Testing the Deployment Repeatability of a Precision Deployable Boom Prototype for the Proposed SWOT Karin Instrument

Science.gov (United States)

Agnes, Gregory S.; Waldman, Jeff; Hughes, Richard; Peterson, Lee D.

2015-01-01

NASA's proposed Surface Water Ocean Topography (SWOT) mission, scheduled to launch in 2020, would provide critical information about Earth's oceans, ocean circulation, fresh water storage, and river discharge. The mission concept calls for a dual-antenna Ka-band radar interferometer instrument, known as KaRIn, that would map the height of water globally along two 50 km wide swaths. The KaRIn antennas, which would be separated by 10 meters on either side of the spacecraft, would need to be precisely deployable in order to meet demanding pointing requirements. Consequently, an effort was undertaken to design build and prototype a precision deployable Mast for the KaRIn instrument. Each mast was 4.5-m long with a required dilitation stability of 2.5 microns over 3 minutes. It required a minimum first mode of 7 Hz. Deployment repeatability was less than +/- 7 arcsec in all three rotation directions. Overall mass could not exceed 41.5 Kg including any actuators and thermal blanketing. This set of requirements meant the boom had to be three times lighter and two orders of magnitude more precise than the existing state of the art for deployable booms.

Eesti funktsionalismi näitus Jyväskyläs / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2002-01-01

6. VIII-15. IX Alvar Aalto muuseumis Eesti Arhitekuurimuuseumi näitus "Funktsionalism Eestis". Eksponeeritakse 1930. aastate originaalprojekte, digitaliseeritud ajaloolisi fotosid ning makette. Näituse ja kataloogi on koostanud Karin Hallas-Murula, näituse kujundanud Peeter Mauer, kataloogi kujundanud Jaanus Tamme ja Jaak Peep (Tank)

1960. aastate arhitektuurist, ajast ja vaimust / Udo Ivask ; interv. Karin Hallas-Murula ja Reet Varblane

Index Scriptorium Estoniae

Ivask, Udo, 1932-2017

2007-01-01

1960. aastatel moodsaid hooneid projekteerinud arhitekti Udo Ivaskiga vestlevad 2. septembrini Eesti Arhitektuurimuuseumis avatud näituse "Kuuekümnendad. Eesti moodne arhitektuur" kuraator Karin Hallas-Murula ja "Sirbi" toimetaja Reet Varblane. Udo Ivaskist (sünd. 1932), tema ehitisi

Optimization of droplets for UV-NIL using coarse-grain simulation of resist flow

Science.gov (United States)

Sirotkin, Vadim; Svintsov, Alexander; Zaitsev, Sergey

2009-03-01

A mathematical model and numerical method are described, which make it possible to simulate ultraviolet ("step and flash") nanoimprint lithography (UV-NIL) process adequately even using standard Personal Computers. The model is derived from 3D Navier-Stokes equations with the understanding that the resist motion is largely directed along the substrate surface and characterized by ultra-low values of the Reynolds number. By the numerical approximation of the model, a special finite difference method is applied (a coarse-grain method). A coarse-grain modeling tool for detailed analysis of resist spreading in UV-NIL at the structure-scale level is tested. The obtained results demonstrate the high ability of the tool to calculate optimal dispensing for given stamp design and process parameters. This dispensing provides uniform filled areas and a homogeneous residual layer thickness in UV-NIL.

Shock wave energy dissipation behavior (SWED) in Network forming ionic liquids (NILs): A Molecular dynamics study

Science.gov (United States)

Guda Vishnu, Karthik; Strachan, Alejandro

2017-06-01

SWED materials play a crucial role in protecting both personnel and structures in close proximity to blasts or ballistic impact. Exposure to shock waves with intensities as low as 1 MPa can cause brain injury in personnel and, hence, it is extremely important to understand the mechanisms operating in SWED materials and help design improved formulations. Recent experimental studies show that NILs containing di-ammonium cations and citrate anions with glass transition temperatures (Tg) below room temperature exhibit shockwave absorption characteristics that outperform polyurea (PU), a benchmark SWED assessment material. The experimentalists further hypothesized that the increased SWED ability in NILs with longer side chains (in di-ammonium cation) is due to a permanent structural ordering and nano-scale segregation. We use molecular dynamics simulations with the Dreiding force field to study shock propagation mechanisms in NILs. Shock propagation mechanisms in these materials are explored by performing both Hugoniostat and large scale non-equilibrium molecular dynamics (NEMD) simulations at 300 K. The simulation results show that the NIL 5-6 (5 C atoms (back bone) and 6 C atoms (side chain)) attenuates shocks better than NIL 5-3 (3 C atoms (side chain) and higher Tg) and PMMA in agreement with experimental observation. The simulations show that under shock loading the structures lose long range order; we find no evidence of nano-segregation nor or permanent structural changes.

Antibacterial Activity of Pharbitin, Isolated from the Seeds of Pharbitis nil, against Various Plant Pathogenic Bacteria.

Science.gov (United States)

Nguyen, Hoa Thi; Yu, Nan Hee; Park, Ae Ran; Park, Hae Woong; Kim, In Seon; Kim, Jin-Cheol

2017-10-28

This study aimed to isolate and characterize antibacterial metabolites from Pharbitis nil seeds and investigate their antibacterial activity against various plant pathogenic bacteria. The methanol extract of P. nil seeds showed the strongest activity against Xanthomonas arboricola pv. pruni (Xap) with a minimum inhibition concentration (MIC) value of 250 μg/ml. Among the three solvent layers obtained from the methanol extract of P. nil seeds, only the butanol layer displayed the activity with an MIC value of 125 μg/ml against Xap. An antibacterial fraction was obtained from P. nil seeds by repeated column chromatography and identified as pharbitin, a crude resin glycoside, by instrumental analysis. The antibacterial activity of pharbitin was tested in vitro against 14 phytopathogenic bacteria, and it was found to inhibit Ralstonia solanacearum and four Xanthomonas species. The minimum inhibitory concentration values against the five bacteria were 125-500 μg/ml for the n-butanol layer and 31.25-125 μg/ml for pharbitin. In a detached peach leaf assay, it effectively suppressed the development of bacterial leaf spot, with a control value of 87.5% at 500 μg/ml. In addition, pharbitin strongly reduced the development of bacterial wilt on tomato seedlings by 97.4% at 250 μg/ml, 7 days after inoculation. These findings suggest that the crude extract of P. nil seeds can be used as an alternative biopesticide for the control of plant diseases caused by R. solanacearum and Xanthomonas spp. This is the first report on the antibacterial activity of pharbitin against phytopathogenic bacteria.

Development of 25 near-isogenic lines (NILs) with ten BPH resistance genes in rice (Oryza sativa L.): production, resistance spectrum, and molecular analysis.

Science.gov (United States)

Jena, Kshirod K; Hechanova, Sherry Lou; Verdeprado, Holden; Prahalada, G D; Kim, Sung-Ryul

2017-11-01

A first set of 25 NILs carrying ten BPH resistance genes and their pyramids was developed in the background of indica variety IR24 for insect resistance breeding in rice. Brown planthopper (Nilaparvata lugens Stal.) is one of the most destructive insect pests in rice. Development of near-isogenic lines (NILs) is an important strategy for genetic analysis of brown planthopper (BPH) resistance (R) genes and their deployment against diverse BPH populations. A set of 25 NILs with 9 single R genes and 16 multiple R gene combinations consisting of 11 two-gene pyramids and 5 three-gene pyramids in the genetic background of the susceptible indica rice cultivar IR24 was developed through marker-assisted selection. The linked DNA markers for each of the R genes were used for foreground selection and confirming the introgressed regions of the BPH R genes. Modified seed box screening and feeding rate of BPH were used to evaluate the spectrum of resistance. BPH reaction of each of the NILs carrying different single genes was variable at the antibiosis level with the four BPH populations of the Philippines. The NILs with two- to three-pyramided genes showed a stronger level of antibiosis (49.3-99.0%) against BPH populations compared with NILs with a single R gene NILs (42.0-83.5%) and IR24 (10.0%). Background genotyping by high-density SNPs markers revealed that most of the chromosome regions of the NILs (BC 3 F 5 ) had IR24 genome recovery of 82.0-94.2%. Six major agronomic data of the NILs showed a phenotypically comparable agronomic performance with IR24. These newly developed NILs will be useful as new genetic resources for BPH resistance breeding and are valuable sources of genes in monitoring against the emerging BPH biotypes in different rice-growing countries.

Gln3p and Nil1p regulation of invertase activity and SUC2 expression in Saccharomyces cerevisiae.

Science.gov (United States)

Oliveira, Edna Maria Morais; Mansure, José João; Bon, Elba Pinto da Silva

2005-04-01

In Saccharomyces cerevisiae, sensing and signalling pathways regulate gene expression in response to quality of carbon and nitrogen sources. One such system, the target of rapamycin (Tor) proteins, senses nutrients and uses the GATA activators Gln3p and Nil1p to regulate translation in response to low-quality carbon and nitrogen. The signal transduction, triggered in response to nitrogen nutrition that is sensed by the Tor proteins, operates via a regulatory pathway involving the cytoplasmic factor Ure2p. When carbon and nitrogen are abundant, the phosphorylated Ure2p anchors the also phosphorylated Gln3p and Nil1p in the cytoplasm. Upon a shift from high- to low-quality nitrogen or treatment with rapamycin all three proteins are dephosphorylated, causing Gln3p and Nil1p to enter the nucleus and promote transcription. The genes that code for yeast periplasmic enzymes with nutritional roles would be obvious targets for regulation by the sensing and signalling pathways that respond to quality of carbon and nitrogen sources. Indeed, previous results from our laboratory had shown that the GATA factors Gln3p, Nil1p, Dal80p, Nil2p and also the protein Ure2 regulate the expression of asparaginase II, coded by ASP3. We also had observed that the activity levels of the also periplasmic invertase, coded by SUC2, were 6-fold lower in ure2 mutant cells in comparison to wild-type cells collected at stationary phase. These results suggested similarities between the signalling pathways regulating the expression of ASP3 and SUC2. In the present work we showed that invertase levels displayed by the single nil1 and gln3 and by the double gln3nil1 mutant cells, cultivated in a sucrose-ammonium medium and collected at the exponential phase, were 6-, 10- and 60-fold higher, respectively, in comparison to their wild-type counterparts. RT-PCR data of SUC2 expression in the double-mutant cells indicated a 10-fold increase in the mRNA(SUC2) levels.

Comparison of "Nil by Mouth" Versus Early Oral Intake in Three Different Diet Regimens Following Esophagectomy

DEFF Research Database (Denmark)

Eberhard, Kristine Elisabeth; Achiam, Michael Patrick; Rolff, Hans Christian

2017-01-01

: regimen 1, nil by mouth until postoperative day (POD) 7 followed by a normal diet; regimen 2, oral intake of clear fluids from POD 1 followed by a normal diet; regimen 3, nil by mouth until POD 7 followed by a slow increase to a blended diet. The outcome endpoints were: (1) anastomotic leakage, (2......) complications [severity and number described using the Dindo-Clavien Classification and Comprehensive Complication Index (CCI)] and (3) length of stay. A multivariate logistic regression model was obtained for CCI and anastomotic leakage using Wald's stepwise selection. RESULTS: CCI was significantly lower...... analyses revealed that high American Society of Anesthesiologist score was a predicting factor for both CCI and anastomotic leakage. CONCLUSION: The study indicates that nil by mouth until postoperative day 7 followed by a slow increase to a blended diet after esophagectomy results in less severe...

Uhked naised / Kozik, Eerika; Tomingas, Triin; Sepp, Karin; Liik, Kadi; Kliimask, Katrin; Saunpere, Anne ; tekst Kärt Kross

Index Scriptorium Estoniae

2007-01-01

Mille üle oled enda juures tõeliselt uhke, mida võid enda kiituseks öelda? Küsimusele vastavad Starland Salongi omanik ja Loyd Tootmine OÜ osanik Eerika Kozik, psühholoog Triin Tomingas, Kontuur Leo Burnett projektidirektor Karin Sepp, Tallinna Ülikooli õppejõud Kadi Liik, AS Koolibri turundusjuht Katrin Kliimask ja eraettevõtja Anne Saunpere

The effect of exogenous acetylcholine and other cholinergic agents on photoperiodic flower induction of Pharbitis nil

Directory of Open Access Journals (Sweden)

Hanna Łukasiewicz-Rutkowska

2014-01-01

Full Text Available Exogenous acetylcholine (ACh, acetylcholinesterase (AChE inhibitors, as well as agonists and antagonists of ACh receptors applied on the cotyledons of 5-day-old seedlings of Pharbitis nil during a 16-hour long inductive night or during a 12-hour long subinductive night, do not essentially influence the flower bud formation. Also the application of above mentioned substances to the seedlings growing under the conditions of 72 hours of darkness, 24 hours of light and then 24 hours of darkness does not influence in an essential way flowering of P. nil. On the other hand, applying these substances on the cotyledons of P. nil during 24-hour-long inductive night, preceded by 72 hours of darkness and then 24 hours of light of lowered intensity finished by 15-minute-long impulse of far red light which inhibit flowering, caused the reversion of the effect of far red light irradiation and stimulated the flowering. The obtained results suggest that endogenous system ACh/AChE could participate in the mechanism of a phytochrome controlled flowering of short day plants.

Experiments towards establishing of design rules for R2R-UV-NIL with polymer working shims

Science.gov (United States)

Nees, Dieter; Ruttloff, Stephan; Palfinger, Ursula; Stadlober, Barbara

2016-03-01

Roll-to-Roll-UV-nanoimprint lithography (R2R-UV-NIL) enables high resolution large area patterning of flexible substrates and is therefore of increasing industrial interest. We have set up a custom-made R2R-UV-NIL pilot machine which is able to convert 10 inch wide web with velocities of up to 30 m/min. In addition, we have developed self-replicable UV-curable resins with tunable surface energy and Young's modulus for UV-imprint material as well as for polymer working stamp/shim manufacturing. Now we have designed test patterns for the evaluation of the impact of structure shape, critical dimension, pitch, depth, side wall angle and orientation relative to the web movement onto the imprint fidelity and working shim life time. We have used female (recessed structures) silicon masters of that design with critical dimensions between CD = 200 nm and 1600 nm, and structure depths of d = 500 nm and 1000 nm - all with vertical as well as inclined side walls. These entire master patterns have been transferred onto single male (protruding structures) R2R polymer working shims. The polymer working shims have been used for R2R-UV-NIL runs of several hundred meters and the imprint fidelity and process stability of the various test patterns have been compared. This study is intended as a first step towards establishing of design rules and developing of nanoimprint proximity correction strategies for industrial R2R-UV-NIL processes using polymer working shims.

Dokumentaalfilm "Maile Grünbergi värvilised maailmad" = "Maile Grünberg's colourful worlds": a documentary / Karin Paulus, Priit Põldme

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2015-01-01

Sisearhitekt Maile Grünbergist ja 2014. aastal temast valminud dokumentaalfilmist "Maile Grünbergi värvilised maailmad". Režissöör Peeter Brambat, tegevprodutsent Priit Põldme, käsikiri Karin Paulus, Peeter Brambat, Priit Põldme. 2014. aasta Kultuurkapitali Arhitektuuripreemia kandidaat

Ton H.M. van Schaik and Karin Strengers-Olde Kalter, Het Arme Roomse Leven. Geschiedenis van de katholieke caritas in de stad Utrecht

Directory of Open Access Journals (Sweden)

Joost van Genabeek

2017-07-01

Full Text Available Ton H.M. van Schaik and Karin Strengers-Olde Kalter, Het Arme Roomse Leven. Geschiedenis van de katholieke caritas in de stad Utrecht (Hilversum: Verloren, 2016, 276 pp., isbn 978 90 8704 578 4.

[Valitsusliidus olevad Reformierakond ning Isamaa ja Res Publica Liit on kavandatava koolireformi suhtes eri meelt] / Mailis Reps, Tiiu Kuurme, Karin Kütt

Index Scriptorium Estoniae

Reps, Mailis, 1975-

2010-01-01

Reformierakonna ettepaneku kohta jätta omavalitsustele õiguse otsustada, kas gümnaasium ja põhikool lahutatakse või jätkatakse ühendkooliga avaldavad arvamust riigikogu liige Mailis Reps, Tallinna Ülikooli dotsent Tiiu Kuurme ja Rannu keskkooli direktor Karin Kütt

Viking Line'i lahkuva "kapteni" 9 põhimõtet / Nils-Erik Eklund

Index Scriptorium Estoniae

Eklund, Nils-Erik

2009-01-01

2009. aasta 1. juunil 50-aastaseks saanud laevakompanii Viking Line ametist lahkuv juht Nils-Erik Eklund vastab küsimustele, mis puudutavad oma isa, Viking Line'i asutaja Gunnar Eklundi jälgedes käimist, ettevõtte võimalikku laienemist teistesse tegevusaladesse, peamisi juhtimispõhimõtteid ning keerulisemaid hetki Viking Line'i ajaloos

Interferência e nível de dano econômico de Brachiaria plantaginea e Ipomoea nil na cultura do feijão comum Interference and economic threshold of Brachiaria plantaginea and Ipomoea nil in the common bean crop

Directory of Open Access Journals (Sweden)

Ribas Antonio Vidal

2010-08-01

Full Text Available As pesquisas acerca do impacto da interferência das plantas daninhas sobre as culturas normalmente são realizadas com uma única espécie infestante, quando na realidade podem ocorrer diversas. Os objetivos deste trabalho foram avaliar a interferência de Brachiaria plantaginea e Ipomoea nil sobre o rendimento de grãos do feijoeiro (Phaseolus vulgaris e determinar o nível de dano econômico (NDE de cada espécie na cultura. Foram realizados dois experimentos a campo com as cultivares de feijão 'IPR Graúna' (Grupo Preto e 'UTF-06' (Grupo Carioca em convivência com infestações mistas em diferentes proporções aleatórias das espécies B. plantaginea e I. nil. Modelos de regressão múltiplos foram utilizados para determinar a capacidade de interferência de cada espécie daninha sobre a produtividade da cultura. O impacto de interferência de cada planta de I. nil correspondeu a 2,6 e 0,25 quando comparada a cada planta de B. plantaginea, dependente das proporções relativas na comunidade infestante e das condições de cada experimento. A cultivar 'IPR Graúna' apresentou maior habilidade competitiva do que 'UTF-06'. O NDE foi dependente da proporção relativa de cada espécie daninha na comunidade e foi obtido sob baixas infestações (The researches about the impact of weed interference on crops are usually performed with a single weed species, when in reality there are numerous. The objective of this study was to evaluate the interference of Brachiaria plantaginea and Ipomoea nil on the grain yield of French beans (Phaseolus vulgaris and to determine the economic weed threshold (EWT of each species on the crop. Two field experiments were conducted with bean cultivars 'IPR Graúna' (Black group and 'UTF-06' (Carioca group in coexistence with random proportions of mixed infestations of B. plantaginea and I. nil. Multiple regression models were used to determine the interference abi1lity of each weed species on crop productivity. The

Kumutekitav arhitektuuriaasta 2005 = The Kumu-lative year in architecture 2005 / Liina Jänes, Karin Paulus

Index Scriptorium Estoniae

Jänes, Liina, 1977-

2006-01-01

Eesti Kultuurkapitali aastapreemia 2005 - Kumu Kunstimuuseum, arhitekt Pekka Vapaavuori. Objektipreemia - büroohoone City Plaza - Alver Trummal Arhitektid (Andres Alver, Tiit Trummal, Martin Melioranski, Indrek Rünkla). Arhitektuuri ja sisekujunduse parima terviku preemia - Jõelähtme golfiklubi, arhitekt Andres Siim, sisearhitekt Juta Lember. Tegevuaspreemia - Teddy Böckler, Tallinna raekoja pikaajalise uurimis- ja restaureerimistöö, raamatu "Tallinna raekoda : uurimine ja restaureerimine 1952-2004" eest. Teadustöö preemia - Karin Hallas-Murula, kahe eesti-soome teemalise arhitektuuriuurimuse eest: "Suurlinn Tallinn: Eliel Saarineni "Suur-Tallinna" projekt, 1913" ja "Soome-Eesti - sajand arhitektuurisuhteid"

Bridging the gap in heart failure prevention: rationale and design of the Nurse-led Intervention for Less Chronic Heart Failure (NIL-CHF) Study

DEFF Research Database (Denmark)

Carrington, Melinda J; Stewart, Simon; de Courten, Barbora

2010-01-01

AIMS: The primary objective of the Nurse-led Intervention for Less Chronic Heart Failure (NIL-CHF) Study is to develop a programme of care that cost-effectively prevents the development of chronic heart failure (CHF). Methods NIL-CHF is a randomized controlled trial of a hybrid, home- and clinic-...

Wounding stimulates ALLENE OXIDE SYNTHASE gene and increases the level of jasmonic acid in Ipomoea nil cotyledons

Directory of Open Access Journals (Sweden)

Emilia Wilmowicz

2016-03-01

Full Text Available Allene oxide synthase (AOS encodes the first enzyme in the lipoxygenase pathway, which is responsible for jasmonic acid (JA formation. In this study we report the molecular cloning and characterization of InAOS from Ipomoea nil. The full-length gene is composed of 1662 bp and encodes for 519 amino acids. The predicted InAOS contains PLN02648 motif, which is evolutionarily conserved and characteristic for functional enzymatic proteins. We have shown that wounding led to a strong stimulation of the examined gene activity in cotyledons and an increase in JA level, which suggest that this compound may be a modulator of stress responses in I. nil.

Citizenship and Children's Identity in "The Wonderful Adventures of Nils" and "Scouting for Boys"

Science.gov (United States)

Sundmark, Bjorn

2009-01-01

"The Wonderful Adventures of Nils" (1906-1907) by Selma Lagerlof and "Scouting for Boys" (1908) by Robert Baden-Powell are characteristic of their time and their respective national and cultural contexts--the Swedish nation state of the early twentieth century and the British Empire. Taking its cue from recent theories on…

Nils Silfverskiöld (1888-1957) and gastrocnemius contracture.

Science.gov (United States)

Singh, Dishan

2013-06-01

Nils Silfverskiöld was an orthopaedic surgeon, Swedish aristocrat, bon vivant, Olympic gymnast, left wing intellectual and anti-Nazi who described that the force required to dorsiflex the ankle in spastic equinus contracture decreased with knee flexion in isolated gastrocnemius contracture. He advocated detaching the origins of the gastrocnemii from the femur and reattaching them to the tibia. The Silfverskiöld knee flexion test has now also been adapted to distinguish between isolated gastrocnemius contracture and combined shortening of the gastrocnemius-soleus complex in non-spastic contracture by measuring the range of ankle dorsiflexion with the knee flexed and the knee straight. Copyright © 2012 European Foot and Ankle Society. Published by Elsevier Ltd. All rights reserved.

Effect of the crack-starter weld condition on the nil-ductility transition temperature

International Nuclear Information System (INIS)

Satoh, Masanobu; Funada, Tatsuo; Tomimatsu, Minoru

1985-01-01

In ASME Code Sec. III, the value of the reference nil-ductility temperature RT sub(EDT) has an important significance to determine the result of the fracture mechanics evaluation. While in the standard both the drop-weight test and Charpy impact test are required to determine the RT sub(NDT), in practice it is normally determined only by the nil-ductility transition temperature (T sub(EDT)) obtained by the drop-weight test. The cases of data scatter in T sub(NDT) were investigated to establish appropriate conditions of crack-starter bead welding. Drop-weight tests were carried out for nuclear vessel steels by changing welding conditions to examine the effects of welding amperage and shapes of welding table on T sub(NDT). The results show that the preparation of crack-starter bead by small welding amperage should not be allowed, because it makes the measured T sub(NDT) non-conservative, and that it is important to use a welding table which increases the cooling rate of specimen. Furthermore, the authors proposed methods for estimating T sub(NDT) of nuclear vessel steels by using Charpy transition temperatures. (author)

Resistless Fabrication of Nanoimprint Lithography (NIL Stamps Using Nano-Stencil Lithography

Directory of Open Access Journals (Sweden)

Juergen Brugger

2013-10-01

Full Text Available In order to keep up with the advances in nano-fabrication, alternative, cost-efficient lithography techniques need to be implemented. Two of the most promising are nanoimprint lithography (NIL and stencil lithography. We explore here the possibility of fabricating the stamp using stencil lithography, which has the potential for a cost reduction in some fabrication facilities. We show that the stamps reproduce the membrane aperture patterns within ±10 nm and we validate such stamps by using them to fabricate metallic nanowires down to 100 nm in size.

On the theory of pre- p-nil -rings | Oduwale | Journal of the Nigerian ...

African Journals Online (AJOL)

Generalizing the concept of p-rings, Abian and Mcworter [1] call an associative and commutative ring R with characteristic p a pre-p-ring if xyy = xyy for every x and y in R. It was proved in [1] that every pre-p-ring R is a direct sum R = B ⊕ N of a p-ring B and a nil ring N, where even xy+2 = 0 for every χ∈N . It was also proved ...

Overcoming Otherness. Considerations on Intercultural Aspects in Karin Gündisch’s Novels

Directory of Open Access Journals (Sweden)

Petra-Melitta Roșu

2015-09-01

Full Text Available Immigration, cultural identity, integration, tolerance and the ability to adapt to a new environment are issues that often come up in today’s global society. The paper focuses on the way in which cultural otherness is perceived by children and teenagers. The article is based on the analysis of Karin Gündisch’s novels. The awarded author from a migrant background offers an insight into the above mentioned problems. Gündisch’s characters are mostly East-Europeans or South-East-Europeans who try to make a living in developed countries of the Western World. The author portrays entire families, children, parents and grandparents. Thus we can discuss the different stages of integration and the different attitudes towards it. How does the comfort of “home” influence identity? How can you rediscover yourself abroad? Does cultural diversity increase prejudice? What does the idea of a “Paradise abroad” involve? These are some of the aspects, the article is trying to explore.

The mediation of fandom in Karin Giphart's Maak me blij

Directory of Open Access Journals (Sweden)

Nicolle Lamerichs

2012-09-01

Full Text Available The plot of the Dutch novel Maak me blij (Make me happy (2005 by Karin Giphart draws from the culture of online fan communities. It describes the life of a lesbian in her late 20s, Ziggy, who has a terminally ill mother. Ziggy is an active fan who writes and reads femmeslash fan fiction—that is, lesbian interpretations of characters from mainstream series such as Star Trek: Voyager (1995–2001. By providing through Ziggy a personal view of fan communities and the genres that flourish there, Maak me blij connects the romantic motives of original lesbian fiction with its underground sister, fan fiction. The novel draws from various source texts and illustrates how fans interpret texts within a wider literary landscape. I use the concept of intermediality to analyze how Maak me blij mediates different types of original fiction (lesbian romances, science fiction and fan fiction (femmeslash, Star Trek fan fiction to establish new views on fandom and its construction of gender and intimacy. These motives are not only apparent within the text itself but also within the character of Ziggy as a fan writer with her own original alien characters.

L-NIL prevents renal microvascular hypoxia and increase of renal oxygen consumption after ischemia-reperfusion in rats

NARCIS (Netherlands)

Legrand, Matthieu; Almac, Emre; Mik, Egbert G.; Johannes, Tanja; Kandil, Asli; Bezemer, Rick; Payen, Didier; Ince, Can

2009-01-01

Legrand M, Almac E, Mik EG, Johannes T, Kandil A, Bezemer R, Payen D, Ince C. L-NIL prevents renal microvascular hypoxia and increase of renal oxygen consumption after ischemia-reperfusion in rats. Am J Physiol Renal Physiol 296: F1109-F1117, 2009. First published February 18, 2009;

Who is the Little Old Lady of International Crimes? Nils Christie’s concept of the Ideal Victim Reinterpreted

NARCIS (Netherlands)

van Wijk, J.

2013-01-01

This article discusses to what extent Nils Christie's famous stereotype of the 'ideal victim' is applicable in a context of international crimes. It argues that the characteristics of the ideal victim of genocide, crimes against humanity and war crimes largely overlap with the ideal victim of

Automatic detection of NIL defects using microscopy and image processing

KAUST Repository

Pietroy, David

2013-12-01

Nanoimprint Lithography (NIL) is a promising technology for low cost and large scale nanostructure fabrication. This technique is based on a contact molding-demolding process, that can produce number of defects such as incomplete filling, negative patterns, sticking. In this paper, microscopic imaging combined to a specific processing algorithm is used to detect numerically defects in printed patterns. Results obtained for 1D and 2D imprinted gratings with different microscopic image magnifications are presented. Results are independent on the device which captures the image (optical, confocal or electron microscope). The use of numerical images allows the possibility to automate the detection and to compute a statistical analysis of defects. This method provides a fast analysis of printed gratings and could be used to monitor the production of such structures. © 2013 Elsevier B.V. All rights reserved.

Hausse du niveau des océans et perte de terres dans le delta du Nil ...

International Development Research Centre (IDRC) Digital Library (Canada)

9 juin 2016 ... Au moyen de systèmes d'information géographique (SIG), des chercheurs subventionnés par le CRDI ont déterminé les zones littorales du delta du Nil qui pourraient être touchées par la hausse du niveau des océans. Il pourrait en résulter d'importantes pertes de terres d'ici 2100. Selon les plus récentes ...

SEM AutoAnalysis: enhancing photomask and NIL defect disposition and review

Science.gov (United States)

Schulz, Kristian; Egodage, Kokila; Tabbone, Gilles; Ehrlich, Christian; Garetto, Anthony

2017-06-01

For defect disposition and repair verification regarding printability, AIMS™ is the state of the art measurement tool in industry. With its unique capability of capturing aerial images of photomasks it is the one method that comes closest to emulating the printing behaviour of a scanner. However for nanoimprint lithography (NIL) templates aerial images cannot be applied to evaluate the success of a repair process. Hence, for NIL defect dispositioning scanning, electron microscopy (SEM) imaging is the method of choice. In addition, it has been a standard imaging method for further root cause analysis of defects and defect review on optical photomasks which enables 2D or even 3D mask profiling at high resolutions. In recent years a trend observed in mask shops has been the automation of processes that traditionally were driven by operators. This of course has brought many advantages one of which is freeing cost intensive labour from conducting repetitive and tedious work. Furthermore, it reduces variability in processes due to different operator skill and experience levels which at the end contributes to eliminating the human factor. Taking these factors into consideration, one of the software based solutions available under the FAVOR® brand to support customer needs is the aerial image evaluation software, AIMS™ AutoAnalysis (AAA). It provides fully automated analysis of AIMS™ images and runs in parallel to measurements. This is enabled by its direct connection and communication with the AIMS™tools. As one of many positive outcomes, generating automated result reports is facilitated, standardizing the mask manufacturing workflow. Today, AAA has been successfully introduced into production at multiple customers and is supporting the workflow as described above. These trends indeed have triggered the demand for similar automation with respect to SEM measurements leading to the development of SEM AutoAnalysis (SAA). It aims towards a fully automated SEM image

The role of stamens in ethylene production in Ipomoea nil

International Nuclear Information System (INIS)

Kiss, H.G.

1989-01-01

Ethylene production inhibits filament and corolla growth during young stages in flower development, and it promotes corolla unfolding and senescence in Ipomoea nil. Initial studies with the in vitro application of gibberellic acid (GA 3 ), demonstrated that decreased filament growth occurred when the anthers remained attached to the filaments during the young stages in development. The removal of the anthers from intact plants did not enhance filament growth until the synthesis of wound ethylene was inhibited by applied aminoethoxyvinylglycine (AVG) or cobalt chloride. It was hypothesized that the anthers were source tissues and that the filaments were transport vectors for the ethylene precursor 1-aminocyclopropane-1-carboxylic acid (ACC) and indole-3-acetic acid (IAA) to regulate growth events in the various floral organs. To test this hypothesis, endogenous IAA and ACC and ethylene production were measured by enzyme linked immunosorbent assay (ELISA) or gas chromatography. The transport of 14 C-IAA and 14 C-ACC through filament segments and filaments within intact flower buds also was examined during flower development

Reseñas y Recensiones: Lenis, Karin. (2014). El sistema de responsabilidad penal de menores. Un estudio de las legislaciones de España y Colombia desde la teoría del Derecho Penal del Enemigo.

OpenAIRE

Muñetones Rozo, Ingrid Bibiana

2015-01-01

Reseñas y Recensiones: Reseñas y Recensiones: Lenis, Karin. (2014). El sistema de responsabilidad penal de menores. Un estudio de las legislaciones de España y Colombia desde la teoría del Derecho Penal del Enemigo. Bogotá: Grupo Editorial Ibañez, 644 p.

Identification and characterization of an Ipomoea nil glucosyltransferase which metabolizes some phytohormones

International Nuclear Information System (INIS)

Suzuki, Hiroyuki; Hayase, Hiroki; Nakayama, Akira; Yamaguchi, Isomaro; Asami, Tadao; Nakajima, Masatoshi

2007-01-01

A glucosyltransferase gene InGTase1 was identified from the immature seeds of morning glory (Ipomoea nil), whose product shows a broad substrate-preference, including that of some phytohormones. When 2-trans-abscisic acid, indole-3-acetic acid, salicylic acid (SA) or (±)-jasmonic acid was reacted with InGTase1 and UDP-[ 14 C]-glucose, each 14 C-labeled compound with high polarity was detected after thin layer chromatography. SA metabolites were identified as SA glucosyl ester by using 1 H NMR and GC/MS. Detailed substrate-preferences of InGTase1 were examined with some analogous compounds, which elucidated that the arm length and/or orientation of a carboxyl group of the compounds or its surrounding electron density severely affected the enzymatic activity. The broad substrate-preference will greatly contribute to the synthesis of various glucoconjugates

Bernstein, Nils: „kennen sie mich herren/meine damen und herren”. Phraseologismen in Moderner Lyrik am Beispiel von Ernst Jandl und Nicanor Parra.

Directory of Open Access Journals (Sweden)

Urška Valenčič Arh

2013-12-01

Full Text Available Bernstein, Nils (2011: „kennen sie mich herren/meine damen und herren”. Phraseologismen in Moderner Lyrik am Beispiel von Ernst Jandl und Nicanor Parra. Würzburg: Königshausen&Neumann. ISBN: 978-3-8260-4699-5, mehka vezava, 262 strani, 38,00 EUR

Treatment of disseminated granuloma annulare with oral vitamin E: 'primum nil nocere'.

Science.gov (United States)

Poppe, Heiko; Poppe, Lidia M; Goebeler, Matthias; Trautmann, Axel

2013-01-01

Disseminated granuloma annulare (DGA) is a benign and usually asymptomatic skin disease. However, many patients feel aesthetically disfigured and ask for treatment. Until today, no standard therapy is recommended. To evaluate the safety and efficacy of oral vitamin E treatment compared to the natural course of DGA. This single-centre observational cohort study included 38 consecutive patients with histologically confirmed DGA. 21 patients underwent treatment with oral vitamin E, whereas 17 patients preferred a wait-and-see approach. Complete healing (40%) and improvement (30%) were frequently seen under oral vitamin E therapy. However, DGA also spontaneously disappeared in 31% and improved in 25% of untreated control patients. Vitamin E therapy was very well tolerated. Oral vitamin E treatment is a safe and probably effective therapy for DGA. As the natural course of DGA leads to complete healing or significant improvement in many cases, 'primum nil nocere' should be the maxim.

Effects of Cotyledon Area and Gibberellin A3 on Photoperiodic Flower Induction in Pharbitis nil Seedlings

OpenAIRE

Ogawa, Yukiyoshi; 小川, 幸持

1993-01-01

The relationship between the cotyledon area reduced before or after an inductive dark period and its photoperiodic response was examined with Pharbitis nil seedlings. Plants with 0.25- to 1-cm2 cotyledon area flowered, showing almost the same critical length of dark period, 11 or 12 h, as is the case with a single intact cotyledon (about 8.5 cm2), but the floral response of plants with reduced cotyledon area did not increase with dark periods longer than 14 h, but it was far greater per unit ...

"Nil per oral after midnight": Is it necessary for clear fluids?

Directory of Open Access Journals (Sweden)

Kajal S Dalal

2010-01-01

Full Text Available Fasting before general anaesthesia aims to reduce the volume and acidity of stomach contents, thus reducing the risk of regurgitation and aspiration. Recent guidelines have recommended a shift in fasting policies from the standard ′nil per oral from midnight′ to a more relaxed policy of clear fluid intake a few hours before surgery. The effect of preoperative oral administration of 150 ml of water 2 h prior to surgery was studied prospectively in 100 ASA I and II patients, for elective surgery. Patients were randomly assigned to two groups. Group I (n = 50 was fasting overnight while Group II (n = 50 was given 150 ml of water 2 h prior to surgery. A nasogastric tube was inserted after intubation and gastric aspirate was collected for volume and pH. The gastric fluid volume was found to be lesser in Group II (5.5 ± 3.70 ml than Group I (17.1 ± 8.2 ml which was statistically significant. The mean pH values for both groups were similar. Hence, we conclude that patients not at risk for aspiration can be allowed to ingest 150 ml water 2 h prior to surgery.

Learning from eponyms: Jose Verocay and Verocay bodies, Antoni A and B areas, Nils Antoni and Schwannomas

Directory of Open Access Journals (Sweden)

Rajiv Joshi

2012-01-01

Full Text Available Schwannomas are benign peripheral nerve sheath neoplasms composed almost entirely of Schwann cells and are diagnosed histopathologically by the presence of singular architectural patterns called Antoni A and Antoni B areas. These were described first in 1920 by the Swedish neurologist Nils Antoni. The Antoni A tissue is highly cellular and made up of palisades of Schwann cell nuclei, a pattern first described in 1910 by the Uruguayan neuro-pathologist Jose Verocay and are known as Verocay bodies. This article describes the structure and appearance of Verocay bodies and Antoni A and B areas with a brief biographical introduction of the men who described these patterns.

Potencialidad de la región costera de Córdoba -Colombia- para el cultivo de tilapia nilótica

OpenAIRE

Oviedo P, Misael; Brú C, Samir; Atencio G, Víctor; Pardo C, Sandra

2013-01-01

RESUMENObjetivo. Identificar las áreas con alta potencialidad para el cultivo de tilapia nilótica en la región costera de Córdoba, Colombia. Materiales y métodos. Cinco capas de información fueron incorporadas en un sistema de información geográfica: ubicación potencial de estanques, calidad del suelo, calidad del agua, infraestructura vial, población, limitantes y restricciones. Se recopiló información cartográfica, se revisaron los planes de ordenamiento territorial (POT) de los municipios ...

Rezension von: Karin Schwiter: Lebensentwürfe. Junge Erwachsene im Spannungsfeld zwischen Individualität und Geschlechternormen. Frankfurt am Main u.a.: Campus Verlag 2011.

Directory of Open Access Journals (Sweden)

Heike Kahlert

2011-10-01

Full Text Available Karin Schwiter untersucht in der vorliegenden Studie, wie junge Erwachsene über ihre Zukunftspläne sprechen und welche Vorstellungen bezüglich ihrer Zukunft sie dabei entwerfen. Die Untersuchung zeichnet sich gegenüber älteren Forschungen zu diesem Thema unter anderem aus durch einen Geschlechtervergleich, die raumzeitliche Fokussierung auf die Deutschschweiz sowie ein diskursanalytisches Vorgehen in Anlehnung an Foucault. Das Ergebnis ist ein anregendes Buch, in dem die Autorin auf der Basis der Erzählungen von 24 jungen Frauen und Männern gesellschaftstheoretische Deutungen und Ausblicke entwickelt. Diese belegen, wie sich neoliberale Ideen von Individualität und fortbestehende Geschlechternormen miteinander so verschränken, dass Thematisierungen geschlechtlicher Ungleichheit kaum mehr möglich scheinen.

Standard test method for conducting drop-weight test to determine nil-ductility transition temperature of ferritic steels

CERN Document Server

American Society for Testing and Materials. Philadelphia

2006-01-01

1.1 This test method covers the determination of the nil-ductility transition (NDT) temperature of ferritic steels, 5/8 in. (15.9 mm) and thicker. 1.2 This test method may be used whenever the inquiry, contract, order, or specification states that the steels are subject to fracture toughness requirements as determined by the drop-weight test. 1.3 The values stated in inch-pound units are to be regarded as the standard. 1.4 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

Review: Karin Reiber (2005. Organisation im Spiegel der Regula Benedicti [Organisation in Reflection of Regula Benedicti

Directory of Open Access Journals (Sweden)

Jürgen Rausch

2007-01-01

Full Text Available For 1500 years, the monastic life of the Benedictines has been defined by rules dating from the time of the first foundation of the order, suggesting an organizational structure that has outlasted historical upheavals and changes. Starting from a new understanding of organisational development as organisational learning, Karin REIBER has looked for clues to organisational formation and learning through a hermeneutic textual analysis of the Regula Benedicti of the 6th Century. Within a theoretical framework, REIBER develops three dimensions of organisational formation and three stages of organisational learning. In a historical reconstruction, the author analyses the text of the Regula Benedicti. In a second section, REIBER adapts and interprets the results of the hermeneutic analysis through a double three-stage theoretical model. She works out interesting aspects for organisational learning, which relate individual learning to organisational learning in favour of members of the organisation, for which consideration for individuality forms a part of the leadership concept and as a framework for social relationships, establishing an informal organisational structure beside the formal one. This illuminating work leads to an integrated concept of organisational learning, which extends the notion of tradition as a characteristic feature of an innovative organisation and which, through continuity and topicality, can hence guarantee the continued existence of modern organisations in the future. URN: urn:nbn:de:0114-fqs070174

Determinación y prevalencia de Mycobacterium spp., en tilapia nilótica (Oreochromis niloticus cultivada en Campeche, México

Directory of Open Access Journals (Sweden)

Maurilio Lara-Flores

2013-03-01

Full Text Available Objetivo. Determinar la presencia y prevalencia de Mycobacterium spp., en granjas de tilapia nilótica (Oreochromis niloticus en el Municipio de Champotón, Campeche, México. Materiales y métodos. La colecta de organismos se realizó en tres granjas de cultivo de tilapia nilótica del municipio de Champotón, Campeche, México. Los organismos se examinaron externa e internamente y se tomó una muestra de riñón la cual fue sembrada en forma de estría en medios de cultivo: Löwesntein-Jensen, TCBS, KF y en TSA; las placas fueron incubadas a 35°C de 24 a 48 horas, los órganos fueron fijados en formalina tamponada al 10% para ser procesados para histología de rutina para análisis posteriores. Asimismo, muestras de cultivo bacteriológico y de tejido fueron teñidas con la técnica de Ziel-Neelsen con el fin de observar la presencia de bacilos ácido-alcohol resistentes. Resultados. Los resultados obtenidos sugieren que la presencia de Mycobacterium spp., es constante y en alta prevalencia y puede ser un factor que este mermando la rentabilidad del cultivo. Conclusiones. La presencia de Mycobacterium spp., representa un riesgo para el cultivo de tilapia en el municipio de Champotón, por ser una enfermedad muy persistente y difícil de erradicar una vez ocurrido e brote de infección, por lo cual es importante llevar estudios más detallados de la presencia de este género bacteriano, así como, medidas de prevención y dispersión de este patógeno en los cultivos adyacentes.

Potencialidad de la región costera de Córdoba -Colombia- para el cultivo de tilapia nilótica

Directory of Open Access Journals (Sweden)

Misael Oviedo P.

2013-11-01

Full Text Available Objetivo. Identificar las áreas con alta potencialidad para el cultivo de tilapia nilótica en la región costera de Córdoba, Colombia. Materiales y métodos. Cinco capas de información fueron incorporadas en un sistema de información geográfica: ubicación potencial de estanques, calidad del suelo, calidad del agua, infraestructura vial, población, limitantes y restricciones. Se recopiló información cartográfica, se revisaron los planes de ordenamiento territorial (POT de los municipios costeros, se obtuvieron imágenes de satélite de la zona y se tomaron muestras de agua y suelo; esta información fue evaluada, organizada e introducida en la base de datos de sistemas de información geográfica (SIG. Se aplicaron herramientas de análisis espacial y se establecieron modelos de análisis que permitieron la generación e integración de los diferentes temas y la construcción final del mapa de aptitud para el cultivo de tilapia. Resultados. El 2% del área de estudio resultó apta para el cultivo de tilapia nilótica. El alto índice de necesidades básicas insatisfechas (NBI y las deficiencias en la infraestructura vial tuvieron efecto negativo sobre la potencialidad para la tilapicultura. Altas concentraciones de hierro y ligera acidez en algunas áreas posibilitan la presencia de suelos sulfatados ácidos. La alta turbidez y sólidos suspendidos afectaron la calidad del agua, además de la reducida capacidad de drenaje que en algunas áreas evidencian los riesgos de inundación. Conclusiones. El municipio de San Antero presentó la mejor aptitud para el cultivo de tilapia; sin embargo el área deltaico-estuarina, los ambientes lacustres y sus alrededores en la cuenca baja del Sinú, no resultaron aptos.

Caracterización de coproductos de la industria del fileteado de tilapia nilótica (oreochromis niloticus) y trucha arcoíris (oncorhynchus mykiss) en colombia

OpenAIRE

Osorio, A.; Wills, A.; Muñoz, A. P.

2013-01-01

La industria del fileteado de tilapia y trucha genera cantidades significativas de coproductos de los cuales no existe suficiente información disponible sobre su composición y calidad. Esta investigación determinó algunos componentes nutricionales y microbiológicos de coproductos obtenidos en plantas exportadoras de filetes de tilapia nilótica y trucha arcoíris en Colombia. El esqueleto mostró el mayor aporte de cenizas (tilapia: 14,12 ± 0,16%; trucha: 6,18 ± 0,06%), calcio (tilapia: 5,7...

From Camps to Conversations in Critical Security Studies

DEFF Research Database (Denmark)

Hansen, Lene

2008-01-01

The article reviews the book "Critical Approaches to International Security," by Karin M. Fierke......The article reviews the book "Critical Approaches to International Security," by Karin M. Fierke...

Study on characteristic differences of wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5 + 1Dy10 gene

International Nuclear Information System (INIS)

Sun Yan; Zhang Hongji; Liu Dongjun; Qi Qianqian; Yang Shuping; Guo Yipan; Ma Shumei; Liu Wenlin; Wang Guangjin; Zhao Wei

2012-01-01

Use wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5 + 1Dy10 gene, characteristics differences have been studied. The two-year results showed that the statistical differences in seed quality parameters, farinogram parameters, extensigram parameters, botany characters and main agricultural characters between 1Ax1 and 1Ax2* were not significant. We considered that 08K860 and 08K871 are similar in hereditary background, 1Ax1 and 1Ax2* have identical contribute on quality. Breeder should attach to 1Ax1 and 1Ax2* identically on wheat breeding. (authors)

Study on characteristic differences of wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5+1Dy10 gene

International Nuclear Information System (INIS)

Sun Yan; Zhang Hongji; Liu Dongjun; Qi Qianqian; Yang Shuping; Guo Yifan; Ma Shumei; Liu Wenlin; Wang Guangjin; Zhao Wei

2011-01-01

Use wheat 1Ax1 and 1Ax2 * NILS obtained by transgenic HMW-GS 1Dx5+1Dy10 gene, characteristics differences have been studied. The two-year results showed that the statistical differences in seed quality parameters, farinogram parameters, extensigram parameters, botany characters and main agricultural characters between 1Ax1 and 1Ax2 * were not significant. We considered that 08K860 and 08K871 are similar in hereditary background, 1Ax1 and 1Ax2 * have identical contribute on quality. Breeder should atlach to 1Ax1 and 1Ax2 * identically on wheat breeding. (authors)

Inimesed ostavad kinnisvara asemel üha rohkem teemante / Kerli Nõu

Index Scriptorium Estoniae

Nõu, Kerli

2005-01-01

Eesti gemmoloogid Karin Eensaar ja Heli Kuulmann teemantidest kui investeeringust. Kommenteerib Karin Eensaar. Lisad: Maapõu peidab ülivanu kivikesi. Kultusehe number kaks: pärlikee; De Beers. Alrosa. BHP Billiton, Rio Tinto

Comprehensive gene expression analysis of the NAC gene family under normal growth conditions, hormone treatment, and drought stress conditions in rice using near-isogenic lines (NILs) generated from crossing Aday Selection (drought tolerant) and IR64.

Science.gov (United States)

Nuruzzaman, Mohammed; Sharoni, Akhter Most; Satoh, Kouji; Moumeni, Ali; Venuprasad, Ramiah; Serraj, Rachid; Kumar, Arvind; Leung, Hei; Attia, Kotb; Kikuchi, Shoshi

2012-05-01

The NAC (NAM, ATAF1/2 and CUC2) genes are plant-specific transcriptional factors known to play diverse roles in various plant developmental processes. We describe the rice (Oryza sativa) OsNAC genes expression profiles (GEPs) under normal and water-deficit treatments (WDTs). The GEPs of the OsNAC genes were analyzed in 25 tissues covering the entire life cycle of Minghui 63. High expression levels of 17 genes were demonstrated in certain tissues under normal conditions suggesting that these genes may play important roles in specific organs. We determined that 16 genes were differentially expressed under at least 1 phytohormone (NAA, GA3, KT, SA, ABA, and JA) treatment. To investigate the GEPs in the root, leaf, and panicle of three rice genotypes [e.g., 2 near-isogenic lines (NILs) and IR64], we used two NILs from a common genetic combination backcross developed by Aday Selection and IR64. WDTs were applied using the fraction of transpirable soil water at severe, mild, and control conditions. Transcriptomic analysis using a 44K oligoarray from Agilent was performed on all the tissue samples. We identified common and specific genes in all tissues from the two NILs under both WDTs, and the majority of the OsNAC genes that were activated were in the drought-tolerant IR77298-14-1-2-B-10 line compared with the drought-susceptible IR77298-14-1-2-B-13 or IR64. In IR77298-14-1-2-B-10, seventeen genes were very specific in their expression levels. Approximately 70 % of the genes from subgroups SNAC and NAM/CUC3 were activated in the leaf, but 37 % genes from subgroup SND were inactivated in the root compared with the control under severe stress conditions. These results provide a useful reference for the cloning of candidate genes from the specific subgroup for further functional analysis.

New Quasi Low-Dimensional 4d and 5d Transition Metal Oxides with Correlated Electronic Properties - Synthesis and Characterizations

Science.gov (United States)

2016-02-17

Rong Li, Artem M. Abakumov, Mark. Croft, Alexander Ignatov, Peter W Stephens, Jason P. Hodges, P?emysl Van?k, Craig J. Fennie ,, Karin M. Rabe...Brian Craig Fennie , Karin Rabe, Stanislav Kamba and M. Greenblatt, submitted to Inorg. Chem. 1-2016 14. First evidence of the multiferroicity in

Hikâyet-i Nil-i Mübârek Üzerine The Story Of The Holy Nile

Directory of Open Access Journals (Sweden)

Yusuf Ziya SÜMBÜLLÜ

2012-12-01

yakın temasa geçmiştir. Bu temas, öncelikle dil ve edebiyat sahasında etkili olmuştur. Tercüme ve adaptasyon faaliyetleri ile ivme kazanan bu kültürel etkileşim döneminde, dini-ahlâki-didaktik nitelikte pek çok eser, Türk Edebiyatı sahasında bu suretle var olabilmiştir. Bahsi geçen eserlerin ana hatlarıyla ideal insan, ideal toplum prensibi ekseninde, ağırlıklı olarak dini ve ahlâki içerikli bir kimlik ile karşımıza çıktığı ifade edilebilir ki bu türden eserlerden bir bölümünü de kıssalar oluşturur. Nîl Nehri���nin kaynağına duyulan merak ve bu merakın giderilmesi adına başlatılan dini-fantastik içerikli maceralı yolculuğu anlatan “Hikâye-i Abdülmecid” adlı kıssa da bahsi geçen türün özelliklerini barındıran bir eser olmakla çalışmamızın genel çerçevesini oluşturmaktadır. Bilinmeyene duyulan merak ve bu merakın giderilmesi adına söylenenler veya icra edilenler, ister istemez etraflarında dini, sihri, mistik olağanüstülüklerin iç içe geçerek işlenmesi sonucunu doğurabilir. “Hikâye-i Abdülmecid” adlı eserde, Abdülmecid’in Nil Nehri’nin kaynağını arayışı, halkın Cennet, Cebrail gibi dini konulardaki algısını yansıtıyor olmanın yanında, Kevser, Nil, Zemzem gibi suların kaynak olarak kutsal bir kökene nasıl bağlanmış olduğuna da işaret etmektedir. Nil Nehri, Fırat Nehri gibi “Mübarek” sıfatı ile yüceltilmiş ve İslâm nehri olarak sayılmıştır. Bu sıfat, nehrin Mısır ve havalisindeki bütün zirai hayatın doğal olarak da insan hayatının can damarı olması münasebetiyle olabileceği gibi, nehrin kaynağının oldukça uzun bir süre tespit edilememesiyle de ilgili olsa gerektir ki Nîl Nehri’nin kaynağının gizeminin oldukça eski ve sık işlenmiş bir tema olduğunu da burada ifade etmek gerekecektir.

Ideed, mis muudavad maailma

Index Scriptorium Estoniae

2012-01-01

Noorte ettevõtluskonkursi Ajujaht finalistidest: Richard Murutar (Dolphin), Andrus Purde (Achoo), Kalev Külaase, Ülane Vilumets, Rait Kapp (Kohalik Giid), Mart Raus, Vahur Mäe (Grillcube), Dmitri Kuznetsov, Anna Agronova, Julia Abolina, Anatoly Loginov (Healthiest.mobi), Karin Juhe, Karin Aruots (Korsid), Raino Sinisalu, Märt Pikkani, Arkadi Tammik, Varje Papp (Raybike), Egle Loit, Kair Käsper (Pille toidukott)

The Nuclear Death Domain Protein p84N5; A Candidate Breast Cancer Susceptibility Gene

Science.gov (United States)

2007-05-01

hallmarks of cancer. Cell 100, 57-70, 2000. 35. Karin M, Cao Y, Greten FR, Li ZW. NF-kappaB in cancer: from innocent bystander to major culprit. Nat Rev...D., and Weinberg, R. A. (2000) Cell 100, 57-70 46. Karin, M., Cao, Y., Greten , F. R., and Li, Z. W. (2002) Nat Rev Cancer 2, 301-310 47. Cogswell, P

The Role of Stat3 Activation in Androgen Receptor Signaling and Prostate Cancer

Science.gov (United States)

2006-07-01

S. C. & Xiao, G. (2003) Cancer Metastasis Rev. 22, 405–422. 10. Karin, M. & Greten , F. R. (2005) Nat. Rev. Immunol. 5, 749–759. 11. Karin, M., Cao, Y... Greten , F. R. & Li, Z. W. (2002) Nat. Rev. Cancer 2, 301–310. 12. Fan, C. M. & Maniatis, T. (1991) Nature 354, 395–398. 13. Betts, J. C. & Nabel, G

Efecto del procesamiento de la dieta sobre el desempeño productivo de tilapia nilótica (Oreochromis niloticus var. Chitralada en un ciclo comercial de producción

Directory of Open Access Journals (Sweden)

F. Aguilar

2010-06-01

Full Text Available Este estudio evaluó el efecto del procesamiento de alimento (extruido frente a peletizadosobre el desempeño productivo de tilapia nilótica durante un ciclo comercial deproducción. Se utilizaron 504 alevinos reversados que fueron alimentados con un sistemade alimentación por fases (alevinaje, crecimiento 1, crecimiento 2 y finalizacióncon niveles de proteína cruda para cada fase de 43,10%, 36,40%, 31,50% y 28,65%respectivamente. Las dietas fueron procesadas (extruidas o peletizadas en micro extrusorapara laboratorio Exteec® (Exteec máquinas, Brasil. El análisis de los indicadoresacumulados mostró que el proceso de extrusión generó un mayor crecimiento y unamayor eficiencia en el uso de alimento hasta la fase de crecimiento 2 (P

GmSALT3, which Confers Improved Soybean Salt Tolerance in the Field, Increases Leaf Cl– Exclusion prior to Na+ Exclusion but does not Improve Early Vigour under Salinity

Directory of Open Access Journals (Sweden)

Ying Liu

2016-09-01

Full Text Available Soil salinity reduces soybean growth and yield. The recently identified GmSALT3 (Glycine max salt Tolerance-associated gene on chromosome 3 has the potential to improve soybean yields in salinized conditions. To evaluate the impact of GmSALT3 on soybean performance under saline or non-saline conditions, three sets of near isogenic lines (NILs, with genetic similarity 95.6-99.3% between each pair of NIL-T and NIL-S, were generated from a cross between two varieties, 85-140 (salt-sensitive, S and Tiefeng 8 (salt-tolerant, T by using marker-assisted selection. Each NIL; 782-T, 820-T and 860-T, contained a common ~1000 kb fragment on chromosome 3 where GmSALT3 was located. We show that GmSALT3 does not contribute to an improvement in seedling emergence rate or early vigour under salt stress. However, when 12-day-old seedlings were exposed to NaCl stress, the NIL-T lines accumulated significantly less leaf Na+ compared with their corresponding NIL-S, while no significant difference of K+ concentration was observed between NIL-T and NIL-S; the magnitude of Na+ accumulation within each NIL-T set was influenced by the different genetic backgrounds. In addition, NIL-T lines accumulated less Cl– in the leaf and more in the root prior to any difference in Na+; in the field they accumulated less pod wall Cl– than the corresponding NIL-S lines. Under non-saline field conditions, no significant differences were observed for yield related traits within each pair of NIL-T and NIL-S lines, indicating there was no yield penalty for having the GmSALT3 gene. In contrast, under saline field conditions the NIL-T lines had significantly greater plant seed weight and 100-seed weight than the corresponding NIL-S lines, meaning GmSALT3 conferred a yield advantage to soybean plants in salinized fields. Our results indicated that GmSALT3 mediated regulation of both Na+ and Cl– accumulation in soybean, and contributes to improved soybean yield through maintaining a

Decision-making framework for testing and grouping of nanomaterials

OpenAIRE

Landsiedel, Robert

2015-01-01

A ‘multiple perspective’ framework for the grouping of nanomaterials Robert Landsiedel presenting the results of the ECETOC Nano Task Force (Josje H.E. Arts a, Mackenzie Hadi b, Athena M. Keene c, Reinhard Kreiling d, Delina Lyon e, Monika Maier f, Karin Michel g, Thomas Petry h, Ursula G. Sauer i, David Warheit j, Karin Wiench k, Robert Landsiedel k) a AkzoNobel, Technology and Engineering, Arnhem, Netherlands b Shell Health, Shell International B.V., The Hague, Netherlands...

Several loadings and stresses of first wall of SiC with metal liner on conceptual design of moving ring reactor 'KARIN-1'

International Nuclear Information System (INIS)

Nishikawa, Masahiro; Tachibana, Eizaburo; Watanabe, Kenji; Fujiie, Yoichi.

1983-01-01

On conceptual design of moving ring reactor ''KARIN-I'' (Output: 1850 MWe), the first wall of SiC with metal liner is considered by reason that SiC ceramics has specific features of excellent radiation damage resistance in fast neutron spectra and a very low residual radioactivity, and that the thin metal liner has good compatibility with liquid lithium and good vaccum-tight, however, a extent electromagnetic interaction. The electromagnetic force applied on the metal liner and several pressure losses of liquid lithum flow are estimated, and these forces correspond to the fluid mechanical loading on SiC first wall. Thermal loading by neutron flux is calculated on the first wall to obtain temperature distributions along the flow direction and toward the wall thickness. At the outlet of the burning section, the surface temperature of SiC rises to the value of 825 0 C on plasma side and on the metal liner, it rises to the value of 540 0 C. Finally, the stress analysis is performed. The thermal stress is about one order larger than the stress induced by the fluid mechanical loading. At the inlet of the burning section, the average tensile stress of 22.4kg/mm 2 is induced on the outer side of SiC wall, and on the inner side, the average compressive stress of -26.1kg/mm 2 is induced. At the outlet of the burning section, the tensile stress is found to oscillate between 25.5kg/mm 2 and 27.3kg/mm 2 on the outer side of SiC wall by frequency of 1 Hz, and on the inner side, the compressive stress also oscillates between -21.6kg/mm 2 and -29.0kg/mm 2 by the same frequency. These stresses are within the value of fracture stress, (72.5kg/mm 2 ). Difficult residual problems on the first wall are also discussed. (author)

Teatri aastaauhindade nominendid 2006. aasta loomingu eest

Index Scriptorium Estoniae

2007-01-01

Nimekiri nominentidest teatri aastaauhinnale sõna-, muusika-, balleti-, tantsulavastuste ja teatri tehnilise töötaja auhinna kategoorias. Kunstnikuauhind: Vladimir Anshon - "Nii see on (kui teile nii näib)" (Tallinna Linnateater) ja "Valged ööd" (Theatrum), Andris Freibergs - "Karin. Indrek. Tõde ja õigus. 4." (Tallinna Linnateater), Kristine Pasternaka - kostüümid lavastustele "Karin. Indrek. Tõde ja õigus. 4." ja "Nii see on (kui teile nii näib" (Tallinna Linnateater), Ene-Liis Semper - "Kuningas Ubu" (NO99), Ervin Õunapuu -"Sada aastat..." (Vanemuine).

Effect of Ppd-1 on the expression of flowering-time genes in vegetative and reproductive growth stages of wheat.

Science.gov (United States)

Kitagawa, Satoshi; Shimada, Sanae; Murai, Koji

2012-01-01

The photoperiod sensitivity gene Ppd-1 influences the timing of flowering in temperate cereals such as wheat and barley. The effect of Ppd-1 on the expression of flowering-time genes was assessed by examining the expression levels of the vernalization genes VRN1 and VRN3/WFT and of two CONSTANS-like genes, WCO1 and TaHd1, during vegetative and reproductive growth stages. Two near-isogenic lines (NILs) were used: the first carried a photoperiod-insensitive allele of Ppd-1 (Ppd-1a-NIL), the other, a photoperiod-sensitive allele (Ppd-1b-NIL). We found that the expression pattern of VRN1 was similar in Ppd-1a-NIL and Ppd-1b-NIL plants, suggesting that VRN1 is not regulated by Ppd-1. Under long day conditions, VRN3/WFT showed similar expression patterns in Ppd-1a-NIL and Ppd-1b-NIL plants. However, expression differed greatly under short day conditions: VRN3/WFT expression was detected in Ppd-1a-NIL plants at the 5-leaf stage when they transited from vegetative to reproductive growth; very low expression was present in Ppd-1b-NIL throughout all growth stages. Thus, the Ppd-1b allele acts to down-regulate VRN3/WFT under short day conditions. WCO1 showed high levels of expression at the vegetative stage, which decreased during the phase transition and reproductive growth stages in both Ppd-1a-NIL and Ppd-1b-NIL plants under short day conditions. By contrast to WCO1, TaHd1 was up-regulated during the reproductive stage. The level of TaHd1 expression was much higher in Ppd-1a-NIL than the Ppd-1b-NIL plants, suggesting that the Ppd-1b allele down-regulates TaHd1 under short day conditions. The present study indicates that down-regulation of VRN3/WFT together with TaHd1 is the cause of late flowering in the Ppd-1b-NIL plants under short day conditions.

An assessment of the process capabilities of nanoimprint lithography

Science.gov (United States)

Balla, Tobias; Spearing, S. Mark; Monk, Andrew

2008-09-01

Nanoimprint lithography (NIL) is an emerging nanofabrication tool, able to replicate imprint patterns quickly and at high volumes. The present study was performed in order to define the capabilities of NIL, based on a study of published research and to identify the application areas where NIL has the greatest potential. The process attributes of different NIL process chains were analysed, and their process capabilities were compared to identify trends and process limitations. The attributes chosen include the line width, relief height, initial resist thickness, residual layer thickness, imprint area and line width tolerances. In each case well-defined limits can be identified, which are a direct result of the mechanisms involved in the NIL process. These quantitative results were compared with the assessments of individuals in academia and within the microfabrication industry. The results suggest NIL is most suited to producing photonic, microfluidic and patterned media applications, with photonic applications the closest to market. NIL needs to address overlay alignment issues for wider use, while an analysis is needed for each market, as to whether NIL adds value.

Житиейный текст в «Соборнике» Нила Сорского: перевод или пересказ?(The Vitae of Nil Sorskii’s “Sobornik”: Translation or Periphrasis?

Directory of Open Access Journals (Sweden)

Tamara Lönngren

2003-02-01

Full Text Available This paper attempts to show that Nil Sorskii, the author of the well-known three-volume "Sobornik", in compiling this collection of ancient Greek vitae used Greek texts as well as Slavonic translations. He compared the Slavonic texts with the Greek originals and corrected their difficult archaic language, thus turning it into the understandable simple Russian language of his own time.

Effect of Iron Deficiency Anemia on Intellectual Performance of ...

African Journals Online (AJOL)

Results: Seventy six of these children had iron deficiency anemia based on their .... Anorexia. 09. Nil. Pica. 07. 03. Dizziness. 04. Nil. Headache. 03. Nil. Table 4: Laboratory investigation ... environment on intelligence, the effect of nutrition.

Final report NIL/HTI: Sectional report 'Inspections'. Eindrapport NIL/HTI: Deelproject 'Inspecties'

Energy Technology Data Exchange (ETDEWEB)

Hulshof, H J.M.; Van Gestel, P J; Dufour, L B [KEMA Inspection Technology, Arnhem (Netherlands)

1994-01-01

The results of the title project are important for the monitoring of the condition of components in electric power plants that are exposed to high temperatures for a long period. A measuring method (SPICA) has been developed, by which the elongation distribution on the surface of a construction component can be analyzed. The measurement is based on making an optical fingerprint of circa 1 cm[sup 2] of the surface, applying the parameter surface roughness. A photo or video shot can show the differences of the reflected light in the form of light and dark spots (specks). If the surface stretches, the roughness profile changes and so does the pattern of specks. By comparing the takes before and after a load period the deformation can be determined and with that the material fatigue. By means of an image computer the images can easily be manipulated and stored. Statistical methods determine the number, the location and the periodicity, by which replicas must be produced to provide reliable data for the residual service life

Tokyo / Karin Thea

Index Scriptorium Estoniae

Karin, Thea

2013-01-01

Tokyo vaatamisväärtused: Sky Tree teletorn, Takeshita Dori jalakäijate tänav, Asakusa linnaosa, The Gate Hotel, Tokyo metroo, Ryogoku Kokugikan, Nippon Kasgaku Miraikan ning Jaapani suurim kalaturg Tsukiji

Cuticular wax accumulation is associated with drought tolerance in wheat near-isogenic lines

Directory of Open Access Journals (Sweden)

Jianmin Song

2016-11-01

Full Text Available Previous studies have shown that wheat grain yield is seriously affected by drought stress, and leaf cuticular wax is reportedly associated with drought tolerance. However, most studies have focused on cuticular wax biosynthesis and model species. The effects of cuticular wax on wheat drought tolerance have rarely been studied. The aims of the current study were to study the effects of leaf cuticular wax on wheat grain yield under drought stress using the above-mentioned wheat NILs and to discuss the possible physiological mechanism of cuticular wax on high grain yield under drought stress. Compared to water-irrigated (WI conditions, the cuticular wax content (CWC in glaucous and non-glaucous NILs under drought-stress (DS conditions both increased; mean increase values were 151.1% and 114.4%, respectively, which was corroborated by scanning electronic microscopy images of large wax particles loaded on the surfaces of flag leaves. The average yield of glaucous NILs was higher than that of non-glaucous NILs under DS conditions in 2014 and 2015; mean values were 7368.37 kg·ha-1 and 7103.51 kg·ha-1. This suggested that glaucous NILs were more drought-tolerant than non-glaucous NILs (P = 0.05, which was supported by the findings of drought tolerance indices TOL and SSI in both years, the relatively high water potential and relative water content, and the low ELWL. Furthermore, the photosynthesis rate (Pn of glaucous and non-glaucous wheat NILs under DS conditions decreased by 7.5% and 9.8%, respectively; however, glaucous NILs still had higher mean values of Pn than those of non-glaucous NILs, which perhaps resulted in the higher yield of glaucous NILs. This could be explained by the fact that glaucous NILs had a smaller Fv/Fm reduction, a smaller PI reduction and a greater ABS/RC increase than non-glaucous NILs under DS conditions. This is the first report to show that wheat cuticular wax accumulation is associated with drought tolerance. Moreover

Fine mapping of S37, a locus responsible for pollen and embryo sac sterility in hybrids between Oryza sativa L. and O. glaberrima Steud.

Science.gov (United States)

Shen, Yumin; Zhao, Zhigang; Ma, Hongyang; Bian, Xiaofeng; Yu, Yang; Yu, Xiaowen; Chen, Haiyuan; Liu, Linglong; Zhang, Wenwei; Jiang, Ling; Zhou, Jiawu; Tao, Dayun; Wan, Jianmin

2015-11-01

Hybrid sterility locus S37 between Oryza glaberrima and Oryza sativa results in both pollen and embryo sac sterility. Interspecific crossing between African cultivated rice Oryza glaberrima and Oryza sativa cultivars is hindered by hybrid sterility. To dissect the mechanism of interspecific hybrid sterility, we developed a near-isogenic line (NIL)-S37 using Dianjingyou1 (DJY1) as the recipient parent and an African cultivated rice variety as the donor parent. Empty pollen and embryo sac sterility were observed in F1 hybrids between DJY1 and NIL-S37. Cytological analyses showed that pollen abortion in the F1 hybrids occurred at the late binucleate stage due to a failure of starch accumulation in pollen grains. In addition, partial abortion of the embryo sac in the F1 hybrid was observed during function megaspore developing into mature embryo sac. Molecular analysis revealed that the semi-sterility was largely caused by the abortion of male and female gametophytes carrying the S37 allele from DJY1. A population of 25,600 plants derived from the hybrid DJY1/NIL-S37 was developed to fine map S37. Based on the physical location of molecular markers, S37 locus was finally delimited to a region of 205 kb on the short arm of chromosome 1 in terms of reference sequences of cv. Nipponbare. Interestingly, an about 97-kb DNA segment was deleted in the NIL-S37 based on BAC clone information of O. glaberrima. Fifty-four open reading frames (ORF) were predicted in this 205-kb region of DJY1, whereas only 31 ORFs were in that of NIL-S37. These results are valuable for cloning of S37 gene and further breaking reproductive isolation between Oryza glaberrima and Oryza sativa cultivars, as well as marker-assisted transferring of the corresponding neutral allele in rice breeding programs.

Välieluruumi ajakiri Õu = Õu, the Landscape Architecture Magazine

Index Scriptorium Estoniae

2016-01-01

Välieluruumi ajakirjast "Õu", peatoimetaja Anna-Liisa Unt, kolleegium Merle Karro-Kalberg ja Karin Bachmann, kujundaja Marje Eelmaa (Tuumik Stuudio). Maastikuarhitektuuri aastapreemia 2016 "Maastikuarhitektuuri tegu" laureaat

Muzei KUMU priglashajet russkih utshenikov / Andrei Babin

Index Scriptorium Estoniae

Babin, Andrei

2007-01-01

KUMU hariduskeskuse uus projekt "Remark"aitab vene õppekeelega koolide õpilastel ja lasteaedade lastel põhjalikumalt tutvuda eesti kunstiklassikaga. Kommenteerivad projekti koordinaator Jelena Levtshenkova ja programmijuht Karin Taidre

Comparison studies of rheological and thermal behaviors of ionic liquids and nanoparticle ionic liquids.

Science.gov (United States)

Xu, Yiting; Zheng, Qiang; Song, Yihu

2015-08-14

Novel nanoparticle ionic liquids (NILs) are prepared by grafting modified nanoparticles with long-chain ionic liquids (ILs). The NIL behaves like a liquid at ambient temperature. We studied the rheological behavior of the IL and NIL over the range of 10-55 °C and found an extraordinary difference between the IL and NIL: a small content of nanosilica (7%) moderately improves the crystallinity by 7% of the poly(ethylene glycol) (PEG) segment in the IL, and it improves the dynamic moduli significantly (by 5 times at room temperature). It retards the decay temperature (by 10 °C) of the dynamic moduli during heating as well. The thermal rheological hysteresis observed during heating-cooling temperature sweeps is ascribed to the melting-recrystallization of the PEG segments. Meanwhile, the IL and NIL express accelerated crystallization behavior in comparison with the oligomeric anion. For the first time, we find that ILs and NILs are able to form nanoparticle-containing spherulites at room temperature after long time aging.

Radiopharmaceuticals 1994. Nil desperandum

International Nuclear Information System (INIS)

Cox, P.H.; Meyer, G.J.

1995-01-01

On the basis of the discussions at a symposium held in Duesseldorf and attended by representatives of various interested bodies, European legislation as it affects radiopharmaceuticals is reviewed. Due consideration is given to the new, centralised and decentralised, registration procedures, effective since 1 January 1995. The dossier required to support an application for marketing authorisation is discussed, separate consideration being given to single-photon emitters, therapeutic radio-nuclides and positron-emitting radiopharmaceuticals. The role of the European Pharmacopoiea is also considered. It is concluded that the new, modified procedures for the registration of medicinal products in the European Union may actually inhibit free availability of radiopharmaceuticals within the Community, and that there is a strong case for modification of the European Directives so that radiopharmaceuticals are placed in a separate category to therapeutic drugs, with less stringent registration requirements. (orig.)

Rotermanni soolalao juurde rajatakse urbanistlik park / Kertu Kalmus

Index Scriptorium Estoniae

Kalmus, Kertu

2008-01-01

Eesti Arhitektuurimuuseumi korraldatud Rotermanni soolalao esise urbanistliku pargi võistluse võitis Villem Tomiste töö "Piazza". Žürii esimees Eesti Arhitektuurimuuseumi direktor Karin Hallas-Murula

Status of Standardization Projects, Quarter Ending 30 June 1992

Science.gov (United States)

1992-06-30

N 8940 A724 NIL H XXX GL HAM AND CHEESE FONDUE POW GL B4 922 932 932 A GL NS 8940 A725 NIL P XXX GL POTATOES LYONNAISE POW GL 84 922 932 932 A GL N...922 932 932 A GL N 8940 A699 NIL P 44182GL NOT 2 POTATOES MASHED POW GL F2 922 932 932 A GL N 8940 A700 MJIL A XXX GL APPLE BROWN BETTY POWDER GL B4...932 A GL N 8940 A708 NIL P 44182GL NOT 1 POTATOES MASHED POW GL B5 922 932 932 A GL N 8940 A709 NIL S 44170 GL NOT 1 SPAGHETTI SAUCE GL 85 922 923 923

Novel magnetic wire fabrication process by way of nanoimprint lithography for current induced magnetization switching

Science.gov (United States)

Asari, Tsukasa; Shibata, Ryosuke; Awano, Hiroyuki

2017-05-01

Nanoimprint lithography (NIL) is an effective method to fabricate nanowire because it does not need expensive systems and this process is easier than conventional processes. In this letter, we report the Current Induced Magnetization Switching (CIMS) in perpendicularly magnetized Tb-Co alloy nanowire fabricated by NIL. The CIMS in Tb-Co alloy wire was observed by using current pulse under in-plane external magnetic field (HL). We successfully observed the CIMS in Tb-Co wire fabricated by NIL. Additionally, we found that the critical current density (Jc) for the CIMS in the Tb-Co wire fabricated by NIL is 4 times smaller than that fabricated by conventional lift-off process under HL = 200Oe. These results indicate that the NIL is effective method for the CIMS.

Mereteemaline festival Melbourneìs / Sirje Jõgi

Index Scriptorium Estoniae

Jõgi, Sirje

2006-01-01

oktoobrikuu viimasel pühapäeval Soome majas, eestlaste ühendkoor Karin Adamsoni juhatusel avas ühisfestivali. "Kirjud Vestid" esitasid Taevo Vaikma loodud laulu, "Eiderattad" esinesid kolme tantsuga

Raamatureisid Veneetsiasse / Margus Haav

Index Scriptorium Estoniae

Haav, Margus, 1969-

2005-01-01

Arvustus: Girardi, Robert. Vaporetto 13 / ingl. k. tlk. Karin Suursalu. Tallinn : Kultuurileht, 2005. (Loomingu Raamatukogu) ; Raittila, Hannu. Canal Grande : [romaan] / tõlkinud Aivo Lõhmus. Tallinn : Varrak, 2003 (Moodne aeg)

Does low stomatal conductance or photosynthetic capacity enhance growth at elevated CO2 in Arabidopsis?

Science.gov (United States)

Easlon, Hsien Ming; Carlisle, Eli; McKay, John K; Bloom, Arnold J

2015-03-01

The objective of this study was to determine if low stomatal conductance (g) increases growth, nitrate (NO3 (-)) assimilation, and nitrogen (N) utilization at elevated CO2 concentration. Four Arabidopsis (Arabidopsis thaliana) near isogenic lines (NILs) differing in g were grown at ambient and elevated CO2 concentration under low and high NO3 (-) supply as the sole source of N. Although g varied by 32% among NILs at elevated CO2, leaf intercellular CO2 concentration varied by only 4% and genotype had no effect on shoot NO3 (-) concentration in any treatment. Low-g NILs showed the greatest CO2 growth increase under N limitation but had the lowest CO2 growth enhancement under N-sufficient conditions. NILs with the highest and lowest g had similar rates of shoot NO3 (-) assimilation following N deprivation at elevated CO2 concentration. After 5 d of N deprivation, the lowest g NIL had 27% lower maximum carboxylation rate and 23% lower photosynthetic electron transport compared with the highest g NIL. These results suggest that increased growth of low-g NILs under N limitation most likely resulted from more conservative N investment in photosynthetic biochemistry rather than from low g. © 2015 American Society of Plant Biologists. All Rights Reserved.

Advent Euroopa viienda õiega

Index Scriptorium Estoniae

1999-01-01

Esimesel advendil Tallinnas toimunud Taivo Pilleri jõuludemonstratsioonil osalesid edukalt ka kaks Ida-Viru lilleseadjat: Karin Lainjärv ja Marietta Rossmann; paremateks tunnistati Irmen Laving, Saale Halla, Heidi Haggi

Novel magnetic wire fabrication process by way of nanoimprint lithography for current induced magnetization switching

Directory of Open Access Journals (Sweden)

Tsukasa Asari

2017-05-01

Full Text Available Nanoimprint lithography (NIL is an effective method to fabricate nanowire because it does not need expensive systems and this process is easier than conventional processes. In this letter, we report the Current Induced Magnetization Switching (CIMS in perpendicularly magnetized Tb-Co alloy nanowire fabricated by NIL. The CIMS in Tb-Co alloy wire was observed by using current pulse under in-plane external magnetic field (HL. We successfully observed the CIMS in Tb-Co wire fabricated by NIL. Additionally, we found that the critical current density (Jc for the CIMS in the Tb-Co wire fabricated by NIL is 4 times smaller than that fabricated by conventional lift-off process under HL = 200Oe. These results indicate that the NIL is effective method for the CIMS.

Disaini abil edukaks / Bo Englund ; interv. Kai Lobjakas

Index Scriptorium Estoniae

Englund, Bo

2005-01-01

Euroopa Disainiühenduste büroost (Bureau of European Design Association - BEDA), rahvuslikust disainipoliitikast, Rootsi-Eesti disainikonverentsist "Innovatsioon läbi disaini - disaini oma tulevik" Viinistu Kunstimuuseumis. Kommentaar Karin Pauluselt

Pronksiööl küpsenud valus tõde / Gerda Kordemets ; intervjueeris Jüri Aarma

Index Scriptorium Estoniae

Kordemets, Gerda, 1960-

2009-01-01

ETV lavastuslike saadete toimetuse juhataja meenutab Tallinna Linnateatri lavastuse "Karin ja Indrek. Tõde ja õigus" Eesti Televisioonile lindistamist aprillis 2007. Lavastaja Elmo Nüganen, aluseks Tammsaare "Tõe ja õiguse" IV osa

75 FR 76482 - Federal Housing Administration (FHA): FHA Maximum Loan Limits for 2011

Science.gov (United States)

2010-12-08

... http://www.hud.gov/offices/adm/hudclips/letters/mortgagee/ . FOR FURTHER INFORMATION CONTACT: Karin B... be found at http://www.hud.gov/offices/adm/hudclips/letters/mortgagee/ mortgagee/. Dated: November 29...

Oliivipuude triloogia - mõnus suvine võrkkiige-lugemine / Mari Klein

Index Scriptorium Estoniae

Klein, Mari

2007-01-01

Tutvustus: Drinkwater, Carol. Oliiviistandus / tlk. Laine Hone. Tallinn : Varrak, 2004 ; Drinkwater, Carol. Oliivisaak / tlk. Eve-Reet Tammet. Tallinn : Varrak, 2997 ; Drinkwater, Carol. Oliivihooaeg / tlk. Lane Hone ja Karin Rita. Tallinn : Varrak, 2006

Kirgas klaas / Margit Aedla

Index Scriptorium Estoniae

Aedla, Margit, 1970-

2008-01-01

Klaasiga saab ruumi tuua kergust ja värvilise klaasiga lisada pilkupüüdvat aktsenti. Valik klaasist riiuleid (disainerid Aziz Sariyer, Karin Rashid, Jean Nouvel), laevalgusti (disainer Michiko Nakata), seinakell, diivanilaud

Deep rooting conferred by DEEPER ROOTING 1 enhances rice yield in paddy fields.

Science.gov (United States)

Arai-Sanoh, Yumiko; Takai, Toshiyuki; Yoshinaga, Satoshi; Nakano, Hiroshi; Kojima, Mikiko; Sakakibara, Hitoshi; Kondo, Motohiko; Uga, Yusaku

2014-07-03

To clarify the effect of deep rooting on grain yield in rice (Oryza sativa L.) in an irrigated paddy field with or without fertilizer, we used the shallow-rooting IR64 and the deep-rooting Dro1-NIL (a near-isogenic line homozygous for the Kinandang Patong allele of DEEPER ROOTING 1 (DRO1) in the IR64 genetic background). Although total root length was similar in both lines, more roots were distributed within the lower soil layer of the paddy field in Dro1-NIL than in IR64, irrespective of fertilizer treatment. At maturity, Dro1-NIL showed approximately 10% higher grain yield than IR64, irrespective of fertilizer treatment. Higher grain yield of Dro1-NIL was mainly due to the increased 1000-kernel weight and increased percentage of ripened grains, which resulted in a higher harvest index. After heading, the uptake of nitrogen from soil and leaf nitrogen concentration were higher in Dro1-NIL than in IR64. At the mid-grain-filling stage, Dro1-NIL maintained higher cytokinin fluxes from roots to shoots than IR64. These results suggest that deep rooting by DRO1 enhances nitrogen uptake and cytokinin fluxes at late stages, resulting in better grain filling in Dro1-NIL in a paddy field in this study.

Eerosest valgustatud / Rein Veidemann

Index Scriptorium Estoniae

Veidemann, Rein, 1946-

2002-01-01

Arvustus: Saarsen, Karin. Lõvi ja orhidee : [luuletused]. Tallinn : Eesti Raamat, 2002 ; Under, Marie. Under armastusest : [luuletused ja katkendid kirjadest] / valik ja järelsõna: Sirje Olesk. Tallinn : Tänapäev, 2002

Ot rokoko do romantizma / Jevgeni Ashihmin

Index Scriptorium Estoniae

Ashihmin, Jevgeni

2006-01-01

Suveekskursioonide tsüklist "Eesti kunsti ajaloost" Kumus. Ekskursioonid teemadel "Rokokoost romantismini","Modernism. II Maailmasõja eelne eesti kunst" ja "Eesti kunst nõukogude perioodil". Ekskursioone juhivad kunstiteadlased Helena Risthein ja Karin Taidre

Nostalgia Arhitektuurimuuseumis : kuldsed kuuekümnendad / Karen Jagodin ; interv. Ellu Maar

Index Scriptorium Estoniae

Jagodin, Karen, 1982-

2007-01-01

Näitusest "Kuuekümnendad. Eesti moodne arhitektuur" ja sisearhitektide Väino Tamme ning Vello Asi loomingu näitusest Eesti Arhitektuurimuuseumis. Kuraatorid Karin Hallas-Murula ja Karen Jagodin. Eesti 1960. aastate sisearhitektuurist

Saku uus logo liidab traditsioonid ja uuendusmeelsuse

Index Scriptorium Estoniae

2007-01-01

Reklaamiagentuur Divisioni loometööd juhtinud Dan Mikkin Saku Õlletehase uue logo loomisprotsessist ja stiiliraamatu kokkupanemisest. Karin Sepa kommentaar "Uus logo on avatum". Illustratsiooniks Saku õlletehase logod läbi aegade

Comparative analysis of root transcriptome profiles of two pairs of drought-tolerant and susceptible rice near-isogenic lines under different drought stress

Directory of Open Access Journals (Sweden)

Moumeni Ali

2011-12-01

Full Text Available Abstract Background Plant roots are important organs to uptake soil water and nutrients, perceiving and transducing of soil water deficit signals to shoot. The current knowledge of drought stress transcriptomes in rice are mostly relying on comparative studies of diverse genetic background under drought. A more reliable approach is to use near-isogenic lines (NILs with a common genetic background but contrasting levels of resistance to drought stress under initial exposure to water deficit. Here, we examined two pairs of NILs in IR64 background with contrasting drought tolerance. We obtained gene expression profile in roots of rice NILs under different levels of drought stress help to identify genes and mechanisms involved in drought stress. Results Global gene expression analysis showed that about 55% of genes differentially expressed in roots of rice in response to drought stress treatments. The number of differentially expressed genes (DEGs increased in NILs as the level of water deficits, increased from mild to severe condition, suggesting that more genes were affected by increasing drought stress. Gene onthology (GO test and biological pathway analysis indicated that activated genes in the drought tolerant NILs IR77298-14-1-2-B-10 and IR77298-5-6-B-18 were mostly involved in secondary metabolism, amino acid metabolism, response to stimulus, defence response, transcription and signal transduction, and down-regulated genes were involved in photosynthesis and cell wall growth. We also observed gibberellic acid (GA and auxin crosstalk modulating lateral root formation in the tolerant NILs. Conclusions Transcriptome analysis on two pairs of NILs with a common genetic background (~97% showed distinctive differences in gene expression profiles and could be effective to unravel genes involved in drought tolerance. In comparison with the moderately tolerant NIL IR77298-5-6-B-18 and other susceptible NILs, the tolerant NIL IR77298-14-1-2-B-10 showed

Professor Peep Veski meie meenutustes

Index Scriptorium Estoniae

2014-01-01

Mälestusi Tartu Ülikooli Farmaatsia instituudi juhatajast Peep Veskist jagavad: Eve-Irene Lepist, Urve Paaver, Karin Kogermann, Kristian Semjonov, Jaak Koppel, Kristin Raudsepp, Imre Klebovich, Filiz Hincal, A. Atilla Hincal ja Elmar Arak

ATM-dialoog Arne Maasiku ainetel / Andreas Trossek, Aleksander Tsapov

Index Scriptorium Estoniae

Trossek, Andreas, 1980-

2008-01-01

Kuni 17. II Tallinna Kunstihoones avatud Arne Maasiku fotode näitusest (kuraator Karin Paulus, kujundaja Urmas Luure) ja fotoalbumist "Fotod : 1994-2007" (tekstide autorid Eero Epner, Peeter Laurits, Jan Kaus, kujundaja Martin Pedanik)

"Impact 4" Berliinis ja Poznanis / Vappu Thurlow

Index Scriptorium Estoniae

Thurlow, Vappu, 1960-

2005-01-01

5.-10. IX Berliinis ja Poznanis toimunud neljandast rahvusvahelisest graafikakonverentsist "Impact" alapealkirjaga "Kontakt". Eestist osalesid Loit Jõekalda, Eve Kask, Karin Laansoo ja Vappu Thurlow. 2007. a. Tallinnas toimuva "Impact 5", alapealkirjaga "Slices of Time/Lõigutud aeg", kontseptsioon

Rahvusvaheline erialabibliograafia sündis Eestis / Piret Voolaid

Index Scriptorium Estoniae

Voolaid, Piret, 1971-

2005-01-01

Rets. rmt.: Internationale volkskundliche Bibliographie = International Folklore Bibliographie = Bibliographie internationale d'Ethnologie: Für das Jahr 1993 : mit Nachträgen für die vorausgehenden / herausgegeben von Karin Maria Rooleid. Bonn : Dr. Rudolf Habelt GMBH, 2004

About Nation, Race, and Ethnicity in Latin America in the 19th and 20th centuries

Directory of Open Access Journals (Sweden)

Hanni Jalil Paier

2013-12-01

Full Text Available Bibliographic outline of the following book:APPELBAUM, Nancy P., Anne S. Macpherson and Karin A. Rosemblatt (Eds. (2003. Race and Nation in Modern Latin America. Chapel Hill: University of North Carolina Press, 329 pp.

Moblaga Veneetsiasse! / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2006-01-01

Veneetsia X arhitektuuribiennaalil esindab Eestit arhitektuuribüroo Urban Mark (arhitektid Ülar Mark, Kaja Pae, Indrek Tiigi) ja Tartu Ülikooli Geograafia Instituudi (teadurid Rein Ahas, Anto Aasa, Siiri Silm) projekt. Kommenteerib Ülar Mark. Lühidalt ka teistest eestisisesel konkursil osalenud töödest

Anneteparaad III / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2008-01-01

Tutvustatakse Tartu Kõrgema Kunstikooli diplomandide lõputöid: 1. Diana Hints "Ba-Rokk", 2. Maire Rebina "Alleshoitud naeratused", 3. Liis Pihlik "Unistused ehk hingele pai", 4. Ille Agu "Pitsiring - pruudipesu kollektsioon", 5. Ingwald Koser "Chaise Longue", 6. Kaisa Paluoja installatsioon "/....../", 7. Kaidi Ploomipuu arvutiga juhitavatel telgedel kootud sisustuskangas

Bruno 2016 / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2016-01-01

Valik disainiauhinnale Bruno 2016 kandideerivatest esemetest (Gerda Retter "Jääkideta nahadisain", Raul Abner "Kummut Mix", Argo Ader ja Rain Aduson "Fitbi - spordi mugavalt!", Merili Sulg "Seinašabloon Kasemets", Rita Assor "Lugemispesa-mänguala Aas", Mare Kelpman "Terra pleedid", Henri Viljarand "Vineervalamu Gniss")

Suurlinlik lukshotell / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2007-01-01

Historitsistlikust hoonest Tallinna vanalinnas Vene tn. 9 (1874. a.), arhitekt Peter Schreiberg. Apteegi tänavale jäävast juurdeehitisest, arhitekt Martin Aunin, sisekujundajad Külli Salum ja Riina Harik

Saagu valgus / Karin Tarto

Index Scriptorium Estoniae

Paulus, Karin, 1975-

1998-01-01

Eesti valgustikujundajatest ja valgustitest. Kas eesti disaineritel on õnnestunud leida oma nišš lambiletil. Tootjatest : OÜ "Raunto", AS "Titanus" (disaineriks Eestis elav rootslane Renni Par)-, Norrast pärineva kontserni "Glamox" tehasest Keilas, "Estoplastist" (disainerid Martin Pärn, Raido Laasing), AS "Steel Line". Valgustikujundajatest Tarmo Luisust, Aleksander Jakovlevist, Raivo Pristolist, Mait Summatavetist, Tõnis Vellamast

Arhitektuurimuuseumid ehitavad / Karin Hallas

Index Scriptorium Estoniae

Hallas, Karin, 1957-

2001-01-01

Arhitektuurimuuseumide konföderatsiooni (ICAM) juhatuse aastakoosolekust Los Angeleses. Uusi ruume saanud või saavaid arhitektuurikeskusi. Uue muuseumikompleksi ehitamist on alustanud New Yorgi Moodsa Kunsti Muuseum (arhitekt Yoshio Taniguchi), 2002. a. valmib Münchenis Moderne Pinakothek (Stephan Braunfels), 2003. a. saab uued ruumid Berlinische Galerie (Frederik Fisher), uue maja Norra Arhitektuurimuuseum (Sverre Fehn), Arhitektuuri- ja Disainimuuseumi konkurss Soomes.

Rokkivad vanadekodud / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2011-01-01

Vanurite hooldekodude arhitektuurist. Harmoonia Maja (arhitekt Vlad Alexandru Gaivoronschi) Rumeenias, De Rokade põetus- ja hoolduskodu (Arons en Gelauff Architecten) Hollandis, büroo Andrés Jaque Arquitectos kavandatud vanadekodu Hispaanias, Atelier Zündel & Cristea projekteeritud vanadekodu Prantsusmaal

Põhjamaade aiatrendid / Karin Truverk

Index Scriptorium Estoniae

Truverk, Karin

2007-01-01

2007. a. märtsis Stockholmis toimunud aiandusmessist Nordiska Trädgardar, mille põhiteemad olid Karl von Linne (1707-1778) ning elu sügis - surm. Rõdude ja kalmude kujundamise võistlusest, kunstnik Stina Sandbergi tööst "Rõõmus surnuaed". 2007. a. püsililleks valiti roog-sinihelmikas, 2006. a. aiaraamatuks Lotte Mölleri teos rootsi maastikuarhitektidest Per Fribergist, Gunnar Martinsonist ja Sven-Ingvar Andersonist "Kolm meistrit, kolm aeda"

Ferro- to antiferromagnetic crossover angle in diphenoxido- and carboxylato-bridged trinuclear Ni(II)₂-Mn(II) complexes: experimental observations and theoretical rationalization.

Science.gov (United States)

Seth, Piya; Figuerola, Albert; Jover, Jesús; Ruiz, Eliseo; Ghosh, Ashutosh

2014-09-02

Three new trinuclear heterometallic Ni(II)-Mn(II) complexes have been synthesized using a [NiL] metalloligand, where H2L = N,N'-bis(salicylidene)-1,3-propanediamine. The complexes [(NiL)2Mn(OCnn)2(CH3OH)2]·CH3OH (1), [(NiL)2Mn(OPh)2(CH3OH)2][(NiL)2Mn(OPh)2]·H2O (2), and [(NiL)2Mn(OSal)2(CH3OH)2]·2[NiL] (3) (where OCnn = cinnamate, OPh = phenylacetate, OSal = salicylate) have been structurally characterized. In all three complexes, in addition to the double phenoxido bridge, the two terminal Ni(II) atoms are linked to the central Mn(II) by means of a syn-syn bridging carboxylate, giving rise to a linear structure. Complexes 1 and 2 with Ni-O-Mn angles of 97.24 and 96.43°, respectively, exhibit ferromagnetic interactions (J(Ni-Mn) = +1.38 and +0.50 cm(-1), respectively), whereas 3 is antiferromagnetic (J(Ni-Mn) = -0.24 cm(-1)), having an Ni-O-Mn angle of 98.51°. DFT calculations indicate that there is a clear magneto-structural correlation between the Ni-O-Mn angle and J(Ni-Mn) values, which is in agreement with the experimental results.

Алексий II 1929-2008

Index Scriptorium Estoniae

2008-01-01

Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president

Adoptive T cell cancer therapy

Science.gov (United States)

Dzhandzhugazyan, Karine N.; Guldberg, Per; Kirkin, Alexei F.

2018-06-01

Tumour heterogeneity and off-target toxicity are current challenges of cancer immunotherapy. Karine Dzhandzhugazyan, Per Guldberg and Alexei Kirkin discuss how epigenetic induction of tumour antigens in antigen-presenting cells may form the basis for multi-target therapies.

Moodsad näidisasumid : Weissenhof & Maasika-Vaarika : näitus Eesti Arhitektuurimuuseumis 21. 04.-20. 05. 2001 / Triin Ojari

Index Scriptorium Estoniae

Ojari, Triin, 1974-

2001-01-01

Karin Kirschi ja Tiina Tammeti koostatud näituse põhjal 1927. a. Stuttgarti rajatud Weissenhofi väikemajade elamurajoonist (arhitektid Walter Gropius, Bruno Taut, Le Corbusier jt.) ja 1931-1932 Tallinnasse ehitatud Maasika-Vaarika tänava asumit

African Zoology - Vol 34, No 4 (1999)

African Journals Online (AJOL)

Korsaranthus natalensis (Carlgren, 1938) nov. comb. (Cnidaria: Actiniaria) a mobile sea anemone attacking octocorals · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Karin Riemann-Zürneck, Charles L. Griffiths, 190-196 ...

Nii hea, kui keegi mõtleb absoluudi peale

Index Scriptorium Estoniae

2008-01-01

11. I avatakse Tallinna Kunstihoones Arne Maasiku fotode näitus. Kuraator Karin Paulus, kujundaja Urmas Luure. Detsembris 2007 ilmus Urmas Luure monograafia, fotod 1994-2007, kujundaja Martin Pedanik. Lõigud Eero Epneri, Jan Kausi ja Peeter Lauritsa sissejuhatavatest kirjutistest

Belaja krov : [luuletused] / Nil Nerlin

Index Scriptorium Estoniae

Nerlin, Nil, pseud., 1937-2015

2001-01-01

Sisu: "Sneg poroshil ijulskim dnjom..." ; "Svet: svet bez plameni (vernulsja li staruhha..." ; Zatvornik ; Pro memoria ; Voronovo krõlo ; Masterskaja metafizitsheskogo realizma ; Monahhi ; Trioditseja ; "etot inei nevessom..." ; Garmonija ; S vostoka na zapad ; Podlog

8. III esitleti Adamson-Ericu muuseumis ajakirja Muuseum 2005. aasta esimest numbrit

Index Scriptorium Estoniae

2005-01-01

Tomislav Shola kirjutab "Kvaliteedist pärimusinstitutsioonides". Rahvusvaheliste konverentside kogemusi jagavad Toomas Abiline, Aino Lepp, Lea Sillart ja Karin Hallas-Murula. Eesti muuseumide olulistest tähtpäevadest kirjutavad Urmas Dresen, Mari-Ann Aimla, Marika Valk ja Merike Koppel

Tulumaks taas kähku riigi kätte : avansiline tulumaks seadusest kadumas / Lemmi Kann

Index Scriptorium Estoniae

Kann, Lemmi

2008-01-01

Dividendide avansiline maksustamine võib määramata ajaks edasi lükkuda. Lisatud: kehtiv kord sunnib tulumaksu kohe maksma ; KPMG Baltics ASi maksuvaldkonna juhi Joel Zernaski ja Harju Elektri finantsdirektori Karin Padjuse kommentaarid: maksudega ei maksa mängida

Hiigelämblik kanali kohal ehk Kuidas ERMi uus hoone lõi kired lõkkele / Tarmo Michelson

Index Scriptorium Estoniae

Michelson, Tarmo, 1975-

2006-01-01

Eesti Rahva muuseumi uue hoone arhitektuurikonkursi võidutööst "Memory Field" (autorid itaalia arhitekt Dan Dorell, liibanoni arhitekt Lina Ghotmeh, jaapani arhitekt Tsuyoshi Tane). Kommenteerivad Jaanus Plaat, Tõnis Lukas, Karin Hallas-Murula, Raivo Palmaru, Laine Jänes, Marika Valk

Demonstration cultivation of Salix in northern Sweden with a focus on frost resistance; Demonstrationsodling av Salix i Norrland med frosttolerans i fokus

Energy Technology Data Exchange (ETDEWEB)

Soederstroem, Yvonne

2010-06-15

This project is part of the Thermal Engineering Research Association's (Vaermeforsk) programme 'Crops from field to energy production' and the goal is to convince growers to begin cultivating Salix in the northern part of Sweden. The project will demonstrate whether it is possible to grow Salix and examine what type of Salix (the report refers to the different types as Tora, Karin and Gudrun) is most frost-resistant and resistant to insects, fungal infections and animals. The project is aimed primarily at landowners and energy companies. The results showed that growth at the demonstration plots was moderate and the establishment rate was considered good. Growth has been uneven across the fields. At Eriksgaard, about 75% of the plants survived the winter. Survival was determined by the number of plants missing and dead. Additional plants were planted at the sites in 2009. No major insect or leaf fungus attacks were noted at either Eriksgaard or Soergaard, but they both experienced grazing from deer and elk. The rating showed that the herbicide treatment was not sufficient on the demonstration fields. For this reason, a comparison of average lengths was performed of Gudrun in Bodum, where the weeds had not grown as much. The comparison showed that the difference in growth was not significant in the autumn 2008, but the plants in Bodum had grown more by autumn 2009. Topping was not performed in the spring 2009 so that the plants would have an opportunity to grow higher than the weeds and the plants would have an opportunity to have a growth spurt. A comparison of Tora, Karin and Gudrun in Roedoen showed moderate growth for the three types. There were variations in the rows and across the field, mostly for Tora and Karin. Gudrun had lower, but more consistent growth across the field. During the summer 2009, survival was rated for the plants in Roedoen. This rating showed that 90% of Tora, 60% of Karin and 70% of Gudrun had survived the winter. The Salix

Leisure in a Multicultural Society

NARCIS (Netherlands)

Peters, K.B.M.

2008-01-01

Leisure practices and public space, second chapter. Karin Peters discusses ethnic diversity and leisure from three perspectives. She first looks at the leisure patterns in terms of ethnic participation. Based on theories of marginality and ethnicity, she argues that both socio-economic and

Festival 'Sünnisõnad' ئ igaühele midagi / Evi Arujärv

Index Scriptorium Estoniae

Arujärv, Evi, 1953-

2000-01-01

29. dets. 1999 - 1. jaan. 2000 toimunud festivalist "Sünnisõnad". Lühidalt ka nonstopfilmist 'Sajand arhitektuuri. Elavad pildid' (autor Karin Hallas), arhitektuurimuuseumi näitusest 'Eesti katedraalid'. 30. XII Nyyd Ensemble esitatud Gavin Bryarsi teosest 'Titanicu hukk' (Jaan Toomiku videod) jm.

Urmas Ott versus Pille-Riin Purje / Andry Ervald

Index Scriptorium Estoniae

Ervald, Andry

2007-01-01

Urmas Oti intervjuuraamat väliseesti ajakirjaniku, luuletaja ja prosaisti Karin Saarseniga "Grand Hotel, Stockholm. Poola suvi" : SE&JS Kirjastus, 2006 ja Pille-Riin Purje raadiosaate "Hiirelõks" tarvis intervjuudest kokku pandud vestluste kogumik "Kuraditosin näitlejat hiirelõksus" : Varrak, 2007

Industrial variographic analysis for continuous sampling system validation

DEFF Research Database (Denmark)

Engström, Karin; Esbensen, Kim Harry

2017-01-01

Karin Engström, LKAB mining, Kiruna, Sweden, continues to present illuminative cases from process industry. Here she reveals more from her ongoing PhD project showing application of variographic characterisation for on-line continuous control of process sampling systems, including the one...

Plaadid / Heidi Purga

Index Scriptorium Estoniae

Purga, Heidy, 1975-

2006-01-01

Uutest heliplaatidest Jay Dee/J Dilla "Donuts", The Strokes "First Impressions Of Earth", Jools Holland & His R&B orchestra "Swinging the Blues, Dancing The Ska", "The Sound Of Music", Karin Clercq "Apres l'amour", Mest "Photographs", The Notorious B.I.G. "Duets"

Küberkiusaja käib varjuna lapse kannul / Sigrid Kõiv

Index Scriptorium Estoniae

Kõiv, Sigrid

2008-01-01

Üle kolmandiku õpilastest on netikiusamist kogenud ja enam kui veerand õpilastest on ise selles osalenud, näitab Tartu Ülikooli magistrandi Karin Naruskovi uurmistöö. Kiusajate kõige menukamateks vahenditeks on MSN ja Rate. Kommenteerib IBM Eesti juht Valdo Randpere

Dying for Pain Relief (A Cup of Health with CDC)

Centers for Disease Control (CDC) Podcasts

It’s an increasingly common story— a woman is found dead in her home from a prescription pain killer overdose. In this podcast, Dr. Karin Mack discusses the growing problem of pain killer overdoses among women.

77 FR 65361 - Xanthan Gum From Austria and the People's Republic of China: Postponement of Preliminary...

Science.gov (United States)

2012-10-26

... Austria and the People's Republic of China: Postponement of Preliminary Determinations of Antidumping Duty...: October 26, 2012. FOR FURTHER INFORMATION CONTACT: Karine Gziryan (Austria) or Brandon Farlander (People's... of initiation of antidumping duty investigations of xanthan gum from Austria and the People's...

Table_S7.xls

Indian Academy of Sciences (India)

Arnold Emerson

... k=6, k=7, k=8. 4, 1, 1a2yA, Igg1-kappa d1.3 fv (light chain), PO4, 100, 100, 100, 100, 100, 100. 5, 2, 1a4sA, Betaine aldehyde dehydrogenase, Nil. 6, 3, 1a5cA, Fructose-1,6-bisphosphate aldolase, Nil. 7, 4, 1a8mA, Tumor necrosis factor alpha, Nil. 8, 5, 1a30A, Hiv-1 protease, GLU-ASP-LEU, 100, 100, 100, 100, 62.5, 62.5.

Integrated model-based retargeting and optical proximity correction

Science.gov (United States)

Agarwal, Kanak B.; Banerjee, Shayak

2011-04-01

Conventional resolution enhancement techniques (RET) are becoming increasingly inadequate at addressing the challenges of subwavelength lithography. In particular, features show high sensitivity to process variation in low-k1 lithography. Process variation aware RETs such as process-window OPC are becoming increasingly important to guarantee high lithographic yield, but such techniques suffer from high runtime impact. An alternative to PWOPC is to perform retargeting, which is a rule-assisted modification of target layout shapes to improve their process window. However, rule-based retargeting is not a scalable technique since rules cannot cover the entire search space of two-dimensional shape configurations, especially with technology scaling. In this paper, we propose to integrate the processes of retargeting and optical proximity correction (OPC). We utilize the normalized image log slope (NILS) metric, which is available at no extra computational cost during OPC. We use NILS to guide dynamic target modification between iterations of OPC. We utilize the NILS tagging capabilities of Calibre TCL scripting to identify fragments with low NILS. We then perform NILS binning to assign different magnitude of retargeting to different NILS bins. NILS is determined both for width, to identify regions of pinching, and space, to locate regions of potential bridging. We develop an integrated flow for 1x metal lines (M1) which exhibits lesser lithographic hotspots compared to a flow with just OPC and no retargeting. We also observe cases where hotspots that existed in the rule-based retargeting flow are fixed using our methodology. We finally also demonstrate that such a retargeting methodology does not significantly alter design properties by electrically simulating a latch layout before and after retargeting. We observe less than 1% impact on latch Clk-Q and D-Q delays post-retargeting, which makes this methodology an attractive one for use in improving shape process windows

High-resolution mapping of the brown planthopper resistance gene Bph6 in rice and characterizing its resistance in the 9311 and Nipponbare near isogenic backgrounds.

Science.gov (United States)

Qiu, Yongfu; Guo, Jianping; Jing, Shengli; Zhu, Lili; He, Guangcun

2010-11-01

Brown planthopper (Nilaparvata lugens Stål, BPH) is one of the most destructive insect pests of rice. Exploring resistance genes from diverse germplasms and incorporating them into cultivated varieties are critical for controlling this insect. The rice variety Swarnalata was reported to carry a resistance gene (designated Bph6), which has not yet been assigned to a chromosome location and the resistance mechanism is still unknown. In this study, we identified and mapped this gene using the F(2) and backcrossing populations and characterized its resistance in indica 9311 and japonica Nipponbare using near isogenic lines (NILs). In analysis of 9311/Swarnalata F(2) population, the Bph6 gene was located on the long arm of chromosome 4 between the SSR markers RM6997 and RM5742. The gene was further mapped precisely to a 25-kb region delimited between the STS markers Y19 and Y9; and the distance between these markers is 25-kb in Nipponbare genome. The Bph6 explained 77.5% of the phenotypic variance of BPH resistance in F(2) population and 84.9% in BC(2)F(2) population. Allele from Swarnalata significantly increased resistance to the BPH, resulted in a reduced damage score. In characterization of Bph6-mediated resistance, the BPH insects showed significant preference between NIL-9311 and 9311 in 3 h and between NIL-NIP and Nipponbare in 120 h after release. BPH growth and development were inhibited, and the insect's survival rates were lower on Bph6-NIL plants, compared with the parents 9311 and Nipponbare. The results indicate that the Bph6 exerted prolonged antixenotic and antibiotic effects in Bph6-NIL plants, and NIL-9311 plants showed a quicker and stronger effect toward BPH than NIL-NIP plants.

Development and characterization of japonica rice lines carrying the brown planthopper-resistance genes BPH12 and BPH6.

Science.gov (United States)

Qiu, Yongfu; Guo, Jianping; Jing, Shengli; Zhu, Lili; He, Guangcun

2012-02-01

The brown planthopper (Nilaparvata lugens Stål; BPH) has become a severe constraint on rice production. Identification and pyramiding BPH-resistance genes is an economical and effective solution to increase the resistance level of rice varieties. All the BPH-resistance genes identified to date have been from indica rice or wild species. The BPH12 gene in the indica rice accession B14 is derived from the wild species Oryza latifolia. Using an F(2) population from a cross between the indica cultivar 93-11 and B14, we mapped the BPH12 gene to a 1.9-cM region on chromosome 4, flanked by the markers RM16459 and RM1305. In this population, BPH12 appeared to be partially dominant and explained 73.8% of the phenotypic variance in BPH resistance. A near-isogenic line (NIL) containing the BPH12 locus in the background of the susceptible japonica variety Nipponbare was developed and crossed with a NIL carrying BPH6 to generate a pyramid line (PYL) with both genes. BPH insects showed significant differences in non-preference in comparisons between the lines harboring resistance genes (NILs and PYL) and Nipponbare. BPH growth and development were inhibited and survival rates were lower on the NIL-BPH12 and NIL-BPH6 plants compared to the recurrent parent Nipponbare. PYL-BPH6 + BPH12 exhibited 46.4, 26.8 and 72.1% reductions in population growth rates (PGR) compared to NIL-BPH12, NIL-BPH6 and Nipponbare, respectively. Furthermore, insect survival rates were the lowest on the PYL-BPH6 + BPH12 plants. These results demonstrated that pyramiding different BPH-resistance genes resulted in stronger antixenotic and antibiotic effects on the BPH insects. This gene pyramiding strategy should be of great benefit for the breeding of BPH-resistant japonica rice varieties.

Impact of polymer film thickness and cavity size on polymer flow during embossing : towards process design rules for nanoimprint lithography.

Energy Technology Data Exchange (ETDEWEB)

Schunk, Peter Randall; King, William P. (Georgia Institute of Technology, Atlanta, GA); Sun, Amy Cha-Tien; Rowland, Harry D. (Georgia Institute of Technology, Atlanta, GA)

2006-08-01

This paper presents continuum simulations of polymer flow during nanoimprint lithography (NIL). The simulations capture the underlying physics of polymer flow from the nanometer to millimeter length scale and examine geometry and thermophysical process quantities affecting cavity filling. Variations in embossing tool geometry and polymer film thickness during viscous flow distinguish different flow driving mechanisms. Three parameters can predict polymer deformation mode: cavity width to polymer thickness ratio, polymer supply ratio, and Capillary number. The ratio of cavity width to initial polymer film thickness determines vertically or laterally dominant deformation. The ratio of indenter width to residual film thickness measures polymer supply beneath the indenter which determines Stokes or squeeze flow. The local geometry ratios can predict a fill time based on laminar flow between plates, Stokes flow, or squeeze flow. Characteristic NIL capillary number based on geometry-dependent fill time distinguishes between capillary or viscous driven flows. The three parameters predict filling modes observed in published studies of NIL deformation over nanometer to millimeter length scales. The work seeks to establish process design rules for NIL and to provide tools for the rational design of NIL master templates, resist polymers, and process parameters.

Neueste Forschung in musiktherapeutischer Diagnostik

DEFF Research Database (Denmark)

Ridder, Hanne Mette Ochsner

2012-01-01

responsivem Verhalten. In der Musiktherapie sind mehrere Assessmentmodelle entwickelt worden, unter anderem der IAP von Kenneth Bruscia, AQR von Karin Schumacher und Claudine Calvet-Kruppa oder das Assessment von Kontaktniveaus bei Anne Steen. Nach dieser Einführung des Assessmentbegriffes werden zusätzlich...

South African Journal of Plant and Soil: Editorial Policies

African Journals Online (AJOL)

Journal Management: Combined Congress Continuing Committee. Karin Hannweg, SASHS President, ARC–Institute for Tropical and Sub-Tropical Crops, Nelspruit, South Africa Arno Janse van Vuuren, SASCP President, NWK Bpk, Lichtenburg, South Africa Piet le Roux, SSSSA Vice-President, University of the Free State, ...

TiSSA pleenum "Sotsiaaltöö kriisi ajal" : mida on sotsiaaltööl pakkuda ja kes saab sellest kasu? / Regina Lind

Index Scriptorium Estoniae

Lind, Regina

2010-01-01

22.-27. aug. 2010 toimus Tallinna Ülikoolis TiSSA doktorantide eelkonverents ja pleenum. Pleenumil peetud sotsiaalteadlaste ettekannetest. Esinesid: Holger Ziegler, Karin Böllert, Catrin Heite, Hans van Ewijk, Walter Lorenz, Mikko Mäntysaari, Heinz Sünker, Synnöve Karvinen-Niinikoski, Olga Borodkina

Book review : Street Architecture: Work by Hans van der Heijden

NARCIS (Netherlands)

Jenniskens, D.P.H.

The recently published book Street Architecture is the result of a collaboration between Karin Templin, currently pursuing a PhD in architecture at the University of Cambridge, and Hans van der Heijden, an Amsterdam-based architect of mainly urban renewal projects and residential architecture. The

Prospective audit of perinatal mortality among inborn babies in a ...

African Journals Online (AJOL)

2010-05-05

May 5, 2010 ... ... on Tuesday, April 12, 2011, IP: 41.185.171.107] || Click here to download free Android application for this journal ..... toxemia of pregnancy, and the mature, cause unknown, .... Source of Support: Nil, Conflict of Interest: Nil.

Kattuvad hääled / Reet Varblane

Index Scriptorium Estoniae

Varblane, Reet, 1952-

2008-01-01

Iisraeli ja palestiina kunstnike näitus "Kattuvad hääled/Overlapping Voices" Essli muuseumis Klosterneuburgis Austrias 16. V-25. X. Kuraatorid: Tal Adler (Iisrael, juut), Amal Murkus (Iisrael, palestiinlane), Karin Schneider ja Friedemann Derschmidt (Austria). Karlheinz ja Agnes Esslile kuuluvast eramuuseumist (1991, arhitekt Heinz Tesar)

An Anthropology of Learning in Epistemic Cultures

DEFF Research Database (Denmark)

Hasse, Cathrine

2015-01-01

I connect Karin Knorr-Cetina's concept of ‘epistemic cultures’ with an anthropological conceptualization of practice-based learning. The theory of practice-based learning I explore departs from the cultural psychologist Lev Vygotsky’s notion of word-meaning which can be seen as a basic unit...

Universal jurisdiction: state of affairs and ways ahead. : A policy paper

NARCIS (Netherlands)

L. Zegveld (Liesbeth); J.D. Handmaker (Jeff)

2012-01-01

textabstractOn 17 September 2010, the International Institute of Social Studies (ISS), Leiden University and ICCO organised an expert meeting at the ISS on universal jurisdiction (UJ). The meeting was chaired in the morning by Professor John Dugard and in the afternoon by Professor Karin Arts. The

Groener drogen

NARCIS (Netherlands)

Loman, N.G.M. (Niek)

2012-01-01

Auteur: N.G.M. (Niek) Loman Begeleiders: Ing. H.W. (Pim) van den Dool, Discrete Technologie en Productie Automatisering, RUG Dr.ir. I. (Ingrid) ten Have MBA, Interfac. Opleidingsinst. Technische Bedrijfskunde, RUG Drs. C.M. (Karin) Ree, Bèta Wetenschapswinkel, Science & Society Group, RUG Drs. R.W.

Comparative transcriptome proifling of two maize near-isogenic lines differing in the allelic state for bacterial brown spot disease resistance

Institute of Scientific and Technical Information of China (English)

WU Xiao-jun; Xu Li; ZHAO Pan-feng; LI Na; WU Lei; HE Yan; WANG Shou-cai

2015-01-01

The bacterial brown spot disease (BBS), caused primarily by Pseudomonas syringae pv. syringae van Hal (Pss), reduces plant vigor, yield and quality in maize. To reveal the nature of the defense mechanisms and identify genes involved in the effective host resistance, the dynamic changes of defense transcriptome triggered by the infection of Pss were investigated and compared between two maize near-isogenic lines (NILs). We found that Pss infection resulted in a sophisticated tran-scriptional reprogramming of several biological processes and the resistant NIL employed much faster defense responses than the susceptible NIL. Numerous genes encoding essential components of plant basal resistance would be able to be activated in the susceptible NIL, such as PEN1, PEN2, PEN3, and EDR1, however, in a basic manner, such resistance might not be sufifcient for suppressing Pss pathogenesis. In addition, the expressions of a large number of PTI-, ETI-, PR-, and WRKY-related genes were pronouncedly activated in the resistant NIL, suggesting that maize employ a multitude of defense pathways to defend Pss infection. Six R-gene homologs were identiifed to have signiifcantly higher expression levels in the resistant NIL at early time point, indicating that a robust surveil ance system (gene-to-gene model) might operate in maize during Pss attacks, and these homolog genes are likely to be potential candidate resistance genes involved in BBS disease resistance. Furthermore, a holistic group of novel pathogen-responsive genes were deifned, providing the repertoire of candidate genes for further functional characterization and identiifcation of their regulation patterns during pathogen infection.

Browse Title Index

African Journals Online (AJOL)

Items 1 - 25 of 1853 ... (Cnidaria: Actiniaria) a mobile sea anemone attacking octocorals, Abstract PDF. Karin Riemann-Zürneck, Charles L. Griffiths. Vol 35, No 2 (2000), Kroyeria deetsi n.sp. (Kroyeriidae: Siphonostomatoida), a parasitic copepod infecting gills of spinner sharks, Carcharhinus brevipinna (Müller & Henle, 1839), ...

The End of the Six-Party Talks?

Science.gov (United States)

2007-01-01

Pyongyang is wary of Beijing’s international influence, its ability to collaborate with the United States and South Korea, its willingness to foster ...Kenneth Quinones, “ Dualism in the Bush Administration’s North Korea Policy,” Asian Perspective, XXVII, no. 1, 2003, 197-224; Karin Lee and Adam Miles

Grunge kodukujunduses / Ene Vool

Index Scriptorium Estoniae

Vool, Ene, 1948-

2004-01-01

Low-tech, campi ja grunge ehitus- ja sisustusstiilidest meil ja mujal - kommenteerivad Andro Kööp ja Ain Nurmela. Tutvustatakse ka Mari-Mira projekti Pariisis, mis kujutab endast nn. mutant-küla, putka- ja onnikultuuri koketeriid. Artikli lõpus kommenteerib kunstiteadlane Karin Paulus grungestiili muusikas, riietuses ja sisekujunduses.

Vargamäelt leigust ei leitud / Jan Kaus

Index Scriptorium Estoniae

Kaus, Jan, 1971-

2008-01-01

Vargamäel 21. juunil 22 tundi kestnud maratonetendusest Tammsaare "Tõe ja õiguse" põhjal - Elmo Nüganeni lavastused "Tõde ja õigus. Teine osa", "Karin. Indrek. Tõde ja õigus. 4" ja "Wargamäe Wabariik" (III osa) ning Jaanus Rohumaa lavastus "Vargamäe kuningriik" (I ja V osa)

Beyond Racism and Poverty : The Truck System on Louisiana Plantations and Dutch peateries, 1865-1920

NARCIS (Netherlands)

Lurvink, K.

The truck system was a global phenomenon in the period 1865-1920, where workers were paid through the company store. In Beyond Racism and Poverty Karin Lurvink looks at how this system functioned on plantations in Louisiana in comparison with peateries in the Netherlands. In the United States, the

Angels and Demons in the Book of Jubilees

NARCIS (Netherlands)

Ruiten, Jacques van; Reiterer, F.V.; Nicklas, T.; Schöpflin, K.

2007-01-01

Jacques van Ruiten, “Angels and Demons in the Book of Jubilees,” in Angels: The Concept of Celestial Beings – Origins, Development and Reception (ed. Friedrich V. Reiterer, Tobias Nicklas, and Karin Schöpflin; Deuterocanonical and Cognate Literature Yearbook 2007; Berlin and New York: de Gruyter,

When in Doubt...?

DEFF Research Database (Denmark)

Bubandt, Nils Ole

2016-01-01

Response to Hau Symposium on Bubandt, Nils. 2014. The empty seashell: Witchcraft and doubt on an Indonesian island. Ithaca, NY: Cornell University Press.......Response to Hau Symposium on Bubandt, Nils. 2014. The empty seashell: Witchcraft and doubt on an Indonesian island. Ithaca, NY: Cornell University Press....

Double-layer imprint lithography on wafers and foils from the submicrometer to the millimeter scale

NARCIS (Netherlands)

Moonen, P.F.; Yakimets, I.; Peter, M.; Meinders, E.R.; Huskens, J.

2011-01-01

In this paper, a thermal imprint technique, double-layer nanoimprint lithography (dlNIL), is introduced, allowing complete filling of features in the dimensional range of submicrometer to millimeter. The imprinting and filling quality of dlNIL was studied on Si substrates as a model system and

Plasma-assisted quartz-to-quartz direct bonding for the fabrication of a multilayered quartz template for nanoimprint lithography

International Nuclear Information System (INIS)

Lee, Jihye; Ali, Altun; Kim, Ki-don; Choi, Dae-guen; Choi, Jun-Hyuk; Jeong, Jun-ho; Kim, Jae-Hyun

2010-01-01

In this paper, a low-temperature plasma-assisted process is developed to realize a uniform, ultraviolet (UV) transparent and chemically inert quartz-to-quartz direct bonding. Two sets of pretests are performed in order to understand how the bond surface energy changes with the plasma exposure time and the wet etching of quartz, respectively. The developed technique is used to fabricate a multilayered quartz template for UV nanoimprint lithography (UV-NIL). The multilayered quartz template is fabricated by bonding a square piece of a standard quartz wafer, which is about 625 µm in thickness, to a wet-etched 6.35 mm thick quartz photomask plate. A fabricated multilayered template is loaded to the commercial UV-NIL tool Imprio(TM) 100, and NIL was performed successfully. The developed direct bonding technique makes it possible for standard quartz wafers, which are compatible with high-resolution semiconductor fabrication processes, to be utilized as the templates in commercial UV-NIL machines with enhanced mechanical stability.

Saksamaa ida kutsub / Thea Karin

Index Scriptorium Estoniae

Karin, Thea

2011-01-01

Endise Ida-Saksamaa aladel asuvate linnade Dessau-Rosslau ja Chemnitzi (endine Karl-Marx-Stadti) vaatamisväärsustest, s.h UNESCO kultuuripärandisse kuuluvatest Wörlitz-Dessau parkidest ja Bauhausi kompleksist

Pargid, maapealsed paradiisid / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2010-01-01

Arvustus: Park on paradiis looduses ja kunstis / vastutavad toimetajad Mart Külvik, Juhan Maiste. Tartu : Eesti Maaülikool, 2009. Prantsuse ja inglise pargistiilidest, vabakujunduslike parkide jõudmisest Eesti- ja Liivimaale, hiitest ja mõisaparkidest, linnaparkidest

Seiklused kapitaguses maailmas / Karin Hansson

Index Scriptorium Estoniae

Hansson, Karin

2007-01-01

C.S. Lewise 1950.a. ilmunud romaani järgi "Narnia lood : Lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") valminud Andrew Adamsoni samanimelisest mängufilmist

Kõige kummalisemad elumajad / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2007-01-01

Le Corbusier' proportsioonisüsteemist "Modulor", Margarete Schütte-Lihotzky ja Peter Eisenmani pakutud uudseid lahendusi arhitektuuris. Mart Kadariku projekteeritud eramust Rannamõisas; arhitektuuribüroo Künnapu & Padrik projekteeritud hoonest Triumph Plaza Tallinnas Narva maanteel; Olev Siinmaa villast Pärnus; püramiidmajadest; Gert Sarve ja Lauri Laisaare projekteeritud monoliitbetoonist eramust Tallinnas Nõmmel; KOKO Arhitektuuristuudios projekteeritud Fahle majast Tallinnas; Ülar Margi ja Indrek Tiigi projekteeritud klaasist seintega majast Tallinnas Silgu tänaval

Tallinna Fotokuu 2015 / Karin Kahre

Index Scriptorium Estoniae

Kahre, Karin

2015-01-01

Tallinna Fotokuu 2015 programmist. Näitus "Prosu(u)mer" Eesti Kaasaegse Kunsti Muuseumis, kuraator David Raymond Conroy. Näitus "Aegvõte. Time Lapse" Tallinna Kunstihoones, kuraator Anna Laarits. Näitus "Võrdlev sissevaade 1990. aastate üleminekuaja Balti fotokunsti" Tallinna Kunstihoone galeriis, kuraator Tanja Muravskaja. Duo-näitus "Leegi vari" Tartu Kunstimajas, kunstnikud Tarvo Hanno Varres ja Kirke Kangro. Näitus "Plahvatusest tasandikule. Eesti kaasaegne foto 1991-2015" Taru Kunstimuuseumis, kuraator Anneli Porri

Aidsiraport tekitab kahtlusi / Karin Volmer

Index Scriptorium Estoniae

Volmer, Karin

2008-01-01

Kuigi ÜRO raporti kohaselt on aidsi levik taanduma hakanud, pelgavad eksperdid, et muunduv haigus lööb näilise stabiliseerumise peagi segamini. Eesti aidsi tugikeskuse juhataja Jüri Kalikovi sõnul Eestis alust stabiliseerumisest rääkida ei ole. Lisa: Petlikud numbrid

Kättpidi Veneetsias / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2006-01-01

Muljeid X rahvusvaheliselt Veneetsia arhitektuuribiennaalilt "Linnad. Arhitektuur ja ühiskond", kuraator Richard Burdett. Ülar Margi kureeritud projektist "Joint Space", kommenteerib Rein Ahas. Väljavõtteid Rem Koolhaasi ja Jacques Herzogi esinemisest Arsenales. Andres Sevtshuki kureeritud projektist. Kuldlõvi auhinna pälvis inglise arhitekt Richard Rogers (sünd. 1933). Bernard Tschumi elliptilise linna projekti kommenteerib Kaja Pae

Rahu, ainult rahu / Karin Bachmann

Index Scriptorium Estoniae

Bachmann, Karin, 1976-

2013-01-01

Eesti Kunstiakadeemia X Urbanistika ja linnamaastike päevad "Between Architecture of War and Military Urbanism" ("Sõjaarhitektuuri ja militaarurbanistika vahel") 25.-28. aprillil 2013. a. Telliskivi Loomelinnakus Tallinnas. Konverentsi peaesinejad Stephen Graham ja Steven Flusty

Austria peidetud aarded / Thea Karin

Index Scriptorium Estoniae

Karin, Thea

2013-01-01

Linzi ja Grazi vaatamisväärsustest, arhitektuurist, toidust s.h maailma vanimast tordist - Linzer torte'st. Langenloisis asuvast Wine&Spa Resort Loisium arhitektihotellist, kus Aveda Destination Spas pakutakse koostöös kosmeetikatootja Vinoble Cosmetics'iga viinamarjatoodetel põhinevaid kehahoolitsusi

Molecular Breeding of Rice Restorer Lines and Hybrids for Brown Planthopper (BPH) Resistance Using the Bph14 and Bph15 Genes.

Science.gov (United States)

Wang, Hongbo; Ye, Shengtuo; Mou, Tongmin

2016-12-01

The development of hybrid rice is a practical approach for increasing rice production. However, the brown planthopper (BPH), Nilaparvata lugens Stål, causes severe yield loss of rice (Oryza sativa L.) and can threaten food security. Therefore, breeding hybrid rice resistant to BPH is the most effective and economical strategy to maintain high and stable production. Fortunately, numerous BPH resistance genes have been identified, and abundant linkage markers are available for molecular marker-assisted selection (MAS) in breeding programs. Hence, we pyramided two BPH resistance genes, Bph14 and Bph15, into a susceptive CMS restorer line Huahui938 and its derived hybrids using MAS to improve the BPH resistance of hybrid rice. Three near-isogenic lines (NILs) with pyramided Bph14 and Bph15 were obtained by molecular marker-assisted backcross (MAB) and phenotypic selection. The genomic components of these NILs were detected using the whole-genome SNP (Single nucleotide polymorphism) array, RICE6K, suggesting that the recurrent parent genome (RPG) recovery of the NILs was 87.88, 87.70 and 86.62 %, respectively. BPH bioassays showed that the improved NILs and their derived hybrids carrying homozygous Bph14 and Bph15 were resistant to BPH. However, the hybrids with heterozygous Bph14 and Bph15 remained susceptible to BPH. The developed NILs showed no significant differences in major agronomic traits and rice qualities compared with the recurrent parent. Moreover, the improved hybrids derived from the NILs exhibited better agronomic performance and rice quality compared with the controls under natural field conditions. This study demonstrates that it is essential to stack Bph14 and Bph15 into both the maternal and paternal parents for developing BPH-resistant hybrid rice varieties. The SNP array with abundant DNA markers is an efficient tool for analyzing the RPG recovery of progenies and can be used to monitor the donor segments in NILs, thus being extremely important

Simultatenous determination of diacetyl and acetoin in traditional turkish butter stored in sheep’s rumen (Karinyagi

Directory of Open Access Journals (Sweden)

Gokce, R.

2014-03-01

Full Text Available Commercial Karinyagi (traditionally named karin is made of cows’ milk cream and is produced by filling butter in cleaned sheep’s rumen. The effect of butter storage in sheep’s rumen on the production of diacetyl and acetoin was investigated. These compounds were determined by GC-MS and they are the typical butter flavor commonly found in fermented dairy products. The modified method for the simultaneous extraction of diacetly and acetoin from butter samples was accurate and precise. The recoveries of diacetyl and acetoin were 94.7 and 110.8%, respectively, while the detection limits were 1.83 and 0.51 mg·L-1, respectively. The proposed method was applied for the monitoring of aroma compounds in Karin butter samples during different time intervals. The concentration of acetoin remained stable through 0–50 days while the concentration of diacetyl increased to 33.0 μg·g-1 up to 40 days and remained constant through 40–50 days.El Karinyagi comercial (nombre tradicional Karin está hecho de crema de leche de vaca, y producido llenando con mantequilla el rumen limpio de ovejas. Se ha investigado el efecto del almacenamiento de la mantequilla en el rumen de ovejas sobre la formación de diacetilo y acetoína. Estos compuestos son el típico flavor a mantequilla que se detecta comúnmente en los productos lácteos fermentados y han sido determinados mediante GC-MS. El método modificado para la extracción simultánea de diacetilo y acetoína en mantequilla resultó ser exacto y preciso y las recuperaciones de 94,7 y 110,8 % respectivamente, mientras que los límites de detección fueron 1.83 y 0,51 mg·L-1, respectivamente. El método propuesto se aplicó al control de compuestos aromáticos en Karin y muestras de mantequilla, durante diferentes intervalos de tiempo. La concentración de acetoína se mantuvo estable entre 0–50 días mientras que la concentración de diacetilo aumentó a 33,0 mg·g-1 hasta 40 días y se mantuvo constante

Endogenous and exogenous factors in national development ...

African Journals Online (AJOL)

radio stations saw his performance where he was adjudged the winner at the ... influence. This is consistent with Karin Barber's position that popular culture be read not ... of the writer apparently colour the poem in the figurative language of a political type, ..... It is always constructed through memory, fantasy, narrative and.

Angels and Demons in the Book of Jubilees

OpenAIRE

Ruiten, Jacques van; Reiterer, F.V.; Nicklas, T.; Schöpflin, K.

2007-01-01

Jacques van Ruiten, “Angels and Demons in the Book of Jubilees,” in Angels: The Concept of Celestial Beings – Origins, Development and Reception (ed. Friedrich V. Reiterer, Tobias Nicklas, and Karin Schöpflin; Deuterocanonical and Cognate Literature Yearbook 2007; Berlin and New York: de Gruyter, 2007), 585-609.

75 FR 8677 - Seamless Refined Copper Pipe and Tube From the People's Republic of China and Mexico...

Science.gov (United States)

2010-02-25

... Copper Pipe and Tube From the People's Republic of China and Mexico: Postponement of Preliminary...: Karine Gziryan (the People's Republic of China) or Joy Zhang (Mexico), AD/CVD Operations, Offices 4 and 3... Tube from the People's Republic of China and Mexico. See Seamless Refined Copper Pipe and Tube from the...

Puitarhitektuur ja puit arhitektuuris / Piret Lindpere

Index Scriptorium Estoniae

Lindpere, Piret, 1963-

1999-01-01

Näitus "Eesti puitarhitektuur" Rotermanni soolalaos 12. septembrini. Koostajad Karin Hallas (stiiliajalugu) ja Epi Tohvri (väikelinnad). Kujundaja Ralf Tamm. Puitarhitektuuri säilitamisest Tallinnas ja väikelinnades. Puidu arhitektuuris kasutamise näide ئ 1998. a. valminud Linnamäe kool Läänemaal (arhitekt Tiit Trummal).

Nanoimprint lithography in the cyclic olefin copolymer, Topas, a highly ultraviolet-transparent and chemically resistant thermoplast

DEFF Research Database (Denmark)

Nielsen, T.; Nilsson, D.; Bundgaard, F.

2004-01-01

-on-a-chipapplications. In particular, Topas® is suitable for micro systems made for optical bio-detection since waveguides for UV-light can be made directly in Topas®. In this article full process sequences for spin coating Topas® onto 4 in. silicon wafers, NIL silicon stamp fabrication with micro and nanometer sized features...... by metal deposition and lift-off ontop of a Topas® film patterned by NIL is demonstrated. This exploits the chemical resistance ofTopas® to sodium hydroxide and acetone. The demonstrated UVL and lift-off on top of an imprinted Topas® film opens new possibilities for post-NIL processing....

Thermodynamic Characteristics of Reactions of the Formation of Complexes between Triglycine and Ni2+ Ions in Aqueous Solution

Science.gov (United States)

Gorboletova, G. G.; Metlin, A. A.; Bychkova, S. A.

2018-05-01

Thermal effects of reactions of the formation of complexes between Ni(II) and triglycine are determined via direct calorimetry in aqueous solutions at 298.15 K and ionic strengths of 0.2, 0.5, and 1.0 (KNO3). Standard thermodynamic characteristics (Δr H°, Δr G°, Δr S°) of complexing processes in the investigated systems are calculated. The structures of triglycinate complexes NiL+, NiH-1L, NiL2, NiH-2L2- 2, NiL- 3, and NiH-3L4- 3 are introduced to compare the obtained values and data on the thermodynamics of triglycinate complexes of Ni(II).

Muzõka tshissel : [luuletused] / Nil Nerlin

Index Scriptorium Estoniae

Nerlin, Nil, pseud., 1943-

2000-01-01

Sisu: "mirokolitsõ kolokol..." ; "vokrug obuglennogo diska..." ; "oblutshajushtshim vinu..." ; "zvjaknut kljutshi o zhelezo..." ; F. I. T. : iz transkriptsi ; A. D. S. ; Sumtshatõi zverjok ; Inferno-final : promezhutotshnõi reportazh ; Fundament ; Reliktovoje izutshenije ; Los Alamos ; "prosti zluju zorkost (pozornõi moi plen)..."

Regio tooted liiguvad maailmaturule / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2005-01-01

Ilmunud ka: Tartu Postimees 16. mai, lk. 1. Välisriikides Reach-U kaubamärgi all tegutsev Regio laiendab tegevust - Saudi Araabia, Araabia Ühendemiraatide, India ja Rumeenia mobiilsideoperaatorid hakkavad kasutama ettevõtte väljatöötatud tarkvara ja kaarte. Lisa: Regio positsioneerimistooted

Vsja tvar zemnaja : [luuletused] / Nil Nerlin

Index Scriptorium Estoniae

Nerlin, Nil, pseud., 1943-

2001-01-01

Sisu: Ne otrõvaja pera ; Freska ; Psõ ; Vesna-ossen ; "pust nemotoju iskussanõ gubõ..." ; Nepodrazhajemõi ; O vneshnei tme ; "izumrudnuju vodu vnizu (i mazut..." ; Tramvainoje sozhalenije ; Strekoza i muravei ; Ulitka ; Kolonnõi zal ; A. G. : neproshenoje prishestvije ; Vek ritoriki ; notshnõje provodõ rozhdestvenski ledok..."

Maanoored peibutavad vanemaid internetti / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2004-01-01

Internetifirma Kernel tegevjuhi Raivo Laatsi hinnangul soovivad internetiühendust eelkõige pere nooremad liikmed, Tartumaal kiiret sideteenust pakkuv ettevõte on kolme aastaga viinud selle mitmesaja maapereni

Mormoonid kopeerivad Eesti arhiive / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2010-01-01

Mormoonid koguvad genealoogilisi materjale üle maailma, mille põhjenduseks on usuliste talituste tegemine surnute eest. Siseministeerium, Tallinna linnaarhiiv ja ajalooarhiiv sõlmisid lepingu mormoonidega seotud Utah' Genealoogilise Seltsiga läinud kümnendi algul

Marker-aided Incorporation of Xa38, a Novel Bacterial Blight Resistance Gene, in PB1121 and Comparison of its Resistance Spectrum with xa13 + Xa21.

Science.gov (United States)

Ellur, Ranjith K; Khanna, Apurva; S, Gopala Krishnan; Bhowmick, Prolay K; Vinod, K K; Nagarajan, M; Mondal, Kalyan K; Singh, Nagendra K; Singh, Kuldeep; Prabhu, Kumble Vinod; Singh, Ashok K

2016-07-11

Basmati rice is preferred internationally because of its appealing taste, mouth feel and aroma. Pusa Basmati 1121 (PB1121) is a widely grown variety known for its excellent grain and cooking quality in the international and domestic market. It contributes approximately USD 3 billion to India's forex earning annually by being the most traded variety. However, PB1121 is highly susceptible to bacterial blight (BB) disease. A novel BB resistance gene Xa38 was incorporated in PB1121 from donor parent PR114-Xa38 using a modified marker-assisted backcross breeding (MABB) scheme. Phenotypic selection prior to background selection was instrumental in identifying the novel recombinants with maximum recovery of recurrent parent phenome. The strategy was effective in delimiting the linkage drag to <0.5 mb upstream and <1.9 mb downstream of Xa38 with recurrent parent genome recovery upto 96.9% in the developed NILs. The NILs of PB1121 carrying Xa38 were compared with PB1121 NILs carrying xa13 + Xa21 (developed earlier in our lab) for their resistance to BB. Both NILs showed resistance against the Xoo races 1, 2, 3 and 6. Additionally, Xa38 also resisted Xoo race 5 to which xa13 + Xa21 was susceptible. The PB1121 NILs carrying Xa38 gene will provide effective control of BB in the Basmati growing region.

77 FR 36285 - Notice of Proposed Information Collection: Comment Request; Application for Fee or Roster...

Science.gov (United States)

2012-06-18

... the FHA insurance fund. Agency form numbers, if applicable: HUD-92563I, HUD 92563A, HUD 92564-CN... to the proposal by name and/or OMB Control Number and should be sent to: Reports Liaison Officer... number for the Federal Information Relay Service (1-800-877-8339). FOR FURTHER INFORMATION CONTACT: Karin...

Raznõje litsa Indreka Paasa / Eteri Kekelidze

Index Scriptorium Estoniae

Kekelidze, Eteri, 1944-

2008-01-01

Vargamäel 22 tundi kestnud maratonetendusest Tammsaare "Tõe ja õiguse" põhjal - Elmo Nüganeni lavastused "Tõde ja õigus. Teine osa", "Karin. Indrek. Tõde ja õigus. 4" ja "Wargamäe Wabariik" (III osa) ning Jaanus Rohumaa lavastus "Vargamäe kuningriik" (I ja V osa). Pikemalt "Wargamäe Wabariigi" lavastusest

Astronaut C. Michael Foale is briefed on use of Sky Genie

Science.gov (United States)

1994-01-01

Astronaut C. Michael Foale, STS-63 mission specialist, is briefed on the use of Sky Genie device by Karin L. Porter. The device would aid in emergency egress operations aboard a troubled Space Shuttle. Porter, an employee of Rockwell International, helps train astronauts in egress procedures at JSC's Shuttle mockup and integration laboratory.

Like-Me Simulation as an Effective and Cognitively Plausible Basis for Social Robotics

Science.gov (United States)

2009-02-24

havior of teams from observation. In: RoboCup 2002: robot soccer world cup, Fukuoka, Japan 25. Karin-D’Arcy MR, Povinelli DJ (2002) Do chimpanzees...2001) Building a multimodal human-robot interface. IEEE Intel Syst 16:16–20 41. Povinelli DJ, Eddy TJ (1994) The eyes as a window: what young

Sõda, viin, naised ja surm / Vaapo Vaher

Index Scriptorium Estoniae

Vaher, Vaapo, 1945-

2005-01-01

Tutvustus: Gelassimov, Andrei. Janu / vene k. tlk. Jaan Ross. Tallinn : Kultuurileht, 2005. (Loomingu Raamatukogu) ; Austen, Jane. Mõistus ja tunded / inglise k. tlk. Karin Suursalu. Tallinn : Tänapäev, 2005 ; Kiik, Heino. Ole usin : 1948-1954. Tartu : Ilmamaa, 2005 ; Palm, August. Villem Reiman : [1861-1917]. 2., täiend. tr. Tartu : Ilmamaa, 2004

Installation Service - Changes in opening hours

CERN Multimedia

GS Department

2010-01-01

For organizational matters, please note that, as from 15 March 2010, the Installation Service will have wen opening hours. The new schedule will be from 14:00 to 17:00 (Monday to Friday). Contact persons are: Martine Briant, Karine Robert and Claudia Bruggmann. The office address remains 73-3-014. Installation Service

Self-recognition of high-mannose type glycans mediating adhesion of embryonal fibroblasts.

Science.gov (United States)

Yoon, Seon-Joo; Utkina, Natalia; Sadilek, Martin; Yagi, Hirokazu; Kato, Koichi; Hakomori, Sen-itiroh

2013-07-01

High-mannose type N-linked glycan with 6 mannosyl residues, termed "M6Gn2", displayed clear binding to the same M6Gn2, conjugated with ceramide mimetic (cer-m) and incorporated in liposome, or coated on polystyrene plates. However, the conjugate of M6Gn2-cer-m did not interact with complex-type N-linked glycan with various structures having multiple GlcNAc termini, conjugated with cer-m. The following observations indicate that hamster embryonic fibroblast NIL-2 K cells display homotypic autoadhesion, mediated through the self-recognition capability of high-mannose type glycans expressed on these cells: (i) NIL-2 K cells display clear binding to lectins capable of binding to high-mannose type glycans (e.g., ConA), but not to other lectins capable of binding to other carbohydrates (e.g. GS-II). (ii) NIL-2 K cells adhere strongly to plates coated with M6Gn2-cer-m, but not to plates coated with complex-type N-linked glycans having multiple GlcNAc termini, conjugated with cer-m; (iii) degree of NIL-2 K cell adhesion to plates coated with M6Gn2-cer-m showed a clear dose-dependence on the amount of M6Gn2-cer-m; and (iv) the degree of NIL-2 K adhesion to plates coated with M6Gn2-cer-m was inhibited in a dose-dependent manner by α1,4-L-mannonolactone, the specific inhibitor in high-mannose type glycans addition. These data indicate that adhesion of NIL-2 K is mediated by self-aggregation of high mannose type glycan. Further studies are to be addressed on auto-adhesion of other types of cells based on self interaction of high mannose type glycans.

RIMS (real-time imprint monitoring by scattering of light) study of pressure, temperature and resist effects on nanoimprint lithography

International Nuclear Information System (INIS)

Yu Zhaoning; Gao He; Chou, Stephen Y

2007-01-01

To optimize nanoimprint lithography (NIL), it is essential to be able to characterize and control the NIL process in situ and in real time. Recently we have developed a real-time imprint monitoring by the scattering-of-light (RIMS) approach, which allows us to detect the degree of resist deformation and the duration of resist penetration by a mould during the imprint process in real time. In this paper we report the performances of RIMS under a broad range of working conditions. RIMS data shows that the resist penetration is facilitated by increasing processing temperature, pressure and the resist film thickness; a prolonged pre-NIL resist baking step, on the other hand, has the effect of slowing it down. Our results provide further demonstration of the effectiveness of this method under different working conditions. RIMS measurements show not only how long an imprint takes to complete, but also how an imprint progresses with time and how it is affected by differences in processing parameters. These measurements provide information crucial for a better understanding and process optimization in NIL

Kulka aastapreemiate žürii hinnang = Comments from the panel of judges / Laila Põdra, Eva Hirvesoo, Tiit Sild, Epp Lankots ; intervjueerinud Margit Mutso

Index Scriptorium Estoniae

2011-01-01

Arhitektuuriaastast 2010. Eesti Kultuurkapitali aastapreemia - Maarja Kask, Karli Luik, Ralf Lõoke, Kristiina Arusoo, Margit Argus, Pelle-Sten Viiburg (Sõmeru keskusehoone, maanteemuuseumi välialad). Arhitektuuri sihtkapitali arhitektuuripreemia - Hannes Koppel (Kuressaare rannahoone), Raul Vaiksoo (eramu), restaureerimispreemia - Jaan Jõgi (Laupa mõis), sisearhitektuuri preemia - Leila Pärtelpoeg (Röa mõis), tegevuspreemia - Karin Hallas-Murula, Eesti Arhitektuurikeskus

Eesti Draamateater tähistas maja 100. sünnipäeva / Tiiu Laks

Index Scriptorium Estoniae

Laks, Tiiu, 1984-

2010-01-01

18. septembril tähistati avatud uste päevaga Eesti Draamateater hoone 100. sünnipäeva. Õhtul sai teatrihoone fassaadilt vaadata Taavet Janseni, Taavi Varmi ja Andres Tenusaare videoinstallatsiooni. Esitleti raamatut "Eesti Draamateatri maja 100" (autorid Karin Hallas-Murula, Kristel Pappel, Haldja Jalajas). Avati Peeter Lauritsa fotonäitus "Pahempidi"

"Tõde ja õigus" ilmutab end prantslastele : [vestlusring A. H. Tammsaare peateose tõlkijatega] / Jean Pascal Ollivry, Eva Toulouze, Jean-Pierre Minaudier ; vestlust juhtinud Tiina Väljaste

Index Scriptorium Estoniae

Ollivry, Jean Pascal

2010-01-01

2009. a. ilmus kirjastus Gaïa väljaandel "Tõde ja õigus" kolm esimest köidet: "La colline-du-voleur", "Indrek" (mõlemad tõlkis J. P. Ollivry) ja "Jours d'emeutes" (tlk. J.-P. Minaudier). E. Toulouze tõlgib romaani 4. osa ("Indrek et Karin") ning J. P. Ollivry 5. osa

Raamat / Matis Rodin

Index Scriptorium Estoniae

Rodin, Matis

2012-01-01

Raamatututvustus: Paulus, Karin. Tootedisain : asjad minu elus. Tallinn : Eesti Kunstiakadeemia, 2011; Vainküla, Tõnu, Pere, René. Vana mööbel korda oma kätega. [Tallinn] : Ajakirjade Kirjastus, 2012; Ruumipilt 2011 : Eesti parimad interjöörid ja disain / Eesti Sisearhitektide Liit ; toimetaja ja vastutav väljaandja Priit Põldme. Tallinn, 2012

1 küsimus noorele juhile : Kuidas peab keskjuht otsused töötajateni viima? / Andrus Soodla, Mairi Jüriska, Terje Pihl... [jt.

Index Scriptorium Estoniae

2009-01-01

Küsimusele vastavad Danske Bank AS-i kliendisuhete juht Andrus Soodla, SA Terve Eesti juht Mairi Jüriska, reklaamiagentuuri Tank töötaja Terje Pihl, audiitor- ja konsultatsioonifirma KPMG siseauditi teenusliini juht Karin Rätsep, konsultatsiooni- ja audiitorfirma Ernst & Young ärikonsultatsioonide osakonna juhataja Tarmo Toiger ning Andrese Klaasi ja Dekoori tegevjuht Gerd Veelma

Linnapea, keda rõõmustab titekisa / Jüri Ratas ; interv. Riina Luik

Index Scriptorium Estoniae

Ratas, Jüri, 1978-

2006-01-01

Tallinna linnapea vastab küsimustele, mis puudutavad tema suhtumist opositsiooni kriitikasse, linna juhtimist, perekonda, lapsepõlve, spordiga tegelemist, sõpruskonda, eraettevõtlusest loobumist ning suhteid kirikuga. Lisa: Jüri Ratas (27). Vt. samas lühiintervjuud linnapea abikaasa Karin Ratasega. Kommenteerib Jüri Ratase endine klassijuhataja Nõmme gümnaasiumist, võrkpallitreener Raimund Pundi

Chemical phenomena in primary titanium production

CSIR Research Space (South Africa)

van Vuuren, DS

2011-01-01

Full Text Available TiO2 $ 490m p.a. $ 2500 p.a. Pigment Production ~20 kt TiO2 5100 kt TiO2 $ 37m p.a. $ 10000 m.p.a. Sponge Production Nil 125 kt p.a. Ti $ 1250 m.p.a. Ingot Production Nil 145 kt p.a. Ti $ 2600 m.p.a. Mill Products Nil ~90 kt p.a. Ti $ 4500 m... Museum Photo courtesy of the Kyushu National Museum http://web-japan.org/nipponia/nipponia38/en/travel/travel03.html V AL U E TiCl4 TiO2 Sponge Powder M2TiF6 Ingot INC R EAS ING COS T PRECURSOR REDUCTANT PRODUCT...

Kinetic Modeling of a Heterogeneous Fenton Oxidative Treatment of Petroleum Refining Wastewater

Science.gov (United States)

Basheer Hasan, Diya'uddeen; Abdul Raman, Abdul Aziz; Wan Daud, Wan Mohd Ashri

2014-01-01

The mineralisation kinetics of petroleum refinery effluent (PRE) by Fenton oxidation were evaluated. Within the ambit of the experimental data generated, first-order kinetic model (FKM), generalised lumped kinetic model (GLKM), and generalized kinetic model (GKM) were tested. The obtained apparent kinetic rate constants for the initial oxidation step (k 2′), their final oxidation step (k 1′), and the direct conversion to endproducts step (k 3′) were 10.12, 3.78, and 0.24 min−1 for GKM; 0.98, 0.98, and nil min−1 for GLKM; and nil, nil, and >0.005 min−1 for FKM. The findings showed that GKM is superior in estimating the mineralization kinetics. PMID:24592152

Uued raamatud

Index Scriptorium Estoniae

2005-01-01

Constructed happiness - domestic environment in the cold war era / Võistlevad õnned - elukeskkond külma sõja perioodil (EKA, 2005; toimetajad Mart Kalm, Ingrid Ruudi, kujundajad Martin Lazarev, Tiit Lepp, Andrus Kõresaar); Ruumipilt : Eesti parimad interjöörid ja disain : konkurss 2004 / Eesti Sisearhitektide Liit (Minuskel, 2005; projektijuht Mati Veermets, kujundaja Tiiu Prisko, tekstid: Ell-Maaja Randküla); Eesti Kunstiakadeemia ajakirja 1. number (toimetajad Karolin Kuusik, Kristina Paju, kujundajad Kadri-Maria Mitt, Tuuli Aule, fotod: Tatjana Muravskaja); Eesti Kunstiakadeemia lõputööd 2005 (EKA, 2005; koostajad Karin Laansoo, Alo Paistik, kujundajad T. Aule, K.-M. Mitt, fotograafid Pelle Kalmo, Riikka Tauriainen, Anu Vahtra); Hallas-Murula, Karin. Suurlinn Tallinn : Eliel Saarineni "Suur-Tallinna" projekt. 1913 (Eesti Arhitektuurimuuseum, 2005; kujundaja Tiit Jürna); Kivi, Raul-Levroit. Tartu planeerimisest ja arhitektuurist : artikleid ja mälestusi (Eesti Arhitektuurimuuseum, 2005; koostajad Jaan Malin, K. Hallas-Murula); Arhitektuuriaasta 2004 : arhitektuuripreemiate nominendid (Solnessi Arhitektuurikirjastus, 2005; tekst: Epp Lankots, kujundaja Arhitektuuri Domeen); Archiprix International 2005 : world's best graduation projects (Rotterdam, 2005; EKA lõpetanud arhitektidest on publitseeritud Ralf Lõokese magistritöö "Superrand")

The method of life extension for the High Flux Isotope Reactor vessel

International Nuclear Information System (INIS)

Chang, Shib-Jung.

1995-01-01

The state of the vessel steel embrittlement as a result of neutron irradiation can be measured by its increase in the nil ductility temperature (NDT). This temperature is sometimes referred to as the brittle-ductile transition temperature (DBT) for fracture. The life extension of the High Flux Isotope Reactor (HFIR) vessel is calculated by using the method of fracture mechanics. A hydrostatic pressure test (hydrotest) is performed in order to determine a safe vessel static pressure. It is then followed by using fracture mechanics to project the reactor life from the safe hydrostatic pressure. The life extension calculation provides the following information on the remaining life of the reactor as a function of the nil ductility temperature increase: the probability of vessel fracture due to hydrotest vs vessel life at several hydrotest pressures; the hydrotest time interval vs the uncertainty of the nil ductility temperature increase rate; and the hydrotest pressure vs the uncertainty of the nil ductility temperature increase rate. It is understood that the use of a complete range of uncertainties of the nil ductility temperature increase is equivalent to the entire range of radiation damage that can be experienced by the vessel steel. From the numerical values for the probabilities of the vessel fracture as a result of hydrotest, it is estimated that the reactor vessel life can be extended up to 50 EFPY (100 MW) with the minimum vessel operating temperature equal to 85 degree F

Effects of antioxidants on apoptosis induced by dasatinib and nilotinib in K562 cells.

Science.gov (United States)

Damiano, Sara; Montagnaro, Serena; Puzio, Maria V; Severino, Lorella; Pagnini, Ugo; Barbarino, Marcella; Cesari, Daniele; Giordano, Antonio; Florio, Salvatore; Ciarcia, Roberto

2018-06-01

In clinical practice for the treatment of chronic myeloid leukemia, second generation of tyrosine kinase inhibitors such as Nilotinib (NIL) specific and potent inhibitor of the BCR/ABL kinase and Dasatinib (DAS) a inhibitor of BCR/ABL and Src family kinase were developed to clinically overcome imatinib resistance. In this study, we wanted to test the ability of some antioxidants such Resveratrol (RES) or a new recombinant mitochondrial manganese containing superoxide dismutase (rMnSOD) or δ-tocotrienol (δ-TOCO) to interact with DAS and NIL on viability, reactive oxygen species (ROS) production, lipid peroxidation, and apoptosis. To test the possible mechanisms of action of such antioxidants, we utilized N-acetyl-L-cysteine (NAC) a specific inhibitor ROS production or PP1 a specific Src tyrosine kinase inhibitor or BAPTA a specific chelator of intracellular calcium. Our data demonstrated: 1) RES, rMnSOD, δ-TOCO, and NAC, at dose used, significantly reduced the intracellular levels of MDA induced by DAS or NIL; 2) RES, rMnSOD, and δ-TOCO increased the intracellular ROS levels; 3) The increase ROS levels is related to higher levels of oligonucleosomesi induced by DAS and NIL and that NAC significantly reduced this activity. Interestingly, our data showed that apoptotic activity of DAS and NIL have significantly increased the production of oligonucleosomes by triggering excessive ROS generation as well as functionality of SERCA receptors. © 2018 Wiley Periodicals, Inc.

Marker-aided Incorporation of Xa38, a Novel Bacterial Blight Resistance Gene, in PB1121 and Comparison of its Resistance Spectrum with xa13 + Xa21

Science.gov (United States)

Ellur, Ranjith K.; Khanna, Apurva; S, Gopala Krishnan.; Bhowmick, Prolay K.; Vinod, K. K.; Nagarajan, M.; Mondal, Kalyan K.; Singh, Nagendra K.; Singh, Kuldeep; Prabhu, Kumble Vinod; Singh, Ashok K.

2016-01-01

Basmati rice is preferred internationally because of its appealing taste, mouth feel and aroma. Pusa Basmati 1121 (PB1121) is a widely grown variety known for its excellent grain and cooking quality in the international and domestic market. It contributes approximately USD 3 billion to India’s forex earning annually by being the most traded variety. However, PB1121 is highly susceptible to bacterial blight (BB) disease. A novel BB resistance gene Xa38 was incorporated in PB1121 from donor parent PR114-Xa38 using a modified marker-assisted backcross breeding (MABB) scheme. Phenotypic selection prior to background selection was instrumental in identifying the novel recombinants with maximum recovery of recurrent parent phenome. The strategy was effective in delimiting the linkage drag to <0.5 mb upstream and <1.9 mb downstream of Xa38 with recurrent parent genome recovery upto 96.9% in the developed NILs. The NILs of PB1121 carrying Xa38 were compared with PB1121 NILs carrying xa13 + Xa21 (developed earlier in our lab) for their resistance to BB. Both NILs showed resistance against the Xoo races 1, 2, 3 and 6. Additionally, Xa38 also resisted Xoo race 5 to which xa13 + Xa21 was susceptible. The PB1121 NILs carrying Xa38 gene will provide effective control of BB in the Basmati growing region. PMID:27403778

Performance and feeding behaviour of two biotypes of the black currant-lettuce aphid, Nasonovia ribisnigri, on resistant and susceptible Lactuca sativa near-isogenic lines.

Science.gov (United States)

ten Broeke, Cindy J M; Dicke, Marcel; van Loon, Joop J A

2013-10-01

The black currant-lettuce aphid, Nasonovia ribisnigri, is an important pest of cultivated lettuce, Lactuca sativa. Since 1982, the control of this aphid on lettuce is largely based on host plant resistance, conferred by the Nr gene, introgressed from Lactuca virosa. The resistance mechanism remains to be identified. N. ribisnigri populations virulent on the Nr-based resistance in lettuce have emerged in several locations in Europe since 2007. The objective of this study was to investigate the resistance mechanism mediated by the Nr gene in lettuce by detailed studies of aphid feeding behaviour and performance. Both avirulent (Nr:0) and virulent (Nr:1)biotypes of N. ribisnigri were studied on five resistant and two susceptible near isogenic lines (NILs). In addition, survival and colony development were quantified.Nr:0 aphids showed a strong decrease in sieve element ingestion and took longer to accept a sieve element on resistant NILs compared with susceptible NILs, and no aphids survived on the resistant NIL. Nr:1 aphids fed and performed equally well on the resistant and susceptible NILs. The resistance mechanism against Nr:0 aphids encoded by the Nr gene seems to be located in the phloem, although we also observed differences in feeding behaviour during the pathway phase to the phloem. Nr:1 aphids were highly virulent to the resistance conferred by the Nr gene. The consequences of the appearance of Nr:1 aphids for control of N. ribisnigri are discussed.

Dying for Pain Relief (A Cup of Health with CDC)

Centers for Disease Control (CDC) Podcasts

2013-07-04

It’s an increasingly common story— a woman is found dead in her home from a prescription pain killer overdose. In this podcast, Dr. Karin Mack discusses the growing problem of pain killer overdoses among women.  Created: 7/4/2013 by MMWR.   Date Released: 7/4/2013.

Baltic beer market : close neighbours, different situations

Index Scriptorium Estoniae

2004-01-01

Baltimaade juhtivate õlletootjate marketingijuhid Martins Dzenis (Cesu Alus), Inita Drezina (Aldaris), Eriks Kalita (Livu Alus), Raimonds Kalnins (Kimmel), Dalius Rutkauskas (AB Ragutis), Dainius Smailys (Svyturis-Utenos Alus), Katrin Vernik (A. Le Coq Eesti), Karin Sepp (Saku Õlletehas) ja Härmo Põlluvee (Frederik Viru Õlu) olukorrast Baltimaade õlleturul, suurematest tarbijamängudest ja reklaamikampaaniatest. Tabelid

Noorte eesti režissööride uued filmid Sõpruses / Mari Peegel

Index Scriptorium Estoniae

Peegel, Mari, 1978-

2005-01-01

Sõpruse kinos esilinastub homme kaks eesti lühimängufilmi - "Vanameeste paradiis" : stsenaristid Ove Musting, Urmas Lennuk : režissöör Ove Musting : mängivad Tõnu Aav, Aleksander Eelmaa jt ning "Ukse taga" : stsenarist Margit Keerdo : režissöör Andrus Tuisk : osades Hele Kõre, Karin Lätsim, Kirill Käro, Igor Gavrilov

Esilinastuseni jõuab kaks uut Eesti lühimängufilmi

Index Scriptorium Estoniae

2005-01-01

Sõpruse kinos esilinastub homme kaks eesti lühimängufilmi - "Vanameeste paradiis" : stsenaristid Ove Musting, Urmas Lennuk : režissöör Ove Musting : mängivad Tõnu Aav, Aleksander Eelmaa jt ning "Ukse taga" : stsenarist Margit Keerdo : režissöör Andrus Tuisk : osades Hele Kõre, Karin Lätsim, Kirill Käro, Igor Gavrilov

Identification of Candidate Genes Responsible for Stem Pith Production Using Expression Analysis in Solid-Stemmed Wheat.

Science.gov (United States)

Oiestad, A J; Martin, J M; Cook, J; Varella, A C; Giroux, M J

2017-07-01

The wheat stem sawfly (WSS) is an economically important pest of wheat in the Northern Great Plains. The primary means of WSS control is resistance associated with the single quantitative trait locus (QTL) , which controls most stem solidness variation. The goal of this study was to identify stem solidness candidate genes via RNA-seq. This study made use of 28 single nucleotide polymorphism (SNP) makers derived from expressed sequence tags (ESTs) linked to contained within a 5.13 cM region. Allele specific expression of EST markers was examined in stem tissue for solid and hollow-stemmed pairs of two spring wheat near isogenic lines (NILs) differing for the QTL. Of the 28 ESTs, 13 were located within annotated genes and 10 had detectable stem expression. Annotated genes corresponding to four of the ESTs were differentially expressed between solid and hollow-stemmed NILs and represent possible stem solidness gene candidates. Further examination of the 5.13 cM region containing the 28 EST markers identified 260 annotated genes. Twenty of the 260 linked genes were up-regulated in hollow NIL stems, while only seven genes were up-regulated in solid NIL stems. An -methyltransferase within the region of interest was identified as a candidate based on differential expression between solid and hollow-stemmed NILs and putative function. Further study of these candidate genes may lead to the identification of the gene(s) controlling stem solidness and an increased ability to select for wheat stem solidness and manage WSS. Copyright © 2017 Crop Science Society of America.

Epigenetic regulation of photoperiodic flowering

OpenAIRE

Takeno, Kiyotoshi

2010-01-01

The cytidine analogue 5-azacytidine, which causes DNA demethylation, induced flowering in the non-vernalization-requiring plants Perilla frutescens var. crispa, Silene armeria and Pharbitis nil (synonym Ipomoea nil) under non-inductive photoperiodic conditions, suggesting that the expression of photoperiodic flowering-related genes is regulated epigenetically by DNA methylation. The flowering state induced by DNA demethylation was not heritable. Changes in the genome-wide methylation state we...

Temporal Constraint Propagation for Airlift Planning Analysis

Science.gov (United States)

1989-12-01

STATIOU KMSP) (OFFLOAD-STATION EGUN ) (AVAILABLE-TIME COIO) (EARLIEST-ARRIVAL-TIME C012) (LATEST-ARRIVAL-TIME COlS) (PRIORITY 001) (BULK-CARGO 200...CODES NIL)) ($F (LOAD-DESIG!ATOR RI) (ONLOAD-STATION KLFI) (OFFLOAD-STATION EGUN ) (AVAILABLE-TIME COOO) (EARLIEST-ARRIVAL-TIME COOS) (LATEST-ARRIVAL...CATEGORY-CODES NIL)) ($F (LOAD-DESIGNATOR RIS) (ONLOAD-STATION KSBD) (OFFLOAD-STATION EGUN ) (AVAILABLE-TIME COO) (EARLIEST-ARRIVAL-TIME COOS) (LATEST

Dermal Absorption of Nanomaterials Titanium Dioxide and Zinc Oxide Based Sunscreen

DEFF Research Database (Denmark)

Beer, Christiane; Dokkedahl, Karin Stenderup; Wang, Jing

at Aarhus University and has been headed by Ass.Prof. Christiane Beer as project leader and scientific manager with significant contributions by the project collaborates and associated scientists Ass.Prof. Karin Stenderup, Dr. Jing Wang, Prof. Jens Randel Nyengaard, and Ass.Prof. Duncan S. Sutherland......-2015 on Better Control of Nanomaterials and their Safety (“Bedre styr på nano”)....

Trichtlinnburg tõi esile asjad, mida turist ei näe / Liina Siib

Index Scriptorium Estoniae

Siib, Liina

2005-01-01

Ajaloolise linnaruumi säilitamist ja arendamist uuriva Euroopa kultuuriprojekti Trichtlinnburg (TLB) Tallinnas toimunud kunstiprojektidest. Sanja Ivekovici video "(If) I Lived Here", Silja Saarepuu ja Villu Plingi objekt "Plats", Anna-Karin Stjerlofi näidispostkaardid, Jüri Ojaveri projekt "Pääsla", Tiina Tammetalu projekt "Seirajad", Katrin Essensoni ja Helen Becki performance'id, David Bate'i fotosari, TLB jalutuskäigud Tallinnas

Perspectives on Positioning, Interaction, and Learning in Small-Group Discussion: Possibilities for Extending the Analytic Lens

Science.gov (United States)

Kittleson, Julie M.; Wilson, Rachel E.

2014-01-01

In this forum piece, we respond to Karin Due's study of social dynamics in groups of students in physics class and gender issues that play out in this context. We discuss two threads that appear in Due's paper: one pertains to patterns of talk within groups and how these patterns open up possibilities for learning, the other pertains to…

Eile sai Eesti Kunstimuuseumi asutamisest 86 aastat ning Tartu Kunstimuuseumi asutamisest 65 aastat

Index Scriptorium Estoniae

2005-01-01

Kumu ettekannetepäev "Roheline, toores ja lõikamata. Noor eesti kunst uue sajandi alguses" sarjast "Lisandusi eesti kunstiloole". Esinesid Karin Laansoo, Irit Rogoff, Kaido Ole, Kristjan Mändmaa, Rael Artel. Esitleti raamatut "22 + Noored eesti kunstnikud. Young Estonian Artists". 18. XI kirjutatakse alla Jaapani valitsuse kultuuritoetusleping, mis on suunatud Kumu varustamiseks kaasaegse audiogiidi süsteemiga, esitlustehnika ja maalikonserveerimislabori tehnikaga

Nano imprint lithography of textures for light trapping in thin film silicon solar cells

Energy Technology Data Exchange (ETDEWEB)

Soppe, W.J.; Dorenkamper, M.S.; Notta, J.B.; Pex, P.P.A.C. [ECN-Solliance, High Tech Campus 5, 5656 AE Eindhoven (Netherlands); Schipper, W.; Wilde, R. [Nanoptics GmbH, Innungsstrasse 5, 21244 Buchholz (Germany)

2012-09-15

Nano Imprint Lithography (NIL) is a versatile and commercially viable technology for fabrication of structures for light trapping in solar cells. We demonstrate the applicability of NIL in thin film silicon solar cells in substrate configuration, where NIL is used to fabricate a textured rear contact of the solar cells. We applied random structures, based on the natural texture of SnO:F grown by APCVD, and designed 2D periodic structures and show that for single junction {mu}c-Si cells these textured rear contacts lead to an increase of Jsc of more than 40 % in comparison to cells with flat rear contacts. Cells on optimized periodic textures showed higher fill factors which can be attributed to reduced microcrack formation, leading to less shunting in comparison to cells on random textures.

Titanic või turist? / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2006-01-01

Tallinnas Tartu maanteel asuva endise Turisti poe (arhitektid Peep Jänes, Henno Sepmann) asemele tahavad hoone omanikud ehitada kõrghoone nimega Titanic. Hoone ajutine võtmine muinsuskaitse alla on põhjustanud kohtuvaidluse

Oma põlvkonna maskottdisainer / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

Toivo Raidmetsast (sünd. 1955) ja tema loomingust. Näitus "Toivo Raidmets. Barokist dadani" Eesti Arhitektuurimuuseumis kuni 18. XII 2005. Loetletud valik T. Raidmetsa sise- ja näitusekujundusi, näitustel osalemised. 10 värv. ill

Uudiseid ja meeldetuletusi raamatukogult / Karin Tulve

Index Scriptorium Estoniae

Tulve, Karin

2000-01-01

2000. aastast on TPÜ raamatukokku ostetud EBSCO online andmebaasid, augustist on võimalik kasutada referaat- ja täistekstandmebaasi Academic Search FullText International 15 CD-ROM-il ja septembrist humanitaarteaduste bibliograafilist andmebaasi Sophia : European Databases in the Humanities CD-ROM-il

Globaalarhitekti uus manifest / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2004-01-01

Hollandi arhitekt Rem Koolhaas'ist, kelle näitus "Content" Rotterdami Kunstihallis ning näitus "Start" Rotterdami Hollandi Arhitektuuriinstituudis on avatud 31. maini. Näituse "Content" kataloogist. 2000. a. sai R. Koolhaas Pritzkeri preemia, 2003. a. Praemium Imperiale, 2004. a. veebruaris RIBA kuldmedali. Kommenteerinud Andres Alver, Hanno Grossschmidt ja Inga Raukas

Kungla rahva kuldne aeg / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2016-01-01

1970ndal aastal Lomonossovi tänavale (praegune Gonsiori tänav) ehitatud Kungla hotellist. Arhitektid Ilmar Puumets, Herbert Rüütlane; sisearhitektid Valter Pormeister, Ingrid Pormeister, Maia Laul. Samale kohale ehitati hiljem 13-korruseline Hilton hotell

Hunnitud hütid / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2016-01-01

Arhitektuuribüroos KOKO Arhitektid (Raivo Kotov, Andrus Kõresaar, Sten-Mark Mändmaa, Indrek Mikk, Martin Tago, Liis Uustal, Maia Grimitliht, Raili Paling, Kadri Kaldam) kavandatud puidust matkahütid Norras Skåpetis

Ilusa Eesti reklaamikonkurss / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas, Karin, 1957-

2009-01-01

Shanghai 2010. aasta EXPO Eesti paviljoni konkursitööd Eesti Arhitektuurimuuseumis 24. maini. Konkursist, võistlustöödest. Premeeritud tööd. Esimese koha pälvis töö "Savecity.org", autorid Illimar Truverk, Andres Labi, Janno Roos, Ionel Lehari, Priit Hamer ja Kristian Paljasmaa

Igavuse mõõt / Karin Bachmann

Index Scriptorium Estoniae

Bachmann, Karin, 1976-

2011-01-01

Tallinn astub samme elukeskkonna mitmekesisuse vähendamiseks. Üheks neist on muru pikkuse normeerimine. Lühidalt 2.-4.11.2011 Tallinnas toimuvast EFLA kongressist "Mind the Gap - Landscape for a New Era"

Linn toetab kohalikke kultuuritegijaid / Karin Klaus

Index Scriptorium Estoniae

Klaus, Karin

2008-01-01

Pärnu linnavalitsuse toetuste saajate seas ka MTÜ Pärnu Kontserdibüroo, MTÜ Pärnu David Oistrahhi Festival, RE Eesti Kontsert Pärnu Kontserdimaja, MTÜ Pärnu Rahvusvaheline Koorifestival, MTÜ Jazzkaare Sõprade Ühing ja MTÜ Suupilliklubi Piccolo

Snow Show Lapimaal / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2003-01-01

2004. a. Rovaniemis läbiviidavast rahvusvahelisest jää- ja lumearhitektuuri üritusest, kuraator Lance Fung. Steven Holli jääplokkidest kuup - projekti pilootehitis. Osalevate arhitektide ja kunstnike osaline loetelu

Värske kunsti paraad / Karin Laansoo

Index Scriptorium Estoniae

Laansoo, Karin, 1976-

2003-01-01

30. V-8. VI Rotermanni soolalaos näitus "Eesti Kunstiakadeemia lõputööd 2003", mille on kujundanud Oliver Soomets ja Kaiko Kivi. Trükised on kujundanud Maya Zerebtsova. 6. VI moeetendus. Academia Grata lõpetajate teoseid esitletakse Pärnus, meediagraafika lõputöid kaitstakse 11. VI EKA aulas

Tudengifilmid seavad fookusesse arhitektuuri / Karin Klaus

Index Scriptorium Estoniae

Klaus, Karin

2015-01-01

Pärnu keskraamatukogus näidatakse Balti Filmi- ja Meediakooli tudengite ühistööna valminud komplekti arhitektuuriteemalistest lühimängufilmidest. Filmid on Kairit Brassi "Lõunavalgus", Liva Vilnite "Sagedus", Marta Pulki "Õhk", Keidi Mäe "Uue alguse loon" ja Epp Kubu "Uustulnuk"

Rotermannid, sool ja soolaladu / Karin Hallas

Index Scriptorium Estoniae

Hallas, Karin, 1957-

2000-01-01

Christian Barthold, Christian Abraham ja Christian Ernst August Rotermannist, nende ettevõtmistest. Rotermanni kvartali kujunemisest, Rotermanni Tehastest, soolalaost (projekt Ernst Boustedt; rekonstrueerimisprojekti arhitekt Ülo Peil büroost Urbel ja Peil, sisearhitekt Taso Mähar). 6 ill

Siivsalt lahendatud Skoone bastion / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

Tallinna vanalinnas asuva Skoone bastioni ja sellega külgneva staadioni arendamiseks väljakuulutatud ideekonkursi võidutöödest. Peapreemia sai töö "Glassii" (autorid Maarja Kask, Ralf Lõoke, Karli Luik arhitektuuribüroost Salto). Teise preemia pälvis töö "SK-one" (autorid Timo Subbi, Mihkel Urmet, Taavi Kaldaru arhitektuuribüroost Suburb OÜ). Kolmanda preemia sai töö "Karl XI" (autorid Ott Kadarik, Villem Tomiste, Mihkel Tüür, Paco-Ernest Ulman arhitektuuribüroost Kosmos). Võistlustöödega saab tutvuda Arhitektuuri- ja Disainigaleriis. Harry Liivranna lühike ülevaade Skone bastioni ajaloost

Non vi sed arte / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2007-01-01

Eesti Betooniühing valis 2006. aasta parimaks betoonehitiseks Tallinnas Tartu maantee ääres asuva Luku-Experdi büroohoone (arhitekt Hindrek Kesler, konstruktor Ago-Allan Kuddu, ehitaja Ahti Väin Konsult OÜ, betooni autor AS E-Betoonelement). Ehitaja eriauhinna pälvis "Eesti Ehitus" Muuga viadukti eest. Kommenteerib Aadu Kana

Tükk demokraatlikku arhitektuuri / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2008-01-01

Taani firma Schmidt Hammer Lassen Architects koostab Tallinnasse Paljassaare poolsaarele kavandatava ECOBAY-linnaku planeeringut. Projekti kontseptsiooni kirjeldus. Taani projekteerimisfirma iseloomustus. Asutajad Morten Schmidt, Bjarne Hammer, John Lassen. Morten Holmi kommentaar

Kõikide mugavustega õnn massidele / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2004-01-01

Kunstiteaduse Instituudi rahvusvaheline konverents "Võistlevad õnned. Elukeskkond külma sõja perioodil". Esines Adrian Forty, Hilde Heynen Hollandist, Julian Holder Shotimaalt, Kirsi Saarikangas Soomest

RIBA kuldmedal Oscar Niemeyerile / Karin Hallas

Index Scriptorium Estoniae

Hallas, Karin, 1957-

1998-01-01

1998. a. RIBA (Royal Institute of British Architects) kuldmedal anti Rio de Janeiros üle brasiilia arhitektile Oscar Niemeyerile. Kuldmedali üleandmise pidulikust tseremooniast. Miks arvukate 20. saj. modernismi klassikasse kuuluvate hoonete autorile alles nüüd RIBA kuldmedal anti. Praegu 91 aastasel vanameistril valmis 1996. a. Rio de Janeiros Niter̤i Moodsa kunsti muuseum, ehitamist ootab Rio konverentsikeskus

Läti parimad majad / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2006-01-01

Muljeid Läti arhitektuuriauhindade jagamiselt. Peapreemia: arhitektide Uldis Lukshevics'i ja Martins Oshans'i projekteeritud eramu. Parim avalik hoone: arhitektuuribüroo Kubs projekteeritud kontorihoone Riias. Suurim Baltikumis: arhitektuuribüroo Arhis projekteeritud Ljepaja politseihoone. Parim rekonstrueerimisprojekt: arhitektuuribüroo Arhis projekteeritud avatud kontor nõukogudeaegses tööstushoones. Parim interjöör: kohvik Vanilla (Ieva Dripe, Janis Broka) ja tekstiilipood Garage (Zaiga Gaile büroo). Uldis Lukshevics'i projekteeritud suvilad, mis paiknevad postidel

Austraallased huvituvad ETV toodangust / Karin Leemet

Index Scriptorium Estoniae

Leemet, Karin

2000-01-01

ETV saadet "Simson Seakülast" näidatakse peagi Austraalia telekanalil The Special Broadcasting Service. 1995. a. valminud kunstisaade on eesti skulptorist Aivar Simsonist, saate autorid Mariina Mälk, Peeter Brambat, operaator Peep Laansalu. Mari Sobolev A. Simsoni töödest

Deontiline modaalsus poliitikute arvamusartiklites / Karin Mandra

Index Scriptorium Estoniae

Mandra, Karin

2008-01-01

Lähtudes funktsionaalse grammatika põhimõtetest analüüsitakse, missuguste tegevuste ja protsesside vajalikkust poliitikud oma arvamusartiklites rõhutavad ning kuivõrd on esindatud deontiline aspekt (ehk kellele on direktiivsus suunatud)

Kvoodiraha jagati Tambovi konstandi alusel / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2011-01-01

Riik sai CO₂ kvoodiraha vähemalt 234 enda hoonele ja omavalitsused 239 objektile, see raha jagati aga 106 omavalitsusele ehk vähem kui pooltele kõigist 226 vallast ja linnast. Kaart: CO₂ kvoodiraha jagus vähem kui pooltele omavalitsustele; Diagramm: Riigi ja omavalitsuste objektid maakonniti

Rae nahaalne skeem soosis lemmikuid / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2007-01-01

Tartu linnavalitsuse maadevahetuse tehingust Reformierakonnaga seotud ettevõtjate Verni Loodmaa, Kalev Kase ja Alar Kroodo firmaga Kvintett Kinnisvara. Skeem: Maadevahetus linnavalitsuse tagatoas. Vt. samas: Lihtinimest ähvardab sundvõõrandamine

Ekskantslerit ei kollita huvide konflikt / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2010-01-01

Kaitseministeeriumi vastuse kohaselt vaatasid sealsed audiitorid üle teadus-arendustegevususe uurimistoetuste maksmise ja seni sõlmitud lepingud ning selgus, et kahtlustused, nagu oleks kaitseministeeriumi endine kantsler Lauri Almann oma eraäri juba kantslerina ette valmistanud, ei vasta tõele. Autor vabandab Lauri Almanni ees

Samõje dorogije kostjumõ / Nil Santelman

Index Scriptorium Estoniae

Santelman, Nil

2004-01-01

Ultramoodsatest ülikondadest ja nende hindadest. Uuritakse tuntud moeloojate YSL, Gucci, Dolce&Gabbana, Valentino, Calvin Kleini valmistooteid ja individuaaltellimuste võimalusi, samuti individuaalõmblejate William Fiovanti (New York), Caraceni (Milano), H. Huntsmani, Anderson&Sheppardi (London) jt. töid

Meltsiveski Konsumist saab korteritega supermarket / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2005-01-01

Meltsiveski Konsumi kõrvale ehitatakse uus hoone, kus saab olema 30 korterit ja supermarket ning viimase katusel mängu- ja puhkeala. Juurdeehituse projekteeris arhitektuuribüroo Pluss arhitekt Indrek Allmann

Laudarobot muudab lehmasõnniku elektriks / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2006-01-01

Vt. ka Tartu Postimees 7. märts, lk. 1. Laudarobot lüpsab USAs Pennsylvania osariigis lehma ilma inimese abita, toob sööda ette ja viib sõnniku ära, võtab piimaproovi, toodab biogaasist elektrit. Sama tüüpi masin hakkab tuleval aastal töötama ka Tartumaal

Kapital annab Rein Kilgile loominguvabaduse / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2004-01-01

Rein Kilgil on 28 ettevõtet, see võimaldab rakendada ettevõtluses loomingulisust. Vt. samas: Priit Rajalo. Rein Kilk hämmastab oskusega ajast kõik võtta. Lisa: Rein Kilgi enamusosalusega ettevõtted; Rein Kilk on tööandja ligi 1000 inimesele; Rein Kilgi enamusosaluseta ettevõtted; Rein Kilgiga on seotud veel

UEFA ametnik laitis staadionide seisukorda / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2004-01-01

UEFA noorte- ja amatöörjalgpalli projektijuht Claudio Negroni andis Tartu ja selle lähiümbruse staadionidele ebarahuldava hinde. Tamme staadionil tehakse 16 miljonit krooni maksev remont, et seal saaks 2007.a. toimuda 19-aastaste noormeeste Euroopa jalgpalli meistrivõistluste finaalturniir

Avangardi kanalast sai moodne biodiislitehas / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2006-01-01

Vennad Ergo ja Elvo Themas on endises Avangardi kolhoosi kanalas sisse seadnud biodiislitehase, mille turuks saavad esialgu Saksamaa ja Rootsi kütuse hulgimüüjad. Kaart: Biodiislitehas alustab märtsis

Genetic dissection of black grain rice by the development of a near isogenic line.

Science.gov (United States)

Maeda, Hiroaki; Yamaguchi, Takuya; Omoteno, Motoyasu; Takarada, Takeshi; Fujita, Kenji; Murata, Kazumasa; Iyama, Yukihide; Kojima, Yoichiro; Morikawa, Makiko; Ozaki, Hidenobu; Mukaino, Naoyuki; Kidani, Yoshinori; Ebitani, Takeshi

2014-06-01

Rice (Oryza sativa L.) can produce black grains as well as white. In black rice, the pericarp of the grain accumulates anthocyanin, which has antioxidant activity and is beneficial to human health. We developed a black rice introgression line in the genetic background of Oryza sativa L. 'Koshihikari', which is a leading variety in Japan. We used Oryza sativa L. 'Hong Xie Nuo' as the donor parent and backcrossed with 'Koshihikari' four times, resulting in a near isogenic line (NIL) for black grains. A whole genome survey of the introgression line using DNA markers suggested that three regions, on chromosomes 1, 3 and 4 are associated with black pigmentation. The locus on chromosome 3 has not been identified previously. A mapping analysis with 546 F2 plants derived from a cross between the black rice NIL and 'Koshihikari' was evaluated. The results indicated that all three loci are essential for black pigmentation. We named these loci Kala1, Kala3 and Kala4. The black rice NIL was evaluated for eating quality and general agronomic traits. The eating quality was greatly superior to that of 'Okunomurasaki', an existing black rice variety. The isogenicity of the black rice NIL to 'Koshihikari' was very high.

Consumer health information partnerships: the health science library and multitype library system.

Science.gov (United States)

Hollander, S

1996-04-01

The University of Illinois Library of the Health Sciences at Rockford (LHS-Rockford) long has honored a commitment to serving the health information needs of the greater Rockford community. Utilization data collected over the past five years indicate that approximately 50% of reference transactions involve persons not affiliated with the university. In early 1994, LHS-Rockford submitted a proposal to the Northern Illinois Library System (NILS), a multitype system spanning twelve counties in northwestern Illinois, asking to serve as a resource library for improving medical and health information services provided by the 138 NILS member libraries. The NILS funded this pilot project as part of an effort to implement a new strategic plan, which encouraged member libraries to form networks to provide reference back-up service. LHS-Rockford acquired InfoTrac's Health Reference Center, a consumer health information database, and set up a dedicated workstation near the information and circulation desk. Referral guidelines were established and the project was promoted among NILS member libraries. Activities were documented in order to track project success in terms of referrals and outcomes. The demonstration project was very successful, and it proves public consumers seeking health information can benefit greatly from this type of cooperative arrangement.

Photonic crystal structures on nonflat surfaces fabricated by dry lift-off soft UV nanoimprint lithography

International Nuclear Information System (INIS)

Sun, Tangyou; Xu, Zhimou; Xu, Haifeng; Zhao, Wenning; Wu, Xinghui; Liu, Sisi; Ma, Zhichao; He, Jian; Liu, Shiyuan; Peng, Jing

2013-01-01

The surface nonflatness induced from the material itself or the production atmosphere can lead to serious non-uniformity consequences in nanoimprint lithography (NIL) which is used for providing a low cost and high throughput nano-fabrication process. In this paper, soft UV NIL (SUNIL) processes are used for photonic crystal (PC) pattern transfer of a GaN-based light-emitting diode (LED) with patterned sapphire substrate (PSS). The results reveal a significant incompatibility between the conventional SUNIL and the nonflat p-GaN surface. Ellipse-shaped rather than circle-shaped PC structure is obtained on the p-GaN surface due the deformation of the soft mold in nonflat NIL. A dry lift-off (DLO) SUNIL is proposed to overcome the non-uniformity issue in nonflat NIL as well as the collapse problem of the free-standing pillar-shaped resist in wet lift-off. The photoluminescence enhancements of the LED fabricated by the DLO SUNIL method compared to those with conventional SUNIL and unpatterned LED are 1.41 fold and 3.48 fold, respectively. Further study shows that the DLO SUNIL is applicable in the fabrication of the PC structure with tunable duty cycle via one single initial PC mold. (paper)

Time-Efficient High-Resolution Large-Area Nano-Patterning of Silicon Dioxide

Directory of Open Access Journals (Sweden)

Li Lin

2017-01-01

Full Text Available A nano-patterning approach on silicon dioxide (SiO2 material, which could be used for the selective growth of III-V nanowires in photovoltaic applications, is demonstrated. In this process, a silicon (Si stamp with nanopillar structures was first fabricated using electron-beam lithography (EBL followed by a dry etching process. Afterwards, the Si stamp was employed in nanoimprint lithography (NIL assisted with a dry etching process to produce nanoholes on the SiO2 layer. The demonstrated approach has advantages such as a high resolution in nanoscale by EBL and good reproducibility by NIL. In addition, high time efficiency can be realized by one-spot electron-beam exposure in the EBL process combined with NIL for mass production. Furthermore, the one-spot exposure enables the scalability of the nanostructures for different application requirements by tuning only the exposure dose. The size variation of the nanostructures resulting from exposure parameters in EBL, the pattern transfer during nanoimprint in NIL, and subsequent etching processes of SiO2 were also studied quantitatively. By this method, a hexagonal arranged hole array in SiO2 with a hole diameter ranging from 45 to 75 nm and a pitch of 600 nm was demonstrated on a four-inch wafer.

Cones fabricated by 3D nanoimprint lithography for highly sensitive surface enhanced Raman spectroscopy

International Nuclear Information System (INIS)

Wu Wei; Hu Min; Ou Fungsuong; Li Zhiyong; Williams, R Stanley

2010-01-01

We demonstrated a cost-effective and deterministic method of patterning 3D cone arrays over a large area by using nanoimprint lithography (NIL). Cones with tip radius of less than 10 nm were successfully duplicated onto the UV-curable imprint resist materials from the silicon cone templates. Such cone structures were shown to be a versatile platform for developing reliable, highly sensitive surface enhanced Raman spectroscopy (SERS) substrates. In contrast to the silicon nanocones, the SERS substrates based on the Au coated cones made by the NIL offered significant improvement of the SERS signal. A further improvement of the SERS signal was observed when the polymer cones were imprinted onto a reflective metallic mirror surface. A sub-zeptomole detection sensitivity for a model molecule, trans-1,2-bis(4-pyridyl)-ethylene (BPE), on the Au coated NIL cone surfaces was achieved.

Hästi restaureeritud raekoda sai Euroopast kõrge tunnustuse / Askur Alas

Index Scriptorium Estoniae

Alas, Askur, 1973-

2006-01-01

Tallinna raekoda sai Euroopa Liidu ja Euroopa pärandkultuuri organisatsiooni Europa Nostra kultuuripärandi medali. Europa Nostra nõukogu liikme Karin Hallas-Murula sõnul arvestatakse auhindade jagamisel nii mälestise säilitamist kui ka kasutamist tänapäeval. Mainekas auhind on tunnustus Teddy Böcklerile, kellele raekoja restaureerimine oli elutööks. Lisatud Europa Nostra peapreemiad

Kriisimängud Berliinis : "Theatertreffen 2010" / Madli Pesti

Index Scriptorium Estoniae

Pesti, Madli, 1980-

2010-01-01

7.-24. maini Berliinis toimunud teatrifestivalist "Theatertreffen". Lavastustest "Räpased, koledad, alatud" (lav. Karin Beier), "Riesenbutzbach. Igavene koloonia" (lav. Marthaler), Dennis Kelly "Ma olen nii armunud, et võiksin oksendada" (lav. Stephan Kimmig), Roland Schimmelpfennigiti "Kuldne draakon" (lav. R. Schimmelpfennig), Peter Handke "Tund, mil me üksteist midagi ei teadnud" (lav. Viktor Bodo) ja Elfride Jelineki tekstide põhjal "Kaupmehe kontraht" (lav. Nicolas Stemann)

Areen küsib : mis oli aasta kultuurishokk?

Index Scriptorium Estoniae

2005-01-01

Positiivne ja negatiivne kultuurisündmus 2005. aastal. Küsimusele vastavad Juhan Maiste, Karin Hallas-Murula, Jaan Toomik, Toivo Raidmets, Maile Grünberg, Leo Lapin, Märt Väljataga, Berk Vaher, Sergei Stadnikov, Veljo Kaasik, Margit Mutso, Erkki-Sven Tüür, Mihkel Mutt, Kaarel Tarand, Priidu Beier, Hasso Krull, Jaan Pehk, Hendrik Luuk, Karlo Funk, Kristo Rajasaare, Andres Maimik, Priit Raud, Marianne Kõrver

Ööpäeva väldanud etendused keerasid näitlejate ja publiku elurütmi pea peale / Marika Rajamäe, Merili Nikkolo

Index Scriptorium Estoniae

Rajamäe, Marika, 1952-

2008-01-01

Vargamäel 22 tundi kestnud maratonetendusest Tammsaare "Tõe ja õiguse" põhjal - Elmo Nüganeni lavastused "Tõde ja õigus. Teine osa", "Karin. Indrek. Tõde ja õigus. 4" ja "Wargamäe Wabariik" (III osa) ning Jaanus Rohumaa lavastus "Vargamäe kuningriik" (I ja V osa). Reportaaž on tähtsamatest hetkedest alates 21. juuni kell 11.00 kuni 22. juuni 10.00-ni

Dicty_cDB: VSF787 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available gsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvg dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnil...snyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlps agvgdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkg nil

Three-Dimensional Route Planning for a Cruise Missile for Minimal Detection by Observer

Science.gov (United States)

1989-06-01

detect the enemy’s weakest avenues of approach are needed. Such systems could also be used to identify our own deficiencies and allow for...vector-k (oval (line-segment-direction-vector (oval line-i))))) ( Tk2 (vector-k (eval (line-segment-direction-voctor (oval line-2))))) (Tval ’nil...zerop Tkl)) (not (zerop Tk2 ))) (setf Tval (/ Tkl Tk2 ))) (t (return-from parallel-lines ’nil))) (cond ((and (equal Til (* Tval Ti2)) (equal Tjl (* Tval

Nanoimprinted organic semiconductor laser pumped by a light-emitting diode.

Science.gov (United States)

Tsiminis, Georgios; Wang, Yue; Kanibolotsky, Alexander L; Inigo, Anto R; Skabara, Peter J; Samuel, Ifor D W; Turnbull, Graham A

2013-05-28

An organic semiconductor laser, simply fabricated by UV-nanoimprint lithography (UV-NIL), that is pumped with a pulsed InGaN LED is demonstrated. Molecular weight optimization of the polymer gain medium on a nanoimprinted polymer distributed feedback resonator enables the lowest reported UV-NIL laser threshold density of 770 W cm(-2) , establishing the potential for scalable organic laser fabrication compatible with mass-produced LEDs. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Simultaneous analysis of residual stress and stress intensity factor in a resist after UV-nanoimprint lithography based on electron moiré fringes

International Nuclear Information System (INIS)

Wang, Qinghua; Kishimoto, Satoshi

2012-01-01

In this study, the residual stress in a resist (PAK01) film and the stress intensity factor (SIF) of an induced crack are simultaneously estimated during ultraviolet nanoimprint lithography (UV-NIL) based on electron moiré fringes. A micro grid in a triangular arrangement on the resist film fabricated by UV-NIL is directly used as the model grid. Electron moiré fringes formed by the interference between the fabricated grid and the electron scan beam are used to measure the displacement distribution around the tip of a crack induced by the residual stress in the resist. The SIF of the crack is estimated using a displacement extrapolation method. The residual strain fields and the corresponding residual stress in the resist film far from the crack are determined and analyzed. This method is effective for evaluating the grid quality fabricated by the UV-NIL technique. (paper)

Characterization and fine mapping of qkc7.03: a major locus for kernel cracking in maize.

Science.gov (United States)

Yang, Mingtao; Chen, Lin; Wu, Xun; Gao, Xing; Li, Chunhui; Song, Yanchun; Zhang, Dengfeng; Shi, Yunsu; Li, Yu; Li, Yong-Xiang; Wang, Tianyu

2018-02-01

A major locus conferring kernel cracking in maize was characterized and fine mapped to an interval of 416.27 kb. Meanwhile, combining the results of transcriptomic analysis, the candidate gene was inferred. Seed development requires a proper structural and physiological balance between the maternal tissues and the internal structures of the seeds. In maize, kernel cracking is a disorder in this balance that seriously limits quality and yield and is characterized by a cracked pericarp at the kernel top and endosperm everting. This study elucidated the genetic basis and characterization of kernel cracking. Primarily, a near isogenic line (NIL) with a B73 background exhibited steady kernel cracking across environments. Therefore, deprived mapping populations were developed from this NIL and its recurrent parent B73. A major locus on chromosome 7, qkc7.03, was identified to be associated with the cracking performance. According to a progeny test of recombination events, qkc7.03 was fine mapped to a physical interval of 416.27 kb. In addition, obvious differences were observed in embryo development and starch granule arrangement within the endosperm between the NIL and its recurrent parent upon the occurrence of kernel cracking. Moreover, compared to its recurrent parent, the transcriptome of the NIL showed a significantly down-regulated expression of genes related to zeins, carbohydrate synthesis and MADS-domain transcription factors. The transcriptomic analysis revealed ten annotated genes within the target region of qkc7.03, and only GRMZM5G899476 was differently expressed between the NIL and its recurrent parent, indicating that this gene might be a candidate gene for kernel cracking. The results of this study facilitate the understanding of the potential mechanism underlying kernel cracking in maize.

Review of National Work Programme on the Long Term Effects of Sustained High G on the Cervical Spine (Analyse du programme de travail national : les effets long terme sur la colonne cervicale d’un nombre de G lev et prolong )

Science.gov (United States)

2008-12-01

Neck Muscle 6-7 Function and Symptoms of Neck Pain in UK Student Pilots 6.3.3 Other Ongoing Relevant Activities 6-9 6.4 Unclassified Reports...Prof. Karin Harms-Ringdahl, PhD, RPT Karolinska Institutet Department of Neurobiology, Care Sciences, and Society Division of Physiotherapy 23100...Äng Karolinska Institutet Department of Neurobiology, Care Sciences, and Society Division of Physiotherapy Alfred Nobels Allé 23100 SE-14183

Proceedings of the 3rd Biennial Conference of the Society for Implementation Research Collaboration (SIRC) 2015: advancing efficient methodologies through community partnerships and team science

OpenAIRE

Lewis, Cara; Darnell, Doyanne; Kerns, Suzanne; Monroe-DeVita, Maria; Landes, Sara J.; Lyon, Aaron R.; Stanick, Cameo; Dorsey, Shannon; Locke, Jill; Marriott, Brigid; Puspitasari, Ajeng; Dorsey, Caitlin; Hendricks, Karin; Pierson, Andria; Fizur, Phil

2016-01-01

Table of contents Introduction to the 3rd Biennial Conference of the Society for Implementation Research Collaboration: advancing efficient methodologies through team science and community partnerships Cara Lewis, Doyanne Darnell, Suzanne Kerns, Maria Monroe-DeVita, Sara J. Landes, Aaron R. Lyon, Cameo Stanick, Shannon Dorsey, Jill Locke, Brigid Marriott, Ajeng Puspitasari, Caitlin Dorsey, Karin Hendricks, Andria Pierson, Phil Fizur, Katherine A. Comtois A1: A behavioral economic perspective ...

Karl Menningu (ja iseenese) päästmiseks / Ants Hein

Index Scriptorium Estoniae

Hein, Ants, 1952-

2008-01-01

Vastuseks Karin Hallas-Murula arvustusele "Maja, mis on sümbol" (Sirp, 2007, 5. X, lk. 13) ja Mait Väljase arvustusele "Iseolemise algus arhitektuuris" (Maja, 2008, nr. 1, lk. 86-87) oma 2007. a. ilmunud raamatust "Maja kui sümbol : Eesti Üliõpilaste Seltsi hoone Tartus" kohta. Georg Hellati ja Karl Menningu osalusest EÜS-i hoone sünniloos. Frank Lloyd Wrightist kui võimalikust eeskujuandjast

Identifying and Leveraging Trust as a Key Element in the Development, Implementation and Sustainment of the Salt Lake City Fire Department’s Intelligence Program

Science.gov (United States)

2014-09-01

this amazing adventure. An education in self-exploration balanced with relentless tests of my stamina and mettle. To my classmates: Thank you for...Karin and son Scott, thank you for providing the comic relief so needed throughout this process. And most importantly, to my husband, Jeff: There...development of a fire intelligence program.190191 In her NPS Masters Thesis, Terrorism Awareness and Education as a Prevention Strategy for First

Effects of nickel chloride and oxygen depletion on behaviour and vitality of zebrafish (Danio rerio, Hamilton, 1822) (Pisces, Cypriniformes) embryos and larvae

International Nuclear Information System (INIS)

Kienle, Cornelia; Koehler, H.-R.; Filser, Juliane; Gerhardt, Almut

2008-01-01

We examined acute (2 h exposure of 5-day-old larvae) and subchronic (exposure from fertilization up to an age of 11 days) effects of NiCl 2 .6H 2 O on embryos and larvae of zebrafish (Danio rerio), both alone and in combination with oxygen depletion. The following endpoints were recorded: acute exposure: locomotory activity and survival; subchronic exposure: hatching rate, deformations, locomotory activity (at 5, 8 and 11 days) and mortality. In acute exposures nickel chloride (7.5-15 mg Ni/L) caused decreasing locomotory activity. Oxygen depletion (≤2.45 ± 0.16 mg O 2 /L) also resulted in significantly reduced locomotory activity. In the subchronic test, exposure to ≥10 mg Ni/L resulted in delayed hatching at an age of 96 h, in decreased locomotory activity at an age of 5 days, and increased mortality at an age of 11 days (LC 20 = 9.5 mg Ni/L). The observed LOEC for locomotory activity (7.5 mg Ni/L) is in the range of environmentally relevant concentrations. Since locomotory activity was already affected by acute exposure, this parameter is recommended to supplement commonly recorded endpoints of toxicity. - Increasing concentrations of nickel chloride and decreasing concentrations of oxygen lead to reduced vitality and locomotory activity in Danio rerio embryos and larvae

Stacking metal nano-patterns and fabrication of moth-eye structure

Science.gov (United States)

Taniguchi, Jun

2018-01-01

Nanoimprint lithography (NIL) can be used as a tool for three-dimensional nanoscale fabrication. In particular, complex metal pattern structures in polymer material are demanded as plasmonic effect devices and metamaterials. To fabricate of metallic color filter, we used silver ink and NIL techniques. Metallic color filter was composed of stacking of nanoscale silver disc patterns and polymer layers, thus, controlling of polymer layer thickness is necessary. To control of thickness of polymer layer, we used spin-coating of UV-curable polymer and NIL. As a result, ten stacking layers with 1000 nm layer thickness was obtained and red color was observed. Ultraviolet nanoimprint lithography (UV-NIL) is the most effective technique for mass fabrication of antireflection structure (ARS) films. For the use of ARS films in mobile phones and tablet PCs, which are touch-screen devices, it is important to protect the films from fingerprints and dust. In addition, as the nanoscale ARS that is touched by the hand is fragile, it is very important to obtain a high abrasion resistance. To solve these problems, a UV-curable epoxy resin has been developed that exhibits antifouling properties and high hardness. The high abrasion resistance ARS films are shown to withstand a load of 250 g/cm2 in the steel wool scratch test, and the reflectance is less than 0.4%.

Map-based Cloning and Characterization of the BPH18 Gene from Wild Rice Conferring Resistance to Brown Planthopper (BPH) Insect Pest.

Science.gov (United States)

Ji, Hyeonso; Kim, Sung-Ryul; Kim, Yul-Ho; Suh, Jung-Pil; Park, Hyang-Mi; Sreenivasulu, Nese; Misra, Gopal; Kim, Suk-Man; Hechanova, Sherry Lou; Kim, Hakbum; Lee, Gang-Seob; Yoon, Ung-Han; Kim, Tae-Ho; Lim, Hyemin; Suh, Suk-Chul; Yang, Jungil; An, Gynheung; Jena, Kshirod K

2016-09-29

Brown planthopper (BPH) is a phloem sap-sucking insect pest of rice which causes severe yield loss. We cloned the BPH18 gene from the BPH-resistant introgression line derived from the wild rice species Oryza australiensis. Map-based cloning and complementation test revealed that the BPH18 encodes CC-NBS-NBS-LRR protein. BPH18 has two NBS domains, unlike the typical NBS-LRR proteins. The BPH18 promoter::GUS transgenic plants exhibited strong GUS expression in the vascular bundles of the leaf sheath, especially in phloem cells where the BPH attacks. The BPH18 proteins were widely localized to the endo-membranes in a cell, including the endoplasmic reticulum, Golgi apparatus, trans-Golgi network, and prevacuolar compartments, suggesting that BPH18 may recognize the BPH invasion at endo-membranes in phloem cells. Whole genome sequencing of the near-isogenic lines (NILs), NIL-BPH18 and NIL-BPH26, revealed that BPH18 located at the same locus of BPH26. However, these two genes have remarkable sequence differences and the independent NILs showed differential BPH resistance with different expression patterns of plant defense-related genes, indicating that BPH18 and BPH26 are functionally different alleles. These findings would facilitate elucidation of the molecular mechanism of BPH resistance and the identified novel alleles to fast track breeding BPH resistant rice cultivars.

Design and Evaluation of an Energy-Dense, Light-Weight Combat Ration to Sustain Land Forces Involved in High-Intensity, Short-Duration Operations

Science.gov (United States)

2015-03-01

group sessions centred on popular jack rations such as retorted fish and salami-type items as well as noodles , other pasta, confectionery and energy...Amount consumed Consumed Partially consumed Not consumed nil response Palatability 0% 20% 40% 60% 80% 100% Coffee, Instant Tea bag SCM sugar Pe rc... Instant Tea bag SCM sugar Pe rc en t o f r es po nd an ts Too much Enough Not enough nil response Amount consumed 0% 20% 40% 60% 80% 100% Coffee, Instant

Appendices on provisional nomenclature, symbols, terminology and conventions - number 55

International Nuclear Information System (INIS)

1976-01-01

Ten numerically-based syllables (nil, un, bi, etc) are used to provide recommended names of elements of atomic numbers greater than 100. The symbol of the element is composed of the initial letters of the numerical roots which make up the name. Abbreviated forms of the names of elements 101 to 199 are proposed. Thus: element 105 would be named Un-nil-pentium [hyphens not part of name but shown in the recommendatoins to assist comprehension], symbol Unp, abbreviation Pentium. (U.K.)

Den umulige film

DEFF Research Database (Denmark)

Moestrup, Steffen Damkjær

2014-01-01

Den smertelige Sorg og Glæde fuldender en lang og glorværdig karriere for danske Nils Malmros. Den er en yderst vellykket film, fordi den forbliver usentimental om en skæbnesvanger dag i instruktørens liv.......Den smertelige Sorg og Glæde fuldender en lang og glorværdig karriere for danske Nils Malmros. Den er en yderst vellykket film, fordi den forbliver usentimental om en skæbnesvanger dag i instruktørens liv....

Toxicidade aguda e efeitos histopatológicos do herbicida diquat na brânquia e no fígado da tilápia nilótica (Oreochromis niloticus = Acute toxicity and histopathologic effects of diquat herbicide on the gill and liver of nile tilapia (Oreochromis niloticus

Directory of Open Access Journals (Sweden)

Matheus Nicolino Peixoto Henares

2008-01-01

Full Text Available A concentração letal 50% e os efeitos histopatológicos do herbicida diquat para a tilápia nilótica (Oreochromis niloticus foram avaliados em três experimentos. Os peixes foram expostos às concentrações de 0; 25; 30; 35; 40; 45; 50; 55; e 60 mg de diquat L-1 e a histologia da brânquia e do fígado foi avaliada nos peixes sobreviventes. A CL (I 50-96h do diquat estimada foi de 37,28 mg L-1, com limite inferior de 33,12 mg L-1 e superior de 41,44mg L-1. No tratamento com 30, 35 e 40 mg L-1, ocorreram início de fusão apical das lamelas secundárias; com 45 e 50 mg L-1 ocorreram congestão nas lamelas primárias e no tratamento com 55 mg L-1, ocorreu congestão sangüínea nas lamelas secundárias. O fígado dos peixes dos tratamentos controle, 30 e 35 mg L-1 estavam com organização cordonal dos hepatócitos. Nos tratamentos com 40 e 45 mg L-1, ocorreram hipertrofia dos hepatócitos; com 50 e 55 mg L-1 ocorreram fusão celular e presença de vacúolos. O diquat apresentoubaixo risco de intoxicação à tilápia nilótica e as alterações histopatológicas mais severas ocorreram somente nas concentrações mais elevadas.The lethal concentration of 50% (LC (I 50-96h and the histopathologic effects of diquat herbicide on Nile tilapia (Oreochromis niloticus fish were evaluated in three experiments. The fishes were exposed to concentrations of 0, 25, 30, 35, 40, 45, 50, 55 and 60 mg diquat L-1, and gill and liver histology were evaluated in the surviving fishes. The estimated LC (I (50-96h of diquat was37.28 mg L-1, with lower limits of 33.12 mg L-1 and upper limits of 41.44 mg L-1. In the treatment with 30, 35 and 40 mg L-1, signs of apical fusion of the secondary lamellae were observed; with 45 and 50 mg L-1, congestion of the primary lamellae was observed; in thetreatment with 55 mg L-1, congestion of blood vessels on secondary lamellae took place. The livers of fishes in treatments with 0, 25, 30 and 35 mg L-1 showed cordonal

Functional patterns obtained by nanoimprinting lithography and subsequent growth of polymer brushes

International Nuclear Information System (INIS)

Genua, A; AlduncIn, J A; Pomposo, J A; Grande, H; Kehagias, N; Reboud, V; Sotomayor, C; Mondragon, I; Mecerreyes, D

2007-01-01

In this work the growth of polymer brushes was combined with nanoimprint lithography (NIL) in order to obtain new functional nanopatterns. First, a functional thermoplastic methacrylic copolymer poly(methyl methacrylate-co-2-bromoisobutyryl-oxy-ethyl methacrylate) was synthesized. This copolymer was successfully patterned by NIL using a silicon stamp at 160 deg. C and 60 bar. Next, hydrophilic polymer brushes based on poly(3-sulfopropylmethacrylate) and hydrophobic polymer brushes based on a poly(fluorinated methacrylate) were grown on the imprinted surfaces. The surface properties of the patterned polymer were accordingly modified and, as a consequence, the water contact angle was modified from 80.3 deg. to 32.5 deg. in the case of the hydrophilic brushes and to 118.1 deg. in the case of the hydrophobic brushes. As an application we demonstrated the use of hydrophobic polymer brushes in order to modify the surface of polymeric stamps for NIL with self-demoulding properties

Diatom-inspired templates for 3D replication: natural diatoms versus laser written artificial diatoms

International Nuclear Information System (INIS)

Belegratis, M R; Schmidt, V; Nees, D; Stadlober, B; Hartmann, P

2014-01-01

The diatoms are ubiquitous, exist in large numbers and show a great diversity of features on their porous silica structures. Therefore, they inspire the fabrication of nanostructured templates for nanoimprint processes (NIL), where large structured areas with nanometer precision are required. In this study, two approaches regarding the respective challenges and potential exploitations are followed and discussed: the first one takes advantage of a template that is directly made of natural occurring diatoms. Here, two replication steps via soft lithography are needed to obtain a template which is subsequently used for NIL. The second approach exploits the technical capabilities of the precise 3D laser lithography (3DLL) based on two-photon polymerization of organic materials. This method enables the fabrication of arbitrary artificial diatom-inspired micro- and nanostructures and the design of an inverse structure. Therefore, only one replication step is needed to obtain a template for NIL. In both approaches, a replication technique for true 3D structures is shown. (paper)

A 3D-printed device for polymer nanoimprint lithography

Science.gov (United States)

Caño-García, Manuel; Geday, Morten A.; Gil-Valverde, Manuel; Megías Zarco, Antonio; Otón, José M.; Quintana, Xabier

2018-02-01

Nanoimprint lithography (NIL) is an imprinting technique which has experienced an increasing popularity due to its versatility in fabrication processes. Commercial NIL machines are readily available achieving high quality results; however, these machines involve a relatively high investment. Hence, small laboratories often choose to perform NIL copies in a more rudimentary and cheaper way. A new simple system is presented in this document. It is based on two devices which can be made in-house in plastic by using a 3D printer or in aluminum. Thus, the overall manufacturing complexity is vastly reduced. The presented system includes pressure control and potentially temperature control. Replicas have been made using a sawtooth grating master with a pitch around half micrometre. High quality patterns with low density of imperfections have been achieved in 2.25 cm2 surfaces. The material chosen for the negative intermediary mould is PDMS. Tests of the imprint have been performed using the commercial hybrid polymer Ormostamp®.

Kui vana on kunstnik? / Anneli Porri

Index Scriptorium Estoniae

Porri, Anneli, 1980-

2003-01-01

Rahvusvahelise kunstihariduse konverentsi "InSea on Sea" raames Kunstiakadeemia galeriis Karin Laansoo kureeritud Tallinna Kunstikooli õpilaste tööde näitus "MÄRKmed", Draakoni galeriis Mari Sobolevi kureeritud Viljandi Maagümnaasiumi kunstistuudio näitus "Sisseastumiseksam maailma", rahvusraamatukogus Anneli Porri kureeritud näitus "Kokkuvõte" EKA tänavuste lõpetajate töödest ja näitus "Leitud tagahoovist", Kullo galeriis rahvusvaheline näitus "Dialoog erinevuste vahel"

Equitable PERSTEMPO - The Challenge for Long-Term Deployed Armed Forces

Science.gov (United States)

2003-04-07

substantial impact on the operational effectiveness of the Bundeswehr of the future.  Rudolf Scharping Former Federal Minister of Defense The vision...Federal Minister of Defense, Rudolf Scharping, initiated a new force planning by means of the so-called "Cornerstones Paper" on 01 June 2000, the Chief of...Annex 1) 77 Rainer Marr, Timea Biro, and Karin Steiner , Vereinbarkeit von Familie und Beruf des Soldaten – Moeglichkeiten und Grenzen einer

Uncommon disorders and decay in near-isogenic lines of melon and reference cultivars Acidentes fisiológicos e podridões atípicas em linhas quase-isogénicas de melão e em cultivares de referência

Directory of Open Access Journals (Sweden)

Juan Antonio Martínez

2009-12-01

Full Text Available Postharvest disorders and rots can produce important economic losses in fruits stored for long time for exportation. The genetic and physiological basis of some disorders in melon (Cucumis melo L. are unknown and particularly the possible relation with climacteric behavior. A collection of melon near-isogenic lines (NILs (SC3-5 and seven more showing climacteric and two non-climacteric ripening pattern were analyzed to study genetic and physiological aspects of fruit disorders and rots. Two non-climacteric (Nicolás; Inodorus Group; and Shongwan Charmi PI161375, Conomon Group and two climacteric cultivars (Fado, Reticulatus Group; Védrantais, Cantaloupensis Group were used as reference. The field was divided in eight blocks containing one three-plant replication for each NIL, two for the parental cultivar Piel de Sapo and one or two for the reference cultivars. Replications evaluated were more than six in the cultivars studied. Plant problems included aphids, powdery mildew, and leaf wind injury. Preharvest fruit disorders included whole fruit cracking in cultivar Védrantais and NIL 5M2, and stylar-end cracking in cultivar Fado. Climacteric NILs with yellow skin were particularly affected by over-ripening, stylar-end cracking, and sunburn during cultivation. At harvest, two NILs showed slight placental tissue necrosis which was inherited from SC and were also detected after storage. Other uncommon disorders seen at harvest or 30 days after storage at 8ºC included warted skin (scarring, flesh discoloration (light brown or translucent areas, hollow flesh disorder, and deep furrow netting inherited from SC. Less common rots included grey mould, bacterial soft rot, Penicillium rot, cottony leak and internal Cladosporium rot. Stylar-end hardness below 20 N·mm-1 was associated with cracking and softening. The incidence of the disorders and rots was too low to confirm that the genetic component played a role in their development

Loodusteaduste olümpiaad tulekul / Karin Hellat

Index Scriptorium Estoniae

Hellat, Karin

2006-01-01

Euroopa Liidu kolmas noorte loodusteaduste võistkondlik olümpiaad toimus 2005. a. Iirimaal, 2005. a. detsembris toimus teistkordselt Indoneesias rahvusvaheline loodusteaduste olümpiaad. 2006. a. toimub Euroopa Liidu 4. loodusteaduste olümpiaad Brüsselis ning 3. rahvusvaheline loodusteaduste olümpiaad leiab aset Sao Paulos. Eesti loodusteaduste olümpiaadi voorud toimuvad veebruaris ja märtsis

Europa Nostra medal Tartusse / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2002-01-01

Alvar Aalto projekteeritud Tammekannu villa (1932) Tartus pälvis Europa Nostra medali, mis antakse eriti õnnestunult renoveeritud objektile. Villa renoveeriti soome arhitekti Tapani Mustoneni projekti järgi

Seewald - kaunis koht Kunstiakadeemiale / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2005-01-01

Seewaldi haiglakompleksi ajaloost. Maa-ala planeerimise konkursist. Osalesid arhitektuuribürood Koot ja Koot, QP arhitektid, Lokomotiiv, Urban Mark ning Andres Põime büroo Studio 3. Konkursi võitis büroo Lokomotiv (Jüri Martson, Rasmus Reinolt, Ivo-Martin Veelma). Eripreemiaga märgiti ära arhitektuuribüroo Urban Mark (autor Ülar Mark) võistlustöö

Linnade lömastavast hoost / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2004-01-01

Arhitektuuriteadlase Andres Kure abiga koostatud linnatemaatikale keskendunud "Vikerkaare" erinumbrist (2004, 4-5). Michel de Certeau, Walter Benjamini, Jean-Paul Sartre, Boris Groysi, Jan Kausi ja Mart Kalmu artiklitest, Arne Maasiku fotodest jm.

Retrovõtmes pühamu / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

Tallinnasse Lasnamäele plaanitava Jumalaema kiriku arhitektuurikonkursi võidutööst arhitektuuribüroolt Z-Projekt (arhitektid Oleg Zhemtshugov, Nikolai Djatko, Jevgeni Kolomenkin). Kommenteerib kunstiteadlane Mari-Liis Paaver. Ergutuspreemiad said arhitektuuribüroo ZiZi & YoYo projekt (arhitektid Veronika Valk, Yoko Alender) ning arhitektuuribüroo Lokomotiiv (arhitektid Jüri Martson, Rasmus Reinolt, Ivo-Martin Veelma)

Kahe riigi õpilased elustasid legende / Karin Klaus

Index Scriptorium Estoniae

Klaus, Karin

2010-01-01

Pärnu Vene Gümnaasium ja Antwerpeni Leonardo Lyceum Belgiast osalevad Comeniuse projektis "Legends Connecting Past and Present, East and West". Etendatakse legende ja muistendeid ning õpitakse eesti ja flaami keelt

Arhitektuuribiennaalil arhitektuurile mõeldes / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2008-01-01

Veneetsia arhitektuuribiennaalist teemal "Out there : Architecture Beyond Buildings". Biennaali üldkuraator Aaron Betsky. Eestlaste gaasitoruinstallatsioonist (autorid Maarja Kask, Ralf Lõoke, Neeme Külm). Lühidalt Hispaania, Inglismaa, Prantsusmaa, Hollandi, Taani, Saksamaa, Hiina ja Poola ekspositsioonidest, pikemalt Venemaa paviljonist. Nigel Coatsi, Zaha Hadidi, Frank Gehry, Herzog & de Meuroni ja Ai Weiwei töödest biennaalil, filmist Rem Koolhaasi Bordeaux' villast. Vt. repliik: Ruudi, Ingrid. Hea Sirbi toimetus! (Sirp, 2009, 30. jaan., lk. 8)

Tailastes kobrutab viha riigijuhi vastu / Karin Dean

Index Scriptorium Estoniae

Dean, Karin

2006-01-01

Ilmunud ka: Postimees : na russkom jazõke 27. veebr. lk. 11. Tai peaminister Thaksin Shinawatra saatis 24. veebruaril parlamendi laiali ja kuulutas 2. aprilliks välja erakorralised üldvalimised. Lisa: Peaminister

Wannabe - Ameerika ja Postkontor 2 / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2008-01-01

Uued hotellid Tallinna kesklinnas: Kaksiktornid (arhitektuuribüroo Nord Projekt, Meeli Truu, sisekujundaja Meelis Press); Forumi hotell (arhitektuuribüroo Pluss, Indrek Allmann, sisekujundajad Kaire Kemp-Tishler ja Ea Andla)

Lasnamäe versus Tiskre / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

Uuenevast Lasnamäest. Tulevasest Paekalda elurajoonist (arhitektuurikonkursi võitis Ilmar Klammer), Valge tänava elamutest (Muru & Pere), korterelamust Spectrum Liikuri tänaval (Künnapu & Padrik), Rohelise Kalda asumist (R-Konsult), kahest Ülo Peil büroo kavandatud 8-korruselisest elamust, Mäevärava majast (arhitekt Ilmar Klammer), Jumalaema kiriku projektist (Oleg Zhemtshugov, Nikolai Djatko, Jevgeni Kolomenkin). 9 värv. ill

Piero Castiglioni - praktilise ilu looja / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

Itaalia disaineritest Castiglioni'dest, pikemalt Piero Castiglionist (sünd. 1944), kes külastas 2005. aasta märtsis Eestit. Loetletud tema tähtsamad tööd. Kommenteerivad sisearhitekt Hannes Praks, sisearhitekt Juta Lember, valgusdisainer Tarmo Luisk ja EKA professor Toivo Raidmets

Arhitektuurieurovisiooni võitjad selgunud / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas, Karin, 1957-

2009-01-01

28. mail antakse Barcelonas üle 2009. a. Euroopa Liidu Mies van der Rohe nimelised kaasaegse arhitektuuri preemiad. Võitjaks tuli Oslo ooperi- ja balletiteater (arhitektuuribüroo Snohetta, arhitektid Kjetil Trædal Thorsen, Tarald Lundevall, Craig Dykers). Noore arhitekti eripreemia läks Horvaatia arhitektuuribüroole Studio Up (arhitektid Lea Pelivan, Toma Plejić) gümnaasiumi "46º09'N/16º50'E" eest Koprivnicas. Kataloogi valiti Eestist KOKO Arhitektide (Andrus Kõresaar, Raivo Kotov) projekteeritud Rotermanni kvartali laudsepatöökoja rekonstruktsioon

SÄSI : kes on parim? / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

Eesti parima noore disaineri auhinna SÄSI näitusest Eesti Kunstiakadeemia galeriis. Eksponeeritakse nominentide Anneli Tammiku, Monika Järgi, Riho Tiiveli, Sixten Heidmetsa, Igor Volkovi ja Björn Koopi töid

Pärnut ootab kirev kultuuriaasta / Karin Klaus

Index Scriptorium Estoniae

Klaus, Karin

2007-01-01

Pärnu linnavalitsuse kultuuriosakonna juhataja Jana Moosari sõnul 2007. aasta kultuuriürituste toetuste saajate hulgas on: MTÜ David Oistrahhi festival, MTÜ Pärnu Kontserdibüroo, muusikafestival "Muusikamoos", MTÜ XXI Sajandi Orkester (Klaudia Taevi nim. ooperilauljate konkursi korraldamine), MTÜ Suupilliklubi Piccolo, Pärnu kontserdimaja, MTÜ Arnold Scönbergi Ühing, MTÜ Jazzkaare Sõprade Ühing

Kasvatusstiilide rohkus ajab lapsevanemad segadusse / Karin Klaus

Index Scriptorium Estoniae

Klaus, Karin

2016-01-01

Vestlusest Pärnumaa Rajaleidja keskuse psühholoogi Olga Šunjajevaga, kes uuris perekasvatuse rolli viie- kuni seitsmeaastaste lastega peredes, nüüdisaegseid peremudeleid ning millist abi vanemad lastega tegeledes vajavad. Uurimusest sündis Olga Šunjajeva magistritöö Tallinna ülikooli kasvatusteaduste instituudis. Ka vanemlusprogrammist "Imelised aastad" - koolieelikute vanematele mõeldud koolitustest

Märgita tooted lahjendavad õlleturgu / Karin Vene

Index Scriptorium Estoniae

Vene, Karin, 1983-

2008-01-01

Kaubandusketid tellivad tooteid oma märgi all, nn. private label'eid, õlletootjate liidu andmeil on juba kümnendik kodumaisest õlleturust niisuguste toodete käes. Balti riikide toiduainesektori analüütiku Aavo Koppeli väitel sünnib seda vähem private label'eid, mida killustunum on kaubanduskettide turg. Graafikud: Kaubanduse õllebrändid Balti turul

Kinoteater tuleb tagasi / Harry Liivrand, Karin Paulus

Index Scriptorium Estoniae

Liivrand, Harry, 1961-

2006-01-01

Tallinnas Vabaduse väljaku ääres asuvast renoveeritud kino Gloria Palace'i ehk Vene Teatri hoonest (arhitekt Fridrihs Skujinsh, fassaadireljeefide autor Jaan Koort). Renoveerimist juhtisid arhitekt Ra Luhse, sisearhitektid Aivar Oja, Riin Luuk ja Piret Bender ning sisekujundaja Margus Sulengo

Riik ja arhitektuur : prantsuse variant / Karin Hallas

Index Scriptorium Estoniae

Hallas, Karin, 1957-

1999-01-01

Prantsuse arhitekti Dominique Perrault' (s. 1953) näitus Rotermanni soolalaos. Kuraator Eric Messerschnidt. Arhitektist, tema loomingust, pikemalt Prantsuse rahvusraamatukogu hoonest (1996; 1997. a. Mies van der Rohe' arhitektuuripreemia) ja Berlier' tootmishoonest (1990) Pariisis, Berliini velodroomist (1998). Franȯis Mitterrand'i arhitektuuripoliitikast

USA raport hoiatab tuumaterroristide eest / Karin Volmer

Index Scriptorium Estoniae

Volmer, Karin

2007-01-01

USA-s tegutseva tuumaterrori vastase organisatsiooni Nuclear Threat Initiative (NTI) raport kinnitab maailma edusamme tuumamaterjali turvalisuses, kuid on ka palju ohuallikaid. Analüütikud kahtlevad Venemaa ja Pakistani armee usaldusväärsuses tuumamaterjali hoidmisel. Lisa: Tuumaterrori raport

Kontserdimajas kõlab brasiilia muusika / Karin Klaus

Index Scriptorium Estoniae

Klaus, Karin

2009-01-01

2. juulil Pärnu kontsedimaja kammersaalis toimuval kontserdil kavaga Musica Brasileira esineb Brasiilia duo Daniel Marques-Sergio Krakowski koos Eesti laulja-instrumentalisti Ele Raikiga, esinejatest

Tartu autotootja hakkab Ferrari koopiaid ehitama / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2007-01-01

Seni Lotus Seveni koopiaid tootnud Võidutehnika AS, Valter Teppani perefirma, hakkab müüma kallimaid autosid - Ford GT40 kui ka Ferrari 330 P4 koopiaid. Ilmunud ka: Postimees, 27. sept. 2007, lk. 9

Tarkon pürib Euroopas liidriks / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2008-01-01

Tarkon laiendab oma ettevõtet, eesmärgiga hõivata valdkonna Euroopa liidri positsioon. Suurem osa firma toodangust läheb telekomi-, tööstus- ja kliimaseadmete tootjatele. Vt. samas: Hanza kontserni osa

ERA-pankurid võivad pattu kahetseda / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2002-01-01

Tartu maakohtu kohtunik andis ERA Grupi üheksa eksjuhi suurprotsessil riiklikule süüdistajale ja kohtualustele kaks nädalat aega protsessi lahendamiseks lihtmenetluse teel, kuid selleks peavad endised pankurid end süüdi tunnistama

Broader leaves result in better performance of indica rice under drought stress.

Science.gov (United States)

Farooq, M; Kobayashi, N; Ito, O; Wahid, A; Serraj, R

2010-09-01

Leaf growth is one of the first physiological processes affected by changes in plant water status under drought. A decrease in leaf expansion rate usually precedes any reduction in stomatal conductance or photosynthesis. Changes in leaf size and stomatal opening are potential adaptive mechanisms, which may help avoid drought by reducing transpiration rate, and can be used to improve rice genotypes in water-saving cultivation. The indica rice cultivar IR64 and four of its near-isogenic lines (NILs; BC(3)-derived lines) unique for leaf size traits, YTK 124 (long leaves), YTK 127 (broad leaves), YTK 205 (short leaves) and YTK 214 (narrow leaves), were compared in this study for changes in leaf growth and its water status. The plants were subjected to two soil water regimes, well-watered and progressive soil drying measured by the fraction of transpirable soil water (FTSW). Applied drought reduced leaf number, total leaf area, specific leaf area, plant biomass, tiller number, plant height, stomatal conductance, amount of water transpired, leaf relative water content, and leaf water potential more in IR64 and the NILs than in the respective controls; nonetheless, transpiration efficiency (TE) was slightly higher under drought than in the well-watered controls. NILs with broader leaves had higher biomass (and its individual components), less stomatal conductance, and higher TE under drought than NILs with narrow and shorter leaves. Under drought, leaf number was positively correlated with tiller number and plant height; nonetheless, root weight and total biomass, water transpired and TE, and plant height and TE were positively correlated with each other. However, a negative correlation was observed between stomatal conductance and the FTSW threshold at which normalized transpiration started to decline during soil drying. Overall, the IR64-derived lines with broader leaves performed better than NILs with narrow and short leaves under drought. Copyright 2010 Elsevier Gmb

Canopy architectural and physiological characterisation of near-isogenic wheat lines differing in the tiller inhibition gene tin

Directory of Open Access Journals (Sweden)

Carina eMoeller

2014-12-01

Full Text Available Tillering is a core constituent of plant architecture, and influences light interception to affect plant performance. Near-isogenic lines (NILs varying for a tiller inhibition (tin gene were investigated for tillering dynamics, organ size distribution, leaf area, light interception, red : far-red ratio, and chlorophyll content. Tillering ceased earlier in the tin lines to reduce the frequencies of later primary and secondary tillers, and demonstrated the genetically lower tillering plasticity of tin compared to free-tillering NILs. The distribution of organ sizes along shoots varied between NILs. In tin lines, internode elongation commenced at a lower phytomer, the peduncles were shorter, the flag leaves were larger, and the longest leaf blades were observed at higher phytomers. Total leaf area was reduced in tin lines. The tiller economy (ratio of seed-bearing shoots to numbers of shoots produced was 10% greater in the tin lines (0.73-0.76 compared to the free-tillering sisters (0.62-0.63. At maximum tiller number, the red: far-red ratio (light quality stimulus that is thought to induce the cessation of tillering at the plant-base was 0.18-0.22 in tin lines and 0.09-0.11 in free-tillering lines at levels of photosynthetic active radiation of 49-53% and 30-33%, respectively. The tin lines intercepted less radiation compared to their free-tillering sisters once genotypic differences in tiller numbers had established, and maintained green leaf area in the lower canopy later into the season. Greater light extinction coefficients (k in tin lines prior to, but reduced k after, spike emergence indicated that differences in light interception between NILs cannot be explained by leaf area alone but that geometric and optical canopy properties contributed. The characterisation of specifically-developed NILs is refining the development of a physiology-based model for tillering to enhance understanding of the value of architectural traits for use in cereal

Acute pancreatitis: a case report

Directory of Open Access Journals (Sweden)

Nafia Ozlem Kazanci

2013-06-01

Full Text Available Akut pankreatit cocukluk caginda heterojen ve ozgul olmayan klinik bulgularla seyreden, genellikle travma, yapisal anomaliler, ilaclar ve kronik sistemik hastalik zeminde gelisen nadir gorulen bir hastaliktir.Bu olgu sunumunda daha once saglikli oldugu bilinen, karin agrisi yakinmasi ile basvuran ve akut pankreatit tanisi konulan 4 yasinda kiz hastaya yer verildi.Akut pankreatitin idiopatik olarak gelisebildigi ve ozgul olmayan klinik bulgulari nedeniyle tanida yasanabilecek guclukler goz onunde bulundurulmalidir. [J Contemp Med 2013; 3(2.000: 129-132

Long Term Cost Efficiency through Green Management Control Systems

OpenAIRE

Vukania Adda, Nancy; Qin, Xiaochen

2012-01-01

Title: Long term cost efficiency through green management control systems.Authors: Nancy Vukania &Xiaochen QinSupervisor: Åsa Karin-EngstrandBackground: The worldwide financial crisis of 2008 has reconfigured the economic turf leading to a more uncertain and turbulent playing field – a greater challenge for business strategy and the quest for optimization- The oil price hike of 2008 (Furlong 2010)1 caused its rippling effect to affect various cost categories including energy, labor and lo...

"Neli arhitektuuri" : Eesti arhitektuurinäitusel Pariisis / Triin Ojari

Index Scriptorium Estoniae

Ojari, Triin, 1974-

2000-01-01

Baltimaade ja Rootsi arhitektuuribüroode töid tutvustav näitus galeriis La Galerie d'Architecture 22. X-10. XII 2000. Rootsist osales büroo White Arkitekter (arhitekt Mattias Lind), Lätist Arhis, Leedust Private Ideology, Eestist Kolm Pluss Üks (valiku tegi Karin Hallas). Kataloogi eessõna - läti arhitekt Janis Dripe. 2 ill. White Arkitekter (arhitektuuribüroo, Rootsi). Arhis (arhitektuuribüroo, Läti). Private Ideology (arhitektuuribüroo, Leedu)

Browse Author Index

African Journals Online (AJOL)

A B C D E F G H I J K L M N O P Q R S T U V W X Y Z All. W. Walker, Melanie · Walters, Shirley · Williams, Kevin · Winberg, Chris · Winberg, Christine · Wisker, Gina · Wolff, Karin 1 - 7 of 7 Items. ISSN: 2310-7103. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

By Process of Elimination: Further Remarks on the Operation chú 除 in Early Imperial Mathematical Astronomy

OpenAIRE

Morgan, Daniel Patrick

2015-01-01

International audience; This paper will return to the operation chu 除 (“eliminate”) as explored by Karine Chemla and myself on January 23, refining the terminology deployed, providing usage statistics, and exploring actors’ rare words of definition and expository. We will revisit how chu “eliminate” is used to prescribe (1) subtraction for a positive integer difference, (2) repeated subtraction of a single value for a positive integer remainder, i.e. modulo, (3) subtraction of a series of val...

The storage of liquid high level waste at BNFL, Sellafield. Addendum to February 2000 report

International Nuclear Information System (INIS)

2001-08-01

On 18 February 2000 the Health and Safety Executive (HSE) published a report on the work of its Nuclear Installations Inspectorate (NIl) in regulating the storage of liquid high level waste at the BNFL Sellafield site. Within the report NIl gave two undertakings. One was to publish an addendum around 1 year later covering its assessment of the new safety case for the storage plant and the second was to publish a further addendum when progress had been made with options studies for reducing the stocks of liquid high level waste (HLW), also referred to as highly active liquor (HAL), to a buffer level. A progress report was published in February 2001 which included a summary of the assessment of the new safety case and NIl's regulatory action to enforce liquid HLW stock reductions. This addendum provides a more detailed update on the position reached based on consideration of BNFL's responses to the recommendations from the February 2000 HLW report since its publication. It embodies the two addenda referred to above integrated into a single document for publication

Identification of a novel IL-1 cytokine family member in teleost fish.

Science.gov (United States)

Wang, Tiehui; Bird, Steve; Koussounadis, Antonis; Holland, Jason W; Carrington, Allison; Zou, Jun; Secombes, Christopher J

2009-07-15

A novel IL-1 family member (nIL-1F) has been discovered in fish, adding a further member to this cytokine family. The unique gene organization of nIL-1F, together with its location in the genome and low homology to known family members, suggests that this molecule is not homologous to known IL-1F. Nevertheless, it contains a predicted C-terminal beta-trefoil structure, an IL-1F signature region within the final exon, a potential IL-1 converting enzyme cut site, and its expression level is clearly increased following infection, or stimulation of macrophages with LPS or IL-1beta. A thrombin cut site is also present and may have functional relevance. The C-terminal recombinant protein antagonized the effects of rainbow trout rIL-1beta on inflammatory gene expression in a trout macrophage cell line, suggesting it is an IL-1beta antagonist. Modeling studies confirmed that nIL-1F has the potential to bind to the trout IL-1RI receptor protein, and may be a novel IL-1 receptor antagonist.

Characterization of QTL for unique agronomic traits of new-plant-type rice varieties using introgression lines of IR64

Directory of Open Access Journals (Sweden)

Analiza G. Tagle

2016-02-01

Full Text Available To enhance the yield potential of an elite indica rice cultivar, an introgression (BC3-derived line of IR64, YTH288, was developed using a new-plant-type cultivar, IR66215-44-2-3, as a donor parent. YTH288 has agronomically valuable characteristics such as large panicles, few unproductive tillers, and large leaves inherited from NPT. To identify the genetic basis of these traits, we used 167 F2 plants derived from a cross between IR64 and YTH288 to conduct QTL analysis for five agronomic traits: days to heading (DTH, culm length (CL, flag leaf length (FLL, flag leaf width (FLW, and filled spikelet number per panicle (FSN. Six putative QTL were detected: four on chromosome 4 (for CL, FLL, FLW, and FSN and two on chromosome 2 (for DTH and FLL. All QTL with the IR66215-44-2-3 allele, except that for FLL on chromosome 2, had positive effects on each trait. To confirm the effects of these putative QTL, we developed NILs with the IR64 genetic background by marker-assisted selection. We observed significant differences in several agronomic traits between IR64 and NILs that carried these QTL on chromosomes 2 and 4. Additionally, four IR64-NILs carrying chromosomal segments derived from different NPT varieties on the long arm of chromosome 4 exhibited similar pleiotropic effects for unique agronomic traits. These NILs can be used as research materials for studying each trait and as breeding materials for yield improvement of indica rice cultivars.

Delineating a Retesting Zone Using Receiver Operating Characteristic Analysis on Serial QuantiFERON Tuberculosis Test Results in US Healthcare Workers

Directory of Open Access Journals (Sweden)

Wendy Thanassi

2012-01-01

Full Text Available Objective. To find a statistically significant separation point for the QuantiFERON Gold In-Tube (QFT interferon gamma release assay that could define an optimal “retesting zone” for use in serially tested low-risk populations who have test “reversions” from initially positive to subsequently negative results. Method. Using receiver operating characteristic analysis (ROC to analyze retrospective data collected from 3 major hospitals, we searched for predictors of reversion until statistically significant separation points were revealed. A confirmatory regression analysis was performed on an additional sample. Results. In 575 initially positive US healthcare workers (HCWs, 300 (52.2% had reversions, while 275 (47.8% had two sequential positive tests. The most statistically significant (Kappa = 0.48, chi-square = 131.0, P<0.001 separation point identified by the ROC for predicting reversion was the tuberculosis antigen minus-nil (TBag-nil value at 1.11 International Units per milliliter (IU/mL. The second separation point was found at TBag-nil at 0.72 IU/mL (Kappa = 0.16, chi-square = 8.2, P<0.01. The model was validated by the regression analysis of 287 HCWs. Conclusion. Reversion likelihood increases as the TBag-nil approaches the manufacturer's cut-point of 0.35 IU/mL. The most statistically significant separation point between those who test repeatedly positive and those who revert is 1.11 IU/mL. Clinicians should retest low-risk individuals with initial QFT results < 1.11 IU/mL.

DESEMPEÑO PRODUCTIVO, COMPOSICIÓN Y BIODISPONIBILIDAD RELATIVA DE SELENIO EN TILAPIA NILÓTICA -Oreochromis niloticus- SUPLEMENTADA CON SELENIO ORGÁNICO E INORGÁNICO

OpenAIRE

J. E. Vinchira; G. A. Wills; A. P. Muñoz

2014-01-01

Se evaluó el desempeño productivo, la composición corporal y la biodisponibilidad relativa de selenio en tilapia nilótica ( Oreochromis niloticus ) suplementada con selenio dietario. Una dieta basal fue suplementada con selenio en forma de selenito de sodio o seleno-levadura en niveles crecientes de suplementación (0.00, 0.10, 0.20, 0.40, 0.80 y 1.60 mg/kg de dieta). Un total de 336 individuos de tilapia nilótica, con un peso inicial de 13.41±0.12 g, fueron distribuidos de forma aleatori...

Modeling of catalytically active metal complex species and intermediates in reactions of organic halides electroreduction.

Science.gov (United States)

Lytvynenko, Anton S; Kolotilov, Sergey V; Kiskin, Mikhail A; Eremenko, Igor L; Novotortsev, Vladimir M

2015-02-28

The results of quantum chemical modeling of organic and metal-containing intermediates that occur in electrocatalytic dehalogenation reactions of organic chlorides are presented. Modeling of processes that take place in successive steps of the electrochemical reduction of representative C1 and C2 chlorides - CHCl3 and Freon R113 (1,1,2-trifluoro-1,2,2-trichloroethane) - was carried out by density functional theory (DFT) and second-order Møller-Plesset perturbation theory (MP2). It was found that taking solvation into account using an implicit solvent model (conductor-like screening model, COSMO) or considering explicit solvent molecules gave similar results. In addition to modeling of simple non-catalytic dehalogenation, processes with a number of complexes and their reduced forms, some of which were catalytically active, were investigated by DFT. Complexes M(L1)2 (M = Fe, Co, Ni, Cu, Zn, L1H = Schiff base from 2-pyridinecarbaldehyde and the hydrazide of 4-pyridinecarboxylic acid), Ni(L2) (H2L2 is the Schiff base from salicylaldehyde and 1,2-ethylenediamine, known as salen) and Co(L3)2Cl2, representing a fragment of a redox-active coordination polymer [Co(L3)Cl2]n (L3 is the dithioamide of 1,3-benzenedicarboxylic acid), were considered. Gradual changes in electronic structure in a series of compounds M(L1)2 were observed, and correlations between [M(L1)2](0) spin-up and spin-down LUMO energies and the relative energies of the corresponding high-spin and low-spin reduced forms, as well as the shape of the orbitals, were proposed. These results can be helpful for determination of the nature of redox-processes in similar systems by DFT. No specific covalent interactions between [M(L1)2](-) and the R113 molecule (M = Fe, Co, Ni, Zn) were found, which indicates that M(L1)2 electrocatalysts act rather like electron transfer mediators via outer-shell electron transfer. A relaxed surface scan of the adducts {M(L1)2·R113}(-) (M = Ni or Co) versus the distance between the

Maaülikooli uksed uutele tulijatele valla / Sirje Pärismaa

Index Scriptorium Estoniae

Pärismaa, Sirje, 1958-

2008-01-01

Oma õpingutest räägivad maaülikooli tudengid: Kadi Avi (majandusarvestus ja finantsjuhtimine III), Kaiti Pilk (maastikuarhitekt III), Mart Kelk (metsatööstuse magistrantuur I), Karin Ojamäe (rakendushüdrobioloogia III), Heidi Heitur (ökonoomika ja ettevõtlus I); Margus Paesalu (metsatööstus III), Kadri Kalle ( maastikukaitse ja -hoolduse magistrantuur I), Liisi Õunapuu (loodusvarade kasutamine ja kaitse III), Laura Niemelä (veterinaarmeditsiin IV) ja Peep Teppo (metsamajanduse magistrantuur II) ning õppeprorektor Jüri Lehtsaar

Arhitektuuriuudised / Karen Jagodin

Index Scriptorium Estoniae

Jagodin, Karen, 1982-

2006-01-01

Elamurajoon Witbrant (Jacq de Brouwer, Erna van Sambeek) Tilburgis Lõuna-Hollandis. Kaubakonteineritest kokkuopandav reisimuuseum (Shigeru Ban). Säästlik, kerge, transporditav ja vähese materjalikuluga näidismaja (Richard Horden, saksa AB Haack + Höpfner). Ristikujuline maja (Bevk Perovic Arhitektid) Ljubljanas. Onnist inspireeritud pargikeskus (Chris Thurlbourne) Taani Rahvuspargis. Eestile ja muuseumidele pühendatud Soome arhitektuuriajakirja Arkkitehti 2006. a. 3. numbrist. Autoritest nimetatud Jorma Mukala, Pekka Vapaavuori, Leonhard Lapin, Triin Ojari, Tarja Nurmi (retsensioon Karin Hallas-Murula raamatule "Soome-Eesti : sajand arhitektuurisuhted)

Robust spinal cord resting-state fMRI using independent component analysis-based nuisance regression noise reduction.

Science.gov (United States)

Hu, Yong; Jin, Richu; Li, Guangsheng; Luk, Keith Dk; Wu, Ed X

2018-04-16

Physiological noise reduction plays a critical role in spinal cord (SC) resting-state fMRI (rsfMRI). To reduce physiological noise and increase the robustness of SC rsfMRI by using an independent component analysis (ICA)-based nuisance regression (ICANR) method. Retrospective. Ten healthy subjects (female/male = 4/6, age = 27 ± 3 years, range 24-34 years). 3T/gradient-echo echo planar imaging (EPI). We used three alternative methods (no regression [Nil], conventional region of interest [ROI]-based noise reduction method without ICA [ROI-based], and correction of structured noise using spatial independent component analysis [CORSICA]) to compare with the performance of ICANR. Reduction of the influence of physiological noise on the SC and the reproducibility of rsfMRI analysis after noise reduction were examined. The correlation coefficient (CC) was calculated to assess the influence of physiological noise. Reproducibility was calculated by intraclass correlation (ICC). Results from different methods were compared by one-way analysis of variance (ANOVA) with post-hoc analysis. No significant difference in cerebrospinal fluid (CSF) pulsation influence or tissue motion influence were found (P = 0.223 in CSF, P = 0.2461 in tissue motion) in the ROI-based (CSF: 0.122 ± 0.020; tissue motion: 0.112 ± 0.015), and Nil (CSF: 0.134 ± 0.026; tissue motion: 0.124 ± 0.019). CORSICA showed a significantly stronger influence of CSF pulsation and tissue motion (CSF: 0.166 ± 0.045, P = 0.048; tissue motion: 0.160 ± 0.032, P = 0.048) than Nil. ICANR showed a significantly weaker influence of CSF pulsation and tissue motion (CSF: 0.076 ± 0.007, P = 0.0003; tissue motion: 0.081 ± 0.014, P = 0.0182) than Nil. The ICC values in the Nil, ROI-based, CORSICA, and ICANR were 0.669, 0.645, 0.561, and 0.766, respectively. ICANR more effectively reduced physiological noise from both tissue motion and CSF pulsation than three alternative methods. ICANR increases the robustness of SC rsf

Redox-active porous coordination polymers prepared by trinuclear heterometallic pivalate linking with the redox-active nickel(II) complex: synthesis, structure, magnetic and redox properties, and electrocatalytic activity in organic compound dehalogenation in heterogeneous medium.

Science.gov (United States)

Lytvynenko, A S; Kolotilov, S V; Kiskin, M A; Cador, O; Golhen, S; Aleksandrov, G G; Mishura, A M; Titov, V E; Ouahab, L; Eremenko, I L; Novotortsev, V M

2014-05-19

Linking of the trinuclear pivalate fragment Fe2CoO(Piv)6 by the redox-active bridge Ni(L)2 (compound 1; LH is Schiff base from hydrazide of 4-pyridinecarboxylic acid and 2-pyridinecarbaldehyde, Piv(-) = pivalate) led to formation of a new porous coordination polymer (PCP) {Fe2CoO(Piv)6}{Ni(L)2}1.5 (2). X-ray structures of 1 and 2 were determined. A crystal lattice of compound 2 is built from stacked 2D layers; the Ni(L)2 units can be considered as bridges, which bind two Fe2CoO(Piv)6 units. In desolvated form, 2 possesses a porous crystal lattice (SBET = 50 m(2) g(-1), VDR = 0.017 cm(3) g(-1) estimated from N2 sorption at 78 K). At 298 K, 2 absorbed a significant quantity of methanol (up to 0.3 cm(3) g(-1)) and chloroform. Temperature dependence of molar magnetic susceptibility of 2 could be fitted as superposition of χMT of Fe2CoO(Piv)6 and Ni(L)2 units, possible interactions between them were taken into account using molecular field model. In turn, magnetic properties of the Fe2CoO(Piv)6 unit were fitted using two models, one of which directly took into account a spin-orbit coupling of Co(II), and in the second model the spin-orbit coupling of Co(II) was approximated as zero-field splitting. Electrochemical and electrocatalytic properties of 2 were studied by cyclic voltammetry in suspension and compared with electrochemical and electrocatalytic properties of a soluble analogue 1. A catalytic effect was determined by analysis of the catalytic current dependency on concentrations of the substrate. Compound 1 possessed electrocatalytic activity in organic halide dehalogenation, and such activity was preserved for the Ni(L)2 units, incorporated into the framework of 2. In addition, a new property occurred in the case of 2: the catalytic activity of PCP depended on its sorption capacity with respect to the substrate. In contrast to homogeneous catalysts, usage of solid PCPs may allow selectivity due to porous structure and simplify separation of product.

DESEMPEÑO PRODUCTIVO, COMPOSICIÓN Y BIODISPONIBILIDAD RELATIVA DE SELENIO EN TILAPIA NILÓTICA -Oreochromis niloticus- SUPLEMENTADA CON SELENIO ORGÁNICO E INORGÁNICO

Directory of Open Access Journals (Sweden)

J. E. Vinchira

2014-01-01

Full Text Available Se evaluó el desempeño productivo, la composición corporal y la biodisponibilidad relativa de selenio en tilapia nilótica ( Oreochromis niloticus suplementada con selenio dietario. Una dieta basal fue suplementada con selenio en forma de selenito de sodio o seleno-levadura en niveles crecientes de suplementación (0.00, 0.10, 0.20, 0.40, 0.80 y 1.60 mg/kg de dieta. Un total de 336 individuos de tilapia nilótica, con un peso inicial de 13.41±0.12 g, fueron distribuidos de forma aleatoria en 48 acuarios de vidrio (80 l, 4 réplicas, 7 peces por acuario. No se detectó selenio en el agua de abastecimiento. Los peces fueron alimentados hasta saciedad aparente 3 veces al día por un período de 9 semanas. El desempeño productivo de la tilapia nilótica no se vio afectado ( P >0.05 por la suplementación con selenio dietario. El selenio corporal se incrementó de forma lineal ( P <0.05 con la suplementación de selenio orgánico e inorgánico. La composición corporal de selenio fue menor ( P <0.05 en los peces suplementados con selenito de sodio (1.67±0.14 mg/kg en comparación con la seleno-levadura (1.95±0.21 mg/kg. A partir de la relación entre pendientes se estimó que la biodisponibilidad relativa de la seleno- levadura para la composición de selenio corporal fue de 155.72±0,10%, con relación al selenito de sodio (fijada en 100%. De acuerdo con los resultados, la concentración basal de selenio dietario (0.21 mg/kg no limitó el desempeño productivo de tilapia nilótica. La suplementación con selenio orgánico (seleno-levadura e inorgánico (selenito de sodio entre 0.10 y 1.60 mg/kg no afectó el desempeño productivo de la tilapia nilótica.

Constitutive water-conserving mechanisms are correlated with the terminal drought tolerance of pearl millet [Pennisetum glaucum (L.) R. Br.].

Science.gov (United States)

Kholová, Jana; Hash, C Tom; Kakkera, Aparna; Kocová, Marie; Vadez, Vincent

2010-01-01

Pearl millet, a key staple crop of the semi-arid tropics, is mostly grown in water-limited conditions, and improving its performance depends on how genotypes manage limited water resources. This study investigates whether the control of water loss under non-limiting water conditions is involved in the terminal drought tolerance of pearl millet. Two pairs of tolerant x sensitive pearl millet genotypes, PRLT 2/89-33-H77/833-2 and 863B-P2-ICMB 841-P3, and near-isogenic lines (NILs), introgressed with a terminal drought tolerance quantitative trait locus (QTL) from the donor parent PRLT 2/89-33 into H77/833-2 (NILs-QTL), were tested. Upon exposure to water deficit, transpiration began to decline at lower fractions of transpirable soil water (FTSW) in tolerant than in sensitive genotypes, and NILs-QTL followed the pattern of the tolerant parents. The transpiration rate (Tr, in g water loss cm(-2) d(-1)) under well-watered conditions was lower in tolerant than in sensitive parental genotypes, and the Tr of NILs-QTL followed the pattern of the tolerant parents. In addition, Tr measured in detached leaves (g water loss cm(-2) h(-1)) from field-grown plants of the parental lines showed lower Tr values in tolerant parents. Defoliation led to an increase in Tr that was higher in sensitive than in tolerant genotypes. The differences in Tr between genotypes was not related to the stomatal density. These results demonstrate that constitutive traits controlling leaf water loss under well-watered conditions correlate with the terminal drought tolerance of pearl millet. Such traits may lead to more water being available for grain filling under terminal drought.

Validation of a 1DL earliness per se (eps) flowering QTL in bread wheat (Triticum aestivum).

Science.gov (United States)

Zikhali, Meluleki; Leverington-Waite, Michelle; Fish, Lesley; Simmonds, James; Orford, Simon; Wingen, Luzie U; Goram, Richard; Gosman, Nick; Bentley, Alison; Griffiths, Simon

2014-01-01

Vernalization, photoperiod and the relatively poorly defined earliness per se ( eps ) genes regulate flowering in plants. We report here the validation of a major eps quantitative trait locus (QTL) located on wheat 1DL using near isogenic lines (NILs). We used four independent pairs of NILs derived from a cross between Spark and Rialto winter wheat varieties, grown in both the field and controlled environments. NILs carrying the Spark allele, defined by QTL flanking markers Xgdm111 and Xbarc62 , consistently flowered 3-5 days earlier when fully vernalized relative to those with the Rialto. The effect was independent of photoperiod under field conditions, short days (10-h light), long days (16-h light) and very long days (20-h light). These results validate our original QTL identified using doubled haploid (DH) populations. This QTL represents variation maintained in elite north-western European winter wheat germplasm. The two DH lines used to develop the NILs, SR9 and SR23 enabled us to define the location of the 1DL QTL downstream of marker Xgdm111 . SR9 has the Spark 1DL arm while SR23 has a recombinant 1DL arm with the Spark allele from Xgdm111 to the distal end. Our work suggests that marker assisted selection of eps effects is feasible and useful even before the genes are cloned. This means eps genes can be defined and positionally cloned in the same way as the photoperiod and vernalization genes have been. This validation study is a first step towards fine mapping and eventually cloning the gene directly in hexaploid wheat.

Nepenthes rafflesiana pitcher liquid has antifungal activity against Candida spp.

Directory of Open Access Journals (Sweden)

Hanna Yolanda

2014-08-01

Full Text Available Background To develop new effective antifungals, it is essential to search for antifungal compounds from plants such as Nepenthes spp., which have their greatest diversity in Indonesia. Since chitin-induced liquid (CIL from Nepenthes khasiana pitchers has antifungal activity, due to their naphthoquinone content, this study aimed to evaluate antifungal activity of Nepenthes rafflesiana pitcher liquids on Candida spp. Methods Collected pitcher liquids were of 3 types: non-induced liquid (NIL, prey-induced liquid (PIL, and chitin-induced liquid (CIL. Non-induced liquid (NIL was collected from fresh naturally opened pitchers, PIL from opened pitchers after 3 hours of induction with Zophobas morio larvae, and CIL from closed pitchers after 5 days of chitin solution injection. The antifungal activity of the liquids against C. albicans, C. glabrata, C. krusei, and C. tropicalis were detected by disc diffusion and macrodilution methods. Results Inhibition zone diameters of NIL, PIL, and CIL against C. albicans were 35.00 (35.00 – 39.33 mm, 26.33 (23.00 – 40.00 mm, and 30.00 ( 28.00 – 32.00 mm, respectively, while for C. glabrata the zone diameters were 22.22 ± 3.66 mm, 29.89 ± 2.79 mm, and 28.89 ± 1.17 mm, respectively. No inhibition zones were found for NIL, PIL, and CIL against C. krusei and C. tropicalis. At concentrations of 80%, almost all samples showed visually apparent inhibition of fungal growth. Conclusion The pitcher liquid of N. rafflesiana has antifungal properties, presumably due to the presence of many potentially active substances, such as naphthoquinones, as has been proven in other studies.

Regulation of intestinal immune response by selective removal of the anterior, posterior, or entire pituitary gland in Trichinella spiralis infected golden hamsters.

Science.gov (United States)

Hernández-Cervantes, Rosalía; Quintanar-Stephano, Andrés; Moreno-Méndoza, Norma; López-Griego, Lorena; López-Salazar, Valeria; Hernández-Bello, Romel; Carrero, Julio César; Morales-Montor, Jorge

2013-01-01

The influence of anterior pituitary hormones on the gastrointestinal tract of humans and animals has been previously reported. Hypophysectomy (HYPOX) in the rat causes atrophy of the intestinal mucosa, and reduction of gastric secretion and intestinal absorption, as well as increased susceptibility to bacterial and viral infections. However, to our knowledge, no findings have been published concerning the immune response following HYPOX during worm infection, particularly that which is caused by the nematode Trichinella spiralis. The aim of this work was to analyze the effects of total or partial HYPOX on colonization of T. spiralis in the intestinal lumen, together with duodenal and splenic cytokine expression. Our results indicate that 5 days post infection, only neurointermediate pituitary lobectomy (NIL) reduces the number of intestinally recovered T. spiralis larvae. Using semiquantitative inmunofluorescent laser confocal microscopy, we observed that the mean intensity of all tested Th1 cytokines was markedly diminished, even in the duodenum of infected controls. In contrast, a high level of expression of these cytokines was noted in the NIL infected hamsters. Likewise, a significant decrease in the fluorescence intensity of Th2 cytokines (with the exception of IL-4) was apparent in the duodenum of control and sham infected hamsters, compared to animals with NIL surgeries, which showed an increase in the expression of IL-5 and IL-13. Histology of duodenal mucosa from NIL hamsters showed an exacerbated inflammatory infiltrate located along the lamina propria, which was related to the presence of the parasite. We conclude that hormones from each pituitary lobe affect the gastrointestinal immune responses to T. spiralis through various mechanisms.

Genetic and biochemical analysis reveals linked QTLs determining natural variation for fruit post-harvest water loss in pepper (Capsicum).

Science.gov (United States)

Popovsky-Sarid, Sigal; Borovsky, Yelena; Faigenboim, Adi; Parsons, Eugene P; Lohrey, Gregory T; Alkalai-Tuvia, Sharon; Fallik, Elazar; Jenks, Matthew A; Paran, Ilan

2017-02-01

Molecular markers linked to QTLs controlling post-harvest fruit water loss in pepper may be utilized to accelerate breeding for improved shelf life and inhibit over-ripening before harvest. Bell pepper (Capsicum annuum L.) is an important vegetable crop world-wide. However, marketing is limited by the relatively short shelf life of the fruit due to water loss and decay that occur during prolonged storage. Towards breeding pepper with reduced fruit post-harvest water loss (PWL), we studied the genetic, physiological and biochemical basis for natural variation of PWL. We performed quantitative trait locus (QTL) mapping of fruit PWL in multiple generations of an interspecific cross of pepper, which resulted in the identification of two linked QTLs on chromosome 10 that control the trait. We further developed near-isogenic lines (NILs) for characterization of the QTL effects. Transcriptome analysis of the NILs allowed the identification of candidate genes associated with fruit PWL-associated traits such as cuticle biosynthesis, cell wall metabolism and fruit ripening. Significant differences in PWL between the NILs in the immature fruit stage, differentially expressed cuticle-associated genes and differences in the content of specific chemical constituents of the fruit cuticle, indicated a likely influence of cuticle composition on the trait. Reduced PWL in the NILs was associated with delayed over-ripening before harvest, low total soluble solids before storage, and reduced fruit softening after storage. Our study enabled a better understanding of the genetic and biological processes controlling natural variation in fruit PWL in pepper. Furthermore, the genetic materials and molecular markers developed in this study may be utilized to breed peppers with improved shelf life and inhibited over-ripening before harvest.

Regulation of intestinal immune response by selective removal of the anterior, posterior, or entire pituitary gland in Trichinella spiralis infected golden hamsters.

Directory of Open Access Journals (Sweden)

Rosalía Hernández-Cervantes

Full Text Available The influence of anterior pituitary hormones on the gastrointestinal tract of humans and animals has been previously reported. Hypophysectomy (HYPOX in the rat causes atrophy of the intestinal mucosa, and reduction of gastric secretion and intestinal absorption, as well as increased susceptibility to bacterial and viral infections. However, to our knowledge, no findings have been published concerning the immune response following HYPOX during worm infection, particularly that which is caused by the nematode Trichinella spiralis. The aim of this work was to analyze the effects of total or partial HYPOX on colonization of T. spiralis in the intestinal lumen, together with duodenal and splenic cytokine expression. Our results indicate that 5 days post infection, only neurointermediate pituitary lobectomy (NIL reduces the number of intestinally recovered T. spiralis larvae. Using semiquantitative inmunofluorescent laser confocal microscopy, we observed that the mean intensity of all tested Th1 cytokines was markedly diminished, even in the duodenum of infected controls. In contrast, a high level of expression of these cytokines was noted in the NIL infected hamsters. Likewise, a significant decrease in the fluorescence intensity of Th2 cytokines (with the exception of IL-4 was apparent in the duodenum of control and sham infected hamsters, compared to animals with NIL surgeries, which showed an increase in the expression of IL-5 and IL-13. Histology of duodenal mucosa from NIL hamsters showed an exacerbated inflammatory infiltrate located along the lamina propria, which was related to the presence of the parasite. We conclude that hormones from each pituitary lobe affect the gastrointestinal immune responses to T. spiralis through various mechanisms.

Iterated Local Search Algorithm with Strategic Oscillation for School Bus Routing Problem with Bus Stop Selection

Directory of Open Access Journals (Sweden)

Mohammad Saied Fallah Niasar

2017-02-01

Full Text Available he school bus routing problem (SBRP represents a variant of the well-known vehicle routing problem. The main goal of this study is to pick up students allocated to some bus stops and generate routes, including the selected stops, in order to carry students to school. In this paper, we have proposed a simple but effective metaheuristic approach that employs two features: first, it utilizes large neighborhood structures for a deeper exploration of the search space; second, the proposed heuristic executes an efficient transition between the feasible and infeasible portions of the search space. Exploration of the infeasible area is controlled by a dynamic penalty function to convert the unfeasible solution into a feasible one. Two metaheuristics, called N-ILS (a variant of the Nearest Neighbourhood with Iterated Local Search algorithm and I-ILS (a variant of Insertion with Iterated Local Search algorithm are proposed to solve SBRP. Our experimental procedure is based on the two data sets. The results show that N-ILS is able to obtain better solutions in shorter computing times. Additionally, N-ILS appears to be very competitive in comparison with the best existing metaheuristics suggested for SBRP

Surface diffusion studies by optical diffraction techniques

International Nuclear Information System (INIS)

Xiao, X.D.

1992-11-01

The newly developed optical techniques have been combined with either second harmonic (SH) diffraction or linear diffraction off a monolayer adsorbate grating for surface diffusion measurement. Anisotropy of surface diffusion of CO on Ni(l10) was used as a demonstration for the second harmonic dim reaction method. The linear diffraction method, which possesses a much higher sensitivity than the SH diffraction method, was employed to study the effect of adsorbate-adsorbate interaction on CO diffusion on Ni(l10) surface. Results showed that only the short range direct CO-CO orbital overlapping interaction influences CO diffusion but not the long range dipole-dipole and CO-NI-CO interactions. Effects of impurities and defects on surface diffusion were further explored by using linear diffraction method on CO/Ni(110) system. It was found that a few percent S impurity can alter the CO diffusion barrier height to a much higher value through changing the Ni(110) surface. The point defects of Ni(l10) surface seem to speed up CO diffusion significantly. A mechanism with long jumps over multiple lattice distance initiated by CO filled vacancy is proposed to explain the observed defect effect

High-throughput fabrication of anti-counterfeiting colloid-based photoluminescent microtags using electrical nanoimprint lithography

International Nuclear Information System (INIS)

Diaz, R; Palleau, E; Poirot, D; Sangeetha, N M; Ressier, L

2014-01-01

This work demonstrates the excellent capability of the recently developed electrical nanoimprint lithography (e-NIL) technique for quick, high-throughput production of well-defined colloid assemblies on surfaces. This is shown by fabricating micron-sized photoluminescent quick response (QR) codes based on the electrostatic directed trapping (so called nanoxerography process) of 28 nm colloidal lanthanide-doped upconverting NaYF 4 nanocrystals. Influencing experimental parameters have been optimized and the contribution of triboelectrification in e-NIL was evidenced. Under the chosen conditions, more than 300 000 nanocrystal-based QR codes were fabricated on a 4 inch silicon wafer, in less than 15 min. These microtags were then transferred to transparent flexible films, to be easily integrated onto desired products. Invisible to the naked eye, they can be decoded and authenticated using an optical microscopy image of their specific photoluminescence mapping. Beyond this very promising application for product tracking and the anti-counterfeiting strategies, e-NIL nanoxerography, potentially applicable to any types of charged and/or polarizable colloids and pattern geometries opens up tremendous opportunities for industrial scale production of various other kinds of colloid-based devices and sensors. (paper)

Uus kuum Eesti disain / Silvia Pärmann, Maris Takk

Index Scriptorium Estoniae

Pärmann, Silvia

2015-01-01

Karl Tauli disainitud taburet "Ämblu", Aap Piho puidust ümmargune laud, Marit Ilisoni tekkmantlid kollektsioonist "Longing for Sleep/Magada tahaks", Narma vaibakollektsioon "OPEN 2015/16" (disainerid Monika Järg, Kaidi Ploomipuu), Annike Laigo vaibakollektsioon "XX", Kairi Katmanni vaip "Storytellers", Valhalla Factory kollektsiooni "Daydreamers" ripptool, Raili Keivi betoonist ja portselanist nõudekollektsioon, Tarmo Luisu valgusti "Kassett", Stella Soomlaisi käekotid, Karin Kallase ja Erik Pasti (Stuudio Nahk) disainitud jalatsid, käekotid ja ehted, Kuula + Jylhä jalatsikollektsioon, Mokoko (disainer Mari Maripuu) nahast aksessuaarid

Rejoinder

OpenAIRE

Dijkstra, Geske

2006-01-01

textabstractI want to begin by thanking Göran Holmqvist and Karin Metell Cueva for financing (on behalf of Sida) our independent research of the PRS processes in Latin America in the first place, and now in particular for taking up the challenge to respond to my doubts and criticisms of the PRS approach. They recognise that this approach has been too optimistic and, in particular, that too many goals have been attached to one single instrument. The proposal they put forward is interesting and...

Four steps in the history of museum technologies and visitors' digital participation

Directory of Open Access Journals (Sweden)

Jørgen Riber Christensen

2011-06-01

    In conclusion, the article asks where the place of signification or meaning of the exhibited object has moved to in the face of the increased degree of visitor participation. The tentative answer is that the signification generating process has moved away from the historical context of the object and towards the contemporary world of the visitor. The article connects this change in cultural discourse with Karin Sander's archaeological imagination and in a wider sense with the concept of negotiation from new historicism.

Eesti läheb Pekingisse / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2008-01-01

Pekingi Eesti saatkonnahoone konkursist žüriiliikme pilguga. Premeeritud ja esiletõstetud töödest. Võidutöö autorid - Lauri Vaimel, Andres Põime, Liisa Põime; II koht - Erik Nobel ja Nobel Arkitekten, Taani-Eesti; III koht - Kalle Vellevoog, Velle Kadalipp, Tiiu Truus, Martin Prommik; ostudega esiletõstetud tööde autorid - Priit Pent ja Raul Järg Bucoma OÜ-st ning Jan Skolimowski, Peeter Loo, Kaspar Kruuse ja Li Vene KAMP Arhitektide OÜ-st. Hiina ja Pekingi uusehitistest, arhitektidest

Kolm inimest tuhandest kannab HI-viirust / Karin Kangro

Index Scriptorium Estoniae

Kangro, Karin

2004-01-01

Poliitikauuringute keskus Praxis uuris aidsiennetustegevust ja selle rahastamist. Tervishoiuspetsialist Maris Jesse sõnul tehakse Eestis aidsiennetustegevuses õigeid asju, ainult alarahastatult ja liiga vähe. Eiki Nestor, Nelli Kalikova aidsiprobleemist, ennetustööst. Vt. samas: Ka Euroopa Eesti pärast mures

Püüd kaevuda vaataja alateadvusse / Karin Saarepuu

Index Scriptorium Estoniae

Saarepuu, Karin

2002-01-01

Lahatakse installatiivset keskkonnaprojekti "X arvab, et ta on Y, aga tegelikult on Z" Viljandis Kilpkonna galeriis, mis on Rotermanni soolalaos toimuva näituse nn. visiitkaart. Autoriteks on Marko Mäetamm ning Lucy Harrison ja Pete Nevin Suurbritanniast

Gaasitoru, ujuv saun ning helisevad tuutud / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2008-01-01

Veneetsia XI arhitektuuribiennaalile kandideerinud tööde tutvustus. Biennaali teemaks on "Majade taga. Arhitektuur väljaspool ehitisi". Eestit esindab projekt "Gaasitoru", autorid Maarja Kask ja Ralf Lõoke arhitektuuribüroost Salto ning skulptor Neeme Külm. Teise koha said Eve Kask, Signe Kivi ja Andrus Kõresaar tööga "Peatus". Kolmas koht läks Villem Tomiste projektile "Veealune Veneetsia"

Hoovigalerii : uued hooned ja rajatised / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2004-01-01

2003. a. korraldatud arhitektuurivõistlusest Eesti Panga hoonekompleksi erinevaid osi ühendava galerii lahenduse saamiseks. Panga juhatus palus esialgse eskiisi kallal edasi töötada arhitektuuribüroodel Schults ja Partnerid ning Urban Mark. Teostamiseks valiti Urban Marki töö. Hoovigalerii valmis 2004. a. 3 ill. konkursitöödest, 2 vaadet valminud galeriist

Juugend - rahvusliku arhitektuuri esimene importstiil / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2001-01-01

12. V toimunud Eesti Arhitektuurimuuseumi rahvusvahelisest art nouveau konverentsist, mis keskendus Rootsi-Soome-Eesti ja Läti vastastikustele arhitektuurimõjutustele. Esinejatest, K. Hallase ettekandest sajandialguse arhitektuurisituatsioonist. Näitus "Riia juugendarhitektuur" Rotermanni soolalaos 20. maini.

Mänguväljak rikastab linnakeskkonda / Karin Bachmann

Index Scriptorium Estoniae

Bachmann, Karin, 1976-

2005-01-01

Mänguväljakute rajamisest ja korrashoiust Tartus, kus on olemas ülelinnaline mänguväljakute teemaplaneering. Projekt algatati 2002. a., eestvedaja Angela Männiste. Arvamust avaldavad Andres Pool ja Indrek Ranniku Tartu linnavalitsusest. Tallinnal ülelinnaline plaan mänguväljakute rajamiseks puudub, olukorrast Mustamäel ja Nõmmel. 3 ill

2008. aastal tõuseb pension 22% / Karin Kalda

Index Scriptorium Estoniae

Kalda, Karin

2007-01-01

Ilmunud ka: Tallinna Teataja : Kesklinn, Lasnamäe, Pirita, okt., 2007, lk. 3; Tallinna Teataja : Haabersti, Kristiine, Põhja-Tallinn, okt., 2007, lk. 3; Tallinnskii Vestnik, okt., 2007, lk. 3. Tallinnskii Vestnik autorita. Valitsusliit on saanud valmis uue pensioniarvestuse süsteemi, mille alusel võetakse aastahinde arvutamisel senisest enam arvesse sotsiaalmaksu laekumist. Kommenteerib Taavi Rõivas

Euroliit vaidleb Birma diktatuuri üle / Karin Dean

Index Scriptorium Estoniae

Dean, Karin

2004-01-01

EL-i ja Aasia riikide diplomaatilisest vaidlusest, kas lubada EL-i ja Kagu-Aasia tippkohtumisele diktatuuririiki Birmat. Kagu-Aasia maade ühenduse ASEAN seisukohtadest. Vt. samas: Birma uue põhiseaduse arutelu põlu all

Kapitalistlik realism muudab Vietnami majandustiigriks jalgrattal / Karin Dean

Index Scriptorium Estoniae

Dean, Karin

2007-01-01

Ilmunud ka: Postimees : na russkom jazõke 13. apr. lk. 10-11. Vietnami majanduspoliitikast, odavast tööjõust, edukatest reformidest ja majanduskasvust. Kaart: Vietnami Sotsialistlik Vabariik. Vt. samas: Sõda oli püüd takistada kommunismi

Disainiöös on asju / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2016-01-01

Tallinna Disainiöö 12.-18. septembrini 2016. Uuest kodumaisest disainist (näiteid Marta Mooratsi, Tarmo Luisu, Veiko Liisi, Urmas Lüüsi, Ivar Kaasiku, Krista Leesi, Mariana Laane, Margot Holtsi, Jan Plaani, Pille Ernesaksa loomingust)

3000 eesti peret rootsi kardinate taha / Karin Hallas

Index Scriptorium Estoniae

Hallas, Karin, 1957-

2000-01-01

Jüri Mõisa ideest hoonestada Pikaliiva Rootsi kataloogimajadega Bo Klok. IKEA ja Skanska üürnike ühenduse majadest. Günther Behnischi projekteeritud, Ingolstadti ehitatavast sotsiaalmajade asumist. Olemasolevad odavate majade projektid Eestis. Arhitektuuripoliitikast

Olmerti lahkumine külvab segadust / Karin Volmer

Index Scriptorium Estoniae

Volmer, Karin

2008-01-01

Iisraeli valitsusjuhi Ehud Olmerti tagasiastumisteade külvas kahtlusi Palestiinaga rahukõneluste jätkumise üle, kuid Jerusalem Posti andmeil üritab Olmert jõuda Palestiina liidri Mahmoud Abbasiga kokkuleppele veel enne uusi erakonnasiseseid valimisi

Idast, ürgse väega / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2007-01-01

Rändnäitus "Uue otsijad - praegune Ida-Euroopa!" Helsingi Arhitektuurimuuseumis. Eesti arhitektuuri esindavad Lootsi tänava kiilukujuline kortermaja (HG Arhitektuur), Villa V Nõmmel (3+1), Okupatsioonide muuseum (Head Arhitektid), Georg Otsa spaa (KOKO Arhitektid)

President Ilves jagas Ruila lastele aabitsaid / Karin Gustasson

Index Scriptorium Estoniae

Gustasson, Karin

2008-01-01

Kernu valla Ruila kooli 138. õppeaasta algas piduliku aktusega, kus tervituskõnega esines president Toomas Hendrik Ilves. President andis esimesse klassi astuvale 18 õpilasele isiklikult üle aabitsad pühendusega "Õpi rõõmuga!"

Noored - tööelanikkonna tulevik / Karin Reinhold

Index Scriptorium Estoniae

Reinhold, Karin, 1976-

2003-01-01

Espoos 20.-22. novembrini 2002. a. toimunud sümpoosionil "Noored ja töö" käsitleti kolme peateemat: õpilaste ettevalmistamine tööeluks, üleminek koolist tööle, noored töötajad ja tervislik tööelu

Kino kui grafiti = Cinema as graffiti / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2001-01-01

Kobarkinost Coca-Cola Plaza Tallinnas. Projekteerija: Arhitektuuristuudio Kirsima ja Niineväli. Arhitekt Andri Kirisma. Üldruumide sisekujundus: Kaire Kemp-Tisler, Ea Andla. II korruse baari kujundas Ursula Sõber. Konstruktsioonid: Marti Sein, Priit Luure Neoprojektist. Akustiline osa: Linda Madalik. Seinamaalingud: Anu Samarüütel. Projekt 1999-2001, valmis 2000-2001. 12 ill.: lõige, I ja V korruse plaanid, välis- ja sisevaated

Briti kultuuriprioriteedid - XX sajandi muuseumid / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2003-01-01

2002. a. novembris Londonis toimunud Briti Nõukogu korraldatud seminarist "Managing Museums and Galleries of the 21st Century", mille rõhk oli kunstimuuseumidel. Inglise muuseumidest: Tate Modern, Baltic, British Museum, Victoria & Alberti muuseum, Londoni loodusmuuseumi Darwini keskus

Turistid-sõjaõhutajad : dessant Iisraeli / Karin Hallas

Index Scriptorium Estoniae

Hallas, Karin, 1957-

1999-01-01

Kultuuridessandist Marika Valgu ja Helle Puusepaga Iisraeli. Jeruusalemma Yad Vashemist ئ Holocausti muuseumist. Arhitekt Moshe Safdie Laste Memoriaali ja Yad Vashemi memoriaali uue hoone lahendusest. Tel Avivi ja Jeruusalemma arhitektuurist ئ funktsionalismist, praegusest arhitektuurist, arhitekte. James Turrelli kunstiteosest "Ruum, mis näeb" Jeruusalemma muuseumi pargis

Kompleksi kujunemine ja tsaariaegsed ehitised / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2004-01-01

20. sajandi alguse Tallinna arhitektuurist. Pangakvartali kujunemise algus: Eestimaa Aadli Mõisate Krediitseltsi (Aadlipanga) hoone Estonia pst. 11 (1902-1904, arhitekt August Reinberg, ehituse järelevalve: Carl Jacoby, stukitöö, reljeefid: August Volz, vitraaž, vapid: Ernst Tode). Venemaa Riigipanga Tallinna osakonna hoone Estonia pst 13 (1907-1908, ehituse järelevalve: Aleksandr Jaron). Panga teenistujate elamu Sakala 6

WAF Dance etendab "Väikest printsi" / Karin Klaus

Index Scriptorium Estoniae

Klaus, Karin

2006-01-01

Pärnu tantsukool WAF Dance toob 17. ja 18. juunil Endla teatris lavale Saint-Exupery "Väikese printsi". See on moodsa tantsuteatri koolitus- ja etendusprojekt. Lavastaja ja koreograaf on Kate Pringle Londonist

Kunstiakadeemia lõpetajate defilee / Harry Liivrand, Karin Paulus

Index Scriptorium Estoniae

Liivrand, Harry, 1961-

2007-01-01

Tutvustatakse 2007. aastal Eesti Kunstiakadeemia lõpetanute töid: klaasikunstnik Kristi Ringkjobi klaasobjektide komplekt "Munk"; ehtekunstnik Raili Arbuse ehted; keraamik Ann Nurga savist "Lennukid"; klaasikunstnik Lauri Kimmi "Klaas ja kivi. Muundumine"; nahakunstnik Allan Põllu kollektsioon "Coffee and Cigars. Chocolate and Cognac"; sisearhitekt Ott Kanguri lamamis/kiiktool; arhitekt Rene Sauemägi visioon Admiraliteedi basseini äärsest tühermaast; Kristiina Uslari dekoratiivobjektid; arhitekt Sander Aasa projekt "Pakri saared. Kultuurmaastiku koloniseerimine"

Bekkerist võib saada sõjalaevastiku baas / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2000-01-01

Teede- ja sideministeeriumis ja siseministeeriumis arutatakse Tallinna miinisadama müüki ja Eesti sõjalavastiku koondamist Bekkeri sadamasse. Vastuseks vt. Äripäev Feb/1 lk. 27 Tiit Maidre artiklit

Nil Bohr-sets and almost automorphy of higher order

CERN Document Server

Huang, Wen; Ye, Xiangdong

2016-01-01

Two closely related topics, higher order Bohr sets and higher order almost automorphy, are investigated in this paper. Both of them are related to nilsystems. In the first part, the problem which can be viewed as the higher order version of an old question concerning Bohr sets is studied: for any d\\in \\mathbb{N} does the collection of \\{n\\in \\mathbb{Z}: S\\cap (S-n)\\cap\\ldots\\cap (S-dn)\

COMUNICAÇÃO DE CRISE NA PUBLICIDADE: Marcas, Prosumers e Mediações

Directory of Open Access Journals (Sweden)

Lucimara Rett

2016-10-01

Full Text Available A comunicação de crise já está incorporada à comunicação corporativa, entretanto, mais efetivamente aplicada na assessoria de imprensa das empresas. A Professora Doutora Karine Berthelot-Guie, da Université de Paris-Sorbonne, na França, traz o conceito para a publicidade, o que desperta o interesse de investigação desse novo desafio para as marcas no cenário de convergência e cultura participativa. A título de estudo exploratório, este trabalho apresenta alguns exemplos em que a manifestação das marcas são interpeladas, nesse contexto, por diferentes tipos de mediação ressignificados pelo receptor, quais sejam: mediações espaciais, humanas e virtuais.   PALAVRAS-CHAVE: Publicidade; Marcas; Mediações; Prosumers; Comunicação de Crise.   ABSTRACT The crisis communications is already integrated to the corporate communications, although it is more effectively applied in media relations offices. PhD Professor Karine Berthelot-Guide, from Paris-Sorbonne University, in France, brings the concept to advertising, which increases the interest in this new research challenge for brands in the context of convergence and participatory culture. As an exploratory study, this paper presents some examples where the brand manifestations are challenged by different kinds of mediation reinterpreted by the receiver, namely: space, human and virtual mediations.   KEYWORDS: Advertising; Brands; Mediations; Prosumers; Crisis Communication.     RESUMEN La comunicación de crisis ya se ha incorporada a la comunicación corporativa, entretanto, se aplica efectivamente en la asesoría de prensa de las empresas. La profesora Doctora Karine Berthelot-Guie, de la Universidad de la Sorbona-Paris, en Francia, introdujo el concepto para el campo de la publicidad, lo que despierta el interés para la investigación de ese nuevo desafío para las marcas en un escenario de convergencia y cultura participativa. A modo de estudio exploratorio, este

A gene encoding an abscisic acid biosynthetic enzyme (LsNCED4) collocates with the high temperature germination locus Htg6.1 in lettuce (Lactuca sp.).

Science.gov (United States)

Argyris, Jason; Truco, María José; Ochoa, Oswaldo; McHale, Leah; Dahal, Peetambar; Van Deynze, Allen; Michelmore, Richard W; Bradford, Kent J

2011-01-01

Thermoinhibition, or failure of seeds to germinate when imbibed at warm temperatures, can be a significant problem in lettuce (Lactuca sativa L.) production. The reliability of stand establishment would be improved by increasing the ability of lettuce seeds to germinate at high temperatures. Genes encoding germination- or dormancy-related proteins were mapped in a recombinant inbred line population derived from a cross between L. sativa cv. Salinas and L. serriola accession UC96US23. This revealed several candidate genes that are located in the genomic regions containing quantitative trait loci (QTLs) associated with temperature and light requirements for germination. In particular, LsNCED4, a temperature-regulated gene in the biosynthetic pathway for abscisic acid (ABA), a germination inhibitor, mapped to the center of a previously detected QTL for high temperature germination (Htg6.1) from UC96US23. Three sets of sister BC(3)S(2) near-isogenic lines (NILs) that were homozygous for the UC96US23 allele of LsNCED4 at Htg6.1 were developed by backcrossing to cv. Salinas and marker-assisted selection followed by selfing. The maximum temperature for germination of NIL seed lots with the UC96US23 allele at LsNCED4 was increased by 2-3°C when compared with sister NIL seed lots lacking the introgression. In addition, the expression of LsNCED4 was two- to threefold lower in the former NIL lines as compared to expression in the latter. Together, these data strongly implicate LsNCED4 as the candidate gene responsible for the Htg6.1 phenotype and indicate that decreased ABA biosynthesis at high imbibition temperatures is a major factor responsible for the increased germination thermotolerance of UC96US23 seeds.

First Detections of the [NII] 122 Micrometer Line at High Redshift: Demonstrating the Utility of the Line for Studying Galaxies in the Early Universe

Science.gov (United States)

Ferkinhoff, Carl; Brisbin, Drew; Nikola, Thomas; Parshley, Stephen C.; Stacey, Gordon J.; Phillips, Thomas G.; Falgarone, Edith; Benford, Dominic J.; Staguhn, Johannes G.; Tucker, Carol E.

2011-01-01

We report the first detections of the [NIl] 122 {\\mu} m line from a high redshift galaxy. The line was strongly (> 6{\\sigma}) detected from SMMJ02399-0136, and HI413+ 117 (the Cloverleaf QSO) using the Redshift(z) and Early Universe Spectrometer (ZEUS) on the CSO. The lines from both sources are quite bright with line-to-FIR continuum luminosity ratios that are approx.7.0x10(exp -4) (Cloverleaf) and 2.1x10(exp -3) (SMMJ02399). With ratios 2-10 times larger than the average value for nearby galaxies, neither source exhibits the line-to-continuum deficits seen in nearby sources. The line strengths also indicate large ionized gas fractions, approx.8 to 17% of the molecular gas mass. The [OIII]/[NII] line ratio is very sensitive to the effective temperature of ionizing stars and the ionization parameter for emission arising in the narrow-line region (NLR) of an AGN. Using our previous detection of the [01II] 88 {\\mu}m line, the [OIII]/ [NIl] line ratio for SMMJ02399-0136 indicates the dominant source of the line emission is either stellar HII regions ionized by 09.5 stars, or the NLR of the AGN with ionization parameter 10g(U) = -3.3 to -4.0. A composite system, where 30 to 50% of the FIR lines arise in the NLR also matches the data. The Cloverleaf is best modeled by a superposition of approx.200 M82like starbursts accounting for all of the FIR emission and 43% of the [NIl] line. The remainder may come from the NLR. This work demonstrates the utility of the [NIl] and [OIII] lines in constraining properties of the ionized medium.

Genetic analysis of a hybrid sterility gene that causes both pollen and embryo sac sterility in hybrids between Oryza sativa L. and Oryza longistaminata.

Science.gov (United States)

Chen, H; Zhao, Z; Liu, L; Kong, W; Lin, Y; You, S; Bai, W; Xiao, Y; Zheng, H; Jiang, L; Li, J; Zhou, J; Tao, D; Wan, J

2017-09-01

Oryza longistaminata originates from African wild rice and contains valuable traits conferring tolerance to biotic and abiotic stress. However, interspecific crosses between O. longistaminata and Oryza sativa cultivars are hindered by reproductive barriers. To dissect the mechanism of interspecific hybrid sterility, we developed a near-isogenic line (NIL) using indica variety RD23 as the recipient parent and O. longistaminata as the donor parent. Both pollen and embryo sac semi-sterility were observed in F 1 hybrids between RD23 and NIL. Cytological analysis demonstrated that pollen abortion in F 1 hybrids occurred at the early bi-nucleate stage due to a failure of the first mitosis in microspores. Partial embryo sacs in the F 1 hybrids were defective during the functional megaspore formation stage. Most notably, nearly half of the male or female gametes were aborted in heterozygotes S40 i S40 l , regardless of their genotypes. Thus, S40 was indicated as a one-locus sporophytic sterility gene controlling both male and female fertility in hybrids between RD23 and O. longistaminata. A population of 16 802 plants derived from the hybrid RD23/NIL-S40 was developed to fine-map S40. Finally, the S40 locus was delimited to an 80-kb region on the short arm of chromosome 1 in terms with reference sequences of cv. 93-11. Eight open reading frames (ORFs) were localized in this region. On the basis of gene expression and genomic sequence analysis, ORF5 and ORF8 were identified as candidate genes for the S40 locus. These results are helpful in cloning the S40 gene and marker-assisted transferring of the corresponding neutral allele in rice breeding programs.

Elistagem eestimaist. Abikaasade meelevallas / Aita Kivi

Index Scriptorium Estoniae

Kivi, Aita, 1954-

2002-01-01

Sisu : Anton Nigov [Tõnu Õnnepalu]. Harjutused; Elme Väljaste. Kiusatus; Reet Kudu. Täiskuu ja tänavalatern; Vaapo Vaher. Surmakuul & seemnepurse; Jelena Skulskaja. Vene rulett; Inge Ojala. Asendusema ja olematud lapsed; Inge Ojala. Andesta - ma kasvasin tänaval; Barbara Vine. Korstnapühkija poeg; Charlotte Bingham. Suveaeg; Lisa Gardner. Täiuslik abikaasa; Wendy Northcutt. Darwini auhinnad 2; Dean Foster. Euroopa riikide etikett ja tavad; J. P. Donleavy. Naine, kellele meeldisid puhtad tualettruumid; Karin Altvegen. Kadunud hing; Grant Naylor. Punane kääbus; Dylan Evans. Emotsioon. Sentimenditeooria

Short outlines of books by Estonian authors / Rutt Hinrikus, Janika Kronberg

Index Scriptorium Estoniae

Hinrikus, Rutt, 1946-

1996-01-01

Kõiv, Madis. Studia memoriae I. Rännuaastad; Krull, Hasso. Luuletused 1987-1991; Krull, Hasso. Swinburne; Mihkelson, Ene. Nime vaev; Saarsen, Karin. Poola suvi; Traat, Mats. Hirm ja iha; Murutar, Kati. Naisena sündinud; Unt, Mati. Tere, kollane kass; Unt, Mati. Argimütoloogia sõnastik 1983-93; Unt, Mati. Vastne argimütoloogia; Mutt, Mihkel. Pingviin ja raisakass; Mutt, Mihkel. Rahvusvaheline mees; Teder, Tarmo. Kurat kargas pähe; Suuman, Sass. Targemat ei ole; Hirv, Indrek. Tähekerjus; Kaplinski, Jaan. Mitu suve ja kevadet; Kaplinski, Jaan. Jää ja Titanic

Kui seda mammit seal jalus ei oleks... / Indrek Pajo, Heiti Riisberg, Jaana Liigand... [jt.

Index Scriptorium Estoniae

2010-01-01

Küsimusele, mida peaks noor keskjuht juhtimise osas tegema kui tunneb pärast paarikuist töötamist üha rohkem, et mõned tema alluvad, kes on temast oluliselt vanemad, töötavad talle vastu, vastavad endine Cleaner Ehitus vanemobjektijuht Indrek Pajo, Trigon Kapital pensioni- ja aktsiafondide eest hoolitsev Heiti Riisberg, konsultatsioonifirma Arikano omanik ja juht Jaana Liigand, Pharmadule OÜ personali- ja büroojuht Helen Neeve, Saku Õlletehase brändide Rock ja Carlsberg juht Karin Golubev ning Kaamos Kinnisvara juht Priit Uustulnd

The Role of I-kappa-B Kinases in Prostate Carcinogenesis and the Effect of Their Inhibition on Survival of Prostate Tumors

Science.gov (United States)

2007-01-01

2. Karin, M., Y. Cao, F.R. Greten , and Z.W. Li. 2002. NF-kappaB in cancer: from innocent bystander to major culprit. Nat Rev Cancer 2:301-310. 3...transcriptional activity are regulated by p100. J Biol Chem 277:1405-1418. 6. Senftleben, U., Y. Cao, G. Xiao, F.R. Greten , G. Krahn, G. Bonizzi, Y...cells: evidence for the involvement of IKKalpha. Embo J 20:6805-6815. 8. Greten , F.R., L. Eckmann, T.F. Greten , J.M. Park, Z.W. Li, L.J. Egan, M.F

Sajand oodatud / Kristo Mäe

Index Scriptorium Estoniae

Mäe, Kristo

2006-01-01

Eesti Rahva Muuseumi uue hoone arhitektuurikonkursi võidutööst "Memory Field". Autorid: itaalia arhitekt Dan Dorell, liibanoni arhitekt Lina Ghotmeh ja jaapani arhitekt Tsuyoshi Tane. II preemia pälvis töö "Gems", autoriteks soome arhitektid Juho Grönholm, Antti Nousjoki, Janne Teräsvirta, Samuli Woolston, III preemia töö "Estonia is on the verge of a new millennium", autoriteks austria arhitektid Alfred Bramberger, Thomas Pucher, Heidrun Steinhauser, Martin Mathy, Christa Pucher. Krista Aru ja Karin Hallas-Murula arvamus, intervjuu Lina Ghotmet'iga

Les parlements du peuple au Kenya

DEFF Research Database (Denmark)

Rasmussen, Jacob

2012-01-01

Despite the adoption of a new constitution in 2010, the post-election violence surrounding the flawed 2007 General Elections have fuelled on-going debates in Kenya about a state of political crisis and fragile democracy. Comparing two street parliaments from Eldoret and Nairobi in the context...... of electoral failure and constitutional reform, this paper investigates dynamics of political participation from below. The street parliaments form arenas for oral debates where speakers and participants collectively engage in the intentional shaping of spaces of speech. Inspired by the work of Karin Barber...

Printable photonic crystals with high refractive index for applications in visible light

International Nuclear Information System (INIS)

Calafiore, Giuseppe; Mejia, Camilo A; Munechika, Keiko; Peroz, Christophe; Piña-Hernandez, Carlos; Fillot, Quentin; Dhuey, Scott; Sassolini, Simone; Salvadori, Filippo; Cabrini, Stefano

2016-01-01

Nanoimprint lithography (NIL) of functional high-refractive index materials has proved to be a powerful candidate for the inexpensive manufacturing of high-resolution photonic devices. In this paper, we demonstrate the fabrication of printable photonic crystals (PhCs) with high refractive index working in the visible wavelengths. The PhCs are replicated on a titanium dioxide-based high-refractive index hybrid material by reverse NIL with almost zero shrinkage and high-fidelity reproducibility between mold and printed devices. The optical responses of the imprinted PhCs compare very well with those fabricated by conventional nanofabrication methods. This study opens the road for a low-cost manufacturing of PhCs and other nanophotonic devices for applications in visible light. (paper)

Transcriptome Profile of Near-Isogenic Soybean Lines for β-Conglycinin α-Subunit Deficiency during Seed Maturation.

Science.gov (United States)

Song, Bo; An, Lixin; Han, Yanjing; Gao, Hongxiu; Ren, Hongbo; Zhao, Xue; Wei, Xiaoshuang; Krishnan, Hari B; Liu, Shanshan

2016-01-01

Crossing, backcrossing, and molecular marker-assisted background selection produced a soybean (Glycine max) near-isogenic line (cgy-2-NIL) containing the cgy-2 allele, which is responsible for the absence of the allergenic α-subunit of β-conglycinin. To identify α-null-related transcriptional changes, the gene expressions of cgy-2-NIL and its recurrent parent DN47 were compared using Illumina high-throughput RNA-sequencing of samples at 25, 35, 50, and 55 days after flowering (DAF). Seeds at 18 DAF served as the control. Comparison of the transcript profiles identified 3,543 differentially expressed genes (DEGs) between the two genotypes, with 2,193 genes downregulated and 1,350 genes upregulated. The largest numbers of DEGs were identified at 55 DAF. The DEGs identified at 25 DAF represented a unique pattern of GO category distributions. KEGG pathway analyses identified 541 altered metabolic pathways in cgy-2-NIL. At 18DAF, 12 DEGs were involved in arginine and proline metabolism. The cgy-2 allele in the homozygous form modified the expression of several Cupin allergen genes. The cgy-2 allele is an alteration of a functional allele that is closely related to soybean protein amino acid quality, and is useful for hypoallergenic soybean breeding programs that aim to improve seed protein quality.

An experimental and theoretical study on the interaction of DNA and BSA with novel Ni2 +, Cu2 + and VO2 + complexes derived from vanillin bidentate Schiff base ligand

Science.gov (United States)

Dostani, Morteza; Kianfar, Ali Hossein; Mahmood, Wan Ahmad Kamil; Dinari, Mohammad; Farrokhpour, Hossein; Sabzalian, Mohammad R.; Abyar, Fatemeh; Azarian, Mohammad Hossein

2017-06-01

In this investigation, the structure of bidentate N,N-Schiff base ligand of vanillin, (E)-4-(((2-amino-5-nitrophenyl)imino)methyl)-2-methoxyphenol (HL) was determined by single crystal X-ray diffraction. The interaction of new [CuL2], [NiL2] and [VOL2] complexes with DNA and BSA was explored through UV-Vis and fluorescence spectroscopy. The electronic spectra changes displayed an isosbestic point for the complexes upon titration with DNA. The Kb values for the complexes [CuL2], [NiL2] and [VOL2] were 2.4 × 105, 1.9 × 105 and 4.2 × 104, respectively. [CuL2] complex was bound more toughly than [NiL2] and [VOL2] complexes. These complexes had a significant interaction with Bovine Serum Albumin (BSA) and the results demonstrated that the quenching mechanism was a static procedure. Also, the complexes interacted with BSA by more than one binding site (n > 1). Finally, the theoretical studies were performed using the docking method to calculate the binding constants and recognize the binding site of the DNA and BSA with the complexes. The ligand and complexes including Ni2 +, Cu2 + and VO2 + ions were colonized by fungal growth.

Characterization of actions of dopamine in the pituitary of the goldfish, Carassius auratus

Energy Technology Data Exchange (ETDEWEB)

Omeljaniuk, R.J.

1988-01-01

The dopamine receptor in the goldfish (Carassius auratus) pituitary and its involvement with inhibition of gonadotropin (GtH) and {alpha}-melanocyte stimulating hormone ({alpha}-MSH) release was studied. In vitro dopamine, in a dose-related manner, inhibited spontaneous GtH and {alpha}-MSH release from superfused fragments of pars distalis (PD) and neurointermediate lob (NIL), respectively; dopamine also inhibited sGnRH-A stimulation of GtH release. Thyrotropin releasing-hormone (TRH), in a dose-related manner, stimulated {alpha}-MSH release from NIL fragments; dopamine inhibited TRH action. The stereoisomers of apomorphine were equivalent in inhibiting GtH and {alpha}-MSH release from fragments treated with releasing factors. Domperidone, in a dose-related manner, antagonized dopamine action. ({sup 3}H)-Spiperone was used to radiolabel the goldfish pituitary dopamine receptor in vitro. The binding of ({sup 3}H)-spiperone had the characteristics of a receptor: tissue specificity, dependence on tissue quantity, reversibility, saturability, displaceability, specificity of binding with various drugs and a correlation of binding with biological effects were demonstrated. This is a low-affinity, high-capacity receptor which does not show binding stereoselectivity for apomorphine; domperidone binds avidly to this receptor. The NIL contains significantly greater numbers of this receptor compared to the PD.

Some leaders, despite reputations, offer Latvians hope through crisis / Arta Ankrava

Index Scriptorium Estoniae

Ankrava, Arta

2009-01-01

DnB Nord Latvia Barometer küsitlusest selgus, et kõige enam usaldatakse ekspresident Vaira Vike-Freiberga, Riia linnapea Nils Usakovsi ja Ventspilsi endise linnapea Aivars Lembergsi majandusprognoose

Bank consolidation expected as crisis creates opportunities

Index Scriptorium Estoniae

2009-01-01

Lätis ja Leedus asuvad pangad vajavad uut kapitali. Nordea panga hinnang Baltimaade majandustele. Nordea panga plaanidest. Parex panga presidendi Nils Melngailise sõnul vajab pank oodatust suuremat riigiabi

Popmuusika / Valner Valme

Index Scriptorium Estoniae

Valme, Valner, 1970-

2005-01-01

Uutest heliplaatidest Starsailor "On The Outside", Alabama "The Essential", Sean Paul "The Trinity", Nils Landgren & Joe Sample "Creole Love Call", Millionaire "Paradisiac", Kashmir "No Balance Palace", Bonnie Raitt "Souls Alike"

Prognostic Factors and Outcome of Management of Ischemic ...

African Journals Online (AJOL)

management, prognostic factors, and outcome of ischemic priapism in patients seen at Ahmadu Bello University Teaching Hospital, Zaria, Nigeria. ..... Financial support and sponsorship. Nil. ... European Association of Urology guidelines on.

DWDM DFB LD fabricated by nanoimprint process

Science.gov (United States)

Liu, Wen; Wang, Lei; Zhou, Ning; Zhang, Yiwen; Qiu, Fei; Xu, Zhimou

2011-02-01

DFB LDs are key components in DWDM optical network. Now they are very expensive because the feedback grating period has to be controlled with very high accuracy and EBL is currently the most popular solution. We propose a high throughput, low cost NIL process based on a large stamp fabricated by SFIL and soft stamp pattern transfer method. DFB chips on 30mm*30mm area were manufactured with both good uniformity and performance. 13 ITU channels from 1540nm to 1560nm of 200GHz space are made. Our results show NIL has high potential to become another popular technology for DFB LD production, this cost effective and high efficiency manufacture solution may yield a significant impact to the future optical communication industry development.

Status of Standardization Projects

Science.gov (United States)

1994-09-01

942 953 953 A VDI N 4820 0657 NIL V 25513F USAF VALVE CHECK FOR 300 71 D2 943 963 944 G AS 99 U 4820 0658 NIL-V-9439 VALVES OXYGEN CYLINDER HIGH 71 02...944 951 951 A AR AS 99 IS N D 5305 2048 N535494 SCREW WOOD FLAT HEAD SLOTTED IS F5 A 944 951 951 A AR AS 99 IS N D 5305 2049 NS35495 SCREW WOOD ROUND...951 A AS U D 5340 2047 MIL-C-85052Z6 CLAMP INSERT 275F AS F4 913 924 951 A AV AS 99 U D 5340 2048 MIL-C-85052/7 CLAMP INSERT LOOP 500F AS F4 913 924

Dried duckweed and commercial feed promote adequate growth performance of tilapia fi ngerlings

OpenAIRE

Tavares, Flávia de A.; Rodrigues, João Bosco R.; Fracalossi, Débora Machado; Esquivel, Juan; Roubach, Rodrigo

2008-01-01

http://dx.doi.org/10.5007/2175-7925.2008v21n3p91Desempenho de alevinos de tilapia nilótica alimentados com uma  combinação de lemnas secas e ração comercial. O presente estudo  avaliou a utilização de ração comercial e lemna seca no cultivo de  alevinos de tilápias nilóticas com o objetivo de reduzir os custos de produção. Três dietas representadas por lemna seca, ração comercial  (40% proteína bruta) e uma combinação de lemna seca e ração  comercial foram fornecidas a um grupo de 20 alevinos...

President tuli "koju" : President Toomas H. Ilves NY Eesti Majas

Index Scriptorium Estoniae

2007-01-01

President Toomas Hendrik Ilvese ja proua Evelin Ilvese külaskäigust New Yorgi Eesti Majja 23. septembril 2007. Tervitussõnavõttudega esinesid New Yorgi Eesti Haridusseltsi esimees dr. Toomas Sõrra, New Yorgi Eesti Kooli juhataja Karin Kärner. Kirjaliku tervituse saatis presidendile tema omaaegne skaudijuht Emu Saarniit. President T.H. Ilves meenutas oma sõnavõtus, et esimest korda külastas ta New Yorgi Eesti Maja 50 aastat tagasi. Pärast ametlike sõnavõttude lõppu said kõik kohaletulnud isiklikult presidenti tervitada. Vabariigi President töövisiidil Ameerika Ühendriikides 20.-26.09.2007

First hoisting of the Portuguese flag at CERN

CERN Multimedia

Unknown, Unknown

1986-01-01

First hoisting of the Portuguese flag at CERN, following the country's membership. Photo taken on January 22 (or 23), 1986. From left to right: António Costa Lobo (Portugal's ambassador to the UN in Geneva), Gaspar Barreira, Karin Wall (José Mariano Gago's wife), José Mariano Gago (Portugal's JNICT president), Catarina Wall Gago (José Mariano Gago's daughter), João Varela, Herwig Schopper (CERN's Director-General), Eduardo Arantes e Oliveira (Portugal's Secretary of State for Science), , Margarida Nesbitt Rebelo, , Mário Pimenta, , Gustavo Castelo Branco, João Seixas, Sérgio Ramos, and Peter Sonderegger.

Boye och "jag" : En grammatisk analys av en litterär persona

OpenAIRE

Lindström, Elina

2015-01-01

I denna uppsats använder jag den interpersonella metafunktionen inom systemisk-funktionell grammatik för att undersöka sex av Karin Boyes dikter, detta med syfte att se huruvida en sådan här analys kan säga något av intresse om diktjaget. Analysen genomfördes enligt Holmberg och Karlssons modell i Grammatik med betydelse, där subjekt och finit tagits ut varpå språkhandlingar markerats och modalitet kommenterats. Dikterna är hämtade ur Boyes Samlade dikter. Av min analys framgår att jaget beha...

Lack of fitness costs and inheritance of resistance to Bacillus thuringiensis Cry1Ac toxin in a near-isogenic strain of Plutella xylostella (Lepidoptera: Plutellidae).

Science.gov (United States)

Zhu, Xun; Yang, Yanjv; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Guo, Zhaojiang; Kang, Shi; Xia, Jixing; Zhang, Youjun

2016-02-01

Resistance to Bacillus thuringiensis (Bt) formulations in insects may be associated with fitness costs. A lack of costs enables resistance alleles to persist, which may contribute to the rapid development and spread of resistance in populations. To assess the fitness costs associated with Bt Cry1Ac resistance in Plutella xylostella, life tables were constructed for a near-isogenic resistant strain (NIL-R) and a susceptible strain in this study. No fitness costs associated with Cry1Ac resistance in NIL-R were detected, based on the duration of egg and larval stages, the survival of eggs and larvae, adult longevity, fecundity, net reproductive rate, gross reproduction rate, finite rate of increase and mean generation time. Based on log dose-probit lines, resistance in NIL-R is incompletely recessive and results from a single, autosomal, recessive locus; the degree of dominance was estimated to be -0.74 and -0.71 for F1 (resistant ♀ × susceptible ♂) and F1 ' (susceptible ♀ × resistant ♂) progeny respectively. Assessment of near-isogenic Cry1Ac-resistant and Cry1Ac-susceptible strains of P. xylostella indicated that resistance is not accompanied with fitness costs, and that resistance is incompletely recessive. These findings should be useful in managing the development of Bt Cry1Ac resistance. © 2015 Society of Chemical Industry.

Increased pericarp cell length underlies a major quantitative trait locus for grain weight in hexaploid wheat.

Science.gov (United States)

Brinton, Jemima; Simmonds, James; Minter, Francesca; Leverington-Waite, Michelle; Snape, John; Uauy, Cristobal

2017-08-01

Crop yields must increase to address food insecurity. Grain weight, determined by grain length and width, is an important yield component, but our understanding of the underlying genes and mechanisms is limited. We used genetic mapping and near isogenic lines (NILs) to identify, validate and fine-map a major quantitative trait locus (QTL) on wheat chromosome 5A associated with grain weight. Detailed phenotypic characterisation of developing and mature grains from the NILs was performed. We identified a stable and robust QTL associated with a 6.9% increase in grain weight. The positive interval leads to 4.0% longer grains, with differences first visible 12 d after fertilization. This grain length effect was fine-mapped to a 4.3 cM interval. The locus also has a pleiotropic effect on grain width (1.5%) during late grain development that determines the relative magnitude of the grain weight increase. Positive NILs have increased maternal pericarp cell length, an effect which is independent of absolute grain length. These results provide direct genetic evidence that pericarp cell length affects final grain size and weight in polyploid wheat. We propose that combining genes that control distinct biological mechanisms, such as cell expansion and proliferation, will enhance crop yields. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

Indolenine meso-substituted dibenzotetraaza[14]annulene and its coordination chemistry toward the transition metal ions Mn(III), Fe(III), Co(II), Ni(II), Cu(II), and Pd(II).

Science.gov (United States)

Khaledi, Hamid; Olmstead, Marilyn M; Ali, Hapipah Mohd; Thomas, Noel F

2013-02-18

A new dibenzotetraaza[14]annulene bearing two 3,3-dimethylindolenine fragments at the meso positions (LH(2)), has been synthesized through a nontemplate method. X-ray crystallography shows that the whole molecule is planar. The basicity of the indolenine ring permits the macrocycle to be protonated external to the core and form LH(4)(2+)·2Cl(-). Yet another structural modification having strong C-H···π interactions was found in the chloroform solvate of LH(2). The latter two modifications are accompanied by a degree of nonplanar distortion. The antiaromatic core of the macrocycle can accommodate a number of metal ions, Mn(III), Fe(III), Co(II), Ni(II) and Cu(II), to form complexes of [Mn(L)Br], [Mn(L)Cl], [Fe(LH(2))Cl(2)](+)·Cl(-), [Co(L)], [Ni(L)], and [Cu(L)]. In addition, the reaction of LH(2) with the larger Pd(II) ion leads to the formation of [Pd(2)(LH(2))(2)(OAc)(4)] wherein the macrocycle acts as a semiflexible ditopic ligand to coordinate pairs of metal ions via its indolenine N atoms into dinuclear metallocycles. The compounds LH(2), [Co(L)], and [Ni(L)] are isostructural and feature close π-stacking as well as linear chain arrangements in the case of the metal complexes. Variable temperature magnetic susceptibility measurements showed thermally induced paramagnetism in [Ni(L)].

Juhtumikorralduse põhimõtte rakendamisest kohalikus omavalitsuses / Karin Hanga

Index Scriptorium Estoniae

Hanga, Karin

2005-01-01

27.-28. juunil 2005. a. Pedasel toimunud kohalike omavalitsuste sotsiaal- ja lastekaitsetöötajate suvepäevadel arutluse all olnud juhtumikorralduse probleemidest. Lisatud juhtumi lahendamise skeem. Kommenteerivad: Merle Linno ja Indrek Rohtla

Mitte ainult jätistele : fassaadid kodututele / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

1999-01-01

Festival 'Backdoor media'99' koondnimetusega 'Fassaadid kodututele' Tallinnas. Andres Kure heliinstallatsioon, performance Tammsaare monumendi juures (kuraator Hanno Soans), Peterburi kunstnike Natalja Jegorova ja Olga Jakimanskaja videod, Silja Saarepuu kerjamiskarbid, Raoul Kurvitza video, samizdat-ajakiri.

Gazpromil tuleb rahast puudus kätte / Karin Volmer

Index Scriptorium Estoniae

Volmer, Karin

2007-01-01

Ilmunud ka: Postimees : na russkom jazõke 16. juuli, lk. 7.Venemaa president Vladimir Putin ja Prantsusmaa president Nicolas Sarkozy leppisid kokku, et Gazpromi partneriks seni suurimate veealuste maagaasivarude kaevandamisel Barentsi meres asuval Shtokmani leiukohal saab Prantsuse firma Total. Lisa: Kas teate? Vt. samas: Jürgen Tamme. Läänemere põhja plaanitava gaasijuhtme tulevik on ebamäärane

Ühe maja lugu / Kalle Vellevoog ; interv. Karin Paulus

Index Scriptorium Estoniae

Vellevoog, Kalle, 1963-

2008-01-01

Näitusest Arhitektuuri- ja Disainigaleriis, kus eksponeeritakse Arne Maasiku fotosid Kalle Vellevoo ja ehitusarhitekt Margus Tamme (arhitektuuribüroo JVR) projekteeritud pansionaadihoonest Pärnus Seedri tänav 4. Näituse ja kataloogi kujundas Martin Pedanik

Polümeerne kultuuritegemine = Polymeric Culture-making / Karin Laansoo

Index Scriptorium Estoniae

Laansoo, Karin, 1976-

2005-01-01

Endises "Polümeeri" tehases Tallinnas 2002. aastast tegutsevast kultuuritehasest "Polymer". Hoones on töökojad, kunstistuudiod (Mare Raidma, Neeme Külm, Raul Keller), kultuuritrükikoda, tegutsevad klubid, toimuvad peod jm. 2005. a. juulist peab kultuuritehas pinnad vabastama, sest kinnisvarafirma Brem lõpetas 21. IV ühepoolselt rendilepingu

Iisraeli ja Palestiina suhted on paranemise teel / Karin Volmer

Index Scriptorium Estoniae

Volmer, Karin

2007-01-01

Iisraeli valitsus kiitis heaks palestiinlastest vangide vabastamise, keda peeti president Mahmud Abbasi liitlasteks võitluses Hamasiga. Iisraeli välisminister Tzipi Livni kohtus Palestiina peaministri Salam Fayyadiga. Vt. samas: Palestiinlaste sisetüli. Ilmunud ka: Postimees : na russkom jazõke, 10. juuli 2007, lk. 7

Eesti saatkonna ehitamisest Riiga 1938. aastal / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2008-01-01

Riiga Eesti saatkonna hoone rajamise katsest. Välisministeeriumi poolt Aleksander Nürnbergilt tellitud eskiisist. 1938. a. korraldatud arhitektuurikonkursist ja selle tulemustest (I preemia - Erich Jacoby ja Hermann Berg, II - Herbert Johanson ja Lorenz Johanson, 1939. aastast Lorenz Haljak, III - Elmar Lohk)

Euroopa parim arhitektuur : kriteeriumidest ja valikutest / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2010-01-01

Näitus "Euroopa parim arhitektuur. Euroopa Liidu Mies van der Rohe arhitektuuripreemiad 2009" Eesti Arhitektuurimuuseumis 5. septembrini 2010. Valiknäitusel on väljas Euroopas aastatel 2008-2009 ehitatud hooned. Preemia määrati arhitektuuribüroo Snøhetta Oslo ooperi- ja balletiteatrile. Noore büroona tõsteti esile Studio UP Horvaatiast. Eestist on näitusel KOKO Arhitektide laudsepa töökoda Rotermanni kvartalis

Pärnu jätkab Europan-projektiga / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

2003. aastal toimunud arhitektuurikonkursi Europan 7 võidutöö "Teine loodus" (arhitektid Oana-Maria Bogdan, Kelly Shannon jt.) põhjal valminud eskiisprojektist Pärnus mere ning Tammsaare puiestee vahelisele krundile. Triin Ojari selgitab võistluse olemust. Arhitekt Kelly Shannon külastas Pärnut

Oscar Niemeyer - arhitekt ja kõiksus / Karin Hallas-Murula

Index Scriptorium Estoniae

Hallas-Murula, Karin, 1957-

2001-01-01

Brasiilia arhitektist Oscar Niemeyerist (s. 1907) ja tema loomingust. Niemeyeri Rio de Janeiro büroo ja Rootsi Arhitektuurimuuseumi koostöös valminud näitusel Rotermanni soolalaos on rõhuasetus idee sünnil, esimestel skitsidel. Näitust saadab film Niemeyerist

Käsitöö teeb asjad paremaks / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2007-01-01

Eesti ja inglise kunstnike ühisnäitusest "Minu maailm : uus subjektiivsus kaasaegses disainis" Eesti Tarbekunsti- ja Disainimuuseumis. Kuraatorid Emily Campell, Andree Cook, Kai Lobjakas. Eksponeeritakse Annike Laigo, Krista Leesi, Ülle Jehe, Kärt Ojavee töid. Inglismaad esindavad 7 kunstnikku, lähemalt Danny Browni ja Alison Willoughby töödest

Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

Index Scriptorium Estoniae

Häniläne,, pseud.

2008-01-01

Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)

Maailma farmaatsiatööstus saab Tartust topeltkiirenduse / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2004-01-01

Tänavu sügisel valmib Tartu Ülikoolis Euroopa Liidu rahastatud molekulaardisaini süsteem, mis kahandab uute ravimite väljatöötamise kestust maailmas seniselt 15 aastalt 7-8 aastani. Lisad: Mis on molekulaardisain?, Mis on grid? Vt. ka Postimehes pealk. all: Tartu Ülikool aitab ravimitootjaid

Uus mõtlemine algab koolipingist / David White ; interv. Nils Niitra

Index Scriptorium Estoniae

White, David

2006-01-01

Ilmunud ka: Postimees 2. okt. lk. 5. Euroopa Komisjoni tööstuse peadirektoraadi innovatsioonipoliitika direktor käis Tartus Euroopa tehnoloogiasiirde IRC võrgustiku aastakonverentsil ja vastas küsimustele innovatsiooni kohta Euroopas, USA-s ja Eestis

Automatic detection of NIL defects using microscopy and image processing

KAUST Repository

Pietroy, David; Gereige, Issam; Gourgon, Cé cile

2013-01-01

patterns, sticking. In this paper, microscopic imaging combined to a specific processing algorithm is used to detect numerically defects in printed patterns. Results obtained for 1D and 2D imprinted gratings with different microscopic image magnifications

Kõrgeimad tipud on kättesaadavad vaid valituile / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2006-01-01

Tartu linnavalitsuse planeeringuteenistuse ja volikogu arengu- ja planeerimiskomisjoni erinevast suhtumisest ehitusfirmade Linnaehitus ja Lion House ehitusplaanidesse püstitada kõrghooneid. Vt. samas: Jüri Saare intervjuud endise abilinnapea Kaarel Sahaga: Tigutorn lisandub mitmete õigusvastaste ehitiste ritta; Jüri Saar. Linnavolinikud toimuvaga rahul

Vanausulised vahetavad võrgud sae ja haamri vastu / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2006-01-01

Kallaste Kaluri juhi Fjodor Pleshankovi sõnul võib praegune kalanduspoliitika tuua ausate kalandusfirmade krahhi, sest kalurid lahkuvad ehitustöödele, mis on tulusam. Põllumajandusministeeriumi ametnike arvamusi

Tartumaa väledad gasellfirmad on Eesti tipus / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2006-01-01

Tartumaa ettevõtetest OÜ-st Viljavedaja, AS-ist EBÖ Eesti, OÜ-st Total Eesti ja OÜ-st Soone Farm, kes kuuluvad ajalehe Äripäev gasellide TOPi esiviisikusse. Lisa: Gaselli TOP. Soovitusi jagavad Tartu Teaduspargi esimees Toomas Noorem, OÜ Viljavedaja asutaja Rainer Puhk ja Nõo valla Soone farmi omanik Andres Tamm

Rotaryst lahkunud Valev Platot ümbritsevad segased rahaasjad / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2004-01-01

Endine kaitseministri nõunik Valev Plato lahkus Rotary klubi liikmete ridadest. 2003. aastal kõrvaldati ta Tartu Ülikooli Kääriku spordibaasi direktori ametikohalt segaduste tõttu rahaasjades. Tartu Rotary klubi presidendi Andrus Ansipi arvamus Plato klubist lahkumise kohta

Kvoodiäri remondib riigi dividendilehma kaunimaid maju / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2011-01-01

CO₂ kvoodirahaga hoonete energiasäästvaks muutmise objektide valik: raha saavad RMK kontorid. Kirikud jäid rahata. Valikutingimused: CO₂ sääst, kasusaajate arv, regionaalsed piirsummad, järjekord

Eesti Energia ehtis end võõraste kuresulgedega / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2007-01-01

Lõuna-Eesti traadita internetituru liider Kernel on üllatunud, et Eesti Energia tütarfirma Televõrk traadita internetivõrk Kõu kasutas reklaamiks nende kurepilti. Lisa: Eilseks kadunud kurejutt. Ilmunud ka: Postimees, 20. juuni 2007, lk. 4

Efferent projections of the ectostriatum in the pigeon (Columba livia)

Science.gov (United States)

Husband, S. A.; Shimizu, T.

1999-01-01

The ectostriatum is a major visual component of the avian telencephalon. The core region of the ectostriatum (Ec) receives visual input from the optic tectum through thalamic nuclei. In the present study, the efferent projections of the ectostriatum were investigated by using the anterograde tracers Phaseolus vulgaris leucoagglutinin and biotinylated dextran amine. Projection patterns resulting from these tracers were confirmed by the retrograde tracer cholera toxin subunit B. When anterograde tracers were injected in Ec, primary projections were seen traveling dorsolaterally to the belt region of the ectostriatum (Ep) and the neostriatal area immediately surrounding Ep (Ep2). Neurons in Ep sent projections primarily to the overlying Ep2. The efferents of Ep2 traveled dorsolaterally to terminate in three telencephalic regions, from anterior to posterior: (1) neostriatum frontale, pars lateralis (NFL), (2) area temporo-parieto-occipitalis (TPO), and (3) neostriatum intermedium, pars lateralis (NIL). A part of the archistriatum intermedium and the lateral part of the neostriatum caudale also received somewhat minor projections. In addition, some neurons in Ec were also the source of direct, but minor, projections to the NFL, TPO, NIL, and archistriatum intermedium. The topographical relationship among the primary (Ec), secondary (Ep and Ep2), and tertiary (NFL, TPO, NIL) areas indicate that the neural populations for visual processing are organized along the rostral-caudal axis. Thus, the anterior Ec sent efferents to the anterior Ep, which in turn sent projections to anterior Ep2. Neurons in the anterior Ep2 sent projections to NFL and the anterior TPO. Similarly, the intermediate and posterior Ec sent projections to corresponding parts of Ep, whose efferents projected to intermediate and posterior Ep2, respectively. The intermediate Ep2 gave rise to major projections to TPO, whereas posterior Ep2 neurons sent efferents primarily to NIL. The organization of this

Incorporation du coprah et des cuticules de cacao et d'arachide ...

African Journals Online (AJOL)

Incorporation du coprah et des cuticules de cacao et d'arachide dans l'aliment du ( tilapia du nil( ( Oreohromis niloticus , linné, 1758) eleve en etang : Effet sur la croissance et la composition biochimique.

Enefit gaining Latvian customers

Index Scriptorium Estoniae

2011-01-01

3. märtsil toimunud Riia linnapea Nils Usakovsi ja Enefiti esindajate kohtumisel räägiti firma tariifidest, mida nad võiks munitsipaalettevõtetele ja -organisatsioonidele pakkuda. Latvenergo tõstab hindu 1. aprillil

New Era stands against Muiznieks / Aaron Eglitis

Index Scriptorium Estoniae

Eglitis, Aaron

2005-01-01

Läti juhtiv parempartei Uus Aeg ning rahvuslikud Isamaa Eest ja Vabadus ei toeta koalitsiooni kuuluva Läti Esimese Partei liikme Nils Muiznieksi kandidatuuri inimõiguste osakonna juhiks kuna viimane olevat ebakompetentne ja eelarvamustega

A Study of Kaduna Polytechnic, Kaduna

African Journals Online (AJOL)

2018-01-30

Jan 30, 2018 ... higher institution in Nigeria, the reasons for its use and related eye ... higher institution, reasons .... management of Kaduna Polytechnic. .... Financial support and sponsorship. Nil. ... Norwalk, CT: Appleton and Lange; 1996. p.

Generation of metallic arc spectrum of pumping discharge of XeCl laser; XeCl ekishima laser reiki hoden ni okeru arc iko to kinzoku supekutoru no hassei

Energy Technology Data Exchange (ETDEWEB)

Koike, H.; Yukimura, K. [Doshisha University, Kyoto (Japan)

1997-12-20

An arc generation of a long-pulse spiker-sustainer excimer laser with about 250ns of pulse width , is discussed by using time-varying spectroscopic method. First arcing occurs during a main discharge for laser excitation and shows XeII spectrum, while a glow-like discharge represents only XeI spectrum, the metallic spectrum such as Nil caused by vaporization of electrode material begins to appear just after the termination of the main discharge. Second arcing occurs after about 2{mu}s, which brings strong intensity of Nil spectrum. It means that the reignition arc might be produced in a metallic vapor that appears during the main discharge. Accordingly, it is concluded that the reignition arc is inherently metallic, which is different from the main arc with rare gas plasma. 9 refs., 9 figs.

Nanoimprinted backside reflectors for a-Si:H thin-film solar cells: critical role of absorber front textures.

Science.gov (United States)

Tsao, Yao-Chung; Fisker, Christian; Pedersen, Thomas Garm

2014-05-05

The development of optimal backside reflectors (BSRs) is crucial for future low cost and high efficiency silicon (Si) thin-film solar cells. In this work, nanostructured polymer substrates with aluminum coatings intended as BSRs were produced by positive and negative nanoimprint lithography (NIL) techniques, and hydrogenated amorphous silicon (a-Si:H) was deposited hereon as absorbing layers. The relationship between optical properties and geometry of front textures was studied by combining experimental reflectance spectra and theoretical simulations. It was found that a significant height variation on front textures plays a critical role for light-trapping enhancement in solar cell applications. As a part of sample preparation, a transfer NIL process was developed to overcome the problem of low heat deflection temperature of polymer substrates during solar cell fabrication.

High-resolution imprint and soft lithography for patterning self-assembling systems

NARCIS (Netherlands)

Duan, X.

2010-01-01

This thesis contributes to the continuous development of patterning strategies in several different areas of unconventional nanofabrication. A series of soft lithography approaches (microcontact printing, nanomolding in capillaries), nanoimprint lithography (NIL), and capillary force lithography

Complete, infected, chronic, nonpuerperal uterine inversion: A case ...

African Journals Online (AJOL)

(district) hospital with a diagnosis of utero-vaginal prolapse for further management. She presented with .... reported with no association with tumor as was seen in this case.[2] Although ... management. Financial support and sponsorship. Nil.

Lattelecom "deal of century" on verge of annulment

Index Scriptorium Estoniae

2007-01-01

Läti majandusministri kohusetäitja Gaidis Berzins teatas Lattelecomi juhatuse esimehele Nils Melngailisele, et tema töölepingut ei pikendata. Asjaolu pidurdab Lattelecomi erastamist investeerimisfirmale Blackstone Group ja Lattelecomi töötajatele

Large Vesico‑Vaginal Fistula Caused by a Foreign Body

African Journals Online (AJOL)

Introduction. Vesico‑vaginal fistula is commonly caused by obstructed labor, gynecological surgery ... of a foreign body in the vagina have been reported mostly in developed countries. .... Source of Support: Nil. Conflict of Interest: None declared.

Download this PDF file

African Journals Online (AJOL)

SERVER

2007-07-18

Jul 18, 2007 ... The near isogenic lines (NILs) of non-susceptible to DNV-Z were bred through backcrossing .... bor nsd-Z and had been selected to generation next generation were ... 30400327), High Technology Research Program of.

Evaluation of Chemical Properties in Wells in Ghana (A Case Study ...

African Journals Online (AJOL)

ADOWIE PERE

blue-baby” ... None of the samples had nil value of nitrates and nitrites. ... drinking water should therefore be the effective management and operation of water ..... determine whether the water supply chain (from ... Pathogens in the United States.

A Rare Case of Zosteriform Cutaneous Metastases from Squamous ...

African Journals Online (AJOL)

2013-04-23

unknown; however, proposed theories include lymphatic ... [Downloaded free from http://www.amhsr.org on Tuesday, April 23, 2013, IP: 41.132.185.55] || Click here to download free Android application for this journal ... Source of Support: Nil.

Use of Otoscope as a Diagnostic and Therapeutic Aid in Umbilical ...

African Journals Online (AJOL)

DISCUSSION. Umbilical pilonidal sinus is a rare entity as compared ... The theory of the acquired origin of umbilical pilonidal sinus was ... knowledge, this is the first study reporting the use of otoscope ... Financial support and sponsorship. Nil.

Reval Hotel Lietuva Vilniuses : Konstitucijos pr. 20 / Piret Lindpere

Index Scriptorium Estoniae

Lindpere, Piret, 1963-

2004-01-01

Vilniuse hotelli "Lietuva" renoveerimine. Arhitektuurse projekti koostaja Rootsi arhitektuuribüroo AB SWECO (arhitektid Aare Saks, Nils Palm. Sisekujundus: Vaikla Disain AS (Katrin ja Argo Vaikla, Liis Lindvere, Peeter Loo). Kommenteerivad Argo ja Katrin Vaikla. 3 ill

Viis sepapoissi näitavad raua tulist ilu / Tanel Veenre

Index Scriptorium Estoniae

Veenre, Tanel, 1977-

2010-01-01

Eesti Kunstiakadeemia sepakunsti eriala tudengite Nils Hindi, Hans-Otto Ojaste, Urmas Lüüsi, Fred Truusi ja Jan Västeri näitus "Ferri canes" Dominiiklaste kloostri Mauritiuse Instituudis (Tallinn, Müürivahe 33) 30. juunini 2010

CACTA-superfamily transposable element is inserted in MYB transcription factor gene of soybean line producing variegated seeds.

Science.gov (United States)

Yan, Fan; Di, Shaokang; Takahashi, Ryoji

2015-08-01

The R gene of soybean, presumably encoding a MYB transcription factor, controls seed coat color. The gene consists of multiple alleles, R (black), r-m (black spots and (or) concentric streaks on brown seed), and r (brown seed). This study was conducted to determine the structure of the MYB transcription factor gene in a near-isogenic line (NIL) having r-m allele. PCR amplification of a fragment of the candidate gene Glyma.09G235100 generated a fragment of about 1 kb in the soybean cultivar Clark, whereas a fragment of about 14 kb in addition to fragments of 1 and 1.4 kb were produced in L72-2040, a Clark 63 NIL with the r-m allele. Clark 63 is a NIL of Clark with the rxp and Rps1 alleles. A DNA fragment of 13 060 bp was inserted in the intron of Glyma.09G235100 in L72-2040. The fragment had the CACTA motif at both ends, imperfect terminal inverted repeats (TIR), inverse repetition of short sequence motifs close to the 5' and 3' ends, and a duplication of three nucleotides at the site of integration, indicating that it belongs to a CACTA-superfamily transposable element. We designated the element as Tgm11. Overall nucleotide sequence, motifs of TIR, and subterminal repeats were similar to those of Tgm1 and Tgs1, suggesting that these elements comprise a family.

Interfacial pattern changes of imprinted multilayered material in milli- and microscales

Science.gov (United States)

Yonekura, Kazuhiro; Tokumaru, Kazuki; Tsumori, Fujio

2018-06-01

Nanoimprint lithography (NIL) is a technique that transfers a mold pattern of nanometer order to the surface of a resist material by heating and pressing. NIL is an excellent technology in terms of high productivity, accuracy, and resolution. Recently, NIL has been applied to the processing of different multilayered materials, in which it is possible to process multiple materials simultaneously. In this processing of multilayered materials, it is possible to form an interfacial pattern between the upper layer and the lower layer simultaneously with patterning on the mold surface. This interface pattern can be controlled by the deformation characteristics, initial thickness, and so forth. In this research, we compared the interfacial pattern changes of imprinted multilayered materials in milli- and microscales. For multilayered imprint using multiple materials, it is important to know the flow of the resist and its dependence on the scale. If there is similarity in the relationship produced by the scale on the imprinted samples, a process design with a number of feedbacks could be realized. It also becomes easier to treat structures in the millimeter scale for the experiment. In this study, we employed micropowder imprint (µPI) for multilayered material imprint. A compound sheet of alumina powder and polymer binder was used for imprint. Two similar experiments in different scales, micro- and millimeter scales, were carried out. Results indicate that the interfacial patterns of micro- and millimeter-scale-imprinted samples are similar.

High-resolution analysis of a QTL for resistance to Stagonospora nodorum glume blotch in wheat reveals presence of two distinct resistance loci in the target interval.

Science.gov (United States)

Shatalina, Margarita; Messmer, Monika; Feuillet, Catherine; Mascher, Fabio; Paux, Etienne; Choulet, Frédéric; Wicker, Thomas; Keller, Beat

2014-03-01

Stagonospora nodorum glume blotch (SNG), caused by the necrotrophic fungus Stagonospora nodorum, is one of the economically important diseases of bread wheat (Triticum aestivum L.). Resistance to SNG is known to be quantitative and previous studies of a recombinant inbred line (RIL) population identified a major quantitative trait locus (QTL) for resistance to SNG on the short arm of chromosome 3B. To localize this QTL (QSng.sfr-3BS) with high resolution, we constructed a genetic map for the QTL target region using information from sequenced flow-sorted chromosomes 3B of the two parental cultivars 'Arina' and 'Forno', the physical map of chromosome 3B of cultivar 'Chinese Spring' and BAC-clone sequences. The mapping population of near-isogenic lines (NIL) was evaluated for SNG resistance in field infection tests. NILs segregated for disease resistance as well as for plant height; additionally, we observed a high environmental influence on the trait. Our analysis detected a strong negative correlation of SNG resistance and plant height. Further analysis of the target region identified two linked loci associated with SNG resistance. One of them was also associated with plant height, revealing an effect of QSng.sfr-3BS on plant height that was hidden in the RIL population. This result demonstrates an unexpectedly high genetic complexity of resistance controlled by QSng.sfr-3BS and shows the importance of the study of QTL in mendelized form in NILs.

Reference intervals for serum cystatin C and creatinine of an ...

African Journals Online (AJOL)

2014-09-25

Sep 25, 2014 ... Some studies suggest that GFR estimated from serum cystatin C (Cys C) is more accurate than ... Current clinical practice guidelines[1,2] recommend the use of ..... Source of Support: Nil, Conflict of Interest: None declared.

Utilization of Teeth Replacement Service Among the Elderly ...

African Journals Online (AJOL)

hanumantp

Dentistry, College of Medicine, University of Lagos, Lagos, Nigeria. Abstract ... needs, among geriatric patient in a tertiary hospital in Nigeria ..... Ann. Med Health Sci Res 2014;4:57-60. Source of Support: Nil. Conflict of Interest: None declared.

Awareness and knowledge of mother-to-child transmission of HIV ...

African Journals Online (AJOL)

2010-02-08

Feb 8, 2010 ... Ninety-one percent of mothers were aware of mother-to-child transmission of HIV. Transplacental ... The pandemic is having a serious effect on the reproductive ..... Source of Support: Nil, Con.ict of Interest: None declared.

The range of abdominal surgical emergencies in children older than ...

African Journals Online (AJOL)

2010-02-08

Feb 8, 2010 ... survey of all children older than 1 year undergoing an emergency abdominal surgery was carried out. ..... that affect the small bowel leading to perforations are ..... Source of Support: Nil, Con.ict of Interest: None declared.

Post‑Operative Complications and Visual Outcome in Eye Camp ...

African Journals Online (AJOL)

Background: Cataract is the principal cause of blindness in India, accounting for 62.6%. This problem can be .... base hospital, 413 patients met the inclusion criteria and were enrolled in ..... Financial support and sponsorship. Nil. Conflicts of ...

Journal of Chemical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

coordinated distorted octahedral environments, and the isophthalato ligand bridges two Ni(II) centres in a bis bidentate fashion to form dimers in all three complexes. The monomers of {[Ni(-L)]2(-IPA)}2+ are connected through intermolecular ...

Fine mapping of a quantitative resistance gene for gray leaf spot of maize (Zea mays L.) derived from teosinte (Z. mays ssp. parviglumis).

Science.gov (United States)

Zhang, Xinye; Yang, Qin; Rucker, Elizabeth; Thomason, Wade; Balint-Kurti, Peter

2017-06-01

In this study we mapped the QTL Qgls8 for gray leaf spot (GLS) resistance in maize to a ~130 kb region on chromosome 8 including five predicted genes. In previous work, using near isogenic line (NIL) populations in which segments of the teosinte (Zea mays ssp. parviglumis) genome had been introgressed into the background of the maize line B73, we had identified a QTL on chromosome 8, here called Qgls8, for gray leaf spot (GLS) resistance. We identified alternate teosinte alleles at this QTL, one conferring increased GLS resistance and one increased susceptibility relative to the B73 allele. Using segregating populations derived from NIL parents carrying these contrasting alleles, we were able to delimit the QTL region to a ~130 kb (based on the B73 genome) which encompassed five predicted genes.

Integrating anti-reflection and superhydrophobicity of moth-eye-like surface morphology on a large-area flexible substrate

International Nuclear Information System (INIS)

Liu, Chia-Hsing; Niu, Pei-Lun; Sung, Cheng-Kuo

2014-01-01

This paper proposes an ultraviolet nanoimprint lithography (UV-NIL) roll-to-roll (R2R) process with argon and oxygen (Ar–O 2 ) plasma ashing and coating of a dilute perfluorodecyltrichlorosilane (FDTS) layer to fabricate the large-area moth-eye-like surface morphology on a polyethylene terephthalate substrate. By using Maxwell-Garnett's effective medium theory, the optimal dimensions of the moth-eye-like surface morphology was designed and fabricated with UV-NIL R2R process to obtain maximum transmittance ratio. In addition, the base angle (θ = 30.1°) of the moth-eye-like surface morphology was modified with Ar–O 2 plasma ashing and coated with a dilute FDTS layer to possess both superhydrophobic and air-retention properties. This increases both the transmittance ratio of 4% and contact angle to 153°. (paper)

Mueller matrix ellipsometric detection of profile asymmetry in nanoimprinted grating structures

Energy Technology Data Exchange (ETDEWEB)

Chen, Xiuguo; Ma, Zhichao; Xu, Zhimou [Wuhan National Laboratory for Optoelectronics, Huazhong University of Science and Technology, Wuhan 430074 (China); Zhang, Chuanwei; Jiang, Hao [State Key Laboratory of Digital Manufacturing Equipment and Technology, Huazhong University of Science and Technology, Wuhan 430074 (China); Liu, Shiyuan, E-mail: shyliu@mail.hust.edu.cn [Wuhan National Laboratory for Optoelectronics, Huazhong University of Science and Technology, Wuhan 430074 (China); State Key Laboratory of Digital Manufacturing Equipment and Technology, Huazhong University of Science and Technology, Wuhan 430074 (China)

2014-11-21

Mueller matrix ellipsometry (MME) is applied to detect foot-like asymmetry encountered in nanoimprint lithography (NIL) processes. We present both theoretical and experimental results which show that MME has good sensitivity to both the magnitude and direction of asymmetric profiles. The physics behind the use of MME for asymmetry detection is the breaking of electromagnetic reciprocity theorem for the zeroth-order diffraction of asymmetric gratings. We demonstrate that accurate characterization of asymmetric nanoimprinted gratings can be achieved by performing MME measurements in a conical mounting with the plane of incidence parallel to grating lines and meanwhile incorporating depolarization effects into the optical model. The comparison of MME-extracted asymmetric profile with the measurement by cross-sectional scanning electron microscopy also reveals the strong potential of this technique for in-line monitoring NIL processes, where symmetric structures are desired.

Carsten Niebuhr and James Bruce

DEFF Research Database (Denmark)

Friis, Ib

2013-01-01

In 1791 Carsten Niebuhr published a review of the first two volumes of Bruce’s Reisen zur Entdeckung der Quellen des Nils (1790). Niebuhr’s strongest criticism of Bruce was that he seemed to have plagiarized some of Niebuhr’s astronomical observations (“adopted them without examination”) and that......In 1791 Carsten Niebuhr published a review of the first two volumes of Bruce’s Reisen zur Entdeckung der Quellen des Nils (1790). Niebuhr’s strongest criticism of Bruce was that he seemed to have plagiarized some of Niebuhr’s astronomical observations (“adopted them without examination...... as written by Bruce in 1770 at Gondar, Abyssinia, contains information about latitudes identical with some of Niebuhr’s observations which were unpublished in 1770; possible explanations for this are proposed. In summary, it seems that Niebuhr is right; it is almost certain that Bruce plagiarized some...

Documentation to the workshop 'Cluster in the environmental protection economy'; Dokumentation zum Workshop ''Cluster in der Umweltschutzwirtschaft''

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-12-11

Within the workshop 'Cluster in the environmental protection economy' at the Umweltbundesamt (Dessau-Rosslau, Federal Republic of Germany) at 27th November, 2008, the following lectures were held: (a) Which contribution can cluster and cluster politics contribute to the promotion of the environmental protection economy? (Harald Legler); (b) Cluster in the environmental protection economy: Targets and expectations (Dieter Rehfeld); (c) Demands at the management of clusters (Karin Hoerhan); (d) Demands at the cluster politics in the environmental protection economy (Bernhard Hausberg); (e) Photovoltaics in Eastern Germany (Johann Wackenbauer); (f) Automotive industry in Bergisches Land (Thomas Lemken); (g) Competence centre environment Augsburg-Schwaben (Egon Beckord).

Haapsalu Piiskopilinnuse uuendamine / Lilian Hansar

Index Scriptorium Estoniae

Hansar, Lilian, 1949-

2015-01-01

Sihtasutus Haapsalu ja Läänemaa Muuseumid koostöös Eesti Arhitektide Liiduga korraldasid arhitektuurivõistluse, et valida välja parim arhitektuurne ja kasutusfunktsioonile sobiv lahendus Haapsalu piiskopilinnuse pealinnuse rekonstrueerimiseks kaasaegseks muuseumikompleksiks. Esimese koha sai töö märgusõnaga "Salaaed" (Margit Aule, Margit Argus, Siim Karro ja Mart Kadarik arhitektuuribüroost KAOS Arhitektid). Teise koha sai töö märgusõnaga "Helevalge" (Mari Hunt, Kalle Komissorov, Silver Liiberg, Kadri Klementi, Aet Ader ja Karin Tõugu arhitektuuribüroost b210). Kolmanda koha sai töö märgusõnaga "Ristvõlv" (Indrek Laos ja Andreas Kivi arhitektuuribüroost Flux projekt)

Die aantrekkingskrag van die see

Directory of Open Access Journals (Sweden)

I. Gertenbach

2008-07-01

This article compares the use of oceanic symbolism in the poetry of Karin Boye, Ingrid Jonker and Sylvia Plath. Freud’s “oceanic feeling” is described and contrasted with Jung’s theory of the “great mother”. According to Jung, the “great mother” is the unconscious which is represented by water. All these elements are discussed in the poems and compared to each other in order to gain a better understanding of the poetry. Although “death” (drowning in the ocean appears to point to new life, it ends in unification with the archetypal mother. This liberates the poets symbolically, but not physically.

On Education and Politics / Karlis Streips

Index Scriptorium Estoniae

Streips, Karlis

2011-01-01

5. septembril ilmunud ajalehes Diena kontrolliti Läti poliitikute teadmisi. Küsimustele vastasid Valdis Zatlers, Solvita Aboltina, Nils Usakovs, Raimonds Vejonis, Ainars Slesers ja Gaidis Berzins. Keskharidusega Ainars Slesersi vastustest. Autor leiab, et keskharidusega inimene ei tohiks parlamendis olla

Arvustused / Aleks Lange

Index Scriptorium Estoniae

Lange, Aleks

2000-01-01

Uute heliplaatide Nils Petter Molvaer "Solid Ether", Leona Naess "Comatised", Naivity in Black II "A Tribute to Black Sabbath", Papa Roach "Infest", A Perfect Circle "Mer de Noms", Queens of the Stone Age "Rated R", "Road Trip" (soundtrack) tutvustused

Unraveling possible association between quantitative trait loci (QTL ...

African Journals Online (AJOL)

fire7-

2016-10-05

Oct 5, 2016 ... The genes for host basal resistance seem to play similar roles in basal .... purpose DNA of each QTL-NILs was isolated following the CTAB isolation method ..... never sleep: non-host resistance in plants. J. Plant Physiol.

Browse Title Index

African Journals Online (AJOL)

Items 401 - 450 of 516 ... ... gain from tree breeding strategies : risks and benefits : creating new germplasm, Abstract ... C Brand Wessels, Nils-Olaf Petersen ... of sap flow in two Eucalyptus species established in the vicinity of gold-mine tailings ...

A Survey of the Awareness of Prostate Cancer and its Screening ...

African Journals Online (AJOL)

blacks and mixed race men compared to men of European or of Asian descent.[3] ... and the United States Preventive Service Task Force[4] did not recommend ..... Source of Support: Nil, Conflicts of Interest: None declared. [Downloaded free ...

Sub-littoral meiobenthos of the northeastern Bay of Bengal

Digital Repository Service at National Institute of Oceanography (India)

Rodrigues, C.L.; Harkantra, S.N.; Parulekar, A.H.

Of the 11 taxonomic groups represented, Nematoda followed by foraminifera and harpacticoida were dominant Meiofaunal abundance was more related to the texture of the sediment than variation in depth Population density varied from nil to 534.65 x 10...

Plaadid / Lauri Sommer

Index Scriptorium Estoniae

Sommer, Lauri, 1973-

2002-01-01

Uutest plaatidest Shannon Lawson "Chase The Sun", Queens of the Stone Age "Songs For The Deaf, "Soundtrack. Pulp Fiction", John Adams "Naive and Sentimental Music", paul Weller "Illumination", Avril Lavigne "Let Go", Pasadena "Vastu taevast", nils Landgren "sentimental Journey"

Histopathological Profile of Breast Cancer in an African Population

African Journals Online (AJOL)

Presently in the United States alone, it was estimated that one in every eight and one in ... female cancer globally with a significant geographic, racial and ethnical variations in its incidence. ..... of Support: Nil. Conflict of Interest: None declared.

Some ecological and biochemical observations on Caloglossa lepreiurii (Harvey) from Zuri estuary, Goa

Digital Repository Service at National Institute of Oceanography (India)

Jagtap, T.G.; Untawale, A.G.

January and February to nil. The alga prefers diffused light, fairly high temperatures, high nutrients and optimum salinity ranging between 10 ppt to 20 ppt. Major metabolites showed 272.75 mg/g dry weight was recorded in September. Organic carbon ranged...

Bringing Culture Back In

DEFF Research Database (Denmark)

A number of international political scientists, economists, philosophers, and humanist scholars address the role of culture, ethnicity, and religion in contemporary states and societies. Contributions by Jørn Borup, Michael Böss, Marianne Qvortrup Fibiger, Antje Gimmler, Nils Holtug, John...

Ethiopian Journal of Environmental Studies & Management 7(2 ...

African Journals Online (AJOL)

Osondu

2013-11-01

Nov 1, 2013 ... the positioning of the sampled sites of water levels for both dry and rainy events. One grid ... Nigeria; Of which total rainfall, percentage of forest and .... where soil moisture in May is almost nil after ..... Chemical and isotopic.

A Clinicomycological Study of Cutaneous Mycoses in Sawai Man ...

African Journals Online (AJOL)

2014-01-10

[Downloaded free from http://www.amhsr.org on Friday, January 10, 2014, IP: 197.87.13.14] || Click here to download free Android application for this ..... mechanism of action are unknown, by some of the respondents .... Source of Support: Nil.

Comparison of 25 and 50 microgram of misoprostol for induction of ...

African Journals Online (AJOL)

2014-09-03

Sep 3, 2014 ... ... on Friday, February 20, 2015, IP: 41.135.175.148] || Click here to download free Android application for this journal ... action is unknown.[5] At present, there is no ..... Source of Support: Nil, Conflict of Interest: None declared.

Malaria has no effect on birth weight in Rwanda

NARCIS (Netherlands)

Rulisa, S.; Mens, P.F.; Karema, C.; Schallig, H.D.F.H.; Kaligirwa, N.; Vyankandondera, J.; de Vries, P.J.

2009-01-01

Background: Malaria has a negative effect on pregnancy outcome, causing low birth weight, premature birth and stillbirths, particularly in areas with high malaria transmission. In Rwanda, malaria transmission intensity ranges from high to nil, probably associated with variable altitudes. Overall,

Malaria has no effect on birth weight in Rwanda

NARCIS (Netherlands)

Rulisa, Stephen; Mens, Pètra F.; Karema, Corine; Schallig, Henk D. F. H.; Kaligirwa, Nadine; Vyankandondera, Joseph; de Vries, Peter J.

2009-01-01

Malaria has a negative effect on pregnancy outcome, causing low birth weight, premature birth and stillbirths, particularly in areas with high malaria transmission. In Rwanda, malaria transmission intensity ranges from high to nil, probably associated with variable altitudes. Overall, the incidence

Ultrasound guided percutaneous fine needle aspiration biopsy ...

African Journals Online (AJOL)

2011-06-15

Jun 15, 2011 ... guided PFNAB/US-guided PNCB was the diagnostic test in 23.33% cases. It confirmed a highly ..... provides guidance in multiple axial, longitudinal and .... Source of Support: Nil, Con.ict of Interest: None declared. Gani, et al.

Mehed ilumaailmast / Krista Dudarenko

Index Scriptorium Estoniae

Dudarenko, Krista, 1970-

2007-01-01

Vestlusringis osalevad Lumene Eesti OÜ tegevdirektor Indrek Lepik, ASi Pariisi Vesi omanik ja juht Nils Niimann, L'Oreali massikosmeetika müügijuht Ivo Rundans, Riviera Internationali juht Antoine Stecken, Sirowa Grupi direktor Juergen Warzecha ning omanimelise kosmeetikafirma omanik Heino Puuste

Viking Line visandab oma laevadele purjeid / Sirje Rank

Index Scriptorium Estoniae

Rank, Sirje, 1966-

2008-01-01

Viking Line'i juht Nils-Erik Eklund leiab, et Tallinki uued laevad on pigem probleem kui konkurentsieelis, sest uue põlvkonna reisilaevad peaks liikuma osaliselt tuule- ja päikeseenergia jõul. Vt. samas: Tallinna-Helsingi liinil on tasakaal lähedal

Enhanced Recovery After Surgery: It's Time to Change Practice

NARCIS (Netherlands)

Steenhagen, E

Perioperative surgical care is undergoing a paradigm shift. Traditional practices such as prolonged preoperative fasting (nil by mouth from midnight), bowel cleaning, and reintroduction of oral nutrition 3-5 days after surgery are being shunned. These and other similar changes have been formulated

Riia trammid-trollid võivad varsti sõita Eesti elektriga. Lätis elekter kallines / Anne Oja ; kommenteerinud Davis Skulte

Index Scriptorium Estoniae

Oja, Anne, 1970-

2011-01-01

Latvenergo tõstab firmadele müüdava elektri tariife 50% võrra. Riia linnapea Nil Ušakov teatas, et Riia munitsipaalettevõtted võivad hakata elektrienergiat ostma Eesti Energia tütarfirmalt Enefit. Mitu ettevõtet on juba Enefiti kasuks otsustanud

Supramolecular Layer-by-Layer Assembly of 3D Multicomponent Nanostructures via Multivalent Molecular Recognition

NARCIS (Netherlands)

Ling, X.Y.; Phang, In Yee; Reinhoudt, David; Vancso, Gyula J.; Huskens, Jurriaan

2008-01-01

The supramolecular layer-by-layer assembly of 3D multicomponent nanostructures of nanoparticles is demonstrated. Nanoimprint lithography (NIL) was used as the patterning tool for making patterned β-cyclodextrin (CD) self-assembled monolayers (SAMs) and for the confinement of nanoparticles on the

Pathologic findings and liver elements in hibernating bats with white-nose syndrome.

Science.gov (United States)

Courtin, F; Stone, W B; Risatti, G; Gilbert, K; Van Kruiningen, H J

2010-03-01

Two groups of vespertilionid bats were collected from affected hibernacula. In group 1 (n, 14; pathology and microbiology), the average body weights of all species were at the lower limit of published ranges. Twelve bats (86%) had mycotic growth in the epidermis, hair follicles, and sebaceous glands. Geomyces destructans, with its characteristic curved conidia, was observed microscopically, cultured, and confirmed by polymerase chain reaction. Dermatitis and mural folliculitis was nil to mild. When focally coinfected with Gram-negative bacteria, there was necrosis and pustules. Fat stores were little to abundant in 12 bats (86%) and nil in 2. Thirteen bats (93%) had pulmonary congestion and 7 (50%) had bone marrow granulocytosis. In group 2 (n, 24; liver elements), 3 bats (13%) had potentially toxic lead levels and 1 (4%), potentially toxic arsenic level. There was no evidence of major organ failure or consistent element toxicity.

Planar self-aligned imprint lithography for coplanar plasmonic nanostructures fabrication

KAUST Repository

Wan, Weiwei

2014-03-01

Nanoimprint lithography (NIL) is a cost-efficient nanopatterning technology because of its promising advantages of high throughput and high resolution. However, accurate multilevel overlay capability of NIL required for integrated circuit manufacturing remains a challenge due to the high cost of achieving mechanical alignment precision. Although self-aligned imprint lithography was developed to avoid the need of alignment for the vertical layered structures, it has limited usage in the manufacture of the coplanar structures, such as integrated plasmonic devices. In this paper, we develop a new process of planar self-alignment imprint lithography (P-SAIL) to fabricate the metallic and dielectric structures on the same plane. P-SAIL transfers the multilevel imprint processes to a single-imprint process which offers higher efficiency and less cost than existing manufacturing methods. Such concept is demonstrated in an example of fabricating planar plasmonic structures consisting of different materials. © 2014 Springer-Verlag Berlin Heidelberg.

OCA-P, a deterministic and probabilistic fracture-mechanics code for application to pressure vessels

International Nuclear Information System (INIS)

Cheverton, R.D.; Ball, D.G.

1984-05-01

The OCA-P code is a probabilistic fracture-mechanics code that was prepared specifically for evaluating the integrity of pressurized-water reactor vessels when subjected to overcooling-accident loading conditions. The code has two-dimensional- and some three-dimensional-flaw capability; it is based on linear-elastic fracture mechanics; and it can treat cladding as a discrete region. Both deterministic and probabilistic analyses can be performed. For the former analysis, it is possible to conduct a search for critical values of the fluence and the nil-ductility reference temperature corresponding to incipient initiation of the initial flaw. The probabilistic portion of OCA-P is based on Monte Carlo techniques, and simulated parameters include fluence, flaw depth, fracture toughness, nil-ductility reference temperature, and concentrations of copper, nickel, and phosphorous. Plotting capabilities include the construction of critical-crack-depth diagrams (deterministic analysis) and various histograms (probabilistic analysis)

Hydrogenation of CO ₂ in Water Using a Bis(diphosphine) Ni–H Complex

Energy Technology Data Exchange (ETDEWEB)

Burgess, Samantha A. [Catalysis; Kendall, Alexander J. [Department; Tyler, David R. [Department; Linehan, John C. [Catalysis; Appel, Aaron M. [Catalysis

2017-03-17

The water soluble Ni bis(diphosphine) complex [NiL2](BF4)2 (L = 1,2- bis(di(methoxypropyl)phosphino)ethane) and the corresponding hydride, [HNiL2]BF4, were synthesized and characterized. For HNiL2+, the hydricity was determined to be 23.2(3) kcal/mol in aqueous solution. Based on the hydricity of formate of 24.1 kcal/mol, the transfer of a hydride from HNiL2 + to CO2 to produce formate is favorable by 1 kcal/mol. Starting from either NiL2 2+ or HNiL2 + in water, catalytic hydrogenation of CO2 was observed with NaHCO3 (0.8 M) as the only additive. A maximum turnover frequency of 3.6(8) h–1 was observed at 80 °C and 51 atm of a 1:1 mixture of CO2 and H2.

Haiglavoodisse sattunud patsiendid küsivad internetti / Nils Niitra, Sandra Maasalu

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2006-01-01

Vt. ka Tartu Postimees 16. juuni, lk. 1 ; Postimees : na russkom jazõke 19. juuni, lk. 9. Pärnu haiglas saavad kõik patsiendid, kel tervis lubab, palatis sülearvutiga traadita internetti kasutada. Tartu ja Tallinna haiglates levib WiFi esialgu tagasihoidlikumalt - kui üldse, siis ainult osas ruumidest

Pakistanis käib võitlus islamiriigi nimel / Karin Volmer

Index Scriptorium Estoniae

Volmer, Karin

2007-01-01

Pakistani pealinna Islamabadi Punase mošee ümber kestva, vähemalt 16 ohvrit nõudnud vastasseisu taga on islamiäärmuslaste soov kangutada ametist Ameerika-meelne president Pervez Musharraf. Vt. samas: Sündmused; Pakistan: kaart

Ago Anderson pälvis Helmi Tohvelmani preemia / Karin Klaus

Index Scriptorium Estoniae

Klaus, Karin

2009-01-01

13. oktoobril anti Endla teatri näitlejale Ago Andersonile üle Helmi Tohvelmani auhind. Pidulik sündmus toimus Väätsa põhikoolis, Tohvelmani kodukohas. Anderson pälvis tunnustuse kui kerge kehakeelega näitleja

Mis toimub tudengiesinduste tagatoas pärast valimisi / Karin Pool

Index Scriptorium Estoniae

Pool, Karin

2008-01-01

Kohtumisest Tartu Ülikooli Üliõpilasesinduse teabespetsialisti Marju Himma, Tallinna Tehnikaülikooli üliõpilasesinduse juhatuse esimehe Oliver Kallase ja Tallinna Ülikooli üliõpilaskonna volikogu spiikri Rome Tikasega, kus arutati üliõpilasesinduste tegevust valimisjärgsel ajal

Arhitektuurimuuseum vaatab Aasiasse / Kim Sung Hong ; intervjueerinud Karin Hallas-Murula

Index Scriptorium Estoniae

Kim Sung Hong

2009-01-01

Näituse kuraatori Kim Sung Hongiga 21. aprillini Eesti Arhitektuurimuuseumis avatud Lõuna-Korea kaasaegse arhitektuuri näitusest "Megacity network" ("Megalinna võrgustik"), Korea arhitektuurist, arhitektidest, muinsuskaitsest ja avalikust ruumist. Näituse kujundas Hwang Doo Jin

Demokraatia mitu elu / Karin Dean, Märt Läänemets

Index Scriptorium Estoniae

Dean, Karin

2014-01-01

Demokraatiast ühiskonnas Aasia ja Ida-Euroopa riikide näitel. Tallinna Ülikooli Eesti Humanitaarinstituudi korraldatud rahvusvahelisest konverentsist "Demokraatia mitu elu: Euroopast Aasia ja Vaikse ookeani regioonini"

"Improvizz" toob Tartu Ülikooli aula lavale improvisatsiooniorkestri / Karin Palo

Index Scriptorium Estoniae

Palo, Karin

2005-01-01

Neljandast rahvusvahelisest improvisatsioonilise muusika festivalist "Improvizz" (festivali peakorraldajaks Aleksander Sünter). Kontserdid: "Opera Kit" 4. märtsil Tartu Sadamateatris, 5. märtsil Tartu Sadamateatris, 6. märtsil TÜ Ajaloomuuseumis, 6. märtsil "Ettearvamatu lõppkontsert" TÜ aulas

Kunstiakadeemia lõpetajad 2005 / Karin Paulus, Tanel Veenre, Tõnu Kaalep

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

Valik Eesti Kunstiakadeemia bakalaureusetöid: Elize Hiiobi "Nimeta ehe", Anton Kooviti uued kirjatüübid, Raili Ilmsalu kipsskulptuur "Eva", Aleksei Aljoshini "Futuristlik spordirõivas", Merle Kasoneni töö "Võimalused", Leena Lüteri draakon "Isiklik kaitsja", Ave Maseri miniatuurid "Teised", Kärt Põldmani "Punased kingad", Riho Tiiveli vetelpäästesüsteem, Ester Kannelmäe rõivakollektsioon "Ahistab", töö "Eesti rahvalaulud", Helena Vaidla mosaiik "Veesilm", Merike Estna kineetiline maal "Punamütsike: I am the Prettiest Girl in the World", Eilve Mangluse käeobjektid, Annike Oldre maal "Üksi", Eliisa Ehini töö "Närviimpulsside liikumine ajus", Veiko Vaine terrassitool "Miinimum"

Patterning techniques for next generation IC's

Science.gov (United States)

Balasinski, A.

2007-12-01

Reduction of linear critical dimensions (CDs) beyond 45 nm would require significant increase of the complexity of pattern definition process. In this work, we discuss the key successor methodology to the current optical lithography, the Double Patterning Technique (DPT). We compare the complexity of CAD solutions, fab equipment, and wafer processing with its competitors, such as the nanoimprint (NIL) and the extreme UV (EUV) techniques. We also look ahead to the market availability for the product families enabled using the novel patterning solutions. DPT is often recognized as the most viable next generation lithography as it utilizes the existing equipment and processes and is considered a stop-gap solution before the advanced NIL or EUV equipment is developed. Using design for manufacturability (DfM) rules, DPT can drive the k1 factor down to 0.13. However, it faces a variety of challenges, from new mask overlay strategies, to layout pattern split, novel OPC, increased CD tolerances, new etch techniques, as well as long processing time, all of which compromise its return on investment (RoI). In contrast, it can be claimed e.g., that the RoI is the highest for the NIL but this technology bears significant risk. For all novel patterning techniques, the key questions remain: when and how should they be introduced, what is their long-term potential, when should they be replaced, and by what successor technology. We summarize the unpublished results of several panel discussions on DPT at the recent SPIE/BACUS conferences.

Quantification of a cardiac biomarker in human serum using extraordinary optical transmission (EOT.

Directory of Open Access Journals (Sweden)

Tao Ding

Full Text Available Nanoimprinting lithography (NIL is a manufacturing process that can produce macroscale surface areas with nanoscale features. In this paper, this technique is used to solve three fundamental issues for the application of localized surface plasmonic resonance (LSPR in practical clinical measurements: assay sensitivity, chip-to-chip variance, and the ability to perform assays in human serum. Using NIL, arrays of 140 nm square features were fabricated on a sensing area of 1.5 mm x 1.5 mm with low cost. The high reproducibility of NIL allowed for the use of a one-chip, one-measurement approach with 12 individually manufactured surfaces with minimal chip-to-chip variations. To better approximate a real world setting, all chips were modified with a biocompatible, multi-component monolayer and inter-chip variability was assessed by measuring a bioanalyte standard (2.5-75 ng/ml in the presence of a complex biofluid, human serum. In this setting, nanoimprinted LSPR chips were able to provide sufficient characteristics for a 'low-tech' approach to laboratory-based bioanalyte measurement, including: 1 sufficient size to interface with a common laboratory light source and detector without the need for a microscope, 2 high sensitivity in serum with a cardiac troponin limit of detection of 0.55 ng/ml, and 3 very low variability in chip manufacturing to produce a figure of merit (FOM of 10.5. These findings drive LSPR closer to technical comparability with ELISA-based assays while preserving the unique particularities of a LSPR based sensor, suitability for multiplexing and miniaturization, and point-of-care detections.

Tööle innustavad aiaraamatud / Jaan Mettik

Index Scriptorium Estoniae

Mettik, Jaan

2007-01-01

Tallinnas 2006. a. kirjastuselt Maalehe Raamat ilmunud "Praktilisest aiarajaja käsiraamatust", Hermann Hacksteini ja Wota Wehmeyeri raamatust "Kiviktaimlaleksikon : teejuht kiviktaimla edukaks rajamiseks", kirjastuselt Varrak 2006. a. ilmunud Graham Rice raamatust "Segaaed" ja 2007. a. ilmunud Nils Skaareri taamatust "Koduõue kivid ja sillutis"

Carcinoma of the pancreas and periampullary region: palliation versus cure

NARCIS (Netherlands)

Klinkenbijl, J. H.; Jeekel, J.; Schmitz, P. I.; Rombout, P. A.; Nix, G. A.; Bruining, H. A.; van Blankenstein, M.

1993-01-01

A retrospective study of 310 patients with carcinoma of the head of the pancreas or periampullary region was performed. Preoperative bile drainage by placement of a stent reduced the number of postoperative complications, especially bleeding (P = 0.03). The operative mortality rate was nil in

Male sexuality after cancer treatment - needs for information and support : testicular cancer compared to malignant lymphoma

NARCIS (Netherlands)

Jonker-Pool, G.; Hoekstra, H.J.; van Imhoff, G.W.; Sonneveld, D.J.A.; Sleijfer, D.T.; van Driel, M.F.; Koops, H.S.; van de Wiel, H.B.M.

Testicular cancer (TC) as well as malignant lymphoma (NIL), both have nowadays an excellent prognosis. However, both types of cancer may be diagnosed at young adulthood and patients may experience sexual concerns. In this article the need for information and support concerning sexuality will be

Transfer standard device to improve the traceable calibration of physiotherapy ultrasound machines

NARCIS (Netherlands)

Hekkenberg, R.T.; Richards, A.; Beissner, K.; Zeqiri, B.; Bezemer, R.A.; Hodnett, M.; Prout, G.; Cantrall, C.

2006-01-01

Ultrasound (US) physiotherapy as a clinical treatment is extremely common in the Western world. Internationally, regulation to ensure safe application of US physiotherapy by regular calibration ranges from nil to mandatory. The need for a portable power standard (PPS) has been addressed within a

Constructivism as the Framework for International Orders

Science.gov (United States)

2016-09-01

idea that each kingdom had a right to sovereign control of its territory, laying the groundwork for our modern concept of the state.5 These shared...Washington, DC: NDU Press, 2013), Chapter 1 “Deviant Globalization” by Nils Gilman, Jesse Goldhammer, and Steven Weber , 3.

(Ventouse) in Modern Obstetric Practice in Nigeria

African Journals Online (AJOL)

2014-01-10

unknown, about 10‑15% in the UK[14] 4.5% in the USA. ... [Downloaded free from http://www.amhsr.org on Friday, January 10, 2014, IP: 197.87.13.14] || Click here to download free Android application for this journal .... Source of Support: Nil.

Kallinevad bussipiletid kiskusid Valgamaa altkäemaksuskandaali / Risto Berendson

Index Scriptorium Estoniae

Berendson, Risto, 1975-

2007-01-01

Ilmunud ka: Postimees : na russkom jazõke 29. okt. lk. 4-5. Transpordiettevõtte GoBus juhte kahtlustatakse Valgamaa maavanemale altkäemaksu andmises. Vt. samas: Nils Niitra. Kriminaalasi avas suuromanikele võimaluse juhte vallandada; Priit Rajalo. Naabrimehed Valgas peavad maavanemat tipp-topp meheks

Fabrication and characterization of free-standing, high-line-density transmission gratings for the vacuum UV to soft X-ray range

NARCIS (Netherlands)

Goh, S.J.; Bastiaens, Hubertus M.J.; Vratzov, B.; Huang, Qiushi; Bijkerk, Frederik; Boller, Klaus J.

2015-01-01

We present state-of-the-art high resolution transmission gratings, applicable for spectroscopy in the vacuum ultraviolet (VUV) and the soft X-ray (SRX) wavelength range, fabricated with a novel process using ultraviolet based nano imprint lithography (UV-NIL). Free-standing, high-line-density

Macrobenthos of the shelf off north eastern Bay of Bengal

Digital Repository Service at National Institute of Oceanography (India)

Harkantra, S.N.; Rodrigues, C.L.; Parulekar, A.H.

.6 (x = 10.61 + or - 3.2 gm/2) and from nil to 12.572 (x = 839 + or - 120 m/2) respectively. Loose sand sheltered rich fauna whereas muddy substrata has very poor fauna. Twenty nine major taxa were identified. Polychaeta formed the dominant group...

Inhibitory control in childhood stuttering

NARCIS (Netherlands)

Eggers, K.; de Nil, L.; Van den Bergh, B.R.H.

2013-01-01

Purpose The purpose of this study was to investigate whether previously reported parental questionnaire-based differences in inhibitory control (IC; Eggers, De Nil, & Van den Bergh, 2010) would be supported by direct measurement of IC using a computer task. Method Participants were 30 children who

Herpes Zoster‑Induced Acute Urinary Retention: Two Cases and ...

African Journals Online (AJOL)

2018-04-04

Apr 4, 2018 ... We report two uncommon cases of acute urinary retention in Chinese patients caused by reactivation of sacral herpes zoster and ... creations are licensed under the identical terms. For reprints contact: reprints@medknow.com .... anonymity cannot be guaranteed. Financial support and sponsorship. Nil.

High Levels of Phytophenolics and Antioxidant Activities in Oryza ...

African Journals Online (AJOL)

Purpose: To investigate phenolic levels, phytophenolic profiles and total antioxidant activities of Oryza sativa, unpolished Thai rice. Methods: Unpolished Thai rice strains of Leum Phua, Klam, Hawm Nil and Black Rose were measured for antioxidant activity using 1,1-diphenyl-2-picrylhydrazyl (DPPH), ...

Histopathological Study of Placentae in Low Birth Weight Babies in ...

African Journals Online (AJOL)

Chi‑square test with or without yate's correction was used as and when required. P < 0.05 was taken as .... For fixation, the placenta was cut into the multiple longitudinal slices of on-2 cm and kept ..... Source of Support: Nil. Conflict of Interest: ...

Birth weight recovery among very low birth weight infants surviving ...

African Journals Online (AJOL)

A multiple linear regression showed a negative association between ZSW at discharge and number of days nil per os without parenteral nutrition (PN). Antenatal steroids were associated with poor GV. There were no factors associated with regaining birth weight after 21 days on multiple logistic regression. Conclusion.

Fabrication of nanoparticle and protein nanostructures using nanoimprint lithography

NARCIS (Netherlands)

Maury, P.A.

2007-01-01

Nanoimprint lithography (NIL) was used as a tool to pattern self-assembled monolayers (SAMs) on silicon substrates because of its ability to pattern in the micrometer and nanometer ranges. The resulting polymer template behaved as a physical barrier preventing the formation of a SAM in the covered

Epithelial Inclusion Cyst in a Cervical Lymph Node: Report of a Rare ...

African Journals Online (AJOL)

epithelial inclusion cyst within a submandibular lymph node. ... Financial support and sponsorship. Nil. Conflicts of interest. There are no conflicts of interest. Bahadur S, Pujani M, Jetley S. Department of Pathology, Hamdard Institute of Medical. Sciences and Research, Jamia Hamdard, New Delhi, India. E‑mail: ...

Novel Technique for Safe Primary Trocar Insertion in Laparoscopy: Chou's Method

Directory of Open Access Journals (Sweden)

Pan-Hsin Chou

2005-06-01

Conclusion: The results with this novel method incorporating the unique concept of directly holding the fascia suggest it to be relatively safe, simple, and economic. The risk of major vascular injury was decreased to nil by this technique and the chance of visceral injury was also minimal.

Fabrication of nano-sized metal patterns on flexible polyethylene-terephthalate substrate using bi-layer nanoimprint lithography

Energy Technology Data Exchange (ETDEWEB)

Hwang, Seon Yong; Jung, Ho Yong [Department of Materials Science and Engineering, Korea University, Seoul, 136-701 (Korea, Republic of); Jeong, Jun-Ho [Nano-Mechanical Systems Research Center, Korea Institute of Machinery and Materials, Yuseong-gu Daejeon, 305-343 (Korea, Republic of); Lee, Heon, E-mail: heonlee@korea.ac.k [Department of Materials Science and Engineering, Korea University, Seoul, 136-701 (Korea, Republic of)

2009-05-29

Polymer films are widely used as a substrate for displays and for solar cells since they are cheap, transparent and flexible, and their material properties are easy to design. Polyethylene-terephthalate (PET) is especially useful for various applications requiring transparency, flexibility and good thermal and chemical resistance. In this study, nano-sized metal patterns were fabricated on flexible PET film by using nanoimprint lithography (NIL). Water-soluble poly-vinyl alcohol (PVA) resin was used as a planarization and sacrificial layer for the lift-off process, as it does not damage the PET films and can easily be etched off by using oxygen plasma. NIL was used to fabricate the nano-sized patterns on the non-planar or flexible substrate. Finally, a nano-sized metal pattern was successfully formed by depositing the metal layer over the imprinted resist patterns and applying the lift-off process, which is economic and environmentally friendly, to the PET films.

Thermo-curable epoxy systems for nanoimprint lithography

International Nuclear Information System (INIS)

Wu, Chun-Chang; Hsu, Steve Lien-Chung

2010-01-01

In this work, we have used solvent-free thermo-curable epoxy systems for low-pressure and moderate-temperature nanoimprint lithography (NIL). The curing kinetic parameters and conversion of diglycidyl ether of bisphenol A (DGEBA) resin with different ambient-cure 930 and 954 hardeners were studied by the isothermal DSC technique. They are useful for the study of epoxy resins in the imprinting application. The DGEBA/930 and DGEBA/954 epoxy resists can be imprinted to obtain high-density nano- and micro-scale patterns on a flexible indium tin oxide/poly(ethylene terephthalate) (ITO/PET) substrate. The DGEBA/930 epoxy resin is not only suitable for resist material, but also for plastic mold material. Highly dense nanometer patterns can be successfully imprinted using a UV-curable resist from the DGEBA/930 epoxy mold. Using the replicated DGEBA/930 epoxy mold instead of the expensive master can prevent brittle failure of the silicon molds in the NIL

Efficient methods of nanoimprint stamp cleaning based on imprint self-cleaning effect

Energy Technology Data Exchange (ETDEWEB)

Meng Fantao; Chu Jinkui [Key Laboratory for Micro/Nano Technology and System of Liaoning Province, Dalian University of Technology, 116024 Dalian (China); Luo Gang; Zhou Ye; Carlberg, Patrick; Heidari, Babak [Obducat AB, SE-20125 Malmoe (Sweden); Maximov, Ivan; Montelius, Lars; Xu, H Q [Division of Solid State Physics, Lund University, Box 118, S-22100 Lund (Sweden); Nilsson, Lars, E-mail: ivan.maximov@ftf.lth.se [Department of Food Technology, Engineering and Nutrition, Lund University, Box 117, S-22100 Lund (Sweden)

2011-05-06

Nanoimprint lithography (NIL) is a nonconventional lithographic technique that promises low-cost, high-throughput patterning of structures with sub-10 nm resolution. Contamination of nanoimprint stamps is one of the key obstacles to industrialize the NIL technology. Here, we report two efficient approaches for removal of typical contamination of particles and residual resist from stamps: thermal and ultraviolet (UV) imprinting cleaning-both based on the self-cleaning effect of imprinting process. The contaminated stamps were imprinted onto polymer substrates and after demolding, they were treated with an organic solvent. The images of the stamp before and after the cleaning processes show that the two cleaning approaches can effectively remove contamination from stamps without destroying the stamp structures. The contact angles of the stamp before and after the cleaning processes indicate that the cleaning methods do not significantly degrade the anti-sticking layer. The cleaning processes reported in this work could also be used for substrate cleaning.

Efficient low bandgap polymer solar cell with ordered heterojunction defined by nanoimprint lithography.

Science.gov (United States)

Yang, Yi; Mielczarek, Kamil; Zakhidov, Anvar; Hu, Walter

2014-11-12

In this work, we demonstrate the feasibility of using nanoimprint lithography (NIL) to make efficient low bandgap polymer solar cells with well-ordered heterojunction. High quality low bandgap conjugated polymer poly[2,6-(4,4-bis(2-ethylhexyl)-4H-cyclopenta[2,1-b;3,4-b']-dithiophene)-alt-4,7-(2,1,3-benzothiadiazole)] (PCPDTBT) nanogratings are fabricated using this technique for the first time. The geometry effect of PCPDTBT nanostructures on the solar cell performance is investigated by making PCPDTBT/C70 solar cells with different feature sizes of PCPDTBT nanogratings. It is found that the power conversion efficiency (PCE) increases with increasing nanograting height, PCPDTBT/C70 junction area, and decreasing nanograting width. We also find that NIL makes PCPDTBT chains interact more strongly and form an improved structural ordering. Solar cells made on the highest aspect ratio PCPDTBT nanostructures are among the best reported devices using the same material with a PCE of 5.5%.