable constituents for pharmacological assays. Thus, for the quality control of Ginkgo extracts, the availability of pure GAs is important. In this in

  18. Reevaluation of JACS code system benchmark analyses of the heterogeneous system. Fuel rods in U+Pu nitric acid solution system

    Energy Technology Data Exchange (ETDEWEB)

    Takada, Tomoyuki; Miyoshi, Yoshinori; Katakura, Jun-ichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2003-03-01

    In order to perform accuracy evaluation of the critical calculation by the combination of multi-group constant library MGCL and 3-dimensional Monte Carlo code KENO-IV among critical safety evaluation code system JACS, benchmark calculation was carried out from 1980 in 1982. Some cases where the neutron multiplication factor calculated in the heterogeneous system in it was less than 0.95 were seen. In this report, it re-calculated by considering the cause about the heterogeneous system of the U+Pu nitric acid solution systems containing the neutron poison shown in JAERI-M 9859. The present study has shown that the k{sub eff} value less than 0.95 given in JAERI-M 9859 is caused by the fact that the water reflector below a cylindrical container was not taken into consideration in the KENO-IV calculation model. By taking into the water reflector, the KENO-IV calculation gives a k{sub eff} value greater than 0.95 and a good agreement with the experiment. (author)

  19. Design and Testing of Lab-scale Red Fuming Nitric Acid/Hydroxyl-terminated Polybutadiene Hybrid Rocket Motor for Studying Regression Rate

    Directory of Open Access Journals (Sweden)

    Sankaran Venugopal

    2011-10-01

    Full Text Available This paper presents the design of a hybrid rocket motor and the experiments carried out for investigation of hybrid combustion and regression rates for a combination of liquid oxidiser red fuming nitric acid with solid fuel hydroxyl-terminated Polybutadiene. The regression rate is enhanced with the addition of small quantity of solid oxidiser ammonium perchlorate in the fuel. The characteristics of the combustion products were calculated using the NASA CEA Code and were used in a ballistic code developed for predicting the performance of the hybrid rocket motor. A lab-scale motor was designed and the oxidiser mass flow requirements of the hybrid motor for the above combination of fuel and oxidiser have been calculated using the developed ballistic code. A static rocket motor testing facility has been realised for conducting the hybrid experiments. A series of tests were conducted and proper ignition with stable combustion in the hybrid mode has been established. The regression rate correlations were obtained as a function of the oxidiser mass flux and chamber pressure from the experiments for the various combinations.Defence Science Journal, 2011, 61(6, pp.515-522, DOI:http://dx.doi.org/10.14429/dsj.61.873

  20. Unravelling the potential of nitric acid as a surface modifier for improving the hemocompatibility of metallocene polyethylene for blood contacting devices

    Science.gov (United States)

    Vellayappan, Muthu Vignesh; Muhamad, Ida Idayu

    2016-01-01

    Design of blood compatible surfaces is obligatory to minimize platelet surface interactions and improve the thromboresistance of foreign surfaces when they are utilized as biomaterials particularly for blood contacting devices. Pure metallocene polyethylene (mPE) and nitric acid (HNO3) treated mPE antithrombogenicity and hydrophilicity were investigated. The contact angle of the mPE treated with HNO3 decreased. Surface of mPE and HNO3 treated mPE investigated with FTIR revealed no major changes in its functional groups. 3D Hirox digital microscopy, SEM and AFM images show increased porosity and surface roughness. Blood coagulation assays prothrombin time (PT) and activated partial thromboplastin time (APTT) were delayed significantly (P hemocompatibility of HNO3 treated mPE. To determine that HNO3 does not deteriorate elastic modulus of mPE, the elastic modulus of mPE and HNO3 treated mPE was compared and the result shows no significant difference. Hence, the overall observation suggests that the novel HNO3 treated mPE may hold great promises to be exploited for blood contacting devices like grafts, catheters, and etc. PMID:26819837

  1. Nitric acid activation of graphite granules to increase the performance of the non-catalyzed oxygen reduction reaction (ORR) for MFC applications

    Energy Technology Data Exchange (ETDEWEB)

    Erable, Benjamin [School of Chemical Engineering and Advanced Materials, Newcastle University, Newcastle upon Tyne - NE1 7RU (United Kingdom); Laboratoire de Genie Chimique, CNRS-Universite de Toulouse, 5 rue Paulin Talabot, BP1301, 31106 Toulouse (France); Duteanu, Narcis [School of Chemical Engineering and Advanced Materials, Newcastle University, Newcastle upon Tyne - NE1 7RU (United Kingdom); Faculty of Industrial Chemistry and Environmental Engineering, University ' ' POLITEHNICA' ' Timisoara, 300006 Timisoara (Romania); Kumar, S.M. Senthil; Scott, Keith [School of Chemical Engineering and Advanced Materials, Newcastle University, Newcastle upon Tyne - NE1 7RU (United Kingdom); Feng, Yujie [State Key Laboratory of Urban Water Resource and Environment, Harbin Institute of Technology, No. 202, Haihe Road, Harbin 150090 (China); Ghangrekar, Makarand M. [School of Chemical Engineering and Advanced Materials, Newcastle University, Newcastle upon Tyne - NE1 7RU (United Kingdom); Department of Civil Engineering, Indian Institute of Technology, Kharagpur - 721302 (India)

    2009-07-15

    Nitric acid and thermal activation of graphite granules were explored to increase the electrocatalytic performance of dissolved oxygen reduction at neutral pH for microbial fuel cell (MFC) applications. Electrochemical experiments showed an improvement of +400 mV in open circuit potential for graphite granules when they were activated. The improvement of ORR performance observed with activated granules was correlated to the increase of Brunauer-Emmett-Teller (BET) surface of the activated material and the emergence of nitrogen superficial groups revealed by X-ray photoelectron spectroscopy (XPS) analysis on its surface. The use of activated graphite granules in the cathodic compartment of a dual-chamber MFC led to a high open circuit voltage of 1050 mV, which is among one of the highest reported so far. The stable performance of this cathode material (current density of 96 A m{sup -3} at +200 mV/Ag-AgCl) over a period of 10 days demonstrated its applicability as a cathode material without any costly noble metal. (author)

  2. The effect of heating temperature and nitric acid treatments on the performance of Cu- and Zn-based broad spectrum respirator carbons.

    Science.gov (United States)

    Smith, J W H; Romero, J V; Dahn, T R; Dunphy, K; Sullivan, B; Mallay, M; Croll, L M; Reynolds, J H; Andress, C; Dahn, J R

    2011-12-01

    Impregnated activated carbons (IACs) that are used in broad spectrum gas mask applications have historically contained copper and/or zinc impregnants. The addition of an oxidizing agent, such as nitric acid (HNO(3)) can be useful in distributing the metallic impregnants uniformly on the activated carbon substrate. In this work, we study IACs prepared from copper nitrate (Cu(NO(3))(2)) and zinc nitrate (Zn(NO(3))(2)) precursors as a function of HNO(3) content present in the impregnating solution and as a function of heating temperature. The gas adsorption capacity of the IACs was determined by dynamic flow testing using sulfur dioxide (SO(2)), ammonia (NH(3)), hydrogen cyanide (HCN) and cyclohexane (C(6)H(12)) challenge gases under dry and humid conditions. The thermal decomposition and distribution of the impregnant on the activated carbon substrate is studied using X-ray diffraction (XRD), scanning electron microscopy (SEM) and thermal analysis techniques. Relationships between gas adsorption capacity, impregnant distribution and the species of surface impregnants are discussed.

  3. Solubility of PdI/sub 2/ in nitrate and perchlorate solutions. [For use in spent fuels processing; solvents are water, nitric acid, calcium nitrate, and sodium perchlorate

    Energy Technology Data Exchange (ETDEWEB)

    Horner, D.E.; Mailen, J.C.; Bigelow, H.R.

    1976-01-01

    This paper reports the solubilities of PdI/sub 2/ as measured in nitric acid by a tracer technique and in water, calcium nitrate, and sodium perchlorate solutions by a specific ion electrode technique. The tracer technique measures all the soluble iodine species, whereas the specific ion electrode measures only simple iodide ions (I/sup -/). When compared on the basis of ionic strength, the values obtained in the nitrate solutions by the two methods were in reasonable agreement. The solubilities in perchlorate solution were much higher than in nitrate, possibly because of ionic equilibria involving Pd/sup 4 +/, but this was not resolved in this work. The activity product constant, K/sub ap(PdI/sub 2/)/ = (2.5 +- 0.4) x 10/sup -23/ (25/sup 0/C), was calculated from PdI/sub 2/ solubility in water. With this value and the standard electrode potentials from the literature, the free energy of formation for PdI/sub 2/ was calculated to be --13.6 kcal/mol.

  4. Nitric oxide suppresses the inhibitory effect of abscisic acid on seed germination by S-nitrosylation of SnRK2 proteins.

    Science.gov (United States)

    Wang, Pengcheng; Zhu, Jian-Kang; Lang, Zhaobo

    2015-01-01

    Nitric oxide (NO) plays important roles in plant development, and biotic and abiotic stress responses. In a recent study, we showed that endogenous NO negatively regulates abscisic acid (ABA) signaling in guard cells by inhibiting sucrose nonfermenting 1 (SNF1)-related protein kinase 2.6 (SnRK2.6)/open stomata 1(OST1) through S-nitrosylation. Application of NO breaks seed dormancy and alleviates the inhibitory effect of ABA on seed germination and early seedling growth, but it is unclear how NO functions at the stages of seed germination and early seedling development. Here, we show that like SnRK2.6, SnRK2.2 can be inactivated by S-nitrosoglutathione (GSNO) treatment through S-nitrosylation. SnRK2.2 and the closely related SnRK2.3 are known to play redundant roles in ABA inhibition of seed germination in Arabidopsis. We found that treatment with the NO donor SNP phenocopies the snrk2.2snrk2.3 double mutant in conferring ABA insensitivity at the stages of seed germination and early seedling growth. Our results suggest that NO negatively regulates ABA signaling in germination and early seedling growth through S-nitrosylation of SnRK2.2 and SnRK2.3.

  5. Techno-Economic Feasibility Study of Renewable Power Systems for a Small-Scale Plasma-Assisted Nitric Acid Plant in Africa

    Directory of Open Access Journals (Sweden)

    Aikaterini Anastasopoulou

    2016-12-01

    Full Text Available The expected world population growth by 2050 is likely to pose great challenges in the global food demand and, in turn, in the fertilizer consumption. The Food and Agricultural Organization of the United Nations has forecasted that 46% of this projected growth will be attributed to Africa. This, in turn, raises further concerns about the sustainability of Africa’s contemporary fertilizer production, considering also its high dependence on fertilizer imports. Based on these facts, a novel “green” route for the synthesis of fertilizers has been considered in the context of the African agriculture by means of plasma technology. More precisely, a techno-economic feasibility study has been conducted for a small-scale plasma-assisted nitric acid plant located in Kenya and South Africa with respect to the electricity provision by renewable energy sources. In this study, standalone solar and wind power systems, as well as a hybrid system, have been assessed for two different electricity loads against certain economic criteria. The relevant simulations have been carried out in HOMER software and the optimized configurations of each examined renewable power system are presented in this study.

  6. Photosynthetic and antioxidant responses of Liquidambar formosana and Schima superba seedlings to sulfuric-rich and nitric-rich simulated acid rain.

    Science.gov (United States)

    Chen, Juan; Wang, Wen-Hua; Liu, Ting-Wu; Wu, Fei-Hua; Zheng, Hai-Lei

    2013-03-01

    To study whether differential responses occur in photosynthesis and antioxidant system for seedlings of Liquidambar formosana, an acid rain (AR)-sensitive tree species and Schima superba, an AR-tolerant tree species treated with three types of pH 3.0 simulated AR (SiAR) including sulfuric-rich (S-SiAR), nitric-rich (N-SiAR), sulfate and nitrate mixed (SN-SiAR), we investigated the changes of leaf necrosis, chlorophyll content, soluble protein and proline content, photosynthesis and chlorophyll fluorescence characteristics, reactive oxygen species production, membrane lipid peroxidation, small molecular antioxidant content, antioxidant enzyme activities and related protein expressions. Our results showed that SiAR significantly caused leaf necrosis, inhibited photosynthesis, induced superoxide radical and hydrogen peroxide generation, aggravated membrane lipid peroxidation, changed antioxidant enzyme activities, modified related protein expressions such as Cu/Zn superoxide dismutase (SOD), l-ascorbate peroxidase (APX, EC 1. 11. 1. 11), glutathione S transferase (GST, EC 2. 5. 1. 18) and Rubisco large subunit (RuBISCO LSU), altered non-protein thiols (NPT) and glutathione (GSH) content in leaves of L. formosana and S. superba. Taken together, we concluded that the damages caused by SiAR in L. formosana were more severe and suffered from more negative impacts than in S. superba. S-SiAR induced more serious damages for the plants than did SN-SiAR and N-SiAR.

  7. NITRIC OXIDE-ASSOCIATED PROTEIN1 (AtNOA1) is essential for salicylic acid-induced root waving in Arabidopsis thaliana.

    Science.gov (United States)

    Zhao, Xiang; Wang, Jin; Yuan, Jing; Wang, Xi-Li; Zhao, Qing-Ping; Kong, Pei-Tao; Zhang, Xiao

    2015-07-01

    Root waving responses have been attributed to both environmental and genetics factors, but the potential inducers and transducers of root waving remain elusive. Thus, the identification of novel signal elements related to root waving is an intriguing field of research. Genetic, physiological, cytological, live cell imaging, and pharmacological approaches provide strong evidence for the involvement of Arabidopsis thaliana NITRIC OXIDE-ASSOCIATED PROTEIN1 (AtNOA1) in salicylic acid (SA)-induced root waving. SA specially induced root waving, with an overall decrease in root elongation in A. thaliana, and this SA-induced response was disrupted in the Atnoa1 mutant, as well as in nonexpresser of pathogenesis-related genes 1 (npr1), which is defective in SA-mediated plant defense signal transduction, but not in npr3/4 single and double mutants. The expression assays revealed that the abundance of AtNOA1 was significantly increased by application of SA. Genetic and pharmacological analyses showed that SA-induced root waving involved an AtNOA1-dependent Ca(2+) signal transduction pathway, and PIN-FORMED2 (PIN2) -based polar auxin transport possibly plays a crucial role in this process. Our work suggests that SA signaling through NPR1 and AtNOA1 is involved in the control of root waving, which provides new insights into the mechanisms that control root growth behavior on a hard agar surface.

  8. Polonium purification

    Energy Technology Data Exchange (ETDEWEB)

    Baker, J.D.

    1996-09-01

    Three processes for the purification of {sup 210}Po from irradiated bismuth targets are described. Safety equipment includes shielded hotcells for the initial separation from other activation products, gloveboxes for handling the volatile and highly toxic materials, and provisions for ventilation. All chemical separations must be performed under vacuum or in inerted systems. Two of the processes require large amounts of electricity; the third requires vessels made from exotic materials.

  9. A pulse radiolysis investigation of the reactions of tributyl phosphate with the radical products of aqueous nitric acid irradiation.

    Science.gov (United States)

    Mincher, Bruce J; Mezyk, Stephen P; Martin, Leigh R

    2008-07-17

    Tributyl phosphate (TBP) is the most common organic compound used in liquid-liquid separations for the recovery of uranium, neptunium, and plutonium from acidic nuclear fuel dissolutions. The goal of these processes is to extract the actinides while leaving fission products in the acidic, aqueous phase. However, the radiolytic degradation of TBP has been shown to reduce separation factors of the actinides from fission products and to impede the back-extraction of the actinides during stripping. As most previous investigations of the radiation chemistry of TBP have focused on steady state radiolysis and stable product identification, with dibutylphosphoric acid (HDBP) invariably being the major product, here we have determined room temperature rate constants for the reactions of TBP and HDBP with the hydroxyl radical [(5.00 +/- 0.05) x 10(9), (4.40 +/- 0.13) x 10(9) M(-1) s(-1)], hydrogen atom [(1.8 +/-0.2) x 10(8), (1.1 +/- 0.1) x 10(8) M(-1) s(-1)], nitrate radical [(4.3 +/- 0.7) x 10(6), (2.9 +/- 0.2) x 10(6) M(-1) s(-1)], and nitrite radical (<2 x 10 (5), <2 x 10(5) M(-1) s(-1)), respectively. These data are used to discuss the mechanism of TBP radical-induced degradation.

  10. Nitric oxide mediates the fungal elicitor-induced puerarin biosynthesis in Pueraria thomsonii Benth. suspension cells through a salicylic acid (SA)-dependent and a jasmonic acid (JA)-dependent signal pathway

    Institute of Scientific and Technical Information of China (English)

    XU Maojun; DONG Jufang; ZHU Muyuan

    2006-01-01

    Nitric oxide (NO) has emerged as a key signaling molecule in plant secondary metabolite biosynthesis recently. In order to investigate the molecular basis of NO signaling in elicitor-induced secondary metabolite biosynthesis of plant cells, we determined the contents of NO, salicylic acid (SA), jasmonic acid (JA), and puerarin in Pueraria thomsonii Benth. suspension cells treated with the elicitors prepared from cell walls of Penicillium citrinum. The results showed that the fungal elicitor induced NO burst, SA accumulation and puerarin production of P. thomsonii Benth. cells. The elicitor-induced SA accumulation and puerarin production was suppressed by nitric oxide specific scavenger cPITO, indicating that NO was essential for elicitor-induced SA and puerarin biosynthesis in P. thomsonii Benth. cells. In transgenic NahG P. thomsonii Benth. cells, the fungal elicitor also induced puerarin biosynthesis, NO burst, and JA accumulation, though the SA biosynthesis was impaired. The elicitor-induced JA accumulation in transgenic cells was blocked by cPITO, which suggested that JA acted downstream of NO and its biosynthesis was controlled by NO. External application of NO via its donor sodium nitroprusside (SNP) enhanced puerarin biosynthesis in transgenic NahG P. thomsonii Benth. cells, and the NO-triggered puerarin biosynthesis was suppressed by JA inhibitors IBU and NDGA, which indicated that NO induced puerarin production through a JA-dependent signal pathway in the transgenic cells. Exogenous application of SA suppressed the elicitor-induced JA biosynthesis and reversed the inhibition of IBU and NDGA on elicitor-induced puerarin accumulation in transgenic cells, which indicated that SA inhibited JA biosynthesis in the cells and that SA might be used as a substitute for JA to mediate the elicitor- and NO-induced puerarin biosynthesis. It was, therefore, concluded that NO might mediate the elicitor-induced puerarin biosynthesis through SA- and JA-dependent signal

  11. DNA fragmentation dynamics allows the assessment of cryptic sperm damage in human: Evaluation of exposure to ionizing radiation, hyperthermia, acidic pH and nitric oxide

    Energy Technology Data Exchange (ETDEWEB)

    Santiso, Rebeca; Tamayo, Maria [Laboratorio de Genetica Molecular y Radiobiologia, Centro Oncologico de Galicia, Doctor Camilo Veiras 1, 15009-A Coruna (Spain); Genetics Unit, INIBIC-Complejo Hospitalario Universitario A Coruna (CHUAC), As Xubias, 84, 15006-A Coruna (Spain); Gosalvez, Jaime [Genetics Unit, Facultad de Biologia, Universidad Autonoma de Madrid, Ciudad Universitaria de Cantoblanco, 28049 Madrid (Spain); Johnston, Steve [School of Agriculture and Food Science, University of Queensland, Gatton 4343 (Australia); Marino, Alfonso [Servicio de Oncologia Radioterapica, Centro Oncologico de Galicia, Doctor Camilo Veiras 1, 15009-A Coruna (Spain); Fernandez, Carlos; Losada, Carlos [Servicio de Radiofisica, Centro Oncologico de Galicia, Doctor Camilo Veiras 1, 15009-A Coruna (Spain); Fernandez, Jose Luis, E-mail: Jose.Luis.Fernandez.Garcia@sergas.es [Laboratorio de Genetica Molecular y Radiobiologia, Centro Oncologico de Galicia, Doctor Camilo Veiras 1, 15009-A Coruna (Spain); Genetics Unit, INIBIC-Complejo Hospitalario Universitario A Coruna (CHUAC), As Xubias, 84, 15006-A Coruna (Spain)

    2012-06-01

    Sperm DNA fragmentation (SDF) is not a static seminal parameter, since the longevity of sperm DNA decreases progressively with time following ejaculation or thawing. While the dynamics of SDF is a species-specific characteristic, in the case of humans, there is still significant variation within patients. To evaluate the suitability of the dynamic SDF assay to assess the adverse effects of agents that cause genetic damage, fresh semen samples from different donors were exposed in vitro to (1) increasing acute doses of ionizing radiation, (2) elevated temperature (41 Degree-Sign C and 45 Degree-Sign C), (3) acidic pH (pH 4) and (4) the nitric oxide (NO) donor sodium nitroprusside (SNP). Sperm DNA fragmentation was analyzed after an incubation period of chronic (24 h), or acute (1 h) exposure to each treatment followed by incubation at 37 Degree-Sign C over a period of 24 h. SDF was assessed using the sperm chromatin dispersion (SCD) test. Dynamic SDF for each treatment was analyzed using Kaplan-Meier survival curves. All agents, except for ionizing radiation, accelerated SDF kinetics following chronic exposure over a 24 h period. Transient exposure to NO and heat but not acidic pH increased the basal (T0) level of SDF. Despite the removal of the three toxicants, the remaining sperm following acute exposure showed a decrease in their expected DNA longevity. It is concluded that the assessment of sperm DNA fragmentation dynamics is an effective methodological approach for revealing latent damage associated with toxicants that is not initially expressed following a single initial observation of SDF.

  12. 硝酸浸取磷矿制轻质碳酸钙工艺研究%Preparation of light calcium carbonate by nitric acid leaching phosphate ore

    Institute of Scientific and Technical Information of China (English)

    胡兆平; 贾洪秀; 庞世花; 刘阳; 贾亮

    2013-01-01

    Calcium nitrate crystal can be obtained by freezing crystallization method from acid solution acquired from nitric acid extracting phosphate rock.After that,light calcium carbonate was prepared by carbonization reaction between ammonium hydrogen carbonate and calcium nitrate crystal.Results show that,the initial carbonization reaction temperature was the normal temperature,mass fraction of calcium nitrate solution was about 23%,ammonium hydrogen carbonate and ammonia dosages were both 110% of theoretical addition amounts,and products were washed by four times of product weight washing water.All quality indexes of the product can meet the standard of Industrial Precipitated Calcium Carbonate,HG/T 2226-2000.%硝酸萃取磷矿后的酸解液,通过冷冻结晶法得到硝酸钙晶体,然后以硝酸钙为原料,通过加入碳酸氢铵进行碳化制取轻质碳酸钙.结果表明,碳化反应的初始反应温度为常温,硝酸钙溶液的质量分数为23%左右,碳酸氢铵和氨水按理论加入量的110%进行反应,用产品质量的4倍洗水量洗涤产品,制备的轻质碳酸钙产品各项指标均达到HG/T 2226-2000《工业沉淀碳酸钙》标准的要求.

  13. COPPER AMINE OXIDASE1 (CuA01)of Arabidopsis thaliana Contributes to Abscisic Acid-and Polyamine-Induced Nitric Oxide Biosynthesis and Abscisic Acid Signal Transduction

    Institute of Scientific and Technical Information of China (English)

    Rinukshi Wimalasekera; Corina Villar; Tahmina Begum; Günther F. E. Scherer

    2011-01-01

    Polyamines (PA), polyamine oxidases, copper amine oxidases, and nitric oxide (NO)play important roles in physiology and stress responses in plants. NO biosynthesis as a result of catabolism of PA by polyamine oxidases and copper amine oxidases may explain in part PA-mediated responses. Involvement of a copper amine oxidase gene, COPPER AMINE OXIDASE1 (CuA01), of Arabidopsis was tested for its role in stress responses using the knockouts cuaol.1 and cuaol-2. PA-induced and ABA-induced NO production investigated by fluorometry and fluorescence microscopy showed that the cuaol-1 and cuaol-2 are impaired in NO production, suggesting a function of CuAO1 in PA and ABA-mediated NO production. Furthermore, we found a PA-dependent increase in protein S-nitrosylation. The addition of PA and ABA also resulted in HO increases, cuaol-1 and cuaol-2 showed less sensitivity to exogenous ABA supplementation during ger-mination, seedling establishment, and root growth inhibition as compared to wild-type. In response to ABA treatment,expression levels of the stress-responsive genes RD29A and ADH1 were significantly lower in the knockouts. These obser-vations characterize cuaol-1 and cuaol-2 as ABA-insensitive mutants. Taken together, our findings extend the ABA signal transduction network to include CuAO1 as one potential contributor to enhanced NO production by ABA.

  14. Effects of a New Glutamic Acid Derivative on Myocardial Contractility of Stressed Animals under Conditions of Nitric Oxide Synthesis Blockade.

    Science.gov (United States)

    Tyurenkov, I N; Perfilova, V N; Sadikova, N V; Berestovitskaya, V M; Vasil'eva, O S

    2015-07-01

    Glufimet (glutamic acid derivative) in a dose of 28.7 mg/kg limited the reduction of the cardiac functional reserve in animals subjected to 24-h stress under conditions of nonselective NO synthase blockade with L-NAME (10 mg/kg). Adrenoreactivity and increased afterload tests showed that the increment of myocardial contraction/relaxation rates, left-ventricular pressure, and HR were significantly higher in glufimet-treated stressed animals with NO synthesis blockade than in animals which received no glufimet. The efficiency of glufimet was higher than that of phenibut (the reference drug).

  15. Quantitative study on water purification capability of permeable breakwaters; Tokasei joka bohatei no suishitsu joka kino no teiryoteki chosa kenkyu

    Energy Technology Data Exchange (ETDEWEB)

    Onishi, M.; Hatamochi, K. [The Kansai Electric Power Co. Inc., Osaka (Japan)

    1997-01-31

    Purification of seawater by interstitial microorganisms and sessile organisms in breakwaters and seawalls made of gravel was investigated. For the experiment, water purification test was conducted using skim milk and phyto-plankton causing red tide by crushed stones having biological coatings formed with natural seawater. Continuous test of seawater near the intake of power generation plant was also conducted. As a result, the interstitial contact oxidation method provided an effect for lowering COD (chemical oxygen demand) levels and reducing SS (suspended solids) in the seawater. It was found that COD can be more easily purified with suspension than in dissolved state. It was considered that COD was caught on the gravel surface to be decomposed biologically. It was also considered that nitrogen was decomposed to nitric acid by nitration. For the simulated gravel breakwater with an area 200{times}400 m in the model sea, purification effect from 0.1 to 0.4 mg/liter was evaluated through biological decomposition near the breakwater, and purification capacity from 3 to 4.5 t/day was calculated. 3 refs., 13 figs., 4 tabs.

  16. Methods of analysis by the U.S. Geological Survey National Water Quality Laboratory; comparison of a nitric acid in-bottle digestion procedure to other whole-water digestion procedures

    Science.gov (United States)

    Garbarino, John R.; Hoffman, Gerald L.

    1999-01-01

    A hydrochloric acid in-bottle digestion procedure is used to partially digest wholewater samples prior to determining recoverable elements by various analytical methods. The use of hydrochloric acid is problematic for some methods of analysis because of spectral interference. The inbottle digestion procedure has been modified to eliminate such interference by using nitric acid instead of hydrochloric acid in the digestion. Implications of this modification are evaluated by comparing results for a series of synthetic whole-water samples. Results are also compared with those obtained by using U.S. Environmental Protection Agency (1994) (USEPA) Method 200.2 total-recoverable digestion procedure. Percentage yields that use the nitric acid inbottle digestion procedure are within 10 percent of the hydrochloric acid in-bottle yields for 25 of the 26 elements determined in two of the three synthetic whole-water samples tested. Differences in percentage yields for the third synthetic whole-water sample were greater than 10 percent for 16 of the 26 elements determined. The USEPA method was the most rigorous for solubilizing elements from particulate matter in all three synthetic whole-water samples. Nevertheless, the variability in the percentage yield by using the USEPA digestion procedure was generally greater than the in-bottle digestion procedure, presumably because of the difficulty in controlling the digestion conditions accurately.

  17. Active-Site Models of Bacterial Nitric Oxide Reductase Featuring Tris-Histidyl and Glutamic Acid Mimics: Influence of Carboxylate Ligand on FeB Binding and Heme Fe/FeB Redox Potential

    Science.gov (United States)

    Collman, James P.; Yan, Yi-Long; Lei, Jianping; Dinolfo, Peter H.

    2008-01-01

    Active-site models of bacterial nitric oxide reductase (NOR) featuring a heme iron and a trisimidazole and a glutaric acid-bound non-heme iron (FeB) have been synthesized. These models closely replicate the proposed active site of native NORs. Examination of these models shows that the glutamic acid mimic is required for both FeB retention in the distal binding site and proper modulation of the redox potentials of both the heme and non-heme irons. PMID:16961346

  18. Toward Radiocarbon Measurement of Individual Amino Acids in Marine Dissolved Organic Matter (DOM): Δ14C Blank Quantification for an HPLC Purification Method.

    Science.gov (United States)

    Bour, A. L.; Broek, T.; Walker, B. D.; Mccarthy, M. D.

    2014-12-01

    The presence of much of the marine dissolved organic nitrogen (DON) pool as uncharacterized, biologically recalcitrant molecules is a central mystery in the marine nitrogen cycle. Radiocarbon (Δ14C) isotopic measurements have been perhaps the most important data constraining the cycling of dissolved organic matter (DOM), but little Δ14C data specific to DON is available. Amino acids (AAs) are the major component of DON that can be isolated on a molecular level. Δ14C measurements for the operational "protein-like" fraction of DOM in the deep ocean indicate that this compound class has radiocarbon ages greater than several ocean mixing cycles, suggesting remarkable preservation of labile AAs exported from the surface. However, it is possible that the previously defined operational "protein-like" fraction may also contain non-AA material. Radiocarbon measurement of purified individual AAs would provide a more direct and reliable proxy for DON Δ14C age and cycling rate. We present here Δ14C blank characterization of an AA purification method based on HPLC, with on-line fraction collection. This method allows the recovery of unmodified AAs, but accurate measurement of small AA samples that can be extracted from DOM requires a system with extremely low Δ 14C blanks. Here we assess the impact of HPLC purification on the Δ14C age of known amino acids standards. Individual AA standards with contrasting (modern vs. dead) and well- characterized Δ14C ages were processed in a range of sample sizes. The eluted peaks were collected and dried, and measurement of their post-chromatography Δ14C content allowed for determination of the Δ14C blank by method of additions. The same protocol was applied to a mixture of six AA standards, to evaluate tailing effects in consecutive AA peaks of contrasting Δ14C age. AA standards were selected to include both Δ14C modern and dead AAs that elute both early and late in the chromatographic solvent program. We discuss implications

  19. Characteristic and mechanism of Th{sup 4+} sorption from nitric acid solutions by rice and wheat bran

    Energy Technology Data Exchange (ETDEWEB)

    Monji, Akbar Boveiri [Kharazmi Univ., Tehran (Iran, Islamic Republic of). Faculty of Chemistry; Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Ghoulipour, Vanik [Kharazmi Univ., Tehran (Iran, Islamic Republic of). Faculty of Chemistry; Mallah, Mohammad Hassan [Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of)

    2015-07-01

    In line with our previously conducted researches, various instrumental methods were applied to evaluate the adsorption features and mechanism of Th{sup 4+} from highly acidic solution (4M HNO{sub 3}) by rice and wheat bran. Although the results of cation exchange confirmed the existence of ion-exchange interaction in Th{sup 4+} adsorption, it had a trivial contribution in the biosorption process. The presence of Th{sup 4+} ions on the biomass surface was obviously revealed in SEM images and EDS elemental analysis. Moreover, the linkage of C=O, O-H and N-H functional groups on the biomass surface with Th{sup 4+} ions was clearly represented in the ATR-FTIR spectroscopic analysis. Additionally, desorption studies indicated that ammonium oxalate (>81.3%) and ammonium carbonate (>75.4%) were effective in desorbing Th{sup 4+} from the biomass surface due to strong interactions of hard functional groups of C=O with Th{sup 4+}. The overall observations unfold the fact that electrostatic complexation mechanism is dominant between biomass and Th{sup 4+} ions.

  20. 稀土氟化物在硝酸中溶解性质的研究%Solubility of rare earth fluorides in nitric acid

    Institute of Scientific and Technical Information of China (English)

    仇婷婷; 彭佳; 何淑华; 郑小北; 刘玉侠; 周伟; 张岚

    2015-01-01

    Background: A varity of rare-earth fluorides can be produced with thorium uranium fuel circulating post-processing. These fluorides need to be dissolubled in solvent for seperation and contents measurement.Purpose: This paper aims to develop a fast and efficient pretreatment method to dissolve slightly soluble rare earth fluorides in nitric acid.Methods: Rare earth fluorides related to the thorium molten salt reactor (TMSR) fuel circulating post-processing including NdF3, EuF3, GdF3 and CeF3 were studied by using Inductively Coupled Plasma Atomic Emission Spectrometry (ICP-AES). After 2-h microwave digestion at temperature of 190 ºC, the maximum solubility of these fluorides in 10 mL nitric acid (16 mol·L−1) is determined by ICP-AES.Results: The saturated concentration varies from 2.5 g·L−1 to 3.9g·L−1, which are two or three orders of magnitude higher than their solubility reported in previous literature. The standard deviation (n=3) of measurement by ICP-AES is under 4.2% and the linear correlation coefficient (r) is in the range of 0.999 47−0.999 96.Conclusion:An efficient chemical procedure for dissolving some rare earth fluorides has been developed. It provides a reference for pretreatment of insoluble rare earth fluorides in the solid molten salt samples of thorium uranium fuel circulating post-processing.%采用微波消解-电感耦合等离子体原子发射光谱(Inductively Coupled Plasma Atomic Emission Spectroscopy, ICP-AES),系统研究了钍铀燃料循环后处理中4种典型稀土氟化物(NdF3、EuF3、GdF3、CeF3)在硝酸中的溶解性质。结果表明,在10 mL、浓度为16 mol·L−1的硝酸中,微波消解2 h,190ºC下,4种稀土氟化物的最大溶解量可达2.5−3.9 g·L−1,均比文献报道的数值高2−3个数量级;采用ICP-AES测试溶解液,线性范围0.99947−0.99996,标准偏差SD≤4.2%(n=3),该溶解方法旨在为核燃料后处理流程中含有难溶稀土氟

  1. Intracerebroventricular administration of Shiga toxin type 2 altered the expression levels of neuronal nitric oxide synthase and glial fibrillary acidic protein in rat brains.

    Science.gov (United States)

    Boccoli, Javier; Loidl, C Fabián; Lopez-Costa, Juan José; Creydt, Virginia Pistone; Ibarra, Cristina; Goldstein, Jorge

    2008-09-16

    Shiga toxin (Stx) from enterohemorrhagic Escherichia coli (STEC) is the main cause of hemorrhagic colitis which may derive into Hemolytic Uremic Syndrome (HUS) and acute encephalopathy, one of the major risk factors for infant death caused by the toxin. We have previously demonstrated that intracerebroventricular administration of Stx2 causes neuronal death and glial cell damage in rat brains. In the present work, we observed that the intracerebroventricular administration of Stx2 increased the expression of glial fibrillary acidic protein (GFAP) leading to astrogliosis. Confocal microscopy showed reactive astrocytes in contact with Stx2-containing neurons. Immunocolocalization of increased GFAP and Stx2 in astrocytes was also observed. This insult in the brain was correlated with changes in the expression and activity of neuronal nitric oxide synthase (nNOS) by using the NADPH-diaphorase histochemical technique (NADPH-d HT). A significant decrease in NOS/NADPH-d-positive neurons and NOS/NADPH-d activity was observed in cerebral cortex and striatum, whereas an opposite effect was found in the hypothalamic paraventricular nucleus. We concluded that the i.c.v. administration of Stx2 promotes a typical pattern of brain injury showing reactive astrocytes and an alteration in the number and activity of nNOS/NADPH-d. According to the functional state of nNOS/NADPH-d and to brain cell morphology data, it could be inferred that the i.c.v. administration of Stx2 leads to either a neurodegenerative or a neuroprotective mechanism in the affected brain areas. The present animal model resembles the encephalopathy developed in Hemolytic Uremic Syndrome (HUS) patients by STEC intoxication.

  2. The poly-γ-d-glutamic acid capsule surrogate of the Bacillus anthracis capsule induces nitric oxide production via the platelet activating factor receptor signaling pathway.

    Science.gov (United States)

    Lee, Hae-Ri; Jeon, Jun Ho; Park, Ok-Kyu; Chun, Jeong-Hoon; Park, Jungchan; Rhie, Gi-Eun

    2015-12-01

    The poly-γ-d-glutamic acid (PGA) capsule, a major virulence factor of Bacillus anthracis, confers protection of the bacillus from phagocytosis and allows its unimpeded growth in the host. PGA capsules released from B. anthracis are associated with lethal toxin in the blood of experimentally infected animals and enhance the cytotoxic effect of lethal toxin on macrophages. In addition, PGA capsule itself activates macrophages and dendritic cells to produce proinflammatory cytokine such as IL-1β, indicating multiple roles of PGA capsule in anthrax pathogenesis. Here we report that PGA capsule of Bacillus licheniformis, a surrogate of B. anthracis capsule, induces production of nitric oxide (NO) in RAW264.7 cells and bone marrow-derived macrophages. NO production was induced by PGA in a dose-dependent manner and was markedly reduced by inhibitors of inducible NO synthase (iNOS), suggesting iNOS-dependent production of NO. Induction of NO production by PGA was not observed in macrophages from TLR2-deficient mice and was also substantially inhibited in RAW264.7 cells by pretreatment of TLR2 blocking antibody. Subsequently, the downstream signaling events such as ERK, JNK and p38 of MAPK pathways as well as NF-κB activation were required for PGA-induced NO production. In addition, the induced NO production was significantly suppressed by treatment with antagonists of platelet activating factor receptor (PAFR) or PAFR siRNA, and mediated through PAFR/Jak2/STAT-1 signaling pathway. These findings suggest that PGA capsule induces NO production in macrophages by triggering both TLR2 and PAFR signaling pathways which lead to activation of NF-kB and STAT-1, respectively.

  3. Whole Atmosphere Community Climate Model With Lower Ionospheric Chemistry: Improved Modeling of Nitric Acid and Active Chlorine During Energetic Particle Precipitation

    Science.gov (United States)

    Verronen, P. T.; Andersson, M. E.; Marsh, D. R.; Kovacs, T.; Plane, J. M. C.; Päivärinta, S. M.

    2016-12-01

    Energetic particle precipitation (EPP) and ion chemistry affect the neutral composition of the polar middle atmosphere. For example, production of odd nitrogen and odd hydrogen during EPP events can decrease ozone by tens of percent. However, the standard ion chemistry parameterizations used in atmospheric models neglect the effects on some important species, such as nitric acid. We present WACCM-D, a variant of the Whole Atmosphere Community Climate Model, which includes a set of lower ionosphere (D-region) chemistry: 307 reactions of 20 positive ions and 21 negative ions. Compared to the Sodankylä Ion and Neutral Chemistry (SIC), a state-of-the-art 1-D model of the D-region chemistry, WACCM-D represents the lower ionosphere well. Comparison of ion concentrations between the models shows that the WACCM-D bias is typically within ±10% or less below 70 km. At 70-90 km, when strong altitude gradients in ionization rates and/or ion concentrations exist, the bias can be larger for some ions but is still within tens of percent. We also compare WACCM-D results for the January 2005 solar proton event (SPE) to those from the standard WACCM and observations from the Aura/MLS and SCISAT/ACE-FTS instruments. The results indicate that WACCM-D improves the modeling of {HNO3}, {HCl}, {ClO}, {OH}, and {NOx} during the SPE. For example, Northern Hemispheric {HNO3} from WACCM-D shows an increase by two orders of magnitude at 40-70 km compared to WACCM, reaching 2.6 ppbv, in agreement with the observations. Based on our results, WACCM-D provides a state-of-the-art global representation of D-region ion chemistry and improves modeling of EPP atmospheric effects considerably.

  4. Biodegradable poly(lactic-co-glycolic acid) microspheres loaded with S-nitroso-N-acetyl-D-penicillamine for controlled nitric oxide delivery.

    Science.gov (United States)

    Lautner, Gergely; Meyerhoff, Mark E; Schwendeman, Steven P

    2016-03-10

    Nitric oxide (NO) is a fascinating and important endogenous free-radical gas with potent antimicrobial, vasodilating, smooth muscle relaxant, and growth factor stimulating effects. However, its wider biomedical applicability is hindered by its cumbersome administration, since NO is unstable especially in biological environments. In this work, to ultimately develop site-specific controlled release vehicles for NO, the NO donor S-nitroso-N-acetyl-D-penicillamine (SNAP) was encapsulated within poly(lactic-co-glycolic acid) 50:50 (PLGA) microspheres by using a solid-in-oil-in-water emulsion solvent evaporation method. The highest payload was 0.56(±0.01) μmol SNAP/mg microspheres. The in vitro release kinetics of the donor were controlled by the bioerosion of the PLGA microspheres. By using an uncapped PLGA (Mw=24,000-38,000) SNAP was slowly released for over 10days, whereas by using the ester capped PLGA (Mw=38,000-54,000) the release lasted for over 4weeks. The presence of copper ions and/or ascorbate in solution was necessary to efficiently decompose the released NO donor and obtain sustained NO release. It was also demonstrated that light can be used to induce rapid NO release from the microspheres over several hours. SNAP exhibited excellent storage stability when encapsulated in the PLGA microspheres. These new microsphere formulations may be useful for site-specific administration and treatment of pathologies associated with dysfunction in endogenous NO production, e.g. treatment of diabetic wounds, or in diseases involving other biological functions of NO including vasodilation, antimicrobial, anticancer, and neurotransmission. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Chlorogenic acid improves ex vivo vessel function and protects endothelial cells against HOCl-induced oxidative damage, via increased production of nitric oxide and induction of Hmox-1.

    Science.gov (United States)

    Jiang, Rujia; Hodgson, Jonathan M; Mas, Emilie; Croft, Kevin D; Ward, Natalie C

    2016-01-01

    Dietary polyphenols are potential contributors toward improved cardiovascular health. Coffee is one of the richest sources of dietary polyphenols in a coffee-drinking population, the most abundant form being chlorogenic acid (CGA). Endothelial dysfunction is an early and major risk factor for cardiovascular disease. Nitric oxide (NO) is a key factor in regulation of endothelial function. Heme oxygenase-1 (Hmox-1), an inducible isoform of heme oxygenase that is produced in response to stressors such as oxidative stress, may also play a role in vascular protection. The aim of this study was to investigate the effect of CGA on endothelial function with oxidant-induced damage in isolated aortic rings from C57BL mice. We further examine the mechanism by investigating cell viability, activation of eNOS and induction of Hmox-1 in human aortic endothelial cells (HAECs). We found that pretreatment of isolated aortic rings with 10-μM CGA-protected vessels against HOCl-induced endothelial dysfunction (P<0.05). Pretreatment of cultured HAECs with 10-μM CGA increased endothelial cell viability following exposure to HOCl (P<0.05). Moreover, CGA increased NO production in HAECs in a dose-dependent manner, peaking at 6 h (P<0.05). CGA at 5 μM and 10 μM increased eNOS dimerization at 6 h and induced Hmox-1 protein expression at 6 h and 24 h in HAECs. These results are consistent with the cardiovascular protective effects of coffee polyphenols and demonstrate that CGA can protect vessels and cultured endothelial cells against oxidant-induced damage. The mechanism behind the beneficial effect of CGA appears to be in part via increased production of NO and induction of Hmox-1.

  6. Emissions of nitrous acid (HONO), nitric oxide (NO) and nitrous oxide (N2O) from boreal agricultural soil - Effect of N fertilization

    Science.gov (United States)

    Bhattarai, Hem Raj; Virkajärvi, Perttu; -Yli Pirilä, Pasi; Maljanen, Marja

    2017-04-01

    There is no doubt that nitrogen (N) fertilization has crucial role in increasing food production. However, in parallel it can cause severe impact in environment such as eutrophication, surface/groundwater pollution via nitrate (NO3-) leaching and emissions of N trace gases. Fertilization increases the emissions of nitrous oxide (N2O) which is 260 stronger greenhouse gas than carbon dioxide (CO2). It also enhances the emissions of nitric oxide (NO); an oxidized and very reactive form of nitrogen which can fluctuate the ozone (O3) concentration in atmosphere and cause acidification. The effects of N- fertilization on the emission of N2O and NO from agricultural soil are well known. However, the effects of N fertilization on nitrous acid (HONO) emissions are unknown. Few studies have shown that HONO is emitted from soil but they lack to interlink fertilization and HONO emission. HONO accounts for 17-34 % of hydroxyl (OH-) radical production? in the atmosphere, OH- radicals have vital role in atmospheric chemistry; they can cause photochemical smog, form O3, oxidize volatile organic compounds and also atmospheric methane (CH4). We formulated hypothesis that N fertilization will increase the HONO emissions as it does for N2O and NO. To study this, we took soil samples from agricultural soil receiving different amount of N-fertilizer (0, 250 and 450 kg ha-1) in eastern Finland. HONO emissions were measured by dynamic chamber technique connected with LOPAP (Quma Elektronik & Analytik GmbH), NO by NOx analyzer (Thermo scientific) and static chamber technique and gas chromatograph was used for N2O gas sampling and analysis. Several soil parameters were also measured to establish the relationship between the soil properties, fertilization rate and HONO emission. This study is important because eventually it will open up more questions regarding the forms of N loss from soils and impact of fertilization on atmospheric chemistry.

  7. Testicular Nitric Oxide and Thiobarbituric Acid Reactive Substances Levels in Obstructive Azoospermia: A Possible Role in Pathophysiology of Infertility

    Directory of Open Access Journals (Sweden)

    2006-01-01

    Full Text Available Objective. The aim of the study is to evaluate the levels of nitrite/nitrate and thiobarbituric acid reactive substances (TBARS and their relationship with seminal parameters in experimental obstructive azoospermic rats to explain the possible mechanism of impaired sperm quality in obstructive azoospermia. Methods . A total of 10 male Spraque-Dawley rats underwent bilateral vas resection and ligation (Group-1=vasectomy group. The findings were compared with control group ( Group-2=sham group,n=10. Animals were sacrificed 8 weeks after surgery. Testes were removed and used for the evaluation of nitrate/nitrite and TBARS levels and for histology. Epididymal-aspirated seminal plasma was used for semen count and morphological analysis according to the Kruger criteria. Results. Testicular tissue nitrate/nitrite and TBARS levels were 35.7±3.1μ mol/g protein and 3.7±0.1 nmol/g protein in Group-1, and 19.3±0.7 μ mol/g protein and 3.1±0.1 nmol/g protein in Group-2, respectively. Both parameters showed statistical differences between the two groups. Testicular tissue nitrate/nitrite and TBARS levels showed negative and statistically significant correlations with sperm motility and morphology. Conclusions. The present study showed that testicular nitrate/nitrite and TBARS levels were increased in obstructive azoospermia. For that reason, we concluded that antioxidant treatment can be recommended to patients before sperm extraction for artificial reproduction due to obstructive infertility after vasectomy reversal.

  8. Testicular Nitric Oxide and Thiobarbituric Acid Reactive Substances Levels in Obstructive Azoospermia: A Possible Role in Pathophysiology of Infertility

    Directory of Open Access Journals (Sweden)

    M. Murad Başar

    2006-01-01

    Full Text Available Objective. The aim of the study is to evaluate the levels of nitrite/nitrate and thiobarbituric acid reactive substances (TBARS and their relationship with seminal parameters in experimental obstructive azoospermic rats to explain the possible mechanism of impaired sperm quality in obstructive azoospermia. Methods . A total of 10 male Spraque-Dawley rats underwent bilateral vas resection and ligation (Group-1=vasectomy group. The findings were compared with control group (Group-2=sham group,n=10. Animals were sacrificed 8 weeks after surgery. Testes were removed and used for the evaluation of nitrate/nitrite and TBARS levels and for histology. Epididymal-aspirated seminal plasma was used for semen count and morphological analysis according to the Kruger criteria. Results. Testicular tissue nitrate/nitrite and TBARS levels were 35.7±3.1μmol/g protein and 3.7±0.1 nmol/g protein in Group-1, and 19.3±0.7μmol/g protein and 3.1±0.1 nmol/g protein in Group-2, respectively. Both parameters showed statistical differences between the two groups. Testicular tissue nitrate/nitrite and TBARS levels showed negative and statistically significant correlations with sperm motility and morphology. Conclusions. The present study showed that testicular nitrate/nitrite and TBARS levels were increased in obstructive azoospermia. For that reason, we concluded that antioxidant treatment can be recommended to patients before sperm extraction for artificial reproduction due to obstructive infertility after vasectomy reversal.

  9. EFFECTS OF HUMIC ACID PURIFICATION ON INTERACTION WITH HYDROPHOBIC ORGANIC MATTER: EVIDENCE FROM FLUORESCENCE BEHAVIOR. (R822832)

    Science.gov (United States)

    Conventional isolation of humic materials from naturalmatrixes includes demineralization by treatment with HF/HCl. The possible effect of this on the structural integrity ofhumic acid (HA) was investigated by comparing theinteractions of two aqueous HAs, one produc...

  10. Isolation, purification and identification of ellagic acid derivatives, catechins, and procyanidins from the root bark of Anisophyllea dichostyla R. Br.

    Science.gov (United States)

    Khallouki, F; Haubner, R; Hull, W E; Erben, G; Spiegelhalder, B; Bartsch, H; Owen, R W

    2007-03-01

    The root bark of Anisophyllea dichostyla R. Br. is traditionally used in the Democratic Republic Congo for the treatment of several conditions such as anorexia, fatigue and intestinal infections. We have identified and quantitated several polyphenol antioxidants in the methanol extract of the root bark (120g). The polyphenol content (3.32g/kg) was predominantly ellagitannins (25%) and polyhydroxyflavan-3-ols (catechins and procyanidins, 75%) with 3'-O-methyl-3,4-methylenedioxo ellagic acid 4'-O-beta-d-glucopyranoside and (-)-epicatechin as the major species in each class. These two compounds and the following species were identified unequivocally by NMR spectroscopy: (+)-catechin, (-)-epicatechin 3-O-gallate, 3-O-methyl ellagic acid, 3,3'-di-O-methyl ellagic acid, 3'-O-methyl-3,4-methylenedioxo ellagic acid, 3'-O-methyl-3,4-methylenedioxo ellagic acid 4'-O-beta-d-glucopyranoside, and 3'-O-methyl ellagic acid 4-O-beta-d-xylopyranoside. The following additional compounds were purified by semi-preparative HPLC and tentatively identified on the basis of UV spectra, HPLC-ESI-MS and nano-ESI-MS-MS: (+)-catechin-3-O-beta-d-glucopyranoside, epicatechin-(4beta-->8)-catechin (procyanidin B(1)), epicatechin-(4beta-->8)-epicatechin (procyanidin B(2)), an (epi)catechin trimer, 3-O-methyl ellagic acid 4-O-beta-d-glucopyranoside, (-)-epicatechin 3-O-vanillate, 3,4-methylenedioxo ellagic acid 4'-O- beta-d-glucopyranoside, and 3,3'-di-O-methyl ellagic acid 4-O-beta-d-xylopyranoside. Fractionation of the raw extract by column chromatography on silicic acid yielded 10 fractions. In the hypoxanthine/xanthine oxidase antioxidant assay system, CC-9 which contained a range of polyphenols dominated by (-)-epicatechin-O-gallate proved to be the most potent antioxidant fraction (IC(50)=52 micro g/mL) in terms of ROS scavenging. In terms of XO inhibition CC-8, dominated by (epi)catechin trimer and which also contained appreciable amounts of 3'-O-methyl ellagic acid 4'-O

  11. Catalytic abatement of nitrous oxide from nitric and production

    NARCIS (Netherlands)

    Oonk, J.

    1998-01-01

    Nitric acid production is identified as a main source of nitrous oxide. Options for emission reduction however are not available. TNO and Hydro Agri studied the technological and economic feasibility of catalytic decomposition of nitrous oxide in nitric acid tail-gases. Although in literature promis

  12. 大孔吸附树脂纯化甘草提取物中甘草酸的研究%Macroporous Adsorption Resin Purification of Glycyrrhizic Acid in Glycyrrhiza Extract Research

    Institute of Scientific and Technical Information of China (English)

    丁利营; 李红艳

    2014-01-01

    Objective To study the best macroporous resin purification process for Glycyrrhizic acid from glycyrrhiza glabra. Methods Glycyrrhizic acid content in macroporous resin purification as the investigation index, select the best macroporous resin from 24 kinds of macroporous resins for Glycyrrhizic acid from liquorice extract, and determine the optimum process conditions for this purification. Results AB-8 macroporous adsorption resin has the best purification ef ect for glycyrrhizic acid, and the optimum process conditions:liquorice extract concentration is 0.11mg/ml, diameter/height is 1:8, liquorice extract volume is 2 times of the resin, the rates of using liquorice extract and elution both are 2bv/h, remove impurities with 30%&50%ETOH, and accumulate glycyrrhizic acid by using 80%ETOH. After purification, the purity of the product is 60.74%, the yield rate is 3.29%, the transfer rate is 76.72%. Conclusion Using AB-8 macroporous adsorption resin can purify glycyrrhizic acid very wel .%目的研究光果甘草中甘草酸的最佳大孔树脂纯化工艺。方法以大孔吸附树脂纯化物中甘草酸的含量为考察指标,从24种大孔吸附树脂中筛选出纯化甘草粗提物中甘草酸的最佳大孔吸附树脂,并确定纯化甘草酸的最佳工艺条件。结果 AB-8大孔吸附树脂纯化甘草酸效果最佳,最佳工艺条件院上柱液浓度为0.11mg/mL,径高比为1:8,上样体积为所用树脂2BV,上样速度与洗脱速度均为2BV/h,用30%、50%的乙醇除杂,用80%乙醇富集甘草酸。纯化后产品纯度为60.74%,收率为3.29%,转移率为76.33%。结论采用AB-8大孔吸附树脂可较好地纯化甘草酸。

  13. Model-based design of a pilot-scale simulated moving bed for purification of citric acid from fermentation broth.

    Science.gov (United States)

    Wu, Jinglan; Peng, Qijun; Arlt, Wolfgang; Minceva, Mirjana

    2009-12-11

    One of the conventional processes used for the recovery of citric acid from its fermentation broth is environmentally harmful and cost intensive. In this work an innovative benign process, which comprises simulated moving bed (SMB) technology and use of a tailor-made tertiary poly(4-vinylpyridine) (PVP) resin as a stationary phase is proposed. This paper focuses on a model-based design of the operation conditions for an existing pilot-scale SMB plant. The SMB unit is modeled on the basis of experimentally determined hydrodynamics, thermodynamics and mass transfer characteristics in a single chromatographic column. Three mathematical models are applied and validated for the prediction of the experimentally attained breakthrough and elution profiles of citric acid and the main impurity component (glucose). The transport dispersive model was selected for the SMB simulation and design studies, since it gives a satisfactory prediction of the elution profiles within acceptable computational time. The equivalent true moving bed (TMB) and SMB models give a good prediction of the experimentally attained SMB separation performances, obtained with a real clarified and concentrated fermentation broth as a feed mixture. The SMB separation requirements are set to at least 99.8% citric acid purity and 90% citric acid recovery in the extract stream. The complete regeneration in sections 1 and 4 is unnecessary. Therefore the net flow rates in all four SMB sections have been considered in the unit design. The influences of the operating conditions (the flow rate in each section, switching time and unit configuration) on the SMB performances were investigated systematically. The resulting SMB design provides 99.8% citric acid purity and 97.2% citric acid recovery in the extract. In addition the citric acid concentration in the extract is a half of its concentration in the pretreated fermentation broth (feed).

  14. Purification of low-concentration phenazine-1-carboxylic acid from fermentation broth of Pseudomonas sp. M18 via free flow electrophoresis with gratis gravity.

    Science.gov (United States)

    Shao, Jing; Fan, Liu-Yin; Zhang, Wei; Guo, Chen-Gang; Li, Si; Xu, Yu-Quan; Cao, Cheng-Xi

    2010-10-01

    The low-concentration phenazine-1-carboxylic acid (PCA) ( = 0.3 mM) extracted from fermentation broth of Pseudomonas sp. M18 was selected to be purified with a newly facile free flow electrophoresis (FFE) device with gratis gravity. Three factors of pH value and concentration of background buffer, and the cooling circle of FFE device were investigated for the purification of PCA in the FFE device. It was found that the pH value and concentration of background buffer had mild influences on the separation of PCA whether with cooling circle or not. However, the cooling circle had a much greater impact on the separation of PCA. The controlling of the band zone of PCA in FFE chamber would be difficult if without cooling circle, while the controlling would become easy if with cooling circle. Under the optimal conditions (10 mM pH 5.5 phosphate as background buffer, 30 mM pH 5.5 phosphate buffer as electrode solution, 5.46 mL/min background flux, 10 min residence time of injected sample, and 500 V), PCA could be continuously prepared from its impurities with relative high purity. The flux of sample injection was 115 μL/min, viz. 7 mL sample throughput per hour, and the recovery was up to 85%. All of the experiments indicated that the FFE technique was a good alternative tool for the study on natural biological control agents.

  15. L-theanine, a Component of Green Tea Prevents 3-Nitropropionic Acid (3-NP)-Induced Striatal Toxicity by Modulating Nitric Oxide Pathway.

    Science.gov (United States)

    Jamwal, Sumit; Kumar, Puneet

    2017-04-01

    L-theanine is unique amino acid which readily crosses blood brain barrier and possesses neuroprotective potential against neurodegenerative disorders including Huntington disease (HD). HD is characterized by selective loss of GABAergic medium spiny neurons. 3-nitropropionic acid (3-NP) induces a spectrum of HD-like neuropathology in rat striatum and widely used as experimental tool to study HD. Therefore, the present study was intended to investigate the effect of L-theanine against 3-NP-induced striatal toxicity and to explore its possible mechanism. Rats were administered with 3-NP for 21 days. L-theanine was given once a day, 1 h prior to 3-NP treatment for 21 days and L-NAME (10 mg/kg, i.p.), NO inhibitor and L-arginine (50 mg/kg; i.p.), NO precursor were administered 1 h prior to L-theanine treatment. Body weight and behavioral observation were made on weekly basis. On the 22nd day, animals were sacrificed, and the striatum was isolated for biochemical (LPO, GSH, and nitrite), pro-inflammatory cytokines and neurochemical analysis. 3-NP treatment significantly altered body weight, locomotor activity, motor coordination, mitochondrial complex-II activity, oxidative defense, pro-inflammatory mediators, and striatal neurotransmitters level. L-theanine pre-treatment (25 and 50 mg/kg/day, p.o.) significantly prevented these alterations. In addition, concurrent treatment of L-NAME with L-theanine (25 mg/kg/day, p.o.) significantly enhanced protective effect of L-theanine (25 mg/kg/day, p.o.) whereas concurrent treatment of L-arginine with L-theanine (50 mg/kg/day, p.o.) significantly ameliorated the protective effect of L-theanine (50 mg/kg/day, p.o.). The neuroprotective potential of L-theanine involves inhibition of detrimental nitric oxide production and prevention of neurotransmitters alteration in the striatum.

  16. Summary Report on Gamma Radiolysis of TBP/n-dodecane in the Presence of Nitric Acid Using the Radiolysis/Hydrolysis Test Loop

    Energy Technology Data Exchange (ETDEWEB)

    Dean R. Peterman; Bruce J. Mincher; Catherine L. Riddle; Richard D. Tillotson

    2010-08-01

    Design and installation has been completed for a state-of-the-art radiolysis/hydrolysis test loop system. The system is used to evaluate the effects of gamma radiolysis and acid hydrolysis on the stability and performance of solvent extraction process solvents. The test loop is comprised of two main sections; the solvent irradiation and hydrolysis loop and the solvent reconditioning loop. In the solvent irradiation and hydrolysis loop, aqueous and organic phases are mixed and circulated through a gamma irradiator until the desired absorbed dose is achieved. Irradiation of the mixed phases is more representative of actual conditions in a solvent extraction process. Additionally, the contact of the organic phase with the aqueous phase will subject the solvent components to hydrolysis. This hydrolysis can be accelerated by controlling the system at an elevated temperature. At defined intervals, the organic from the irradiation/hydrolysis loop will be transferred to the solvent reconditioning loop where the solvent is contacted with scrub, strip, and solvent wash solutions which simulate process flowsheet conditions. These two processes are repeated until the total desired dose is achieved. Since all viable solvent extraction components in an advanced fuel cycle must exhibit high radiolytic and hydrolytic stability, this test loop is not limited to any one solvent system but is applicable to all systems of interest. Also, the test loop is not limited to testing of process flowsheets. It is also a valuable tool in support of fundamental research on newly identified extractants/modifiers and the impact of gamma radiation on their stability in a dynamic environment. The investigation of the radiolysis of a TBP/n-dodecane process solvent in contact with aqueous nitric acid has been performed. These studies were intended to confirm/optimize the operability of the test loop system. Additionally, these data are directly applicable to numerous other solvent extraction

  17. Characterization of Group V Dubnium Homologs on DGA Extraction Chromatography Resin from Nitric and Hydrofluoric Acid Matrices

    Energy Technology Data Exchange (ETDEWEB)

    Despotopulos, J D; Sudowe, R

    2012-02-21

    somewhere between Nb and Pa. Much more recent studies have examined the properties of Db from HNO{sub 3}/HF matrices, and suggest Db forms complexes similar to those of Pa. Very little experimental work into the behavior of element 114 has been performed. Thermochromatography experiments of three atoms of element 114 indicate that the element 114 is at least as volatile as Hg, At, and element 112. Lead was shown to deposit on gold at temperatures about 1000 C higher than the atoms of element 114. Results indicate a substantially increased stability of element 114. No liquid phase studies of element 114 or its homologs (Pb, Sn, Ge) or pseudo-homologs (Hg, Cd) have been performed. Theoretical predictions indicate that element 114 is should have a much more stable +2 oxidation state and neutral state than Pb, which would result in element 114 being less reactive and less metallic than Pb. The relativistic effects on the 7p{sub 1/2} electrons are predicted to cause a diagonal relationship to be introduced into the periodic table. Therefore, 114{sup 2+} is expected to behave as if it were somewhere between Hg{sup 2+}, Cd{sup 2+}, and Pb{sup 2+}. In this work two commercially available extraction chromatography resins are evaluated, one for the separation of Db homologs and pseudo?homologs from each other as well as from potential interfering elements such as Group IV Rf homologs and actinides, and the other for separation of element 114 homologs. One resin, Eichrom's DGA resin, contains a N,N,N',N'-tetra-n-octyldiglycolamide extractant, which separates analytes based on both size and charge characteristics of the solvated metal species, coated on an inert support. The DGA resin was examined for Db chemical systems, and shows a high degree of selectivity for tri-, tetra-, and hexavalent metal ions in multiple acid matrices with fast kinetics. The other resin, Eichrom's Pb resin, contains a di-t-butylcyclohexano 18-crown-6 extractant with isodecanol solvent

  18. Purification and properties of protocatechuate 3,4-dioxygenase from Chaetomium piluliferum induced with p-hydroxybenzoic acid.

    Science.gov (United States)

    Wojtaś-Wasilewska, M; Trojanowski, J

    1980-01-01

    1. Protocatechuate 3,4-dioxygenase (protocatechuate : oxygen 3,4-oxidoreductase, EC 1.13.11.3) was isolated from mycelium of Chaetomium piluliferum induced with p-hydroxybenzoic acid. The enzyme was purified about 80-fold by ammonium sulphate fractionation and DEAE-cellulose and Sephadex G-200 chromatography, and was homogeneous on polyacrylamide-gel electrophoresis. 2. The enzyme showed high substrate specificity; its pH optimum was 7.5-8.0, and molecula weight about 76 000 as determined by filtration on Sephadex G-200. The Michaelis constant for protocatechuic acid was 11.1 microM.

  19. Grafting iminodiacetic acid on silica nanoparticles for facilitated refolding of like-charged protein and its metal-chelate affinity purification.

    Science.gov (United States)

    Liu, Hu; Dong, Xiaoyan; Sun, Yan

    2016-01-15

    A series of highly charged nanoscale chelators were fabricated by grafting of poly(glycidyl methacrylate-iminodiacetic acid) (pGI) chains with iminodiacetic acid (IDA) chelating group on silica nanoparticles (SNPs) via atom transfer radical polymerization (ATRP). The nanoscale chelators, denoted as SNPs-pGI, possessed a nickel ion chelating capacity as high as 2800 μmol/g, 50 times higher than the IDA-modified Sepharose FF (IDA-Sepharose) resin reported in literature and offered a high affinity binding capacity for hexahistidine-tagged enhanced green fluorescence protein (6 × His-EGFP) after nickel ion loading. More importantly, the anionic SNPs-pGI of high charge densities displayed much better performance than IDA-Sepharose in facilitating the refolding of like-charged 6 × His-EGFP from inclusion bodies (IBs). For example, for 0.2mg/mL 6 × His-EGFP IB refolding, addition of 6.2 μL/mL SNPs-pGI with the highest charge density led to a refolding yield of 90%, over 43% higher than that obtained with 460 μL/mL IDA-Sepharose. It is notable that the much higher efficiency of the nanoscale chelator was obtained with a chelator consumption corresponding to only 1.4% of IDA-Sepharose. Moreover, the highly charged SNPs-pGI could efficiently facilitate the refolding of 6 × His-EGFP at higher IB concentrations (0.4 and 0.8 mg/mL). After refolding, nickel ions addition led to the recovery of the refolded 6 × His-EGFP with high yield (80%), purity (96%) and enrichment ratio (1.8). All the results suggest that the SNPs-pGI of high charge densities were promising for cost-effective recovery of His-tagged proteins expressed as IBs with the integrative like-charge facilitated refolding and metal-chelate affinity purification strategy.

  20. Purification and N-terminal amino acid sequence of solanapyrone synthase, a natural Diels-Alderase from Alternaria solani.

    Science.gov (United States)

    Katayama, Kinya; Kobayashi, Tomonori; Chijimatsu, Masao; Ichihara, Akitami; Oikawa, Hideaki

    2008-02-01

    The first natural Diels-Alderase, solanapyrone synthase, was purified 1,630-fold from a crude extract. The 41-kDa protein on SDS-polyacrylamide gel electrophoresis was identified as truncated solanapyrone synthase, and its N-terminal amino acid sequence was found to be QETQNLNNFLESNAINP.

  1. Purification and characterization of a novel intracellular acid proteinase from the plasmodia of a true slime mold, Physarum polycephalum.

    Science.gov (United States)

    Murakami-Murofushi, K; Takahashi, T; Minowa, Y; Iino, S; Takeuchi, T; Kitagaki-Ogawa, H; Murofushi, H; Takahashi, K

    1990-11-15

    An acid proteinase was purified to apparent homogeneity from the plasmodia of a slime mold, Physarum polycephalum, by a combination of detergent extraction, acid precipitation, and column chromatographies on DEAE-Sephadex, hydroxylapatite, CM-Sephadex, and Sephadex G-100. The enzyme was shown to be composed of two polypeptide chains (a 31-kDa heavy chain and a 23-kDa light chain) cross-linked by disulfide bond(s). The NH2-terminal amino acid sequence of the heavy chain was determined to be Ala-Gly-Val- Asp-Gly-Tyr-Ile-Val-Pro-Tyr-Val-Ile-Phe-Asp-Leu-Tyr-Gly-Ile-Pro-Tyr and that of the light chain to be Ala-Glu-Pro-Pro-Ile. The heavy chain contained carbohydrate moiety composed of mannose, glucosamine, fucose, and glucose. The enzyme was optimally active at pH 1.7 toward hemoglobin as a substrate. Among the proteinase inhibitors tested only diazoacetyl-D,L-norleucine methyl ester, a typical aspartic proteinase inhibitor, inhibited the acid proteinase in the presence of cupric ions. It was insensitive to the other typical aspartic proteinase inhibitors, pepstatin A and 1,2-epoxy-3-(p-nitrophenoxy)propane. The enzyme hydrolyzed Lys-Pro-Ile-Glu-Phe(4-NO2)-Arg-Leu at the Phe-Phe(4-NO2) bond, but could not hydrolyze another synthetic pepsin-substrate, N-acetyl-L-phenylalanyl-3,5-diiodo-L-tyrosine. The enzyme showed a unique substrate specificity toward oxidized insulin B chain. The major cleavage sites were the bonds Gly8-Ser9, Leu11-Val12, Cya19-Gly20, and Phe24-Phe25, and the Gly8-Ser9 bond was most susceptible. These results indicate that the enzyme is a novel type of intracellular acid proteinase with a unique substrate specificity.

  2. Citric acid production from extract of Jerusalem artichoke tubers by the genetically engineered yeast Yarrowia lipolytica strain 30 and purification of citric acid.

    Science.gov (United States)

    Wang, Ling-Fei; Wang, Zhi-Peng; Liu, Xiao-Yan; Chi, Zhen-Ming

    2013-11-01

    In this study, citric acid production from extract of Jerusalem artichoke tubers by the genetically engineered yeast Yarrowia lipolytica strain 30 was investigated. After the compositions of the extract of Jerusalem artichoke tubers for citric acid production were optimized, the results showed that natural components of extract of Jerusalem artichoke tubers without addition of any other components were suitable for citric acid production by the yeast strain. During 10 L fermentation using the extract containing 84.3 g L(-1) total sugars, 68.3 g L(-1) citric acid was produced and the yield of citric acid was 0.91 g g(-1) within 336 h. At the end of the fermentation, 9.2 g L(-1) of residual total sugar and 2.1 g L(-1) of reducing sugar were left in the fermented medium. At the same time, citric acid in the supernatant of the culture was purified. It was found that 67.2 % of the citric acid in the supernatant of the culture was recovered and purity of citric acid in the crystal was 96 %.

  3. Purification of human brain metallothionein by organic and reversed-phase high-performance liquid chromatography under acidic conditions.

    Science.gov (United States)

    Cartel, N J

    1996-02-09

    A simplified high-performance liquid chromatographic method for the detection of metallothioneins, notably metallothionein-III, has been developed. In order to purify metallothionein, differential acetone precipitation at 50% (v/v) and at 80% (v/v) was employed on a 20% normal human brain homogenate. The reconstituted pellet was injected into a C18 microbore reversed-phase HPLC column, equilibrated with 0.1% trifluoroacetic acid, and developed at a flow-rate of 800 microliter/min with a linear gradient from 0% to 60% acetonitrile in 0.094% trifluoroacetic acid for 60 min. Western blots indicated that metallothioneins-I and II eluted at 16% acetonitrile and metallothionein-III eluted at 37% acetonitrile.

  4. Separation and purification of dodecanedi