WorldWideScience

Sample records for niels chr nielsen

  1. Carl Nielsen's voice

    DEFF Research Database (Denmark)

    Reynolds, Anne-Marie

    works, the first symphony and the opera Masquerade. This is done with a view to demonstrating that the opposition between Carl Nielsen as a composer of songs and Carl Nielsen as the composer of "great" works is only a seeming opposition. The book which is the result a collaboration with Niels Krabbe......, head of the Carl Nielsen Edition at The Royal Library will be published simultaneously with the publication of approximately 300 of the composer's songs, the last volume in the collected edition of Carl Nielsen's works....

  2. Niels Hemmingsen

    DEFF Research Database (Denmark)

    Lausten, Martin Schwarz

    Præsentation af Niels Hemmingsen (1513-1600), hans biografi, forfatterskabet på ca. 100 skrifter og virke som professor i teologi ved Københavns universitet. Hans suspension i 1579 og forflyttelse til Roskilde skete efter pres fra kurfyrste August og hans hustru Anna,søster til Frederik d.2. Niel...

  3. CHR grammars

    DEFF Research Database (Denmark)

    Christiansen, Henning

    2005-01-01

    A grammar formalism based upon CHR is proposed analogously to the way Definite Clause Grammars are defined and implemented on top of Prolog. These grammars execute as robust bottom-up parsers with an inherent treatment of ambiguity and a high flexibility to model various linguistic phenomena....... The formalism extends previous logic programming based grammars with a form of context-sensitive rules and the possibility to include extra-grammatical hypotheses in both head and body of grammar rules. Among the applications are straightforward implementations of Assumption Grammars and abduction under...... integrity constraints for language analysis. CHR grammars appear as a powerful tool for specification and implementation of language processors and may be proposed as a new standard for bottom-up grammars in logic programming....

  4. CHR Grammars

    DEFF Research Database (Denmark)

    Christiansen, Henning

    A grammar formalism based upon CHR is proposed analogously to the way Definite Clause Grammars are defined and implemented on top of Prolog. These grammars execute as robust bottom-up parsers with an inherent treatment of ambiguity and a high flexibility to model various linguistic phenomena....... The formalism extends previous logic programming based grammars with a form of context-sensitive rules and the possibility to include extra-grammatical hypotheses in both head and body of grammar rules. Among the applications are straightforward implementations of Assumption Grammars and abduction under...... integrity constraints for language analysis. CHR grammars appear as a powerful tool for specification and implementation of language processors and may be proposed as a new standard for bottom-up grammars in logic programming....

  5. A tribute to Niels Bohr

    International Nuclear Information System (INIS)

    1985-01-01

    This report is organized around the contribution of A. Pais, 'Niels Bohr and the development of physics', presented at CERN on the occasion of a special colloquium in the honour of Niels Bohr. It gives a broad survey of Bohr's life, the revolution in physics created by his quantum theory and his attempts to influence the peaceful development of nuclear energy. (orig.)

  6. Niels Bohr before/After

    International Nuclear Information System (INIS)

    Lurcat, F.

    1991-01-01

    Physics Nobel Price in 1922, Niels Bohr is the atomic modern theory inventor. He was Einstein friend and opponent. Niels Bohr never accepted that the physics became incomprehensible. Bohr was also a philosophe, and his theses ask to be explained. This book intends to non specialists [fr

  7. 1979 Nielsen Report on Television.

    Science.gov (United States)

    Nielsen (A.C.) Co., Chicago, IL.

    The Nielsen data on commercial television viewing and programming contained in this report are estimates of the audiences and other characteristics of television usage as derived from Nielsen Television Index and Nielsen Station Index measurements. Data and brief discussions are provided on the number of commercial and public stations; number of…

  8. Prioritized Abduction with CHR

    DEFF Research Database (Denmark)

    Christiansen, Henning

    2008-01-01

    A class of Prioritized Abductive Logic Programs (PrioALPs) is introduced and an implementation is developed in CHR for solving abductive problems, providing minimal explanations with best-first search. Priorities may represent probabilities or a cost function to be optimized. Compared with other...

  9. Vitalisme i Carl Nielsens musik

    DEFF Research Database (Denmark)

    Fjeldsøe, Michael

    2010-01-01

    symfoni, Det uudslukkelige. Formålet med artiklen er en specifi k og analytisk underbygget diskussion af vitalisme i Carl Nielsens musik, der forholder sig til, om og hvordan træk i musikken svarer til forestillinger om vitalisme. Her inddrages Helios-ouverturen (1903) og Nielsens tredje, fjerde og femte...... symfoni. Afslutningsvis diskuteres, hvordan Nielsens essaysamling Musik er Liv (1925) kan læses som et vitalitisk programskrift og hvordan Nielsens position i dansk musikliv gjorde det muligt at videreføre vitalistiske musikæstetiske positioner på trods af det legitimitetstab, den europæiske vitalisme...

  10. Inspiration & Insight - a tribute to Niels Reeh

    Science.gov (United States)

    Ahlstrom, A. P.; Vieli, A.

    2009-12-01

    Niels Reeh was highly regarded for his contributions to glaciology, specifically through his rigorous combination of numerical modelling and field observations. In 1966 he began his work on the application of beam mechanics to floating glaciers and ice shelves and throughout his life, Niels retained a strong interest in modelling glacier dynamics. In the early 1980s Niels developed a 3D-model for ice sheets and in the late 1980s an advanced flow-line model. Niels Reeh also took part in the early ice-core drilling efforts in Greenland and later pioneered the concept of retrieving similar records from the surface of the ice-sheet margin. Mass balance of glaciers and ice sheets was another theme in Niels Reeh’s research, with a number of important contributions and insights still used when teaching the subject to students. Niels developed elegant models for ablation and snow densification, notable for their applicability in large-scale ice-sheet models and studied the impact of climate change on ice sheets and glaciers. Niels also took his interest in ice-dynamics and mass balance into remote sensing and worked successfully on methods to utilize radar and laser data from airborne surveys and satellites in glaciology. In this, he pioneered the combination of field experiments, satellite observations and numerical modelling to solve problems on the Greenland Ice Sheet. In this presentation we will attempt to provide an overview of Niels Reeh’s many-facetted career in acknowledgement of his contributions to the field of glaciology.

  11. Higher-order Nielsen numbers

    Directory of Open Access Journals (Sweden)

    Saveliev Peter

    2005-01-01

    Full Text Available Suppose , are manifolds, are maps. The well-known coincidence problem studies the coincidence set . The number is called the codimension of the problem. More general is the preimage problem. For a map and a submanifold of , it studies the preimage set , and the codimension is . In case of codimension , the classical Nielsen number is a lower estimate of the number of points in changing under homotopies of , and for an arbitrary codimension, of the number of components of . We extend this theory to take into account other topological characteristics of . The goal is to find a "lower estimate" of the bordism group of . The answer is the Nielsen group defined as follows. In the classical definition, the Nielsen equivalence of points of based on paths is replaced with an equivalence of singular submanifolds of based on bordisms. We let , then the Nielsen group of order is the part of preserved under homotopies of . The Nielsen number of order is the rank of this group (then . These numbers are new obstructions to removability of coincidences and preimages. Some examples and computations are provided.

  12. Nielsen number and differential equations

    Directory of Open Access Journals (Sweden)

    Andres Jan

    2005-01-01

    Full Text Available In reply to a problem of Jean Leray (application of the Nielsen theory to differential equations, two main approaches are presented. The first is via Poincaré's translation operator, while the second one is based on the Hammerstein-type solution operator. The applicability of various Nielsen theories is discussed with respect to several sorts of differential equations and inclusions. Links with the Sharkovskii-like theorems (a finite number of periodic solutions imply infinitely many subharmonics are indicated, jointly with some further consequences like the nontrivial -structure of solutions of initial value problems. Some illustrating examples are supplied and open problems are formulated.

  13. Nielsen number of a covering map

    Directory of Open Access Journals (Sweden)

    Jezierski Jerzy

    2006-01-01

    Full Text Available We consider a finite regular covering over a compact polyhedron and a map admitting a lift . We show some formulae expressing the Nielsen number as a linear combination of the Nielsen numbers of its lifts.

  14. Jakob Nielsen and His Contributions to Topology

    DEFF Research Database (Denmark)

    Hansen, Vagn Lundsgaard

    1999-01-01

    The Danish mathematician Jakob Nielsen won international recognition as one of the developers of combinatorial group theory and the topology of surfaces. This article describes the life and work of Jakob Nielsen with emphasis on his contributions to topology.......The Danish mathematician Jakob Nielsen won international recognition as one of the developers of combinatorial group theory and the topology of surfaces. This article describes the life and work of Jakob Nielsen with emphasis on his contributions to topology....

  15. House for Niels Strøyberg

    DEFF Research Database (Denmark)

    Welling, Helen

    2007-01-01

    The house for Niels Strøyberg in Hasseris near Aalborg, Denmark, is a notable example of early modernism in an unconventional way. Although Poul Henningsen's approach to the dwelling was thoroughly functional, he added a number of visual effects to provide a sense of dynamism to the spatial...

  16. Gauge invariance and Nielsen identities

    International Nuclear Information System (INIS)

    Lima, A.F. de; Bazaia, D.

    1989-01-01

    The one-loop contribution to the effective potential and mass are computed within the context of scalar electrodynamics for the class of general R gauges in the MS scheme. These calculations are performed in order to construct a non-trivial verification of the corresponding Nielsen identities within the context of the Higgs model. Some brief comments on the Coleman-Weinberg model are also included. (author) [pt

  17. Higher-order Nielsen numbers

    Directory of Open Access Journals (Sweden)

    Peter Saveliev

    2005-04-01

    Full Text Available Suppose X, Y are manifolds, f,g:X→Y are maps. The well-known coincidence problem studies the coincidence set C={x:f(x=g(x}. The number m=dim X−dim Y is called the codimension of the problem. More general is the preimage problem. For a map f:X→Z and a submanifold Y of Z, it studies the preimage set C={x:f(x∈Y}, and the codimension is m=dim X+dim Y−dim Z. In case of codimension 0, the classical Nielsen number N(f,Y is a lower estimate of the number of points in C changing under homotopies of f, and for an arbitrary codimension, of the number of components of C. We extend this theory to take into account other topological characteristics of C. The goal is to find a “lower estimate” of the bordism group Ωp(C of C. The answer is the Nielsen group Sp(f,Y defined as follows. In the classical definition, the Nielsen equivalence of points of C based on paths is replaced with an equivalence of singular submanifolds of C based on bordisms. We let Sp'(f,Y=Ωp(C/∼N, then the Nielsen group of order p is the part of Sp'(f,Y preserved under homotopies of f. The Nielsen number Np(F,Y of order p is the rank of this group (then N(f,Y=N0(f,Y. These numbers are new obstructions to removability of coincidences and preimages. Some examples and computations are provided.

  18. Reasoning about passive declarations in CHR

    DEFF Research Database (Denmark)

    Christiansen, Henning

    2005-01-01

    The programming language of Constraint Handling Rules (CHR) is gaining more and more popularity and this has motivated the development of new optimization techniques to be applied in implementations of CHR. As for other logic programming languages, a program written CHR can be understood declarat......The programming language of Constraint Handling Rules (CHR) is gaining more and more popularity and this has motivated the development of new optimization techniques to be applied in implementations of CHR. As for other logic programming languages, a program written CHR can be understood...

  19. A Museum for Palle Nielsen

    DEFF Research Database (Denmark)

    Thorborg, Christoffer

    2016-01-01

    The present project attempts to articulate architecturally the psychic content in the danish graphic artist and draftsman Palle Nielsen's oeuvre. The museum inscribes itself within the city of Copenhagen as a part of it, but simultaneously establishes a taut vacuum between the city's buildings......, thereby setting these existing, surrounding monumental buildings in relief. The interior of the museum manifests itself as a dramatic, labyrinthine course of empty spaces, within which the visitor is deprived of contact with the city, and potentially loses his or her sense of place....

  20. Niels Bohr - his life and scientific achievements

    International Nuclear Information System (INIS)

    Kailas, S.

    2013-01-01

    Niels Bohr, a Nobel laureate and a celebrated scientist of the 20th century is remembered for his lasting contributions to atomic and nuclear physics. His pioneering works on Energy loss by charged particles, the structure of the atom, the compound nucleus model and the mechanism of nuclear fission are indeed remarkable. In this article a brief account of his life and scientific achievements is provided. (author)

  1. Address at the opening session of the Niels Bohr Symposium

    International Nuclear Information System (INIS)

    Mayor, F.

    1998-01-01

    In his address at the opening session of the Niels Bohr Symposium organized jointly by UNESCO and the Niels Bohr Institute in Copenhagen in May 1998 in order to examine the latest developments in key fields of physics, the Director General of UNESCO presented the scientific work and the spirit of Niels Bohr, emphasizing the impact of his discoveries for new openings in science and in society in general

  2. Niels Bohr and Complementarity An Introduction

    CERN Document Server

    Plotnitsky, Arkady

    2012-01-01

    This book offers a discussion of Niels Bohr’s conception of “complementarity,” arguably his greatest contribution to physics and philosophy. By tracing Bohr’s work from his 1913 atomic theory to the introduction and then refinement of the idea of complementarity, and by explicating different meanings of “complementarity” in Bohr and the relationships between it and Bohr’s other concepts, the book aims to offer a contained and accessible, and yet sufficiently comprehensive account of Bohr’s work on complementarity and its significance.

  3. Complementarity beyond physics Niels Bohr's parallels

    CERN Document Server

    Bala, Arun

    2017-01-01

    In this study Arun Bala examines the implications that Niels Bohr’s principle of complementarity holds for fields beyond physics. Bohr, one of the founding figures of modern quantum physics, argued that the principle of complementarity he proposed for understanding atomic processes has parallels in psychology, biology, and social science, as well as in Buddhist and Taoist thought. But Bohr failed to offer any explanation for why complementarity might extend beyond physics, and his claims have been widely rejected by scientists as empty speculation. Scientific scepticism has only been reinforced by the naïve enthusiasm of postmodern relativists and New Age intuitionists, who seize upon Bohr’s ideas to justify anti-realist and mystical positions. Arun Bala offers a detailed defence of Bohr’s claim that complementarity has far-reaching implications for the biological and social sciences, as well as for comparative philosophies of science, by explaining Bohr’s parallels as responses to the omnipresence...

  4. Jakob Nielsen and his Contributions to Topology

    DEFF Research Database (Denmark)

    Hansen, Vagn Lundsgaard

    1996-01-01

    The Danish mathematician Jakob Nielsen won international recognitionas one of the developers of combinatiorial group theory and the topologyof surfaces. This article describes the life and work of Jakob Nielsenwith emphasis on his contributions to topology.The biography is to be included in the b......The Danish mathematician Jakob Nielsen won international recognitionas one of the developers of combinatiorial group theory and the topologyof surfaces. This article describes the life and work of Jakob Nielsenwith emphasis on his contributions to topology.The biography is to be included...

  5. Nielsen number of a covering map

    Directory of Open Access Journals (Sweden)

    Jerzy Jezierski

    2006-02-01

    Full Text Available We consider a finite regular covering pH:X˜H→X over a compact polyhedron and a map f:X→X admitting a lift f˜:X˜H→X˜H. We show some formulae expressing the Nielsen number N(f as a linear combination of the Nielsen numbers of its lifts.

  6. Julia Sloth-Nielsen and Jacqui Gallinetti

    African Journals Online (AJOL)

    juliasn

    The history of the development and passage through Parliament of the Child Justice ... Sloth-Nielsen J The Role of International law in Juvenile Justice Reform in .... rehabilitation and reintegration of children; balancing the interests of children and ... African Charter on the Rights and Welfare of the Child (African Children's ...

  7. Dicty_cDB: CHR591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR591 (Link to dictyBase) - - - Contig-U11865-1 CHR591P (Link... to Original site) CHR591F 557 CHR591Z 706 CHR591P 1243 - - Show CHR591 Library CH (Link to library) Clone ID CHR591 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11865-1 Original site URL http://dict... IDPYEIQQNKQSNNSNSNSNRNLTPNSSSPTNQRKNKQEDDDDESKLDDESDLNERFQKV VLRFREFPSLDTNLYRLQEICT...DLNERFQKV VLRFREFPSLDTNLYRLQEICTDLLHISQDFIHTVKTYGRIIIEERYLKEKTIQSRSIGG H--- ---RK

  8. Niels Bukh's gymnastics school in Denmark, 1912–1933

    DEFF Research Database (Denmark)

    Bonde, Hans

    2015-01-01

    Around 1916–1917 the Danish gymnastics pedagogue Niels Bukh (1880–1950) created, in an international sense, a revolutionary men's gymnastics, and in 1920 he established Denmark's and the world's first folk high school of physical education and sport. During the 1930s, Niels Bukh and his team...... of gymnasts first became a symbol for the dynamic Danish farming community, and then for the face of Denmark both at home and abroad. Bukh changed the stereotypical male expression of bodily dynamics, which in Danish rural gymnastics had been almost military. He made it legitimate for the young lads to get...

  9. Expansion of the CHR bone code system

    International Nuclear Information System (INIS)

    Farnham, J.E.; Schlenker, R.A.

    1976-01-01

    This report describes the coding system used in the Center for Human Radiobiology (CHR) to identify individual bones and portions of bones of a complete skeletal system. It includes illustrations of various bones and bone segments with their respective code numbers. Codes are also presented for bone groups and for nonbone materials

  10. "J. Chr. Brotze. Estonica" esitlused Poolas

    Index Scriptorium Estoniae

    2007-01-01

    TLÜ emeriitprofessori Raimo Pullati juhtimisel ja TLÜ teadlaste ühistööna valminud entsüklopeedilise suurteose "J. Chr. Brotze. Estonica" esitlused Johannes Paulus II nim. Lublini Katoliiklikus Ülikoolis seminaril "Eesti kultuur ja kunst" ning Poola Rahvusraamatukogus, kus toimub ka Brotze kollektsiooni näituse avamine

  11. Niels Bohr. Physicist and philospher of the atomic era

    International Nuclear Information System (INIS)

    Fischer, Ernst Peter

    2012-01-01

    The physicist and Nobel-prize carrier Niels Bohr (1885-1962) changed by his research our view to the world. By his atomic model for the first time the stability of matter could be explained, but simultaneously the atomic physics and nuclear technique based on this made our world so dangerous as never before. In an impressive portrait Ernst Peter Fischer describes the life and action of this fascinating man, his great physical finding, as well as his political engagement.

  12. Genetics Home Reference: Jervell and Lange-Nielsen syndrome

    Science.gov (United States)

    ... Home Edition for Patients and Caregivers: Long QT Syndrome and Torsades de Pointes Ventricular Tachycardia Orphanet: Familial long QT syndrome Orphanet: Jervell and Lange-Nielsen syndrome Patient Support ...

  13. Chromium resistance characteristics of Cr(VI) resistance genes ChrA and ChrB in Serratia sp. S2.

    Science.gov (United States)

    He, Yuan; Dong, Lanlan; Zhou, Simin; Jia, Yan; Gu, Ruijia; Bai, Qunhua; Gao, Jieying; Li, Yingli; Xiao, Hong

    2018-08-15

    To find an efficient chromium (VI) resistance system, with a highly efficient, economical, safe, and environmentally friendly chromium-removing strain, ChrA, ChrB, and ChrAB fragments of the chromium (VI) resistance gene in Serratia sp. S2 were cloned, and their prokaryotic expression vectors were constructed and transformed into E. coli BL21. The anti-chromium (VI) capacity and characteristics of engineered bacteria, role of ChrA and ChrB genes in the anti-chromium (VI) processes, and the mechanism of chromium metabolism, were explored. The PCR technique was used to amplify ChrA, ChrB, and ChrAB genes from the Serratia sp. S2 genome. ChrA, ChrB, and ChrAB genes were connected to the prokaryotic expression vector pET-28a and transferred into E. coli BL21 for prokaryotic expression. Cr-absorption and Cr-efflux ability of the engineered strains were determined. The effects of respiratory inhibitors and oxygenated anions on Cr-efflux of ChrA and ChrB engineered strains were explored. ChrA, ChrB, and ChrAB engineered strains were constructed successfully; there was no significant difference between the control strain and the ChrB engineered strain for Cr-metabolism (P > 0.05). Cr-absorption and Cr-efflux of ChrA and ChrAB engineered strains were significantly stronger than the control strain (P < 0.05). Oxyanions (sulfate and molybdate) and inhibitors (valinomycin and CN - ) could significantly inhibit the Cr-efflux capacities of ChrA and ChrAB engineered strains (P < 0.05), while NADPH could significantly promote such capacities (P < 0.05). The Cr-transporter, encoded by ChrA gene, confer the ability to pump out intracellular Cr on ChrA and ChrAB engineered strains. The ChrB gene plays a positive regulatory role in ChrA gene regulation. The Cr-metabolism ability of the ChrAB engineered strain is stronger than the ChrA engineered strain. ChrA and ChrAB genes in the Cr-resistance system may involve a variety of mechanisms, such as sulfate ion channel and

  14. Carl Nielsen and the Idea of English National Music

    DEFF Research Database (Denmark)

    Fjeldsøe, Michael; Boeg, Jens

    2012-01-01

    between Vaughan Williams’ image of English national music and perceived characteristics of Nielsen’s style made it easier for English listeners and critics to appreciate Nielsen’s music than for those on the European Continent, and this might help explain the rather favourable reception of Nielsen......Why did Carl Nielsen achieve such a favourable reception in England from the 1950s on, compared to the rather reluctant recognition in continental Europe? We would suggest that one reason could be an affi nity of features in his music with the concept of English national music. The affi nity...

  15. Dicty_cDB: CHR241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

  16. The language of Orthodox theology & quantum mechanics: St Gregory Palamas and Niels Bohr

    DEFF Research Database (Denmark)

    Tanev, Stoyan

    2013-01-01

    The objective of this chapter is to provide an analytical framework that would enable the comparison of the ways of using words and language in the cases of St. Gregory Palamas and Niels Bohr. The main motivation will be to explore Christos Yannaras’ point about the opportunity of using quantum....... The focus on epistemological issues could be justified by the fact that both St. Gregory Palamas and Niels Bohr have been acknowledged for their epistemological insights....

  17. Some New Transformation Properties of the Nielsen Generalized Polylogarithm

    Directory of Open Access Journals (Sweden)

    Nina Shang

    2014-01-01

    Full Text Available Many of the properties of Nielsen generalized polylogarithm Sn,p(z, for example, the special value and the transformation formulas, play important roles in the computation of higher order radiative corrections in quantum electrodynamics. In this paper, some transformation formulas of z→p(z,p(z=1-z,1/z,1/(1-z,z/(z-1, and (1-z/z are obtained. In particular, the last three transformation formulas are new results so far in the literature. By use of these transformation formulas presented, new fast algorithms for Nielsen generalized polylogarithm Sn,p(z can be designed. For sn,p=Sn,p(1, a new recurrence formula is also given. The identities and the calculation of σn,p and an,p are also investigated.

  18. Froggatt-Nielsen hierarchy and the neutrino mass matrix

    International Nuclear Information System (INIS)

    Kamikado, H.; Takasugi, E.

    2008-05-01

    We study the neutrino mass matrix derived from the seesaw mechanism in which the neutrino Yukawa couplings and the heavy Majorana neutrino mass matrix are controlled by the Froggatt-Nielsen mechanism. In order to obtain the large neutrino mixings, two Froggatt-Nielsen fields are introduced with a complex vacuum expectation values. As a by-product, CP violation is systematically induced even if the order one couplings of FN fields are real. We show several predictions of this model, such as θ 13 , the Dirac CP phase, two Majorana CP phases, the effective mass of the neutrinoless double beta decay and the leptogenesis. The prediction of the branching ratio of μ→eγ is also given in SUSY model. (orig.)

  19. Paul Ehrenfest, Niels Bohr, and Albert Einstein: Colleagues and Friends

    Science.gov (United States)

    Klein, Martin J.

    2010-09-01

    In May 1918 Paul Ehrenfest received a monograph from Niels Bohr in which Bohr had used Ehrenfest's adiabatic principle as an essential assumption for understanding atomic structure. Ehrenfest responded by inviting Bohr, whom he had never met, to give a talk at a meeting in Leiden in late April 1919, which Bohr accepted; he lived with Ehrenfest, his mathematician wife Tatyana, and their young family for two weeks. Albert Einstein was unable to attend this meeting, but in October 1919 he visited his old friend Ehrenfest and his family in Leiden, where Ehrenfest told him how much he had enjoyed and profited from Bohr's visit. Einstein first met Bohr when Bohr gave a lecture in Berlin at the end of April 1920, and the two immediately proclaimed unbounded admiration for each other as physicists and as human beings. Ehrenfest hoped that he and they would meet at the Third Solvay Conference in Brussels in early April 1921, but his hope was unfulfilled. Einstein, the only physicist from Germany who was invited to it in this bitter postwar atmosphere, decided instead to accompany Chaim Weizmann on a trip to the United States to help raise money for the new Hebrew University in Jerusalem. Bohr became so overworked with the planning and construction of his new Institute for Theoretical Physics in Copenhagen that he could only draft the first part of his Solvay report and ask Ehrenfest to present it, which Ehrenfest agreed to do following the presentation of his own report. After recovering his strength, Bohr invited Ehrenfest to give a lecture in Copenhagen that fall, and Ehrenfest, battling his deep-seated self-doubts, spent three weeks in Copenhagen in December 1921 accompanied by his daughter Tanya and her future husband, the two Ehrenfests staying with the Bohrs in their apartment in Bohr's new Institute for Theoretical Physics. Immediately after leaving Copenhagen, Ehrenfest wrote to Einstein, telling him once again that Bohr was a prodigious physicist, and again

  20. Fra turistkort version 1.0 til 2.0. og videre?

    DEFF Research Database (Denmark)

    Nielsen, Niels Christian

    2008-01-01

    Post doc Niels Chr. Nielsen fortæller i denne artikel om formidling af geografisk information henvendt til turister og rejsende. Artiklen er den første i en serie, der skal give indblik i danske forskeres arbejde - og som begynder med historiske turistkort fra Danmark. Udgivelsesdato: september...

  1. Nielsen's identity and gluon condensation at finite temperature

    International Nuclear Information System (INIS)

    Skalozub, V.V.

    1992-11-01

    The gauge dependence problem of the gluon field zero component condensate, A 0 =const, is investigated in finite temperature SU(3) gluodynamics. The two-loop effective action W(A 0 ,ξ) is recalculated in the background R ξ gauge. The obtained result somewhat differs from that of other authors. By straightforward calculation it is shown that W(A 0 ,ξ) satisfies the Nielsen (the Ward type) identity. Thus, the gauge invariance of the gluon condensation phenomenon is proved. (author). 14 refs

  2. Die ware rede agter Niels Bukh se besoek aan Suid-Afrika in 1939 ...

    African Journals Online (AJOL)

    Gymnastics and politics: Niels Bukh and male aesthetics” is an excellent work by ... the Afrikaners were anti-British and therefore pro-German, it was easy for Bonde to ... War left a large component of the European minority in a poor state of health. Apart

  3. The Life and Work of Niels Bohr – A Brief Sketch

    Indian Academy of Sciences (India)

    IAS Admin

    Niels Henrik David Bohr was born to affluent parents on. 7 October 1885 in ... two years older; while his brother Harald, to whom he was ... sions from a very young age. ... married on 1 August 1912, the beginning of a 50-year relationship.

  4. Multimerized CHR-derived peptides as HIV-1 fusion inhibitors.

    Science.gov (United States)

    Nomura, Wataru; Hashimoto, Chie; Suzuki, Takaharu; Ohashi, Nami; Fujino, Masayuki; Murakami, Tsutomu; Yamamoto, Naoki; Tamamura, Hirokazu

    2013-08-01

    To date, several HIV-1 fusion inhibitors based on the carboxy-terminal leucine/isoleucine heptad repeat (CHR) region of an HIV-1 envelope protein gp41 have been discovered. We have shown that a synthetic peptide mimetic of a trimer form of the CHR-derived peptide C34 has potent inhibitory activity against the HIV-1 fusion mechanism, compared to a monomer C34 peptide. The present study revealed that a dimeric form of C34 is evidently structurally critical for fusion inhibitors, and that the activity of multimerized CHR-derived peptides in fusion inhibition is affected by the properties of the unit peptides C34, SC34EK, and T20. The fluorescence-based study suggested that the N36-interactive sites of the C34 trimer, including hydrophobic residues, are exposed outside the trimer and that trimerization of C34 caused a remarkable increase in fusion inhibitory activity. The present results could be useful in the design of fusion inhibitors against viral infections which proceed via membrane fusion with host cells. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  5. Adjusted NIEL calculations for estimating proton-induced degradation of GaInP/GaAs/Ge space solar cells

    International Nuclear Information System (INIS)

    Lu Ming; Wang Rong; Liu Yunhong; Hu Wentao; Feng Zhao; Han Zhaolei

    2011-01-01

    The non-ionizing energy loss (NIEL) values for protons in solar cells should be modified by taking into account the distribution of the Bragg damage peak in the active region to calculate the corresponding displacement damage dose. In this paper, based upon a thin target approximation, a new approach is presented to modify NIEL values for protons on a GaAs sub-cell. Adjusted NIEL values can be used to estimate the degradation induced by protons on GaInP/GaAs/Ge triple-junction space solar cells.

  6. D branes in background fluxes and Nielsen-Olesen instabilities

    International Nuclear Information System (INIS)

    Russo, Jorge G.

    2016-01-01

    In quantum field theory, charged particles with spin ≥1 may become tachyonic in the present of magnetic fluxes above some critical field, signaling an instability of the vacuum. The phenomenon is generic, in particular, similar instabilities are known to exist in open and closed string theory, where a spinning string state can become tachyonic above a critical field. In compactifications involving RR fluxes F_p_+_2, the quantum states which could become tachyonic by the same Nielsen-Olesen mechanism are Dp branes. By constructing an appropriate background with RR magnetic flux that takes into account back-reaction, we identify the possible tachyonic Dp brane states and compute the formula for the energy spectrum in a sector. More generally, we argue that in any background RR magnetic flux, there are high spin Dp quantum states which become very light at critical fields.

  7. D branes in background fluxes and Nielsen-Olesen instabilities

    Energy Technology Data Exchange (ETDEWEB)

    Russo, Jorge G. [Institució Catalana de Recerca i Estudis Avançats (ICREA),Pg. Lluis Companys, 23, 08010 Barcelona (Spain); Department de Fisica Cuantica i Astrofisica and Institut de Ciències del Cosmos,Universitat de Barcelona, Martí Franquès, 1, 08028 Barcelona (Spain)

    2016-06-06

    In quantum field theory, charged particles with spin ≥1 may become tachyonic in the present of magnetic fluxes above some critical field, signaling an instability of the vacuum. The phenomenon is generic, in particular, similar instabilities are known to exist in open and closed string theory, where a spinning string state can become tachyonic above a critical field. In compactifications involving RR fluxes F{sub p+2}, the quantum states which could become tachyonic by the same Nielsen-Olesen mechanism are Dp branes. By constructing an appropriate background with RR magnetic flux that takes into account back-reaction, we identify the possible tachyonic Dp brane states and compute the formula for the energy spectrum in a sector. More generally, we argue that in any background RR magnetic flux, there are high spin Dp quantum states which become very light at critical fields.

  8. Flavor cosmology. Dynamical Yukawas in the Froggatt-Nielsen mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Baldes, Iason; Konstandin, Thomas [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Servant, Geraldine [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik

    2016-12-02

    Can the cosmological dynamics responsible for settling down the present values of the Cabibbo-Kobayashi-Maskawa matrix be related to electroweak symmetry breaking? If the Standard Model Yukawa couplings varied in the early universe and started with order one values before electroweak symmetry breaking, the CP violation associated with the CKM matrix could be the origin of the matter-antimatter asymmetry. The large effective Yukawa couplings which lead to the enhanced CP violation can also help in achieving a strong first-order electroweak phase transition. We study in detail the feasibility of this idea by implementing dynamical Yukawa couplings in the context of the Froggatt-Nielsen mechanism. We discuss two main realizations of such a mechanism, related phenomenology, cosmological and collider bounds, and provide an estimate of the baryonic yield. A generic prediction is that this scenario always features a new scalar field below the electroweak scale. We point out ways to get around this conclusion.

  9. Flavor cosmology: dynamical yukawas in the Froggatt-Nielsen mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Baldes, Iason; Konstandin, Thomas [DESY,Notkestraße 85, Hamburg, D-22607 (Germany); Servant, Géraldine [DESY,Notkestraße 85, Hamburg, D-22607 (Germany); II. Institute for Theoretical Physics, University of Hamburg,Luruper Chaussee 149, Hamburg, D-22761 (Germany)

    2016-12-15

    Can the cosmological dynamics responsible for settling down the present values of the Cabibbo-Kobayashi-Maskawa matrix be related to electroweak symmetry breaking? If the Standard Model Yukawa couplings varied in the early universe and started with order one values before electroweak symmetry breaking, the CP violation associated with the CKM matrix could be the origin of the matter-antimatter asymmetry. The large effective Yukawa couplings which lead to the enhanced CP violation can also help in achieving a strong first-order electroweak phase transition. We study in detail the feasibility of this idea by implementing dynamical Yukawa couplings in the context of the Froggatt-Nielsen mechanism. We discuss two main realizations of such a mechanism, related phenomenology, cosmological and collider bounds, and provide an estimate of the baryonic yield. A generic prediction is that this scenario always features a new scalar field below the electroweak scale. We point out ways to get around this conclusion.

  10. Atoms, metaphors and paradoxes Niels Bohr and the construction of a new physics

    CERN Document Server

    Petruccioli, Sandro

    2006-01-01

    This book gives a detailed study of the development and the interpretation given to Niels Bohr's Principle of Correspondence. It also describes the role that this principle played in guiding Bohr's research over the critical period from 1920 to 1927. Quantum mechanics, developed in the 1920s and 1930s by Bohr, Heisenberg, Born, Schrödinger and Dirac, represents one of the most profound turning points in science. This theory required a wholly new kind of physics in which many of the principles, concepts and models representing reality, that had formed the basis of classical physics since Galileo and Newton, had to be abandoned. This book re-examines the birth of quantum mechanics, in particular examining the development of crucial and original insights of Niels Bohr.

  11. Niels Bohr and the philosophy of physics twenty-first century perspectives

    CERN Document Server

    Folse, Henry

    2017-01-01

    Niels Bohr and Philosophy of Physics: Twenty-First Century Perspectives examines the philosophical views, influences and legacy of the Nobel Prize physicist and philosophical spokesman of the quantum revolution, Niels Bohr. The sixteen contributions in this collection by some of the best contemporary philosophers and physicists writing on Bohr's philosophy today all carefully distinguish his subtle and unique interpretation of quantum mechanics from views often imputed to him under the banner of the “Copenhagen Interpretation.” With respect to philosophical influences on Bohr's outlook, the contributors analyse prominent similarities between his viewpoint and Kantian ways of thinking, the views of the Danish philosopher Harald Høffding, and themes characteristic of American pragmatism. In recognizing the importance of Bohr's epistemological naturalism they examine his defence of the indispensability of classical concepts from a variety of different perspectives. This collection shows us that Bohr's int...

  12. GaAs Led based NIEL spectrometer for the space radiation environment

    International Nuclear Information System (INIS)

    Houdayer, A.J.; Hinrichsen, P.F.; Barry, A.L.; Ng, A.

    1999-01-01

    A NIEL (non-ionizing-energy-loss) spectrometer for the Mir space station is described. The NIEL spectrometer package contained 20 GaAs LEDs, 10 SiC LEDs and 13 locations for TLD-700s. In order to probe different energy regions of the radiation field, the package is divided into 4 compartments covered by absorbers of varying thicknesses. This device has been submitted to proton irradiation. The effects on both the response time and the intensity of the light were measured as a function of the fluence. One of the advantages of LEDs as radiation monitors is their sensitivity and it is shown that it would be possible to detect a fluence of 4*10 7 p/cm 2 of 10 MeV protons, with sensitivity scaled as 1/E for other energies. (A.C.)

  13. Transverse momentum distribution in the Nielsen-Olesen model

    Energy Technology Data Exchange (ETDEWEB)

    Sakai, S [Tokyo Univ. of Education (Japan). Dept. of Physics

    1976-05-01

    The power dependence in the inclusive ksub(T)-distribution in the large ksub(T)-region is derived in the extended hadron model of Nielsen and Olesen without relying upon hard scattering of hadron constituents. The ksub(T)-dependence behaves like -- -ln ksub(T) when ksub(T) is small, then it becomes exp(-..gamma..ksub(T)) in the medium ksub(T) region (ksub(T)<=1.5(GeV/c)), and further it changes to behave like (ksub(T))sup(-n(ksub(T)), when ksub(T) becomes much larger. Our ksub(T)-dependence is consistent with the experimental data. This ksub(T)-distribution is derived by the strong repulsive force between two vortex lines (identified as hadron). This repulsive force is caused by the pressure of the spontaneously broken vacuum state which is necessary to confine the vector field. Our model on the ksub(T)-distribution is very analogous to the production of massive resonances and their successive decay.

  14. Nielsen PrimeLocation Web/Desktop: Assessing and GIS Mapping Market Area

    Data.gov (United States)

    Social Security Administration — Nielsen PrimeLocation Web and Desktop Software Licensed for Internal Use only: Pop-Facts Demographics Database, Geographic Mapping Data Layers, Geo-Coding locations.

  15. An algorithm using reticulocyte hemoglobin content (CHr) measurement in screening adolescents for iron deficiency.

    Science.gov (United States)

    Stoffman, Nava; Brugnara, Carlo; Woods, Elizabeth R

    2005-06-01

    To evaluate whether the use of an algorithm including reticulocyte hemoglobin content (CHr), a new hematologic parameter, in addition to the screening complete blood count (CBC), improves detection of iron deficiency and iron deficiency anemia in healthy adolescents. After initiation of an algorithm using CHr in addition to CBC results for identifying iron-deficient patients in a primary care hospital-based adolescent clinic, we reviewed results of all hematological tests performed in the clinic during an 8-month period. Electronic medical records were screened for health status and inclusion criteria. We determined the number of patients with low hematocrit values, low mean cell volume (MCV), and low CHr. To evaluate the impact of the protocol, we calculated the percentage of cases in which the CHr results suggested a management plan different from that which would have been formulated using the CBC results only. A total of 381 patients (mean age 16.8 +/- 3.1 years) were included in the study. Anemia was diagnosed by the Centers for Disease Control (CDC) guidelines in 63 patients (16.5%), low MCV in 170 patients (44.6%), and a low CHr in 80 (21%) patients. In 68% of anemia cases, a normal CHr suggested that iron deficiency was not the cause of the anemia. Although low MCV values were found in 38 (60.4%) of all anemic cases, mean MCV was significantly (p < 0.001) lower in the 19 cases with a low CHr as well. In 19% of 318 patients with a normal hematocrit (HCT), a low CHr suggested the need for treatment of early iron deficiency. In 103 (27%) cases, CHr suggested a different treatment plan from that which would have been formulated using the screening CBC only. The use of an algorithm including CHr to screen for iron deficiency anemia may increase the accuracy of diagnosis, enabling early detection and treatment of iron deficiency in adolescents without the need for additional costly iron studies.

  16. Audiovisual work- Interview with Niels Thygesen, Copenhagen 9 April 2016 (Lenght 02:35:03)

    OpenAIRE

    Danescu, Elena; Klein, Francois; Thygesen, Niels

    2017-01-01

    In the framework of the research project "Pierre Werner and Europe, Interview with Niels Thygesen, Professor of Economics at the University of Copenhagen from 1964 to 1969 and from 1971 to 2004, Adviser to the Governor of the Danmarks Nationalbank from 1973 to 1983 and a member of the Delors Committee set up to study and propose practical steps that would lead to the gradual establishment of Economic and Monetary Union (EMU) from 1988 to 1989, carried out by the Centre Virtuel de la Connaissa...

  17. Niels Hemmingsen and the Construction of a Seventeenth-Century Protestant Memory

    DEFF Research Database (Denmark)

    Sommer, Mattias Skat

    2017-01-01

    Danish reformer Niels Hemmingsen was a Lutheran, but owing to Pan-Protestant sentiments that became apparent in his later writings, he found an appreciative audience in non-Lutheran Western Europe during the late sixteenth and early seventeenth centuries. This article argues that the early modern...... European reception of Hemmingsen and his theology should be seen as an attempt to construct him as part of a Protestant memory. It also argues that in order to understand the dynamics behind the reception of Hemmingsen’s ideas, one has to consider the geopolitics of early modern Denmark. Due to her...

  18. Il danese tranquillo Niels Bohr, un fisico e il suo tempo, 1885-1962

    CERN Document Server

    Pais, Abraham

    1993-01-01

    Niels Bohr è una figura centrale nella fisica del Novecento, padre fondatore della teoria atomica e della meccanica quantistica. La storia della sua vita, ricca e piena anche sul piano affettivo e personale, non può dunque ridursi a un resoconto dei suoi successi scientifici e Pais, allievo e poi amico di Bohr, ne è perfettamente consapevole. Il libro si sviluppa su vari piani: capitoli strettamente biografici o storico-scientifici si alternano a discussioni sulle idee di Bohr in campo politico e filosofico, sui suoi rapporti con Einstein, sul suo ruolo nei drammatici anni della guerra e su molti altri aspetti della vicenda umana.

  19. ChR2 transgenic animals in peripheral sensory system: Sensing light as various sensations.

    Science.gov (United States)

    Ji, Zhi-Gang; Wang, Hongxia

    2016-04-01

    Since the introduction of Channelrhodopsin-2 (ChR2) to neuroscience, optogenetics technology was developed, making it possible to activate specific neurons or circuits with spatial and temporal precision. Various ChR2 transgenic animal models have been generated and are playing important roles in revealing the mechanisms of neural activities, mapping neural circuits, controlling the behaviors of animals as well as exploring new strategy for treating the neurological diseases in both central and peripheral nervous system. An animal including humans senses environments through Aristotle's five senses (sight, hearing, smell, taste and touch). Usually, each sense is associated with a kind of sensory organ (eyes, ears, nose, tongue and skin). Is it possible that one could hear light, smell light, taste light and touch light? When ChR2 is targeted to different peripheral sensory neurons by viral vectors or generating ChR2 transgenic animals, the animals can sense the light as various sensations such as hearing, touch, pain, smell and taste. In this review, we focus on ChR2 transgenic animals in the peripheral nervous system. Firstly the working principle of ChR2 as an optogenetic actuator is simply described. Then the current transgenic animal lines where ChR2 was expressed in peripheral sensory neurons are presented and the findings obtained by these animal models are reviewed. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. A sensitive chemiluminescent immunoassay to detect Chromotrope FB (Chr FB) in foods.

    Science.gov (United States)

    Xu, Kun; Long, Hao; Xing, Rongge; Yin, Yongmei; Eremin, Sergei A; Meng, Meng; Xi, Rimo

    2017-03-01

    Chromotrope FB (Chr FB) is a synthetic azo dye permitted for use in foods and medicines. An acceptable daily intake (ADI) of Chr FB was 0-0.5mg/kg in China. In this study, we synthesized a Chr FB hapten with an amino group to prepare its artificial immunogen. Polyclonal antibodies obtained from New Zealand rabbits were applied to develop an indirect competitive chemiluminescent immunoassay (icCLIA) to detect Chr FB in foods. A horseradish peroxidase (HRP)-luminol-H 2 O 2 system was used to yield CL signal with p-iodophenol as an enhancement reagent. The method showed good specificity towards Chr FB and could detect as low as 0.02ngmL -1 Chr FB in buffer, 0.07ngg -1 in yoghurt candy, 0.07ngg -1 in vitamin drink and 0.13ngg -1 in bread. Compared with HPLC method, the proposed method is more sensitive by two orders of magnitude. The accuracy and precision of this method are acceptable and comparable with HPLC method. Therefore, the proposed method could be used for rapid screening of Chr FB in the mentioned foodstuffs. Copyright © 2016. Published by Elsevier B.V.

  1. Den sene Derrida, eller: Er Claus Beck-Nielsen et spøgelse?

    DEFF Research Database (Denmark)

    Rösing, Lilian Munk

    2009-01-01

    This article is about hosting the ghost. In Spectres de Marx (1993) Derrida introduces the ghost which seems to condense in one figure the important themes of his late writings: the address, the other, the ethical turn, the event, the mourning, the reality of immateriality, the guest. The article...... turns to the paternal ghost from Shakespeare's Hamlet, as well as to the most ghost-like artist on the Danish contemporary art scene: Claus Beck-Nielsen, who some years ago declared himself dead. Is Claus Beck-Nielsen really a ghost? That is the question....

  2. Love, literature and the quantum atom Niels Bohr's 1913 trilogy revisited

    CERN Document Server

    Aaserud, Finn

    2013-01-01

    Niels Bohr ranks with Einstein among the physicists of the 20th century. He rose to this status through his invention of the quantum theory of the atom and his leadership in its defense and development. He also ranks with Einstein in his humanism and his sense of responsibility to his science and the society that enabled him to create it. Our book presents unpublished excerpts from extensive correspondence between Bohr and his immediate family, and uses it to describe and analyze the psychological and cultural background to his invention. The book also contains a reprinting of the three papers of 1913 - the "Trilogy" - in which Bohr worked out the provisional basis of a quantum theory of the atom.

  3. Niels Stensen: a 17th century scientist with a modern view of brain organization.

    Science.gov (United States)

    Parent, André

    2013-07-01

    In 1665 the Danish scholar Niels Stensen (1638-1686) reached Paris, where he pronounced a discourse on brain anatomy that was to orient neuroscientists for years to come. In his lecture, Stensen rejected ancient speculations about animal spirits and criticized René Descartes and his followers who, despite a poor knowledge of brain anatomy, elaborated complex models to explain the multifaceted function of what he considered the principal organ of the human mind. He advocated the need for studying the brain through a comparative, developmental and pathological convergent approach and called for appropriate dissection methods and accurate illustrations. His own careful anatomical studies permitted him to precisely depict many brain structures. After pioneering works in paleontology and geology, he devoted himself to theology. In 1677 Stensen converted from Lutheranism to Catholicism and, while working relentlessly as a bishop and apostolic vicar in Northern Europe, he died in self-imposed poverty at age 48.

  4. Gravity and absolute space. The works of Niels Bjern (1865-1909)

    International Nuclear Information System (INIS)

    Burlankov, Dmitrii E

    2004-01-01

    Nearly 20 years before Einstein, Niels Bjern developed a theory of gravity based on what is today known as the equivalence principle - but naturally without invoking the ideas of the special relativity theory. Bjern predicted almost all the effects considered to be tests for general relativity, his calculation formulas for the effects being identical to those of general relativity. An advocate of the absolute space concept, Bjern described the gravitational field in terms of the field of absolute velocities of an inertial space. He only used the ideas of general relativity to describe the precession of the perihelion of Mercury. The reason why Bjern's predictions and those of general relativity are identical is discussed. (from the history of physics)

  5. FN-2HDM: Two Higgs Doublet Models with Froggatt-Nielsen symmetry

    Energy Technology Data Exchange (ETDEWEB)

    Dery, Avital; Nir, Yosef [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, Herzl 234, Rehovot 76100 (Israel)

    2017-04-03

    We embed Two Higgs Doublet Models (2HDMs) in the Froggatt Nielsen (FN) framework. We find that the approximate FN symmetry predicts i) approximate Natural Flavor Conservation (NFC) of Types II or IV in the Yukawa sector, and ii) approximate Peccei-Quinn (PQ) symmetry in the scalar sector. We discuss the phenomenological consequences of these features.

  6. GAME STUDIES ENCONTRAM JOGOS PARA SAÚDE: Uma entrevista com Espen Aarseth e Rune Nielsen

    Directory of Open Access Journals (Sweden)

    Luiz Adolfo Andrade

    2018-06-01

    Full Text Available Os pesquisadores do Centro para Pesquisas em Jogos de Computador da IT – Universidade de Copenhagen, Espen Aarseth e Rune Nielsen, discutem nesta entrevista a relação entre jogos e cuidados com a saúde.

  7. Creation and annihilation operators for Nielsen-Olesen vortices in the coherent state approximation

    International Nuclear Information System (INIS)

    Pottinger, D.E.L.

    1978-01-01

    Using the standard techniques of canonical quantization, the author constructs approximate expressions for the creation and annihilation operators for Nielsen-Olesen vortices. The forms for the creation and annihilation operators are appropriate to situations where large-scale vortex condensation takes place. In particular, a phenomenon such as this is basic in the quark confinement schemes of Mandelstam and 't Hooft. (Auth.)

  8. Nielsen: Aladdin-Suite, FS89. Maskarade-Overture / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Nielsen: Aladdin-Suite, FS89. Maskarade-Overture, Prelude, Act 2. The Cockerels' Dance. Rhapsody Overture: An imaginary journey to the Faroe Islands, FS123. Helios Overture, FS32. Saga-Drom, FS46. Pan and Syrinx, FS87. Gothenburg Symphony Orchestra, Neeme Järvi" DG 447 757-2GH (72 minutes: DDD)

  9. Identification and functional analysis of a CDE/CHR element in the POLDI promoter

    Institute of Scientific and Technical Information of China (English)

    SONG NanMeng; ZHU XiaoYu; SHI Lei; AN Jing; WU YanWei; SANG JianLi

    2009-01-01

    Chinese Center for Disease Control and Prevention, Beijing 102206, China DNA polymerase delta is encoded by the POLD1 gene, the transcription of which is strictly cell cy-cle-dependent. However, the means by which POLD1 transcription is regulated by the cell cycle mechanism is currently unknown. We discovered a novel element in the POLD1 promoter known as a CDE(cell cycle-dependent element)lCHR(cell cycle gene homology region) element. A series of luci-ferase reporter constructs containing various POLD1 promoter mutations were used to investigate the role of the CDF_JCHR element in POLD1 transcription. When the CDE/CHR element was mutated, the promoter activity was up-regulated, and the cell-cycle related factors E2F1 and p21 stopped regulating the promoter. Furthermore, cell cycle-dependent changes in the promoter activity required the integra-tive CDE/CHR element. Electrophoretic mobility shift assay (EMSA) revealed the presence of at least three types of DNA/protein complexes binding to the CDE/CHR element. Our findings provide strong evidence that the CDE/CHR-like sequence is an active functional element in the POLD1 promoter, which is important for the cell cycle regulation of the POLD1 gene.

  10. Niels Bohr collected works, volume 9: Nuclear physics (1929-1952)

    International Nuclear Information System (INIS)

    Peierls, R.

    1985-01-01

    This volume deals with Bohr's work on nuclear physics which began in the pre-1932 days with his thinking deeply, but inconclusively about the seeming contradictions then presented by the evidence about the nucleus. In 1936 Bohr recognized and described the insights provided by neutron scattering experiments and the excitement of this new understanding and its extension and consolidation occupied much of the subsequent years. In 1939 he was again first in understanding the essential features of the newly discovered phenomenon of fission, applying successfully the point of view of nuclear reactions which he had developed over the past three years. Later, in 1949-50, he was impressed by the success of the nuclear shell model, which on the face of it seemed hard to reconcile with the picture of the closely interacting nucleons which he had pioneered in 1936 and he put much effort into clarifying this paradox. As in earlier volumes the published papers are supported by appropriate selections from unpublished notes and drafts, and by relevant correspondence. CONTENTS: Foreword. Part I: Papers and Manuscripts Related to Nuclear Physics. Part II: Selected Correspondence (1929-1949). Inventory of Relevant Manuscripts in the Niels Bohr Archive. Index

  11. Des images et des paraboles : Niels Bohr et le discours descriptif en physique quantique

    Directory of Open Access Journals (Sweden)

    Ilias Yocaris

    2011-01-01

    Full Text Available Cette étude porte sur l’importance accordée aux images verbales dans le discours descriptif utilisé en mécanique quantique, et plus précisément sur la conception de la langue scientifique qui est celle de Niels Bohr (1885-1962 : en raison d’une série de considérations techniques, méthodologiques et épistémologiques que nous nous proposons d’analyser in extenso, Bohr considère effectivement que les phénomènes subatomiques ne peuvent être évoqués directement (sans référence au contexte observationnel, par le biais d’un langage dénotatif non figural, mais uniquement de manière métaphorique, détournée, ce qui réduit à ses yeux le discours descriptif des physiciens à « des images et des paraboles ». En examinant les textes de Bohr à la lumière d’un certain nombre de travaux épistémologiques, de commentaires et d’expérimentations auxquels ils ont donné lieu ultérieurement, nous nous proposons de décrire les implications conceptuelles d’une telle prise de position, qui constitue une vraie révolution sur le plan philosophique.

  12. Editors’ Introduction: The life and work of Jørgen S. Nielsen

    DEFF Research Database (Denmark)

    Vinding, Niels Valdemar

    2018-01-01

    In September 2016, Jørgen S. Nielsen celebrated his 70th birthday. The articles in the present volume are collected in expectation of that joyous occasion. As often is in academia, it is only now that we have been able to gather and publish all the contributions from friends and colleagues. As wi...... they indeed echo the themes and curiosity in Jørgen S. Nielsen’s own exploration of the multitude of Muslims in Europe....

  13. Dynamical basis for Koba-Nielsen-Olesen scaling and its violation

    International Nuclear Information System (INIS)

    Hinz, D.C.; Lam, C.S.

    1986-01-01

    We discuss a class of dynamical models motivated by Koba-Nielsen-Olesen (KNO) scaling and phase-space considerations. These modified phase-space models (MPSM's) generalize some of the existing models and provide them with a dynamical basis. Multiplicity distributions in MPSM's can be obtained by solving an appropriate evolution equation, from which kinematical KNO-scaling violations before the asymptotic scaling energy is reached can be calculated. Possible causes for dynamical KNO-scaling violations are also discussed

  14. Lie symmetry and the generalized Hojman conserved quantity of Nielsen equations for a variable mass holonomic system of relative motion

    International Nuclear Information System (INIS)

    Zhang Mei-Ling; Wang Xiao-Xiao; Xie Yin-Li; Jia Li-Qun; Sun Xian-Ting

    2011-01-01

    Lie symmetry and the generalized Hojman conserved quantity of Nielsen equations for a variable mass holonomic system of relative motion are studied. The determining equation of Lie symmetry of Nielsen equations for a variable mass holonomic system of relative motion under the infinitesimal transformations of groups is given. The expression of generalized Hojman conserved quantity deduced directly from Lie symmetry for a variable mass holonomic system of relative motion is obtained. An example is given to illustrate the application of the results. (general)

  15. Baltika CHR/Evermani asemele tuleb Mosaic / Liis Kängsepp

    Index Scriptorium Estoniae

    Kängsepp, Liis, 1981-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 22. veebr. lk. 6. AS Baltika annab kaubamärgile CHR/Evermen uue nime Mosaic. Diagramm: Kaupluste arv ja käive. Vt. samas: Klementi juht kiidab Baltika brändivahetuse heaks

  16. What Does it Take to Travel Philosophically Light? A Response to Nielsen

    Directory of Open Access Journals (Sweden)

    Idil Boran

    2008-10-01

    Full Text Available In his reply to criticism raised against his reading of Rawls’s constructivist method in light of Rorty’s pragmatism, Kai Nielsen defends his position on the basis that it provides the tools for an external defence of liberalism. An external defence seeks to justify a liberal conception of justice in a way that will be acceptable not only to those who have already accepted the core substantive principles of liberal theory, but to those who reject these core principles. This paper assesses Nielsen’s proposal and shows that Rortian pragmatism is a limited way of achieving an external defence of liberal political and legal institutions. I propose to develop instead the idea of Kantian constructivism to this end. This discussion also brings to light broader questions about the idea of practical philosophy, and thus pays tribute to the works of John Rawls, Richard Rorty, and Kai Nielsen. Dans sa réplique à la critique faite de son interprétation de la méthode constructiviste de Rawls à la lumière du pragmatisme de Rorty, Kai Nielsen défend sa position en indiquant qu’elle offre des outils pour faire une défense externe du libéralisme. Une défence externe cherche à justifier une conception libérale de la justice d’une façon qui sera acceptable non seulement par ceux qui ont déjà accepté les principes importants de fond de la théorie libérale, mais par ceux qui rejettent ces principes de fond. Cet article évalue la proposition de Nielsen et démontre que le pragmatisme de Rorty est une façon limitée d’en arriver à une défense externe des institutions politiques et juridiques libérales. Je propose de développer plutôt l’idée de constructivisme kantien à cette fin. Cette discussion fait aussi ressortir des questions de plus grande envergure au sujet de l’idée de philosophie pratique et rend ainsi hommage aux oeuvres de John Rawls, Richard Rorty et Kai Nielsen.

  17. El pabellón Niels Bohr. Tradición Danesa y Modernidad

    Directory of Open Access Journals (Sweden)

    Carmen García Sánchez

    2015-12-01

    Full Text Available La casa de invitados de Niels Bohr fue el primer edificio del arquitecto danés Vilhelm Wohlert (1920-2007. Arraigado a la tradición danesa, representa una renovación basada en la absorción de influencias extranjeras: la arquitectura americana y la tradición japonesa. La caja de madera tiene el carácter sensible de un organismo vivo, siempre cambiante según las variaciones de luz del día o temperatura. Puertas plegables y contraventanas generan extensiones de las habitaciones. Cuando se abren, crean una prolongación del espacio interior, que se extiende a la naturaleza circundante, y se expande hacia el espacio exterior, permitiendo su movilización. Se establece una arquitectura de flujos. Protagoniza un ejemplo de la modernidad como refinamiento en la técnica de los límites y la idea de que la arquitectura no es un objeto material, sino el espacio generado en su interior. Podría ser visto como un ikebana; “el arte del espacio”, donde se produce una circulación de aire entre sus componentes; algo vivo que expresa la tercera dimensión, el equilibrio asimétrico, un interés por la materia, su textura y efecto emocional que emana. Hay armonía y equilibrio, que transmiten serenidad y belleza; un encuentro con la naturaleza; un mundo de relaciones amable al ser humano.

  18. Synthesis and spectroscopic studies of silver and rhodium mono- and polynuclear complexes with multidentate phosphines (Ph2P)2CHR (R = H, Me, PPh2)

    NARCIS (Netherlands)

    Koten, G. van; Ploeg, A.F.M.J. van der

    1981-01-01

    Trinuclear [{(Ph{2}P){3}CH}Ag{3}(O{2}CR'){3}], dinuclear [{(Ph{2}P){2}CHR}Ag{2}(O{2}CR'){2}], [{(Ph{2}P){2}CHR}{2}Ag{2}](BF{4}){2} and (Rh{2}(Cl)(CO){2}{(Ph{2}P){2}CHMe}{2}][RhCl{2}(CO){2}], and mononuclear (Rh{(Ph{2}P){2}CHR}{2}](BF{4}), (Rh{(Ph{2}P){2}CHR}{2}HCl](BF{4}), d

  19. The bishop and anatomist Niels Stensen (1638-1686) and his contributions to our early understanding of the brain.

    Science.gov (United States)

    Tubbs, R Shane; Mortazavi, Martin M; Shoja, Mohammadali M; Loukas, Marios; Cohen-Gadol, Aaron A

    2011-01-01

    Many physicians are familiar with the parotid duct and the Danish physician/anatomist's name associated with it. However, most are unaware of Niels Stensen's life and his significant contributions to the early study of the brain. This physician of the Medici court was clearly ahead of his time and found errors in the publications of such giants as Varolius and Willis. The present review discusses the life of this seventeenth century anatomist, physician, and priest/bishop and highlights his contributions to neuroanatomy.

  20. Nielsen: Homescan

    Data.gov (United States)

    Department of Agriculture — Contains information on household based purchases for about 400,000 UPC’s and non-UPC coded random weight items, including prices, quantities, purchase date, product...

  1. Hamiltonian quantization of self-dual tensor fields and a bosonic Nielsen-Ninomiya theorem

    International Nuclear Information System (INIS)

    Tang Waikeung

    1989-01-01

    The quantization of self-dual tensor fields is carried out following the procedure of Batalin and Fradkin. The (anti) self-duality constraints (either fermionic or bosonic) in the action leads to the gravitational anomaly. In the process of gauge fixing, the impossibility of the co-existence of a positive hamiltonian and covariant action is shown. A version of the Nielsen-Ninomiya theorem applies to self-dual tensor fields viz. the lattice version of the theory shows species doubling with zero net chirality. (orig.)

  2. Baltika muudab CHR/Evermeni kaubamärgi Mosaiciks / Anneli Lepp

    Index Scriptorium Estoniae

    Lepp, Anneli

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 15. veebr. lk. 7. Baltika muudab rõivamärgi CHR/Everman nime Mosaiciks, et anda viimastel aastatel kõige kiiremini kasvanud poeketile ühtne identiteet ja kergem kirjapilt, mis võimaldaks ka välisturul edukamalt läbi lüüa. Lisa: Baltika uus kaubamärk Mosaic

  3. CHR729 Is a CHD3 Protein That Controls Seedling Development in Rice.

    Science.gov (United States)

    Ma, Xiaoding; Ma, Jian; Zhai, Honghong; Xin, Peiyong; Chu, Jinfang; Qiao, Yongli; Han, Longzhi

    2015-01-01

    CHD3 is one of the chromatin-remodeling factors that contribute to controlling the expression of genes associated with plant development. Loss-of-function mutants display morphological and growth defects. However, the molecular mechanisms underlying CHD3 regulation of plant development remain unclear. In this study, a rice CHD3 protein, CHR729, was identified. The corresponding mutant line (t483) exhibited late seed germination, low germination rate, dwarfism, low tiller number, root growth inhibition, adaxial albino leaves, and short and narrow leaves. CHR729 encoded a nuclear protein and was expressed in almost all organs. RNA-sequencing analysis showed that several plant hormone-related genes were up- or down-regulated in t483 compared to wild type. In particular, expression of the gibberellin synthetase gibberellin 20 oxidase 4 gene was elevated in the mutant. Endogenous gibberellin assays demonstrated that the content of bioactive GA3 was reduced in t483 compared to wild type. Moreover, the seedling dwarfism, late seed germination, and short root length phenotypes of t483 were partially rescued by treatment with exogenous GA3. These results suggest that the rice CHD3 protein CHR729 plays an important role in many aspects of seedling development and controls this development via the gibberellin pathway.

  4. CHR729 Is a CHD3 Protein That Controls Seedling Development in Rice.

    Directory of Open Access Journals (Sweden)

    Xiaoding Ma

    Full Text Available CHD3 is one of the chromatin-remodeling factors that contribute to controlling the expression of genes associated with plant development. Loss-of-function mutants display morphological and growth defects. However, the molecular mechanisms underlying CHD3 regulation of plant development remain unclear. In this study, a rice CHD3 protein, CHR729, was identified. The corresponding mutant line (t483 exhibited late seed germination, low germination rate, dwarfism, low tiller number, root growth inhibition, adaxial albino leaves, and short and narrow leaves. CHR729 encoded a nuclear protein and was expressed in almost all organs. RNA-sequencing analysis showed that several plant hormone-related genes were up- or down-regulated in t483 compared to wild type. In particular, expression of the gibberellin synthetase gibberellin 20 oxidase 4 gene was elevated in the mutant. Endogenous gibberellin assays demonstrated that the content of bioactive GA3 was reduced in t483 compared to wild type. Moreover, the seedling dwarfism, late seed germination, and short root length phenotypes of t483 were partially rescued by treatment with exogenous GA3. These results suggest that the rice CHD3 protein CHR729 plays an important role in many aspects of seedling development and controls this development via the gibberellin pathway.

  5. Gewaltenteilung im Rechsstaat und europäische Geschichte. 3 : Vorträge am Staatsgerichtshof und am Historischen Seminar der Universität Tartu (Dorpat)/Estland / Ingo von Münch, Niels von Redecker ; Forum Academicum Inter Nationes ; Roela Uemõisa

    Index Scriptorium Estoniae

    Münch, Ingo von

    1998-01-01

    Sisaldab: Die Gewaltenteilung im Rechtstaat = Võimude lahususe printsiip õigusriigis / Ingo von Münch ; Can we have a European history / Niels von Redecker ; The Ostpolitik of Willy Brandt / Niels von Redecker

  6. Anatomy of a reindeer dissected in Copenhagen in 1672 by Niels Stensen as reported by Thomas Bartholin. I. Introduction by Troels Kardel. II. Translation by Paul Maquet

    Directory of Open Access Journals (Sweden)

    Troels Kardel

    2013-03-01

    Full Text Available A report by Professor Thomas Bartholin on the dissection of a reindeer performed in 1672 by his former student Niels Stensen as Royal Anatomist in Copenhagen is presented in English translation with biographical introduction and bibliographical notes. The report is most likely the first of its kind being an early contribution to comparative anatomy.

  7. Erik Rasmussen, Niels Bohr og Værdirelativismen - i anledning af Kasper Lippert-Rasmussens bog om Erik Rasmussen

    DEFF Research Database (Denmark)

    Ougaard, Morten

    2015-01-01

    En svaghed ved Kasper Lippert-Rasmussens i øvrigt udmærkede bog om Erik Rasmussen er, at den forbigår den sene Rasmussens bog om komplementaritet og statskundskab. Bogen var vigtig for Rasmussen, og den bør indgå i hans faglige eftermæle. Den rummer videnskabsteoretiske argumenter af stor relevans...... ikke mindst forholdet mellem normative og kognitive udsagn. Efter mødet med Niels Bohrs filosofi står Rasmussens værdirelativisme både skarpere og stærkere end før, og Kasper Lippert-Rasmussens karakteristik af denne position som et ubegrundet dogme i dansk politologi er ikke overbevisende....

  8. Froggatt-Nielsen models from E8 in F-theory GUTs

    CERN Document Server

    Dudas, Emilian; 10.1007

    2009-01-01

    This paper studies F-theory SU(5) GUT models where the three generations of the standard model come from three different curves. All the matter is taken to come from curves intersecting at a point of enhanced E8 gauge symmetry. Giving a vev to some of the GUT singlets naturally implements a Froggatt-Nielsen approach to flavour structure. A scan is performed over all possible models and the results are filtered using phenomenological constraints. We find a unique model that fits observations of quark and lepton masses and mixing well. This model suffers from two drawbacks: R-parity must be imposed by hand and there is a doublet-triplet splitting problem.

  9. Width and partial widths of unstable particles in the light of the Nielsen identities

    International Nuclear Information System (INIS)

    Grassi, P.A.; Sirlin, A.; Kniehl, B.A.; Hamburg Univ.

    2001-09-01

    Fundamental properties of unstable particles, including mass, width, and partial widths, are examined on the basis of the Nielsen identities (NI) that describe the gauge dependence of Green functions. In particular, we prove that the pole residues and associated definitions of branching ratios and partial widths are gauge independent to all orders. A simpler, previously discussed definition of branching ratios and partial widths is found to be gauge independent through next-to-next-to-leading order. It is then explained how it may be modified in order to extend the gauge independence to all orders. We also show that the physical scattering amplitude is the most general combination of self-energy, vertex, and box contributions that is gauge independent for arbitrary s, discuss the analytical properties of the NI functions, and exhibit explicitly their one-loop expressions in the Z-γ sector of the Standard Model. (orig.)

  10. Width and partial widths of unstable particles in the light of the Nielsen identities

    International Nuclear Information System (INIS)

    Grassi, Pietro A.; Kniehl, Bernd A.; Sirlin, Alberto

    2002-01-01

    Fundamental properties of unstable particles, including mass, width, and partial widths, are examined on the basis of the Nielsen identities (NI) that describe the gauge dependence of Green functions. In particular, we prove that the pole residues and associated definitions of branching ratios and partial widths are gauge independent to all orders. A simpler, previously discussed definition of branching ratios and partial widths is found to be gauge independent through next-to-next-to-leading order. It is then explained how it may be modified in order to extend the gauge independence to all orders. We also show that the physical scattering amplitude is the most general combination of self-energy, vertex, and box contributions that is gauge independent for arbitrary s, discuss the analytical properties of the NI functions, and exhibit explicitly their one-loop expressions in the Z-γ sector of the standard model

  11. The Nielsen identities for the two-point functions of QED and QCD

    International Nuclear Information System (INIS)

    Breckenridge, J.C.; Sasketchewan Univ., Saskatoon, SK; Lavelle, M.J.; Steele, T.G.; Sasketchewan Univ., Saskatoon, SK

    1995-01-01

    We consider the Nielsen identities for the two-point functions of full QCD and QED in the class of Lorentz gauges. For pedagogical reasons the identities are first derived in QED to demonstrate the gauge independence of the photon self-energy, and of the electron mass shell. In QCD we derive the general identity and hence the identities for the quark, gluon and ghost propagators. The explicit contributions to the gluon and ghost identities are calculated to one-loop order, and then we show that the quark identity requires that in on-shell schemes the quark mass renormalisation must be gauge independent. Furthermore, we obtain formal solutions for the gluon self-energy and ghost propagator in terms of the gauge dependence of other, independent Green functions. (orig.)

  12. Surface coating of jeungjing wood (Paraserianthes Falcataria (L) NIELSEN) with acrylate resins by using radiation technique

    International Nuclear Information System (INIS)

    Suhariyono, Gatot

    1998-01-01

    An experiment on surface coating with acrylate resins has been done by using radiation technique to improve the quality and added value of jeunjing wood (Paraserianthes Falcataria (L) NIELSEN). Doses used in Electron Beam (BE) radiation were 20, 40, and 60 kGy. Epoxy acrylate and ester acrylate resins were used as coating materials after added with tripropylene glycol diacylate (TPGDA) monomer, 2,2-dimethyl-2hidroxy acetophenone (Darocur 1173) photoinitiator and talc as base coat. Top coat consists of este acrylate Setacure AM 548, after added with titanium dioxide OK 412 as additive respectively. Titanium dioxides in the mixture were varied at the concentration level of 0, 2, 4 and 6 % by weight. Conventional coating as comparison was carried out by using varnish as coating material. The results showed that the properties of film on jeunjing wood by EB curing are better than that of conventional one. (authors)

  13. Standard model and fine structure constant at Planck distances in the Bennett-Brene-Nielsen-Picek random dynamics

    International Nuclear Information System (INIS)

    Laperashvili, L.V.

    1994-01-01

    The first part of the present paper contains a review of papers by Nielsen, Bennett, Brene and Picek which underly the model called random dynamics. The second part of the paper is devoted to calculating the fine structure constant by means of the path integration in the U(1)-lattice gauge theory

  14. A constitutively expressed pair of rpoE2-chrR2 in Azospirillum brasilense Sp7 is required for survival under antibiotic and oxidative stress.

    Science.gov (United States)

    Gupta, Namrata; Kumar, Santosh; Mishra, Mukti Nath; Tripathi, Anil Kumar

    2013-02-01

    Extracytoplasmic function (ECF) sigma factors (σ(E)) are known to bring about changes in gene expression to enable bacteria to adapt to different stresses. The Azospirillum brasilense Sp245 genome harbours nine genes encoding σ(E), of which two are adjacent to the genes encoding ChrR-type zinc-binding anti-sigma (ZAS) factors. We describe here the role and regulation of a new pair of rpoE-chrR, which was found in the genome of A. brasilense Sp7 in addition to the previously described rpoE-chrR pair (designated rpoE1-chrR1). The rpoE2-chrR2 pair is also cotranscribed, and their products show protein-protein interaction. The -10 and -35 promoter elements of rpoE2-chrR2 and rpoE1-chrR1 were similar but not identical. Unlike the promoter of rpoE1-chrR1, the rpoE2-chrR2 promoter was neither autoregulated nor induced by oxidative stress. Inactivation of chrR2 or overexpression of rpoE2 in A. brasilense Sp7 resulted in an overproduction of carotenoids. It also conferred resistance to oxidative stresses and antibiotics. By controlling the synthesis of carotenoids, initiation and elongation of translation, protein folding and purine biosynthesis, RpoE2 seems to play a crucial role in preventing and repairing the cellular damage caused by oxidative stress. Lack of autoregulation and constitutive expression of rpoE2-chrR2 suggest that RpoE2-ChrR2 may provide a rapid mechanism to cope with oxidative stress, wherein singlet oxygen ((1)O(2))-mediated dissociation of the RpoE2-ChrR2 complex might release RpoE2 to drive the expression of its target genes.

  15. Anomaly-free discrete gauge symmetries in Froggatt-Nielsen models

    International Nuclear Information System (INIS)

    Luhn, C.

    2006-05-01

    Discrete symmetries (DS) can forbid dangerous B- and L-violating operators in the supersymmetric Lagrangian. Due to the violation of global DSs by quantum gravity effects, the introduced DS should be a remnant of a spontaneously broken local gauge symmetry. Demanding anomaly freedom of the high-energy gauge theory, we determine all family-independent anomaly-free Z N symmetries which are consistent with the trilinear MSSM superpotential terms in Part I. We find one outstanding Z 6 symmetry, proton hexality P 6 , which prohibits all B- and L-violating operators up to dimension five, except for the Majorana neutrino mass terms LH u LH u . In Part II, we combine the idea that a DS should have a gauge origin with the scenario of Froggatt and Nielsen (FN). We construct concise U(1) X FN models in which the Z 3 symmetry baryon triality, B 3 , arises from U(1) X breaking. We choose this specific DGS because it allows for R-parity violating interactions; thus neutrino masses can be explained without introducing right-handed neutrinos. We find six phenomenologically viable B 3 -conserving FN models. (orig.)

  16. A progressively reduced pretension method to fabricate Bradbury-Nielsen gates with uniform tension

    International Nuclear Information System (INIS)

    Ni, Kai; Guo, Jingran; Yu, Zhou; Cao, Like; Yu, Quan; Qian, Xiang; Wang, Xiaohao

    2015-01-01

    A Bradbury-Nielsen gate (BNG) is often used to modulate ion beams. It consists of two interleaved and electrically isolated sets of wires with uniform tension, which ideally keep parallel, equidistant, and coplanar over a wide temperature range, making the BNG reliable and robust. We have previously analyzed the non-uniformity problem of wire tensions with sequentially winding method and developed a template-based transfer method to solve this problem. In this paper, we introduced a progressively reduced pretension method, which allows directly and sequentially fixing wires onto the substrate without using a template. Theoretical analysis shows that by applying proper pretension to each wire when fixing it, the final wire tensions of all wires can be uniform. The algorithm and flowchart to calculate the pretension sequence are given, and the fabrication process is introduced in detail. Pretensions are generated by weight combination with a weaving device. A BNG with stainless steel wire and a printed circuit board substrate is constructed with this method. The non-uniformity of the final wire tensions is less than 2.5% in theory. The BNG is successfully employed in our ion mobility spectrometer, and the measured resolution is 33.5 at a gate opening time of 350 μs. Compared to the template-based method, this method is simpler, faster, and more flexible with comparable production quality when manufacturing BNGs with different configurations

  17. Cochlear implantation in children with Jervell and Lange-Nielsen syndrome - a cautionary tale.

    Science.gov (United States)

    Broomfield, Stephen J; Bruce, Iain A; Henderson, Lise; Ramsden, Richard T; Green, Kevin M J

    2012-08-01

    Jervell and Lange-Nielsen (JLN) syndrome is a rare cause of congenital profound hearing loss associated with a prolonged QT interval on the electrocardiogram. Children presenting for cochlear implantation with this condition may be asymptomatic but are at risk of sudden death. SCREENING AND SUBSEQUENT: careful management is therefore required to ensure a successful outcome. We present our experience of cochlear implantation in children with JLN syndrome, including two who died unexpectedly, and suggest a protocol for management of such cases. Clinical presentation Four cases of cochlear implantation in JLN syndrome are described. None had any previous cardiological family history. Two were diagnosed pre-operatively but, despite appropriate management under a cardiologist, died from cardiac arrest; the first in the perioperative period following reimplantation for infection, and the second unrelated to his cochlear implant surgery. The other two patients were diagnosed only subsequent to their implantation and continue to use their implants successfully. These cases highlight the variation in presentation of JLN syndrome, and the spectrum of disease severity that exists. Our protocol stresses the importance of careful assessment and counselling of parents by an experienced implant team.

  18. Merton's problem for an investor with a benchmark in a Barndorff-Nielsen and Shephard market.

    Science.gov (United States)

    Lennartsson, Jan; Lindberg, Carl

    2015-01-01

    To try to outperform an externally given benchmark with known weights is the most common equity mandate in the financial industry. For quantitative investors, this task is predominantly approached by optimizing their portfolios consecutively over short time horizons with one-period models. We seek in this paper to provide a theoretical justification to this practice when the underlying market is of Barndorff-Nielsen and Shephard type. This is done by verifying that an investor who seeks to maximize her expected terminal exponential utility of wealth in excess of her benchmark will in fact use an optimal portfolio equivalent to the one-period Markowitz mean-variance problem in continuum under the corresponding Black-Scholes market. Further, we can represent the solution to the optimization problem as in Feynman-Kac form. Hence, the problem, and its solution, is analogous to Merton's classical portfolio problem, with the main difference that Merton maximizes expected utility of terminal wealth, not wealth in excess of a benchmark.

  19. Optimization of spectral printer modeling based on a modified cellular Yule-Nielsen spectral Neugebauer model.

    Science.gov (United States)

    Liu, Qiang; Wan, Xiaoxia; Xie, Dehong

    2014-06-01

    The study presented here optimizes several steps in the spectral printer modeling workflow based on a cellular Yule-Nielsen spectral Neugebauer (CYNSN) model. First, a printer subdividing method was developed that reduces the number of sub-models while maintaining the maximum device gamut. Second, the forward spectral prediction accuracy of the CYNSN model for each subspace of the printer was improved using back propagation artificial neural network (BPANN) estimated n values. Third, a sequential gamut judging method, which clearly reduced the complexity of the optimal sub-model and cell searching process during printer backward modeling, was proposed. After that, we further modified the use of the modeling color metric and comprehensively improved the spectral and perceptual accuracy of the spectral printer model. The experimental results show that the proposed optimization approaches provide obvious improvements in aspects of the modeling accuracy or efficiency for each of the corresponding steps, and an overall improvement of the optimized spectral printer modeling workflow was also demonstrated.

  20. Anomaly-free discrete gauge symmetries in Froggatt-Nielsen models

    Energy Technology Data Exchange (ETDEWEB)

    Luhn, C.

    2006-05-15

    Discrete symmetries (DS) can forbid dangerous B- and L-violating operators in the supersymmetric Lagrangian. Due to the violation of global DSs by quantum gravity effects, the introduced DS should be a remnant of a spontaneously broken local gauge symmetry. Demanding anomaly freedom of the high-energy gauge theory, we determine all family-independent anomaly-free Z{sub N} symmetries which are consistent with the trilinear MSSM superpotential terms in Part I. We find one outstanding Z{sub 6} symmetry, proton hexality P{sub 6}, which prohibits all B- and L-violating operators up to dimension five, except for the Majorana neutrino mass terms LH{sub u}LH{sub u}. In Part II, we combine the idea that a DS should have a gauge origin with the scenario of Froggatt and Nielsen (FN). We construct concise U(1){sub X} FN models in which the Z{sub 3} symmetry baryon triality, B{sub 3}, arises from U(1){sub X} breaking. We choose this specific DGS because it allows for R-parity violating interactions; thus neutrino masses can be explained without introducing right-handed neutrinos. We find six phenomenologically viable B{sub 3}-conserving FN models. (orig.)

  1. Review: Niels C. Taubert (2006. Produktive Anarchie? Netzwerke freier Softwareentwicklung [Productive Anarchy? Networks of Open Source Software Development

    Directory of Open Access Journals (Sweden)

    Matthias Groß

    2007-01-01

    Full Text Available Open source software is software designed to allow anyone to use and make changes in the software. This practice often renders the product superior to more centralized models such as those used in commercial software companies. How is such a phenomenon possible in a time where nothing seems to be acquirable save by purchase? Niels C. TAUBERT's book Productive Anarchy? Networks of Open Source Software Development aims at a sociological understanding of the prerequisites and conditions for the success of open source software. One of the conclusions of TAUBERT's book is that the process of open software development needs to be understood as adaptive and experimental. A continuous feedback between the context of production and the context of application is the basis for robust and successful software production. One of the surprising results of the book is that the most important requirement for this feedback process is a set of norms—neutrality, communism, disinterestedness, and universalism—norms that Robert MERTON associated with academic science in the 1940s. If TAUBERT is right that these norms are to be found outside the world of institutional science in open source software development projects today, then his case study can be seen as an indicator for a new form of knowledge production in the 21st century, where the social relevance and responsibility of a research process are keys to successful innovation. With this book, which deserves a wide readership, TAUBERT makes an important contribution to our understanding of the successful organization of technology development. URN: urn:nbn:de:0114-fqs0701109

  2. Reduction of patient dose delivered by CHR diagnostic x-ray examinations

    International Nuclear Information System (INIS)

    Evans, R.D.; Schlenker, R.A.

    1978-01-01

    Three changes in technique have been made which reduce the x-ray dose delivered by diagnostic examinations of patients of the Center for Human Radiobiology (CHR): Kodak Lanex Regular screens and Kodak Ortho G film have been substituted for DuPont Cronex Parspeed screens and DuPont Cronex 4 film for five projections in the MIT examinations; 3 mm Al added filtration is now used in place of 1 mm Al added filtration in the ANL examination; improvements in collimation for the ANL examination have been made. Use of the new screen-film combination at MIT has reduced the mean dose to the active marrow of the female RANDO phantom from 606 +- 69 mrad to 235 +- 16 mrad; it has reduced the ovary dose from 606 +- 40 mrad to 291 +- 19 mrad and has left the breast dose unchanged at 333 +- 103 mrad. The change from 1 mm Al to 3 mm Al added filtration at ANL, without changes in collimation, would reduce the mean marrow dose in the phantom from 232 +- 14 mrad to 175 +- 26 mrad, reduce the ovary dose from 243 +- 25 mrad to 162 +- 38 mrad and reduce the breast dose from 388 +- 35 mrad to 226 +- 9 mrad. The changes in collimation at ANL should reduce these doses even further but the quantitative effect has not been ascertained

  3. Reduction of Hexavalent Chromium and Detection of Chromate Reductase (ChrR in Stenotrophomonas maltophilia

    Directory of Open Access Journals (Sweden)

    Rosa Baldiris

    2018-02-01

    Full Text Available An Gram negative strain of S. maltophilia, indigenous to environments contaminated by Cr(VI and identified by biochemical methods and 16S rRNA gene analysis, reduced chromate by 100%, 98–99% and 92% at concentrations in the 10–70, 80–300, and 500 mg/L range, respectively at pH 7 and temperature 37 °C. Increasing concentrations of Cr(VI in the medium lowered the growth rate but could not be directly correlated with the amount of Cr(VI reduced. The strain also exhibited multiple resistance to antibiotics and tolerance and resistance to various heavy metals (Ni, Zn and Cu, with the exception of Hg. Hexavalent chromium reduction was mainly associated with the soluble fraction of the cell evaluated with crude cell-free extracts. A protein of molecular weight around 25 kDa was detected on SDS-PAGE gel depending on the concentration of hexavalent chromium in the medium (0, 100 and 500 mg/L. In silico analysis in this contribution, revealed the presence of the chromate reductase gene ChrR in S. maltophilia, evidenced through a fragment of around 468 bp obtained experimentally. High Cr(VI concentration resistance and high Cr(VI reducing ability of the strain make it a suitable candidate for bioremediation.

  4. A Genome-wide Association Study Provides Evidence of Sex-specific Involvement of Chr1p35.1 (ZSCAN20-TLR12P and Chr8p23.1 (HMGB1P46 With Diabetic Neuropathic Pain

    Directory of Open Access Journals (Sweden)

    Weihua Meng

    2015-10-01

    Full Text Available Neuropathic pain is defined as pain arising as a direct consequence of a lesion or a disease affecting the somatosensory system and it affects around 1 in 4 diabetic patients in the UK. The purpose of this genome-wide association study (GWAS was to identify genetic contributors to this disorder. Cases of neuropathic pain were defined as diabetic patients with a multiple prescription history of at least one of five drugs specifically indicated for the treatment of neuropathic pain. Controls were diabetic individuals who were not prescribed any of these drugs, nor amitriptyline, carbamazepine, or nortriptyline. Overall, 961 diabetic neuropathic pain cases and 3260 diabetic controls in the Genetics of Diabetes Audit and Research Tayside (GoDARTS cohort were identified. We found a cluster in the Chr1p35.1 (ZSCAN20-TLR12P with a lowest P value of 2.74 × 10−7 at rs71647933 in females and a cluster in the Chr8p23.1, next to HMGB1P46 with a lowest P value of 8.02 × 10−7 at rs6986153 in males. Sex-specific narrow sense heritability was higher in males (30.0% than in females (14.7%. This GWAS on diabetic neuropathic pain provides evidence for the sex-specific involvement of Chr1p35.1 (ZSCAN20-TLR12P and Chr8p23.1 (HMGB1P46 with the disorder, indicating the need for further research.

  5. Improving the Yule-Nielsen modified Neugebauer model by dot surface coverages depending on the ink superposition conditions

    Science.gov (United States)

    Hersch, Roger David; Crete, Frederique

    2005-01-01

    Dot gain is different when dots are printed alone, printed in superposition with one ink or printed in superposition with two inks. In addition, the dot gain may also differ depending on which solid ink the considered halftone layer is superposed. In a previous research project, we developed a model for computing the effective surface coverage of a dot according to its superposition conditions. In the present contribution, we improve the Yule-Nielsen modified Neugebauer model by integrating into it our effective dot surface coverage computation model. Calibration of the reproduction curves mapping nominal to effective surface coverages in every superposition condition is carried out by fitting effective dot surfaces which minimize the sum of square differences between the measured reflection density spectra and reflection density spectra predicted according to the Yule-Nielsen modified Neugebauer model. In order to predict the reflection spectrum of a patch, its known nominal surface coverage values are converted into effective coverage values by weighting the contributions from different reproduction curves according to the weights of the contributing superposition conditions. We analyze the colorimetric prediction improvement brought by our extended dot surface coverage model for clustered-dot offset prints, thermal transfer prints and ink-jet prints. The color differences induced by the differences between measured reflection spectra and reflection spectra predicted according to the new dot surface estimation model are quantified on 729 different cyan, magenta, yellow patches covering the full color gamut. As a reference, these differences are also computed for the classical Yule-Nielsen modified spectral Neugebauer model incorporating a single halftone reproduction curve for each ink. Taking into account dot surface coverages according to different superposition conditions considerably improves the predictions of the Yule-Nielsen modified Neugebauer model. In

  6. O Concerto para Clarineta, Op.57 de Carl Nielsen: contexto, análises e interpretações Carl Nielsen's Clarinet Concerto, Op.57: context, analysis and performance

    Directory of Open Access Journals (Sweden)

    Vinicius de Sousa Fraga

    2013-06-01

    Full Text Available Composto em 1928, o Concerto para Clarineta, Op.57, de Carl Nielsen (1865-1931 tornou-se uma obra fundamental na literatura da clarineta no século XX. A presente pesquisa procura discutir algumas de suas questões de performance através de uma contextualização da época em que foi escrito, com ênfase nos aspectos relevantes sobre o compositor e a produção da obra. São observadas as divergências entre a edição da Samfundet e os originais manuscritos. Por meio de uma análise da obra, busca-se discutir sua recepção inicial e seu papel na literatura da clarineta.Composed in 1928, Carl Nielsen's Clarinet Concerto, Op.57 became a fundamental work in the twentieth century clarinet literature. This study discusses some of the work's performance aspects by means of examining its context related to its composer and compositional procedures. The discrepancies between the Sanfundet edition and the composer's manuscripts are observed. Analysis aspects of the work support the discussion about its initial reception and its role in the clarinet literature.

  7. Niels Juels sidste togt

    DEFF Research Database (Denmark)

    Nørby, Søren

    2017-01-01

    Den 29. august 1943 var en af de mest dramatiske dage under den tyske besættelse af Danmark. Denne dag brød samarbejdspolitikken sammen, og tyske styrker satte sig derfor i besiddelse af den danske hær og flådes materiel. Enkelte steder kom det til kamp mellem danske og tyske styrker, og en af de...

  8. Aarhus Conference on Probability, Statistics and Their Applications : Celebrating the Scientific Achievements of Ole E. Barndorff-Nielsen

    CERN Document Server

    Stelzer, Robert; Thorbjørnsen, Steen; Veraart, Almut

    2016-01-01

    Collecting together twenty-three self-contained articles, this volume presents the current research of a number of renowned scientists in both probability theory and statistics as well as their various applications in economics, finance, the physics of wind-blown sand, queueing systems, risk assessment, turbulence and other areas. The contributions are dedicated to and inspired by the research of Ole E. Barndorff-Nielsen who, since the early 1960s, has been and continues to be a very active and influential researcher working on a wide range of important problems. The topics covered include, but are not limited to, econometrics, exponential families, Lévy processes and infinitely divisible distributions, limit theory, mathematical finance, random matrices, risk assessment, statistical inference for stochastic processes, stochastic analysis and optimal control, time series, and turbulence. The book will be of interest to researchers and graduate students in probability, statistics and their applications. .

  9. Recessive cardiac phenotypes in induced pluripotent stem cell models of Jervell and Lange-Nielsen syndrome: disease mechanisms and pharmacological rescue

    NARCIS (Netherlands)

    Zhang, Miao; D'Aniello, Cristina; Verkerk, Arie O.; Wrobel, Eva; Frank, Stefan; Ward-van Oostwaard, Dorien; Piccini, Ilaria; Freund, Christian; Rao, Jyoti; Seebohm, Guiscard; Atsma, Douwe E.; Schulze-Bahr, Eric; Mummery, Christine L.; Greber, Boris; Bellin, Milena

    2014-01-01

    Jervell and Lange-Nielsen syndrome (JLNS) is one of the most severe life-threatening cardiac arrhythmias. Patients display delayed cardiac repolarization, associated high risk of sudden death due to ventricular tachycardia, and congenital bilateral deafness. In contrast to the autosomal dominant

  10. De l’utopie socialiste au réalisme chrétien

    Directory of Open Access Journals (Sweden)

    Isabelle Richet

    2006-03-01

    Full Text Available Le New Deal est le premier mouvement réformiste d’ampleur dans l’histoire des Etats‑Unis qui n’ait pas été inspiré, ni soutenu, par les forces du protestantisme. Si une majorité des protestants et de leur clergé se sont opposés au New Deal à partir de positions conservatrices, le théologien Reinhold Niebuhr en a développé au départ une virulente critique de gauche avant de finalement rallier le président démocrate à la fin des années trente. Nourrie par le rejet de l’idéalisme du Social Gospel, incapable à ses yeux de comprendre les rapports sociaux en terme de classe et de pouvoir, la critique de Niebuhr emprunte les outils d’analyse marxistes pour développer une approche réaliste, tant du point de vue des fins que des moyens de la lutte politique. Le New Deal lui apparaît avant tout comme un programme visant à sauver le capitalisme, alors que la société fondée sur la justice qu’il envisage passe par la socialisation des moyens de production qui ne pourra émerger qu’à travers des conflits sociaux au cours desquels les moyens de lutte même violents sont justifiés. Mais sous l’influence des évènements en Europe au lendemain de la victoire d’Hitler, Reinhold Niebuhr se tourne au milieu des années trente vers une réflexion théologique inspirée de l’orthodoxie de Karl Barth et de son frère Richard Niebuhr, qui l’amène à réintroduire le péché comme la limite absolue de toute l’expérience humaine, interdisant d’envisager la création d’une société de paix et de justice. Ce nouvel absolutisme théologique nourrit un relativisme politique, le réalisme chrétien consistant désormais à choisir la moins mauvaise des options en présence. De ce point de vue, le président démocrate qui appelle à la préparation militaire s’impose désormais comme le choix le plus réaliste face à la montée du fascisme en Europe.The New Deal was the first major reformist experiment in the

  11. Du neuf dans les relations de l'Église orthodoxe avec les autres chrétiens

    OpenAIRE

    Famerée, Joseph

    2015-01-01

    Cette note évoque quatre réunions scientifiques (Athènes, Chambésy, Thessalonique, Iasi) qui, coup sur coup, de mai 2013 à mai 2014, ont permis à des Orthodoxes d’échanger avec d’autres chrétiens, catholiques notamment, sur des sujets théologiques et œcuméniques importants pour l’évolution des différentes Églises. Une nouvelle génération de théologiens orthodoxes se lève, osant parler librement à propos de leur Église et montrer l’écart entre l’Orthodoxie idéale et l’Orthodoxie réelle, spécia...

  12. Froggatt-Nielsen meets Mordell-Weil: a phenomenological survey of global F-theory GUTs with U(1)s

    International Nuclear Information System (INIS)

    Krippendorf, Sven; Schäfer-Nameki, Sakura; Wong, Jin-Mann

    2015-01-01

    In F-theory, U(1) gauge symmetries are encoded in rational sections, which generate the Mordell-Weil group of the elliptic fibration of the compactification space. Recently the possible U(1) charges for global SU(5) F-theory GUTs with smooth rational sections were classified http://dx.doi.org/10.1007/JHEP09(2015)144. In this paper we utilize this classification to probe global F-theory models for their phenomenological viability. After imposing an exotic-free MSSM spectrum, anomaly cancellation (related to hypercharge flux GUT breaking in the presence of U(1) gauge symmetries), absence of dimension four and five proton decay operators and other R-parity violating couplings, and the presence of at least the third generation top Yukawa coupling, we generate the remaining quark and lepton Yukawa textures by a Froggatt-Nielsen mechanism. In this process we require that the dangerous couplings are forbidden at leading order, and when re-generated by singlet vevs, lie within the experimental bounds. We scan over all possible configurations, and show that only a small class of U(1) charge assignments and matter distributions satisfy all the requirements. The solutions give rise to the exact MSSM spectrum with realistic quark and lepton Yukawa textures, which are consistent with the CKM and PMNS mixing matrices. We also discuss the geometric realization of these models, and provide pointers to the class of elliptic fibrations with good phenomenological properties.

  13. Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148

    NARCIS (Netherlands)

    Fang, Jun; Jia, Jinping; Makowski, Matthew; Xu, Mai; Wang, Zhaoming; Zhang, Tongwu; Hoskins, Jason W; Choi, Jiyeon; Han, Younghun; Zhang, Mingfeng; Thomas, Janelle; Kovacs, Michael; Collins, Irene; Dzyadyk, Marta; Thompson, Abbey; O'Neill, Maura; Das, Sudipto; Lan, Qi; Koster, Roelof; Stolzenberg-Solomon, Rachael S; Kraft, Peter; Wolpin, Brian M; Jansen, Pascal W T C; Olson, Sara H; McGlynn, Katherine A; Kanetsky, Peter A; Chatterjee, Nilanjan; Barrett, Jennifer H.; Dunning, Alison M.; Taylor, John C.; Newton-Bishop, Julia A; Bishop, D. Timothy; Andresson, Thorkell; Petersen, Gloria M; Amos, Christopher I; Iles, Mark M.; Nathanson, Katherine L.; Landi, Maria Teresa; Vermeulen, Michiel; Brown, Kevin M; Amundadottir, Laufey T; Peeters, P

    2017-01-01

    Genome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of these,

  14. Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148

    NARCIS (Netherlands)

    Fang, J. (Jun); Jia, J. (Jinping); Makowski, M. (Matthew); Xu, M. (Mai); Z. Wang (Zhaoming); Zhang, T. (Tongwu); Hoskins, J.W. (Jason W.); Choi, J. (Jiyeon); Han, Y. (Younghun); M. Zhang (Mingfeng); Thomas, J. (Janelle); Kovacs, M. (Michael); Collins, I. (Irene); Dzyadyk, M. (Marta); Thompson, A. (Abbey); O'Neill, M. (Maura); Das, S. (Sudipto); Lan, Q. (Qi); Koster, R. (Roelof); Stolzenberg-Solomon, R.S. (Rachael S.); P. Kraft (Peter); Wolpin, B.M. (Brian M.); P. Jansen; Olson, S. (Sara); K.A. McGlynn; P.P. Kanetsky (Peter P.); N. Chatterjee (Nilanjan); J.H. Barrett (Jennifer H.); A.M. Dunning (Alison); Taylor, J.C. (John C.); J.A. Newton Bishop (Julia); Timothy Bishop, D. (D.); Andresson, T. (Thorkell); Petersen, G.M. (Gloria M.); W. Amos; M.M. Iles (Mark M.); K.L. Nathanson (Katherine); Landi, M.T. (Maria Teresa); M. Vermeulen (Michiel); Brown, K.M. (Kevin M.); Amundadottir, L.T. (Laufey T.)

    2017-01-01

    textabstractGenome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of

  15. Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148.

    NARCIS (Netherlands)

    Fang, Jun; Jia, Jinping; Makowski, Matthew; Xu, Mai; Wang, Zhaoming; Zhang, Tongwu; Hoskins, Jason W; Choi, Jiyeon; Han, Younghun; Zhang, Mingfeng; Thomas, Janelle; Kovacs, Michael; Collins, Irene; Dzyadyk, Marta; Thompson, Abbey; O'Neill, Maura; Das, Sudipto; Lan, Qi; Koster, Roelof; Stolzenberg-Solomon, Rachael S; Kraft, Peter; Wolpin, Brian M; Jansen, Pascal W T C; Olson, Sara; McGlynn, Katherine A; Kanetsky, Peter A; Chatterjee, Nilanjan; Barrett, Jennifer H; Dunning, Alison M; Taylor, John C; Newton-Bishop, Julia A; Bishop, D Timothy; Andresson, Thorkell; Petersen, Gloria M; Amos, Christopher I; Iles, Mark M; Nathanson, Katherine L; Landi, Maria Teresa; Vermeulen, Michiel; Brown, Kevin M; Amundadottir, Laufey T

    2017-01-01

    Genome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of these,

  16. Comprehensive fine mapping of chr12q12-14 and follow-up replication identify activin receptor 1B (ACVR1B) as a muscle strength gene

    NARCIS (Netherlands)

    Windelinckx, An; De Mars, Gunther; Huygens, Wim; Peeters, Maarten W.; Vincent, Barbara; Wijmenga, Cisca; Lambrechts, Diether; Delecluse, Christophe; Roth, Stephen M.; Metter, E. Jeffrey; Ferrucci, Luigi; Aerssens, Jeroen; Vlietinck, Robert; Beunen, Gaston P.; Thomis, Martine A.

    Muscle strength is important in functional activities of daily living and the prevention of common pathologies. We describe the two-staged fine mapping of a previously identified linkage peak for knee strength on chr12q12-14. First, 209 tagSNPs in/around 74 prioritized genes were genotyped in 500

  17. Los orígenes del grial en la literatura medieval: de Chrétien de Troyes a Robert de Boron

    Directory of Open Access Journals (Sweden)

    Mario Martín Botero

    2010-12-01

    Full Text Available Este artículo muestra el origen literario del tema del Grial en la literatura medieval francesa, abordando dos textos esenciales para el surgimiento y consolidación de la “literatura del Grial”: Le Conte du Graal de Chrétien de Troyes y Le Roman de l’Estoire dou Graal de Robert de Boron. Los autores de estas obras establecen las bases para el desarrollo de toda una temática que gira alrededor del Grial a partir del siglo XII hasta nuestros días. El artículo muestra cómo de un objeto apenas sagrado en el texto de Chrétien de Troyes se pasa a una reliquia de la sangre de Cristo en la versión de Robert de Boron.This paper studies the literary origin of the Grail legend in medieval French literature, taking into account two important romances: Le Conte du Graal by Chrétien de Troyes and Le Roman de l’Estoire dou Graal by Robert de Boron. In these two texts the authors established the basis for the development of a new subject matter around the mysterious object called “Grail” from the Middle Ages to the present times. It will also be shown how an object, not totally sacred in Chrétien de Troyes, becomes a relic related with Jesus’s blood in Robert de Boron.

  18. Une catastrophe glorieuse : le martyre des premiers chrétiens du Japon, Nagasaki, 1597

    Directory of Open Access Journals (Sweden)

    Clotilde Jacquelard

    2011-11-01

    Full Text Available Le naufrage du galion San Felipe dans le port de Urado (Shikoku, Japon en octobre 1596 fut le déclencheur d’un désastre missionnaire : le martyre de vingt-six chrétiens, franciscains espagnols et chrétiens japonais, à Nagasaki, le 5 février 1597. Cet article s’attache à examiner la relation dialectique entre les deux événements par l’étude de deux discours missionnaires franciscains hagiographiques. Il s’agit tout d’abord de rappeler la lecture providentialiste du temps à travers la perception de présages matériels et spirituels de la part des acteurs, puis de montrer que ces évènements paroxystiques révèlent en même temps qu’ils résolvent – temporairement – des tensions et des crises latentes, résultat de la confrontation entre plusieurs communautés culturelles comme la japonaise, l’espagnole et la portugaise, autour de prétentions géopolitiques, commerciales et religieuses dans cette zone de frontière de l’antiméridien du Pacifique nord.El naufragio del galeón San Felipe en el puerto de Urado (Shikoku, Japón en octubre de 1596 desembocó en un desastre misionero : el martirio de veintiséis cristianos, franciscanos españoles y cristianos japoneses, en Nagasaki, el 5 de febrero de 1597. Este artículo quiere examinar la relación dialéctica entre ambos acontecimientos, mediante el estudio de dos discursos misioneros franciscanos hagiográficos. Se trata de recordar primero la lectura providencialista de la época a través de la percepción de presagios tanto materiales como espirituales por parte de los actores, y mostrar luego que estos acontecimientos paroxísticos revelan, al mismo tiempo que resuelven –temporalmente– tensiones y crisis latentes, resultados de la confrontación de varias comunidades culturales como la japonesa, la española y la portuguesa, en torno a pretensiones geopolíticas, comerciales y religiosas en la zona fronteriza del antimeridiano del Pacífico norte.

  19. Living Joyfully after Losing Social Hope: Kierkegaard and Chrétien on Selfhood and Eschatological Expectation

    Directory of Open Access Journals (Sweden)

    J. Aaron Simmons

    2017-02-01

    Full Text Available In this essay, I offer an existential-phenomenological consideration of what it might look like to live joyfully after losing social hope. Using the example of the widespread hopelessness that many are feeling in light of the election of Donald Trump, I suggest that the danger of losing hope is that we can also lose our selfhood in the process. In order to develop a conception of “eschatological hope” that would be resistant to the loss of such social and political expectations, I draw specifically on Søren Kierkegaard’s notion that “the expectancy of faith is victory,” and Jean-Louis Chrétien’s idea of “the unhoped for,” in order to develop a model of hope that remains when it seems like all other hope has been lost. Rather than being overcome by anxiety about the future, eschatological hope fosters joy in the present.

  20. ANDERS GAMMELGAARD NIELSEN

    DEFF Research Database (Denmark)

    Gammelgaard Nielsen, Anders

    2015-01-01

    conducting research in this field. His research work is especially directed towards the perceptual relationship to materials as well as the opportunities of creating atmospheres through e use of building materials. As a practicing architect, he designed a series of smaller buildings and structures. Parallel...... to his work as an architect, he has a career as a sculptor. He received his basic teaching in sculpture at Edinburgh College of Art and has since been autodidact. He has exhibited in numerous national exhibitions and is currently a member of the artist group "Guirlanden". He is a member of the Danish...... Moore and Barbara Heptworth, whereas the later have a strong affinity to the works of Constantin Brancusi and Eduardo Chillida. The developments in the sculptural works can be seen with a parallel to the architectural research in materials and tectonics. Thus his research work has resulted in artefacts...

  1. Jeux et enjeux d’écriture chez Chrétien de Troyes: l’exemple de «Cligès»

    Directory of Open Access Journals (Sweden)

    Ida Lucia Machado

    2011-10-01

    Full Text Available Neste artigo, nos propomos descrever a estética da trama irônica presente na escritura de Chrétien de Troyes, tomando por base seu romance Cligès. A destacar algumas estratégias passíveis de criar o fenômeno irônico, estaremos também mostrando o poder de sedução que emana desta escritura.Nous nous proposons, dans cet artible, de décrire l’esthétique du jeu ironique chez Chrétien de Troyes, em puisant dans son roman Cligès. Enn dégageant qulques unes dês stratégies susceptibles de créer le phénomène ironique, nous montrerons, à la fois, le pouvoir de séduction qui emane de cette écriture.

  2. A Phase Ib dose-escalation study to evaluate safety and tolerability of the addition of the aminopeptidase inhibitor tosedostat (CHR-2797) to paclitaxel in patients with advanced solid tumours

    NARCIS (Netherlands)

    C.M.L. Herpen (Carla); F.A.L.M. Eskens (Ferry); M.J.A. de Jonge (Maja); I.M.E. Desar (Ingrid); L. Hooftman (Leon); E. Bone (Elisabeth); J.N.H. Timmerbonte (Johanna); J. Verweij (Jaap)

    2010-01-01

    textabstractBackground: This Phase Ib dose-escalating study investigated safety, maximum tolerated dose (MTD), dose-limiting toxicity (DLT), pharmacokinetics (PK) and clinical antitumour activity of tosedostat (CHR-2797), an orally bioavailable aminopeptidase inhibitor, in combination with

  3. A Phase Ib dose-escalation study to evaluate safety and tolerability of the addition of the aminopeptidase inhibitor tosedostat (CHR-2797) to paclitaxel in patients with advanced solid tumours.

    NARCIS (Netherlands)

    Herpen, C.M.L. van; Eskens, F.A.; Jonge, M. de; Desar, I.M.E.; Hooftman, L.; Bone, E.A.; Timmer-Bonte, J.N.H.; Verweij, J.

    2010-01-01

    BACKGROUND: This Phase Ib dose-escalating study investigated safety, maximum tolerated dose (MTD), dose-limiting toxicity (DLT), pharmacokinetics (PK) and clinical antitumour activity of tosedostat (CHR-2797), an orally bioavailable aminopeptidase inhibitor, in combination with paclitaxel. METHODS:

  4. Implementation and Analysis of the Chromakey Augmented Virtual Environment (ChrAVE) Version 3.0 and Virtual Environment Helicopter (VEHELO) Version 2.0 in Simulated Helicopter Training

    National Research Council Canada - National Science Library

    Hahn, M. E

    2005-01-01

    The Chromakey Augmented Virtual Environment (ChrAVE) 3.0 System is a training system created to augment initial, refresher, and proficiency training in helicopter aviation using accurate simulation...

  5. Om Chr. Petersen

    DEFF Research Database (Denmark)

    Rasborg, Klaus

    1992-01-01

    Om en i dag næsten glemt skikkelse i dansk sociologi, der i sin samtid især blev kendt for sin doktordisputats om den franske sociolog Émile Durkheim......Om en i dag næsten glemt skikkelse i dansk sociologi, der i sin samtid især blev kendt for sin doktordisputats om den franske sociolog Émile Durkheim...

  6. A tribute to Niels Bohr

    International Nuclear Information System (INIS)

    Kubbinga, H.

    2008-01-01

    The 3 most important scientific achievements of N.Bohr follow. First, the Bohr-Rutherford atomic model in which Thomson's electrons, Rutherford's nucleus and Planck's quanta merged together to explain the line spectra of atoms. Secondly, the compound nucleus model in which Bohr explained nuclear reactions by the production of an intermediate state by the impact of an incident nucleus: the entering projectile would hit one or more nucleons, its energy and momentum being spread over them and after a while when one or more nucleons have acquired sufficient energy they escape from the compound nucleus. And thirdly, the drop model that presents the nucleus as behaving like a liquid, with modes of surface and volume oscillations of its own, ready to become excited isotopes by incoming neutrons. (A.C.)

  7. Development of Joint Climate and Discharge Projections for the International Rhine River Basin - the CHR RheinBlick2050 Project

    Science.gov (United States)

    Görgen, K.; Pfister, L.

    2008-12-01

    The anticipated climate change will lead to modified hydro-meteorological regimes that influence discharge behaviour and hydraulics of rivers. This has variable impacts on managed (anthropogenic) and unmanaged (natural) systems, depending on their sensitivity and vulnerability (ecology, economy, infrastructure, transport, energy production, water management, etc.). Decision makers in these contexts need adequate adaptation strategies to minimize adverse effects of climate change, i.e. an improved knowledge on the potential impacts including uncertainties means an extension of the informed options open to users. The goal of the highly applied study presented here is the development of joint, consistent climate and discharge projections for the international Rhine River catchments (Switzerland, France, Germany, Netherlands) in order to assess future changes of hydro-meteorological regimes in the meso- and macroscale Rhine River catchments and to derive and improve the understanding of such impacts on hydrologic and hydraulic processes. The RheinBlick2050 project is an international effort initiated by the International Commission for the Hydrology of the Rhine Basin (CHR) in close cooperation with the International Commission for the Protection of the Rhine. The core experiment design foresees a data-synthesis, multi-model approach where (transient) (bias- corrected) regional climate change projections are used as forcing data for existing calibrated hydrological (and hydraulic) models at a daily temporal resolution over mesoscale catchments of the Rhine River. Mainly for validation purposes, hydro-meteorological observations from national weather services are compiled into a new consistent 5 km x 5 km reference dataset from 1961 to 2005. RCM data are mainly used from the ENSEMBLES project and other existing dynamical downscaling model runs to derive probabilistic ensembles and thereby also access uncertainties on a regional scale. A benchmarking is helping to

  8. Los enigmas del Grial. En torno a la polémica sobre la unidad de El Cuento del Grial de Chrétien de Troyes

    Directory of Open Access Journals (Sweden)

    Victoria Cirlot

    2014-12-01

    Full Text Available Relectura de la polémica acerca de la unidad del último roman de Chrétien de Troyes, Li Contes del Graal que tuvo lugar a finales de los años cincuenta entre Martín de Riquer, Jean Frappier y Erich Köhler. Más de cincuenta años después se trata de valorar las aportaciones que dicha polémica supuso para la filología románica y, en concreto, para la valoración de la última obra del escritor de la Champaña.

  9. Orelhas de elefante, olhos de coruja, dentes de javali: maravilhoso e descritivo em Yvain ou le chevalier au lion, de Chrétien de Troyes

    OpenAIRE

    Luis Claudio Kinker Caliendo

    2009-01-01

    No final do século XII, Chrétien de Troyes considerado por muitos críticos o maior poeta francês da chamada Idade Média compõe um poema narrativo Yvain ou le Chevalier au Lion no qual se percebem elementos tidos como característicos do gênero maravilhoso, tais quais objetos mágicos e seres extraordinários, como monstros e gigantes. Esses elementos entre outros fatores levaram boa parte da crítica a enxergar na poesia medieval, durante muito tempo, uma certa ingenuidade, típica de uma in...

  10. Jervell and Lange-Nielsen syndrome in a father and daughter from a large highly inbred family: a 16-year follow-up of 59 living members.

    Science.gov (United States)

    Sanyal, Shyamal Kumar; Kaul, Kanwar K; Hussein, Akhtar; Wilroy, Robert S; Agarwal, Kisan; Sohel, Saira

    2013-08-01

    To report the autosomal dominant inheritance of the Jervell and Lange-Nielsen syndrome in a highly inbred family, the initiation of Torsades de Pointes, and the natural history of the syndrome based on a 16-year follow-up of the kindred. A family tree was constructed that included 66 blood relatives from three successive generations. Electrocardiograms were obtained from 59 living members including the proband, four members from a nuclear family, and 54 from the extended family. Evoked response audiometry was recorded for the proband and the nuclear family. All 59 family members were followed up regularly for 16 years. A total of 24 living members were affected--QTc: 480-680 ms. The proband had long QTc, bilateral high-tone sensorineural deafness, recurrent syncope, and Torsades de Pointes. The asymptomatic father had long QTc and unilateral high-tone sensorineural deafness that involved specifically the left ear. One asymptomatic sibling of the proband had long QTc and normal hearing. The mother and another sibling were asymptomatic; QTc and hearing were normal in both. A total of 21 affected members from the extended family had only long QTc, and all were asymptomatic. There were three congenitally deaf first cousins who had recurrent syncope and adrenergic-triggered sudden death. In all, seven of 10 parents had consanguineous marriage to a first cousin. Each affected offspring had at least one affected parent. The severely symptomatic proband who received only β-blocker therapy and the 23 affected members without antiadrenergic therapy, all remained asymptomatic throughout the 16-year follow-up period. Jervell and Lange-Nielsen syndrome was inherited as autosomal dominant in this kindred. The majority of the affected members had a mild phenotype. The severity of auditory and cardiac phenotypes corresponded.

  11. Da Chrétien de Troyes a Shakespeare («The tragedy of King Richard the Third», a. I, sc. 2

    Directory of Open Access Journals (Sweden)

    Alfonso D'Agostino

    2015-07-01

    Full Text Available L’articolo si propone di considerare le somiglianze fra alcune vicende antico-francesi (l’Yvain di Chrétien de Troyes e il fabliau anonimo De celle que se fist foutre sur la fosse son mari con una scena del Riccardo III di Shakespeare. Anche se non si può dire che il dramma inglese dipenda dai testi narrativi oitanici, esso sviluppa lo stesso motivo della vedova consolata e una serie di motivi secondarî, di immagini (il sangue, il diavolo, la seduzione e di espressioni letterarie in modo sintomaticamente affine. The paper aims to evaluate similarities between some Old-French narratives (Chrétien de Troyes’ Yvain and the anonymous fabliau De celle que se fist foutre sur la fosse son mari and a scene from Shakespeare’s Richard III. Although we cannot affirm that Shakespeare’s play derives from the French narratives, it develops the same theme of “comforted widow” along with a series of secondary themes, of images (the blood, the devil, the seduction and literary expressions in a symptomatically, very similar way.

  12. Application of response surface methodology for rapid chrysene biodegradation by newly isolated marine-derived fungus Cochliobolus lunatus strain CHR4D.

    Science.gov (United States)

    Bhatt, Jwalant K; Ghevariya, Chirag M; Dudhagara, Dushyant R; Rajpara, Rahul K; Dave, Bharti P

    2014-11-01

    For the first time, Cochliobolus lunatus strain CHR4D, a marine-derived ascomycete fungus isolated from historically contaminated crude oil polluted shoreline of Alang-Sosiya ship-breaking yard, at Bhavnagar coast, Gujarat has been reported showing the rapid and enhanced biodegradation of chrysene, a four ringed high molecular weight (HMW) polycyclic aromatic hydrocarbon (PAH). Mineral Salt Broth (MSB) components such as ammonium tartrate and glucose along with chrysene, pH and trace metal solution have been successfully optimized by Response Surface Methodology (RSM) using central composite design (CCD). A validated, two-step optimization protocol has yielded a substantial 93.10% chrysene degradation on the 4(th) day, against unoptimized 56.37% degradation on the 14(th) day. The results depict 1.65 fold increase in chrysene degradation and 1.40 fold increase in biomass with a considerable decrement in time. Based on the successful laboratory experiments, C. lunatus strain CHR4D can thus be predicted as a potential candidate for mycoremediation of HMW PAHs impacted environments.

  13. A 'college of astrology and medicine'? Charles V, Gervais Chrétien, and the scientific manuscripts of Maître Gervais's College.

    Science.gov (United States)

    Boudet, Jean-Patrice

    2010-06-01

    Considered an institution mainly devoted to astrology and medicine by Simon de Phares and by some historians who believe that he was reliable, the college founded in 1371 by Charles V's first physician, Gervais Chrétien, was in fact primarily dedicated to theological students. It was not before 1377 that there were created there two bursaries for scholares regis, specialising in 'licit mathematical sciences', and two medical fellowships. Yet the influence of the activity of these fellows seems to have been rather moderate and-as far as we can learn from the material still extant, notably from manuscripts that belonged to Maître Gervais' College and to some of its members-this institution was devoted much more to theological studies than to medicine and the quadrivium.

  14. Virally mediated Kcnq1 gene replacement therapy in the immature scala media restores hearing in a mouse model of human Jervell and Lange-Nielsen deafness syndrome.

    Science.gov (United States)

    Chang, Qing; Wang, Jianjun; Li, Qi; Kim, Yeunjung; Zhou, Binfei; Wang, Yunfeng; Li, Huawei; Lin, Xi

    2015-08-01

    Mutations in the potassium channel subunit KCNQ1 cause the human severe congenital deafness Jervell and Lange-Nielsen (JLN) syndrome. We applied a gene therapy approach in a mouse model of JLN syndrome (Kcnq1(-/-) mice) to prevent the development of deafness in the adult stage. A modified adeno-associated virus construct carrying a Kcnq1 expression cassette was injected postnatally (P0-P2) into the endolymph, which resulted in Kcnq1 expression in most cochlear marginal cells where native Kcnq1 is exclusively expressed. We also found that extensive ectopic virally mediated Kcnq1 transgene expression did not affect normal cochlear functions. Examination of cochlear morphology showed that the collapse of the Reissner's membrane and degeneration of hair cells (HCs) and cells in the spiral ganglia were corrected in Kcnq1(-/-) mice. Electrophysiological tests showed normal endocochlear potential in treated ears. In addition, auditory brainstem responses showed significant hearing preservation in the injected ears, ranging from 20 dB improvement to complete correction of the deafness phenotype. Our results demonstrate the first successful gene therapy treatment for gene defects specifically affecting the function of the stria vascularis, which is a major site affected by genetic mutations in inherited hearing loss. © 2015 The Authors. Published under the terms of the CC BY 4.0 license.

  15. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency

    NARCIS (Netherlands)

    Prins, M.; van Leeuwen, M.W.; Teske, E.

    2009-01-01

    Tijdschr Diergeneeskd. 2009 Apr 1;134(7):272-8. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency. Prins M, van Leeuwen MW, Teske E.

  16. Recessive cardiac phenotypes in induced pluripotent stem cell models of Jervell and Lange-Nielsen syndrome: disease mechanisms and pharmacological rescue.

    Science.gov (United States)

    Zhang, Miao; D'Aniello, Cristina; Verkerk, Arie O; Wrobel, Eva; Frank, Stefan; Ward-van Oostwaard, Dorien; Piccini, Ilaria; Freund, Christian; Rao, Jyoti; Seebohm, Guiscard; Atsma, Douwe E; Schulze-Bahr, Eric; Mummery, Christine L; Greber, Boris; Bellin, Milena

    2014-12-16

    Jervell and Lange-Nielsen syndrome (JLNS) is one of the most severe life-threatening cardiac arrhythmias. Patients display delayed cardiac repolarization, associated high risk of sudden death due to ventricular tachycardia, and congenital bilateral deafness. In contrast to the autosomal dominant forms of long QT syndrome, JLNS is a recessive trait, resulting from homozygous (or compound heterozygous) mutations in KCNQ1 or KCNE1. These genes encode the α and β subunits, respectively, of the ion channel conducting the slow component of the delayed rectifier K(+) current, IKs. We used complementary approaches, reprogramming patient cells and genetic engineering, to generate human induced pluripotent stem cell (hiPSC) models of JLNS, covering splice site (c.478-2A>T) and missense (c.1781G>A) mutations, the two major classes of JLNS-causing defects in KCNQ1. Electrophysiological comparison of hiPSC-derived cardiomyocytes (CMs) from homozygous JLNS, heterozygous, and wild-type lines recapitulated the typical and severe features of JLNS, including pronounced action and field potential prolongation and severe reduction or absence of IKs. We show that this phenotype had distinct underlying molecular mechanisms in the two sets of cell lines: the previously unidentified c.478-2A>T mutation was amorphic and gave rise to a strictly recessive phenotype in JLNS-CMs, whereas the missense c.1781G>A lesion caused a gene dosage-dependent channel reduction at the cell membrane. Moreover, adrenergic stimulation caused action potential prolongation specifically in JLNS-CMs. Furthermore, sensitivity to proarrhythmic drugs was strongly enhanced in JLNS-CMs but could be pharmacologically corrected. Our data provide mechanistic insight into distinct classes of JLNS-causing mutations and demonstrate the potential of hiPSC-CMs in drug evaluation.

  17. The Jervell and Lange-Nielsen syndrome; atrial pacing combined with ß-blocker therapy, a favorable approach in young high-risk patients with long QT syndrome?

    Science.gov (United States)

    Früh, Andreas; Siem, Geir; Holmström, Henrik; Døhlen, Gaute; Haugaa, Kristina H

    2016-11-01

    Patients with Jervell and Lange-Nielsen syndrome (JLNS) exhibit severe phenotypes that are characterized by congenital deafness, very long QT intervals, and high risk of life-threatening arrhythmias. Current treatment strategies include high doses of beta-blocker medication, left cardiac sympathetic denervation, and ICD placement, which is challenging in young children. The purpose of this study was to evaluate the safety and effect of pacing in addition to beta-blocker treatment in children with JLNS. All genetically confirmed patients with JLNS born since 1999 in Norway were included in the study. Data on history of long QT syndrome-related symptoms, QT interval, and beta-blocker and pacemaker treatment were recorded. A total of 9 patients with QT intervals ranging from 510 to 660 ms were identified. Eight patients developed long QT syndrome-related symptoms, and 1 patient died before diagnosis. The survivors received beta-blocker medication. Seven patients also received a pacemaker; 1 had a ventricular lead and 6 had atrial leads. The patient with the ventricular lead died during follow-up. The 6 patients with atrial leads survived without events at a mean follow-up of 6.9 years after pacemaker implantation. Two patients received prophylactic upgrade to a 2-chamber ICD. No arrhythmic events occurred in 6 very young JLNS patients who received atrial pacing in combination with increased doses of beta-blockers during 7-year follow-up. If confirmed in additional patients, this treatment strategy may prevent life-threatening arrhythmias in this high-risk patient group and may act as a bridge to insertion of a 2-chamber ICD when left cardiac sympathetic denervation is not available. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  18. La Fábula Ovidiana de Filomela revisada por la Edad Media: de Chrétien de Troyes a Alfonso x

    Directory of Open Access Journals (Sweden)

    Mario Martín Botero García

    2014-12-01

    Full Text Available En este trabajo se expone el contraste entre las dos traducciones al francés y al castellano de Filomela, una de las fábulas de las Metamorfosis de Ovidio, realizadas en los siglos xii y xiii por Chrétien de Troyes y Alfonso X. Por medio del análisis y cotejo de tres momentos narrativos, veremos la forma en que la materia antigua es tratada según el contexto determinado en el que se producen las traducciones. La versión francesa hace énfasis en una dimensión cortés en donde el personaje femenino es altamente valorado; por su parte, la versión castellana reivindica una racionalización de la fábula ovidiana, supeditada a una visión política e histórica. Se puede constatar así que las traducciones medievales no son serviles con respecto a la fuente latina sino que demuestran una gran libertad en la selección y combinación de elementos.

  19. Ora et labora. Paradigmes du modèle monacal médiéval chez Chrétien de Troyes / Ora et labora. Paradigms of the Medieval Monastic Model in Chrétien de Troyes’s Work

    Directory of Open Access Journals (Sweden)

    Diana Gradu

    2015-05-01

    Full Text Available The medieval monachal model is marked out by the faith, by the power, by the morality. It is also shared between confidence and fear with regard to the power on the earth, but, certainly, all the clerks and the monks of the Middle Age know and assume the rule Redde Caesari quae sunt Cesaris and quae sunt Dei Deo. The medieval literature, the unfaithful mirror, is reflected in an incomplete and sometimes idealized way, the example of the hermit, but it constitutes in the essential source of its paradigm. I shall stop to Chrétien of Troyes and to its novels, they are the most glorious proof of the Renaissance of the 12th century.

  20. La cinéphilie chrétienne : Amédée Ayfre (1922-1964), sulpicien et critique de cinéma1

    OpenAIRE

    Rocher, Philippe

    2012-01-01

    Prêtre français de saint Sulpice et chrétien cinéphile, Amédée Ayfre a défendu l’esthétique et le réalisme cinématographiques contre le cinéma religieux du « Cinéma catholique ». Le « réalisme cinématographique » est un instrument de révélation chrétienne du Prochain. Brusquement décédé, Amédée Ayfre n’a pas eu la possibilité de dépasser ses premiers « Jalons pour une théologie de l’image ». In the middle Twentieth century, Amédée Ayfre, French priest of the Society of saint Sulpice and Ch...

  1. CHR AL IDRISSI OF KENITRA

    African Journals Online (AJOL)

    lanez

    31 déc. 2014 ... prescription médicale, dans un objectif de diagnostic, dépistage, ... L'activité de cet emploi/métier s'exerce au sein de laboratoires (analyses médicales, recherche, ... Techniques de prélèvement biologique. Réaliser ... albicans, Pseudomonas, Syphilis, Les virus d'hépatite et le VIH) dans des prélèvements.

  2. “Et qui or me vaurra entendre, cuer et oreilles me doit rendre”: espacios de lectura y público de los roman courtois de Chrétien de Troyes (siglos XII-XIII

    Directory of Open Access Journals (Sweden)

    Diego Carlo Améndolla Spinola

    2016-06-01

    Full Text Available Basado en los planteamientos de la lógica social del texto, este artículo presenta un estudio del público que escuchaba los romances corteses entre los siglo XII y XIII, específicamente los realizados por Chrétien de Troyes –clérigo lector de la Corte de Leonor de Aquitania y de Enrique II Plantagenet–, además de establecer y analizar las diversas salas de los castillos donde estas obras literarias eran narradas.

  3. Niels Bohr and the Atomic Structure

    Indian Academy of Sciences (India)

    IAS Admin

    principle with the restriction that no more than two electrons occupy a given ... displacement laws. Early in his ... The only difference between them is their atomic weight. F Soddy ... validity, Bohr took his theory to Rutherford. Unfortunately,.

  4. 30 January 2012 - Danish National Research Foundation Chairman of board K. Bock and University of Copenhagen Rector R. Hemmingsen visiting ATLAS underground experimental area, CERN Control Centre and ALICE underground experimental area, throughout accompanied by J. Dines Hansen and B. Svane Nielsen; signing the guest book with CERN Director for Research and Scientific Computing S. Bertolucci and Head of International Relations F. Pauss.

    CERN Document Server

    Jean-Claude Gadmer

    2012-01-01

    30 January 2012 - Danish National Research Foundation Chairman of board K. Bock and University of Copenhagen Rector R. Hemmingsen visiting ATLAS underground experimental area, CERN Control Centre and ALICE underground experimental area, throughout accompanied by J. Dines Hansen and B. Svane Nielsen; signing the guest book with CERN Director for Research and Scientific Computing S. Bertolucci and Head of International Relations F. Pauss.

  5. Des monastères aux funérailles. La construction d’une relation ethnographique avec des chrétiennes de Damas (Syrie

    Directory of Open Access Journals (Sweden)

    Anna Poujeau

    2009-03-01

    Full Text Available Des monastères aux funérailles. La construction d’une relation ethnographique avec des chrétiennes de Damas (Syrie. En juillet 2004, j’ai assisté aux funérailles d’un jeune homme de la famille au sein de laquelle je vivais à Damas. À l’époque, l’intense émotion suscitée par cet événement empêcha que je m’y intéresse de plus près. Ce n’est que deux ans plus tard, en juillet 2006, que j’ai décidé d’enquêter sur l’un des aspects majeurs de la cérémonie : les lamentations funèbres féminines. Lors de ce dernier terrain, les femmes de la famille que j’interrogeais, que j’accompagnais aux funérailles et dont j’enregistrais les chants m’assignèrent alors une place tout à fait particulière. Puisque, moi aussi, « je m’habillais en noir et je venais aux funérailles », je ne pouvais plus être considérée comme une étrangère. Dès lors, elles firent de moi la fille d’une de leur sœur émigrée à Paris et mariée avec un Français. Ce statut me fut par ailleurs confirmé lorsqu’elles m’attribuèrent une place dans leurs plaisanteries entre sœurs, tantes et neveux matrilatéraux.Dans cet article, je souhaite engager une double réflexion : sur la position et l’implication de l’ethnologue sur un terrain où l’émotion est au premier plan, ainsi que sur la façon dont être assignée à une place dans la parenté de ses informateurs donne enfin toute liberté d’action à l’ethnologue sur son terrain.From monasteries to funerals. The construction of ethnographical relations with the Christians of Damascus (Syria. In July 2004, I attended the funeral of a young man from the family with whom I was staying in Damascus. At the time, the intense emotion provoked by that event prevented me from immediately examining it more closely. It was only two years later, in July 2006, that I decided to study one of the main features of the ceremony: the women’s lamentations. During this

  6. Odd Bed-fellows: British Christians and Communists in the Struggle for Peace D’étranges compagnons : chrétiens et communistes britanniques dans la lutte pour la paix

    Directory of Open Access Journals (Sweden)

    Jeremy Tranmer

    2011-04-01

    Full Text Available Au début des années 1950, le doyen de l’archevêché de Cantorbéry œuvra au sein du mouvement pour la paix et participa à des activités organisées par le parti communiste britannique. En 1983, le prêtre catholique Bruce Kent, leader de la Campagne pour le Désarmement Nucléaire, loua l’engagement des communistes britanniques en faveur de la paix. Cet article cherche à examiner pourquoi et comment chrétiens et communistes surmontèrent leurs différences et coopérèrent dans la lutte contre l’arme nucléaire.

  7. De la chair imbibée de foi : la viande comme marqueur de la frontière entre chrétiens et musulmans en Éthiopie

    Directory of Open Access Journals (Sweden)

    Éloi Ficquet

    2006-05-01

    Full Text Available Jamais en Éthiopie un chrétien et un musulman ne mangent de viande ensemble. Consommer de la viande qui n’a pas été consacrée à sa propre foi est appréhendé comme un acte hautement sacrilège équivalent à une apostasie. Cet interdit doit être compris dans une perspective comparative large sur les pratiques et les débats qui restreignent la commensalité de la viande entre les chrétiens et les musulmans. Les usages éthiopiens ont accentué cette question pour en faire un interdit puissant, marqueur d’une frontière interreligieuse. Comme toute frontière, cette « frontière carnée » a été le lieu de confrontations, d’aménagements et de transgressions dont les effets ont contribué à la construction de l’espace national éthiopien contemporain.Christians and Muslims in Ethiopia never eat meat together. Consuming meat that was not consecrated to one’s faith is seen as a highly sacrilegious act equal to apostasy. This interdict must be understood in comparative perspective that looks at the restrictions regarding the sharing of meat between Christians and Muslims. Ethiopian customs have emphasized this issue to turn it into a powerful interdict, tracing an inter-religious boundary. Like any boundary, this “dietary boundary” has been the site of confrontations, readjustments and transgressions whose effects have contributed to the building of a contemporary Ethiopian national space.

  8. Nanocompósitos de PEAD/PEBDL: avaliação da esfoliação da argila organofílica pela aplicação do modelo de Nielsen e das propriedades mecânicas, ópticas e permeabilidade PEAD/PEBDL composites: evaluation of the exfoliation of organophilic clay using the Nielsen model and of the mechanical, optical and permeability properties

    Directory of Open Access Journals (Sweden)

    Ana R. Morales

    2010-01-01

    Full Text Available Uma blenda de polietileno de alta densidade e polietileno de baixa densidade (PEAD/PEBDL comumente utilizada em filmes de embalagem foi modificada com argila montmorilonita organofílica comercial para obter nanocompósitos com melhores propriedades de barreira. Amostras com 5 e 7,5% de argila (em massa foram estudadas em diferentes condições de processamento. Filmes produzidos com os nanocompósitos foram avaliados quanto à dispersão da argila por difração de raio X e Microscopia Eletrônica de Transmissão. As propriedades de barreira dos filmes foram determinadas pelas medições de permeabilidade ao oxigênio e ao vapor d'água. As propriedades mecânicas e ópticas também foram determinadas. Observou-se uma estrutura com a argila parcialmente esfoliada e intercalada. A permeabilidade ao oxigênio diminuiu significativamente enquanto a permeabilidade à água foi pouco influenciada. As propriedades mecânicas e a transparência dos filmes foram pouco alteradas. O modelo de Nielsen foi aplicado para os dados de permeabilidade relativa e demonstrou ser um ótimo recurso para a avaliação do grau de esfoliação da argila para as diferentes amostras, que foram confirmadas pelas análises realizadas em microscopia eletrônica de transmissão.A typical high density polyethylene and linear low density polyethylene (HDPE/LLDPE blend used in flexible packaging was modified with commercial organophylic montmorilonite clay to obtain nanocomposites with superior barrier properties. Samples with 5 and 7.5% of clay were prepared under different processing conditions. Films produced from the nanocomposites were evaluated in terms of oxygen and water vapor permeation and also by X-ray diffraction and Transmission Electron Microscopy. Tensile and optical properties were also evaluated. The clay showed to be intercalated and partially exfoliated. The oxygen permeation was mainly reduced and the vapor permeation was weakly modified. The mechanical

  9. A novel KCNQ1 nonsense variant in the isoform-specific first exon causes both jervell and Lange-Nielsen syndrome 1 and long QT syndrome 1: a case report.

    Science.gov (United States)

    Nishimura, Motoi; Ueda, Marehiko; Ebata, Ryota; Utsuno, Emi; Ishii, Takuma; Matsushita, Kazuyuki; Ohara, Osamu; Shimojo, Naoki; Kobayashi, Yoshio; Nomura, Fumio

    2017-06-08

    According to previous KCNQ1 (potassium channel, voltage gated, KQT-like subfamily, member 1) gene screening studies, missense variants, but not nonsense or frame-shift variants, cause the majority of long QT syndrome (LQTS; Romano-Ward syndrome [RWS]) 1 cases. Several missense variants are reported to cause RWS by a dominant-negative mechanism, and some KCNQ1 variants can cause both Jervell and Lange-Nielsen Syndrome (JLNS; in an autosomal recessive manner) and LQTS1 (in an autosomal dominant manner), while other KCNQ1 variants cause only JLNS. The human KCNQ1 gene is known to have two transcript isoforms (kidney isoform and pancreas isoform), and both isoforms can form a functional cardiac potassium channel. Here, we report a novel nonsense KCNQ1 variant causing not only JLNS, but also significant QTc prolongation identical to RWS in an autosomal dominant manner. Our case study supports that haploinsufficiency in the KCNQ1 gene is causative of significant QTc prolongation identical to RWS. Interestingly, the nonsense variant (NM_000218.2:c.115G > T [p.Glu39X]) locates in exon 1a of KCNQ1, which is a kidney-isoform specific exon. The variant is located closer to the N-terminus than previously identified nonsense or frame-shift variants. To the best of our knowledge, this is the first report showing that a nonsense variant in exon 1a of KCNQ1, which is the kidney-isoform specific exon, causes JLNS. Our findings may be informative to the genetic pathogenesis of RWS and JLNS caused by KCNQ1 variants.

  10. Reseña de: Caselli, Elisa, Antijudaïsme, pouvoir politique et administration de la justice. Juifs, chrétiens et converts dans l’ espace jurisdictionnel de la Chancillería de Valladolid (XVe-XVIe siècles.Villeneuve d’Ascq...

    Directory of Open Access Journals (Sweden)

    Enrique Cantera Montenegro

    2017-05-01

    Full Text Available Caselli, Elisa, Antijudaïsme, pouvoir politique et administration de la justice. Juifs, chrétiens et converts dans l’ espace jurisdictionnel de la Chancillería de Valladolid (XVe-XVIe siècles. Villeneuve d’Ascq Cedex. Atelier National de Reproduction des Thèses, 2016. 396 págs. isbn: 978-2-7295-8891-5.

  11. Uus teater tuleb Aasiast / Katrin Nielsen

    Index Scriptorium Estoniae

    Nielsen, Katrin

    2007-01-01

    Soulius toimunud Aasia lasteteatrite festivalist "AssiFE 2007". Mõningatest lavastustest: Tõkyõ teater Kakashiza "Saabastega kass", Sadari teatri "Kui ta kell seisma jäi", Tuida teatri "Haruki lugu", Souli Joyful Theatre'i vendade Grimmide lugu konn-printsist, Shiny Shoes Theatre'i "Maagiline hõljuv laud", Ulgul Gwa Ulgul "Laul lameda näoga Kong-List"

  12. Cosmopolitanism | Nielsen | South African Journal of Philosophy

    African Journals Online (AJOL)

    This essay explicates and defends a version of moral cosmopolitanism. It builds on the work of Martha Nussbaum and Kwame Anthony Appiah, who in turn build on Cicero and Kant. It is an update in a contemporary idiom of a classical cosmopolitanism. In a time when Enlightenment ideas are widely discounted, it gives ...

  13. Ad agency overview / koost. Ingrid Nielsen

    Index Scriptorium Estoniae

    2004-01-01

    Ülevaade Baltimaade reklaamifirmade assotsiatsioonidesse kuuluvatest reklaamifirmadest. Ettevõtete üldandmed, juhid, teenused, konkurentsieelised, olulisemad kliendid, autasud reklaamikonkurssidelt

  14. Le Mouvement républicain populaire (MRP : l’expérience singulière d’un parti d’inspiration démocrate chrétienne en République française (1944-1965

    Directory of Open Access Journals (Sweden)

    Isabelle Clavel

    2016-05-01

    Full Text Available En 1944, le Mouvement républicain populaire (MRP est créé par un groupe d’hommes et de femmes, apparenté à la famille démocrate-chrétienne. Dans le contexte de libération du territoire français, il s’agit pour ceux qui ont pris part aux mouvements de Résistance contre l’occupation nazie et le régime collaborateur de Vichy, de contribuer à la reconstruction du pays après le second conflit mondial. L’émergence de ce parti « d’inspiration chrétienne » constitue une nouveauté dans le paysage politique français. Jusqu’alors, aucun parti confessionnel n’était parvenu à peser électoralement au point de devenir l’un des principaux acteurs des gouvernements. Malgré une existence relativement brève de 1944 à 1965, cette trajectoire singulière permet d’étudier comment les catholiques, qui se reconnaissent dans la famille démocrate-chrétienne, ont achevé un processus d’acculturation au régime républicain, dont l’un des principes fondamentaux est la laïcité.

  15. Kommunikation erstatter transport

    DEFF Research Database (Denmark)

    Indhold: Kim Østrup: På vej mod vidensamfundet : fra grusvej til informationsmotorvej. En revolutions historie i overblik / af Erland Kolding Nielsen og Niels Mark. Annette Winkel Schwarz: Når du ser den rigtige retning, vent da ikke på ordrer. Søren Clausen: Den ministerielle jordemodergerning. ...

  16. La cinéphilie chrétienne : Amédée Ayfre (1922-1964, sulpicien et critique de cinéma The Christian cinema enthusiasm: Amédée Ayfre (1922-1964, priest of the Society of saint Sulpice and film critic

    Directory of Open Access Journals (Sweden)

    Philippe Rocher

    2012-06-01

    Full Text Available Prêtre français de saint Sulpice et chrétien cinéphile, Amédée Ayfre a défendu l’esthétique et le réalisme cinématographiques contre le cinéma religieux du « Cinéma catholique ». Le « réalisme cinématographique » est un instrument de révélation chrétienne du Prochain. Brusquement décédé, Amédée Ayfre n’a pas eu la possibilité de dépasser ses premiers « Jalons pour une théologie de l’image ».In the middle Twentieth century, Amédée Ayfre, French priest of the Society of saint Sulpice and Christian cinema enthusiast, defended esthetic and realism cinema against the religious cinema of « Catholic cinema ». For him, realist Cinema is the Christian revelation instrument of fellow man. Brusquely to die, he can’t proposed any more his first “Jalons pour une théologie de l’image”.

  17. weblog: http://www.kommunikationsforum.dk/Niels-Ole-Finnemann

    DEFF Research Database (Denmark)

    Finnemann, Niels Ole

    2007-01-01

    ...men det er også et område, som mange mennesker ikke rigtig tør forholde sig til og nærmest fortrænger, både fordi de ligger under for IT profeternes demagogi, og fordi de selv føler sig fremmedgjorte overfor ny teknologi og nye medier. ...og IT-fremmedgørelsen Fremmedgørelsen over teknologi og...

  18. The Niels Bohr Archive is Placing Collections on its Website

    DEFF Research Database (Denmark)

    Aaserud, Finn

    2010-01-01

    this supplement, the documents of which we hope to make available on our website by 2013, the centennial for Bohr's model of the nuclear atom. We have found the task of digitizing our collections generally complex, sometimes frustrating, and in the end satisfying. At this stage it is particularly important...

  19. What has happened to previous Estonian marketing acts? / Ingrid Nielsen

    Index Scriptorium Estoniae

    Nielsen, Ingrid

    2004-01-01

    Ülevaade eelnevatel aastatel Eesti turundusteo tiitli pälvinud kampaaniatega seotud ettevõtete, teenuste ja ürituste - EGO järelmaksukaart, EMT ja Eurovisiooni lauluvõistlus - käekäigust, korraldatud reklaamikampaaniate tulemuslikkusest

  20. 12000 rotation periods of Kepler stars (Nielsen+, 2013)

    DEFF Research Database (Denmark)

    Nielsen, M. B.; Gizon, L.; Schunker, H.

    2013-01-01

    Rotation periods of 12253 stars in the Kepler field. The periods are determined by the brightness variations, from star spots or active regions, in the light curves of the white light photometry obtained by the Kepler spacecraft. The median absolute deviation from the median (MAD) of the periods...... shows the scatter of periods for each star, over 6 or more (out of 8 analyzed) Kepler quarters. The g-r color index, E(B-V), radius, surface gravity, and effective temperature are from the Kepler Input Catalog (KIC). Column 9 (TF) indicates whether or not the msMAP data for a given star satisfies...... the selection criteria described in section 2. Of these, there are 86 stars with periods from the msMAP data that differ from the period derived from the PDCMAP data by more than one frequency resolution element (1/90d-1). For these stars the msMAP periods are therefore given in column 10 as a none-zero value...

  1. On Hamlet's Crypt: Effi Briest, Asta Nielsen, Aand Britney Spears

    Directory of Open Access Journals (Sweden)

    Viola Kolarov

    2011-10-01

    Full Text Available This contribution looks at the way instinct is transmitted and represented as ghost appearance. The essay elaborates two basic theses: first, that instinct is not defined by creaturely heritage, since it is not a testable structure in itself, nor subject to mourning and developmental processes; and second, that works of fine literature and pop oeuvres alike may serve as carriers of a ghost transmission charged with instinctive heritage. The study represents a model for reading ghostly genealogies that complement the familiar and familial reproductive ones as it draws on traditions such as the adultery novel, continental philosophy, psychoanalysis, and Disney. Currently based in Berlin, Viola Kolarov has taught in the German Departments of the Johns Hopkins University and New York University. She has published on Shakespeare, contemporary art, film, and pop culture. Her forthcoming book, “Shakespeare and the Autobiography of the Machine Age,” rethinks Goethe, the German translation/transmission of Shakespeare, and the German literary tradition in the contexts of media technology. Originally from Berlin, Susanne Lanckowsky entered the Academy of Fine Arts Karlsruhe, class of Franz Ackermann, in 2007. Since 2009 she has shown solo and in group on numerous occasions and studied abroad with prestigious scholarship support for one semester at the Faculdade de Belas Artes Universidade do Porto, Portugal, and for another semester at the Escuela Nacional de Pintura, Escultura y Grabado La Esmeralda in Mexico.

  2. Communication and advertising top agency now in Baltics / Ingrid Nielsen

    Index Scriptorium Estoniae

    Nielsen, Ingrid

    2004-01-01

    Baltimaade turule tulnud Euroopa juhtiva reklaami- ja kommunikatsiooniagentuuri Media Planning Group juht Kaspars Ulsts ettevõtte tegevusest ja eesmärkidest. Lisa: MPG's biggest clients; Background of MPG

  3. Mobile marketing will take big part in marketing / Ingrid Nielsen

    Index Scriptorium Estoniae

    Nielsen, Ingrid

    2004-01-01

    Mobiiltelefoniturunduse populaarsus kasvab kiiresti ning tulevikus muutub SMS-i või MMS-i teel toodete pakkumine igapäevaseks nähtuseks, leiab Inpoc Baltics juht Mart Kikas. Kommenteerib Rauno Stüff. Lisa

  4. Sarkozy presidendina on Euroopale parim valik / Kristian L. Nielsen

    Index Scriptorium Estoniae

    Nielsen, Kristian L.

    2007-01-01

    Autori hinnangul tundub Prantsusmaa presidendiks valitud Nicolas Sarkozy olevat tugeval positsioonil, et tegelda krooniliselt suure töötusega eriti noorte hulgas ja sellest tulenevate sotsiaalprobleemidega, ta on näidanud tahet tegelda tööturu reformi ja avaliku sektori kärpimisega. Autor vaatleb, kuidas N. Sarkozy võib mõjutada Euroopa poliitikat laiemalt, käsitledes tema seisukohti EL-i laienemise, põhiseadusleppe, USA-suhete küsimustes

  5. Klaaspärlimäng peletab klassikahirmu / Katrin Nielsen

    Index Scriptorium Estoniae

    Nielsen, Katrin

    2003-01-01

    Eri stiile-ajastuid ühendavast Peeter Vähi kujandatud muusikafestivalist "Klaaspärlimäng" 22. juulist-24. augustini. Kontsertidest Pärnu kontserdimajas: gamelaniansambli Gamelan Son of Lion kontserdist 22. juulil, Vardo Rumesseni kontserdist ja CD esitlusest 28. juulil, tütarlastekoori "Ellerhein" kontserdist 30. juulil

  6. The Evaluation of the Outside Matter in Dictionary Reviews | Nielsen ...

    African Journals Online (AJOL)

    Reviewing dictionaries is part of the ongoing work in lexicography, and several lexi-cographers have discussed the process and guidelines for reviews published in academic journals. However, few have addressed the evaluation of the outside matter and, if so, only in a cursory way. This article examines the evaluation of ...

  7. Claus Beck-Nielsen som spøgelse

    DEFF Research Database (Denmark)

    Larsen, Peter Stein

    2012-01-01

    Med Brian Grahams artikel “Sympathy for the Spectres: The Double Nature of Blake’s Spectral Figures in Jerusalem” forbliver vi inden for den litterære tradition, men bevæger os en smule længere frem i tiden. Graham retter blikket mod William Blakes forfatterskab og påpeger, at Blakes univers er...... feministisk synsvinkel – er spøgelserne dobbelte: de spiller en rolle i kristendommens historie, samtidig med at de spiller en kontrasterende sympatisk rolle i den universelle strid mellem Blakes ”male and female powers”, denne evige strid mellem disse to poler ses af Blake som grundlaget for al skabelse og...

  8. Saared meis ja meie ümber / Katrin Nielsen

    Index Scriptorium Estoniae

    Nielsen, Katrin

    1998-01-01

    Chaplini kunstikeskuses 17. detsembrini avatud fotonäitusest 'Põhjala saared', kus oma töid eksponeerisid: Absalon Hansen - Fääri saartest, Göte Ask - Gotlandist, Andy Horner - Ahvenamaalt, ning Tartu kunstikooli fotoeriala tudengid oma pilte Naissaarest, Piirissaarest, Abrukast, Manijast, Vormsist ja Vilsandist.

  9. Alternative Neo-Rimannian Approaches to Carl Nielsen

    DEFF Research Database (Denmark)

    Nielsen, Svend Hvidtfelt

    2012-01-01

    their respective groundbreaking works. Even though Jersild’s and Maegaard’s theories are developed independent of these writers, their content communicates with the content of these writer’s theories. And even though a theory of foreground harmonic progressions like Jersild’s is seemingly as opposed as possible...... to a Schenkerian middleground based harmonic approach they actually in some regards do have something in common, just as they in other regards supplement each other perfectly. I try through the analyses of Nielsen’s music – plus a few other examples (Schumann, Liszt and Wolf) – to show how the theories...

  10. Dicty_cDB: CHR553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available wftfi lq*nsc***iitnlfhkfsgsst***r*rnyqrvyq*sksistikffrgrrndg*fiefn s*w*fqriekdess...VSGEKAVLIQKEIEDLKKQKKRDQDKLAEKDKLLTKLAKRMRKMEEA I--- ---kv***iynv*kgfgn*kih*r*inskke*kgekrngd*kieigndsfeiken

  11. Dicty_cDB: CHR636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode

  12. Dicty_cDB: CHR522 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gene, mitochondrial gene encoding mitochondrial protein, partial cds. 46 0.86 1 AJ505593 |AJ505593.1 Alcis repanda...ial), isolate 00372. 46 0.86 1 AJ438725 |AJ438725.1 Alcis repandata mitochondrion nd1 gene (partial), 16S rR...rum 3D7 chromosome 11 section 3 of 8 of the complete sequence. 46 0.86 1 AJ416938 |AJ416938.1 Alcis repand

  13. Dicty_cDB: CHR619 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rslfikmptkt*mxx**sw*kmlckdslx*sl*fr lw*rf*m*nxt*wfxmlcpfrkttpttt*xm**xmpxrpxm*s*stxkrmxrccp*tttk mxfkmxxkt*m*sxplx*rmlcxxxxrxmfxqmsx...rpxm*s*stwkrmxxccp*ttxkmi ixmsxkt*m*nqsxw*rmxc Frame B: s...vqlhivxxvxhcsmxkdvatcpchqqlveqvyqepssstagv ssclttlmsxwhicvkdsnggklgpngxxxfrr*fixkyir--- ---mnv*lixxvknvgxdpx

  14. Dicty_cDB: CHR818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce. 52 5e-09 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltior...rhiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.

  15. Dicty_cDB: CHR861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available no Acid sequence ---ETTELXNKXIKFXSXXAXGEIXSISTWXXXFVXNXPAYXHDSXVNDEIXXDYFQRCL XISXGTXYDXSIQGDKXDYYC*ixyfxlfxxxxxixxxxx...ame A: ---*nxrig**xy*ixfkxsxwxnxixfxlxxxicxkxsxlxs*fxxk**nsx*lfstlf xyfkxxxl**xxsrr*x*llllnixfxpipxlxxxlxxxs...XGEIXSISTWXXXFVXNXPAYXHDSXVNDEIXXDYFQRCL XISXGTXYDXSIQGDKXDYYC*ixyfxlfxxxxxixxxxxfxinfkniiiikq*x*xkkk kvkngk...*iksqyknnnqiknkknkknktfi Frame C: ---kxpnwxixilnsfqxxxxxkxnxfxlgqxnlxkxixptimipx*mmkfxxiifnvvx ifqxxpfmixxfkaixmiiivkyxixsysxtxxxfxxx

  16. Dicty_cDB: CHR684 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tiiihvllilamt*lvvailqsmlmiiihvpsmpvlnqqvllipqsm*miitn vqlihvpkkvv*lilqsilmitmpvplipahhqlvfpipq*tvmiiinvl*ihv...qtqlvv *ilqltvtivihvp*thaliqlvv*tlqsmlmiiihvpsmpvpnqqvllipqsm*mittn vqlmhvpkkvv*liphsilmitm

  17. La construction relative dans Chrétien de Troyes

    NARCIS (Netherlands)

    Fabriek, Pieter

    1924-01-01

    1. On peut reléguer à la syntaxe figée la construction relative avec la pronom neutre que dans feire que sages, que je sache, (au) plus tost qu'il pot, je n'ai que feire; avec le pronom adjectif qui dans il n'i a celui (nul, un seul) qui, com cil qui; en outre qui vive dans riens (om) qui vive

  18. Dicty_cDB: CHR211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 'HPRT insertion targeting and chromosome engineering clone MHPN350f07. 50 0.13 1 ...BX965467 |BX965467.1 Forward strand read from insert in 5'HPRT insertion targeting and chromosome engineering

  19. Dicty_cDB: CHR769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available r cysteine) proteinase inhibitor clade B (ovalbumin) family member. 32 0.51 2 CX072513 |CX072513.1 UCRCS08_28E10_g Parent...is cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 0.97 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent

  20. Dicty_cDB: CHR866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 52.2 Felis catus clone RP86-222L20, WORKING DRAFT SEQUENCE, 2 ordered pieces. 38 0.57 3 CX072513 |CX072513.1 UCRCS08_28E10_g Parent...CS08-28E10-J20-1-4.g, mRNA sequence. 46 0.77 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent Washington Navel

  1. Dicty_cDB: CHR728 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP142o16. 5... targeting and chromosome engineering clone MHPP421e10. 50 0.14 1 CR044130 |CR044130.1 Forward strand read f...rom insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.14 1 CR017539 |CR...017539.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...nsertion targeting and chromosome engineering clone MHPP47e19. 50 0.14 1 dna update 2005.11.21 Homology vs P

  2. Dicty_cDB: CHR667 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available strand read from insert in 5'HPRT insertion targeting and chromosome engineering clone MHPN347m23. 46 0.19 ...2 CR052856 |CR052856.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering

  3. Dicty_cDB: CHR419 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10.25 Translated Amino Acid sequence iklklkfnykqqiknsikk*ncylfyylff*yfqywynlkqpilv*kpmvtimilfs...lkfkl*e*n*ithd*i*sn*ILKYLIIKFI --- ---IKLKLKFNYKQQIKNSIKK*ncylfyylff*yfqywynlkqpilv*kpmvtimilfs n*qipkkfkwpe...ylff*yfqywynlkqpilv*kpmvtimilfsn*q ipkkfkwpeifclerkamkfm*wvelkrdlkaiiqsfplfltqiqshflpwllkfvmlql fm*kitlmrpvv...lssqvasgahglqn*qeklkfkl*e*n*ithd*i*sn*ILKYLIIKFI --- ---IKLKLKFNYKQQIKNSIKK*ncylfyylff*yfqywynlkqpilv*kpmvtimilfs

  4. « Comment se comporter avec un roi chrétien » : l’ouvrage perdu d’Abū l-Ḥasan ʿAlī Ibn al-Qaṭṭān et les enjeux du cérémonial almohade

    Directory of Open Access Journals (Sweden)

    Mehdi Ghouirgate

    2014-05-01

    Full Text Available Cet article propose de revenir sur un document aussi exceptionnel que méconnu. Il s’agit du résumé d’un ouvrage (maqāla, aujourd’hui perdu, intitulé « Comment se comporter avec un roi chrétien », et que l’on trouve dans le dictionnaire bio-bibliographique d’Ibn ʿAbd al-Malik. Cette maqāla fut rédigée, par un homme de lettres au service des Almohades, Abū l-Ḥasan ʿAlī Ibn al-Qaṭṭān (m. 1231. C’est la seule source qui ait consigné des indications sur la conduite que devait adopter le souverain lors d’une cérémonie, en présence d’un prince étranger. À ce titre, on y trouve des renseignements essentiels sur le cérémonial almohade ainsi que sur les dilemmes que devaient résoudre le calife : d’un point de vue idéologique, il ne pouvait souffrir aucun autre pouvoir, mais l’impossibilité de mener des opérations d’envergure sur deux fronts à la fois l’amena à composer avec le roi du León. De même, c’est le seul document à avoir fait état d’une divergence de point de vue entre le calife et les intellectuels organiques du système, les Ṭalaba. Ce différend met en lumière des tensions latentes au sommet entre divers serviteurs de l’État, qui n’avaient pas la même forme de légitimité, ni tout à fait les mêmes intérêts.

  5. Niels Bohr's complementarity its structure, history, and intersections with hermeneutics and deconstruction

    CERN Document Server

    Katsumori, Makoto

    2011-01-01

    Through detailed textual and conceptual analysis, and with special attention to the potentially conflicting elements of Bohr's thought, this volume's fresh approach analyzes the relations between realism and antirealism through the prism of complementarity.

  6. What is complementarity?: Niels Bohr and the architecture of quantum theory

    Science.gov (United States)

    Plotnitsky, Arkady

    2014-12-01

    This article explores Bohr’s argument, advanced under the heading of ‘complementarity,’ concerning quantum phenomena and quantum mechanics, and its physical and philosophical implications. In Bohr, the term complementarity designates both a particular concept and an overall interpretation of quantum phenomena and quantum mechanics, in part grounded in this concept. While the argument of this article is primarily philosophical, it will also address, historically, the development and transformations of Bohr’s thinking, under the impact of the development of quantum theory and Bohr’s confrontation with Einstein, especially their exchange concerning the EPR experiment, proposed by Einstein, Podolsky and Rosen in 1935. Bohr’s interpretation was progressively characterized by a more radical epistemology, in its ultimate form, which was developed in the 1930s and with which I shall be especially concerned here, defined by his new concepts of phenomenon and atomicity. According to this epistemology, quantum objects are seen as indescribable and possibly even as inconceivable, and as manifesting their existence only in the effects of their interactions with measuring instruments upon those instruments, effects that define phenomena in Bohr’s sense. The absence of causality is an automatic consequence of this epistemology. I shall also consider how probability and statistics work under these epistemological conditions.

  7. What is complementarity?: Niels Bohr and the architecture of quantum theory

    International Nuclear Information System (INIS)

    Plotnitsky, Arkady

    2014-01-01

    This article explores Bohr’s argument, advanced under the heading of ‘complementarity,’ concerning quantum phenomena and quantum mechanics, and its physical and philosophical implications. In Bohr, the term complementarity designates both a particular concept and an overall interpretation of quantum phenomena and quantum mechanics, in part grounded in this concept. While the argument of this article is primarily philosophical, it will also address, historically, the development and transformations of Bohr’s thinking, under the impact of the development of quantum theory and Bohr’s confrontation with Einstein, especially their exchange concerning the EPR experiment, proposed by Einstein, Podolsky and Rosen in 1935. Bohr’s interpretation was progressively characterized by a more radical epistemology, in its ultimate form, which was developed in the 1930s and with which I shall be especially concerned here, defined by his new concepts of phenomenon and atomicity. According to this epistemology, quantum objects are seen as indescribable and possibly even as inconceivable, and as manifesting their existence only in the effects of their interactions with measuring instruments upon those instruments, effects that define phenomena in Bohr’s sense. The absence of causality is an automatic consequence of this epistemology. I shall also consider how probability and statistics work under these epistemological conditions. (paper)

  8. Niels Bohr, Max Delbruck and the paradox of light and life

    International Nuclear Information System (INIS)

    Scott, G.P.

    1983-01-01

    This paper features a concise, interdisciplinary history of philosophical issues which were the basis of Delbruck's scientific career. The paradox in living behavior of freedom-to-adapt versus deterministic atomism required complete reassessment with the advent of quantum mechanics. Apparent contradictions implied, for example, by the wave-particle model led Bohr to a belief in the ''complementarity of nature,'' which in 1932 he applied to biology. His claim was that purely physicochemical explanations of purposeful life functions such as ''self-generation and freedom of the will'' were impossible since mutually exclusive situations were involved. Thus Delbruck was challenged to spend his career investigating these vital functions. Beginning with ''fruit-fly photochemistry'' he established the molecular nature of the gene and then collected a world-wide group for a research effort on phage virus, which culminated in discovery of the DNA double helix by Watson and Crick. The second phase of his career featured a study of the total stimulus-response system of the fungus Phycomuces, which is still in progress. The extreme light-sensitivity observed, approaching one-quantum response, has raised the question of the survival value of amplified quantum noise. In critical comments to the author, Delbruck opposed the ''Compton-switch model'' for mind-body interaction; and in his lecture, ''Mind from Matter?'' he revealed his ''a priori concept of truth,'' which embraces a neutral monism and rejects the language of emergent evolution. His views are contrasted with those expressed in Popper's First Darwin Lecture

  9. Communicating the Heisenberg uncertainty relations: Niels Bohr, Complementarity and the Einstein-Rupp experiments

    NARCIS (Netherlands)

    van Dongen, Jeroen|info:eu-repo/dai/nl/242629431

    2015-01-01

    The Einstein-Rupp experiments have been unduly neglected in the history of quantum mechanics. While this is to be explained by the fact that Emil Rupp was later exposed as a fraud and had fabricated the results, it is not justified, due to the importance attached to the experiments at the time. This

  10. Viikingite rünnakud algasid Eestist / Niels-Peter Granzow Busch

    Index Scriptorium Estoniae

    Granzow Busch, Niels-Peter

    2014-01-01

    Saaremaalt Salmelt kaevati välja kaks viikingilaeva koos 41 sõdalase skeletiga. Leidude kohta jagavad selgitusi antropoloog Raili Allmäe ja arheoloog Jüri Peets Tallinna Ülikooli Ajaloo Instituudist

  11. Euroopa jääb USAst aina enam maha / Niels Thygesen

    Index Scriptorium Estoniae

    Thygesen, Niels

    2006-01-01

    Ilmunud ka: Molodjozh Estonii 28. veebr. lk. 12-13, Delovõje Vedomosti 8. märts lk. 10. Sissetulekute tase eurotsoonis tervikuna ning majandusnäitajate poolest tähtsamates riikides Prantsusmaal, Saksamaal ja Itaalias on ligikaudu 30% madalam kui Ameerika Ühendriikides. Oht, et vahe veelgi suureneb ning selle põhjustest

  12. Development by Niels Bohr of the quantum theory of the atom and of the correspondence principle

    International Nuclear Information System (INIS)

    El'yashevich, M.A.

    1985-01-01

    Bohr's investigations in 1912-1923 on the quantum theory of atoms are considered. The sources of N. Bohr's works on this subject are analyzed, and the beginning of his quantum research in 1912 is described. A detailed analysis is given of N. Bohr's famous paper on the hydrogen atom theory and on the origin of spectra. The further development of Bohr's ideas on atomic structure is considered, special attention is being payed to his postulates of stationary states and of radiation transitions and to the development of the correspondence principle. It is shown how well N. Bohr understood the difficulties of the model theory and how be tried to obtain a deep understanding of quantum phenomena

  13. Niels Stensen (Nicolas Sténon, Discours sur l’anatomie du cerveau

    Directory of Open Access Journals (Sweden)

    Claire Crignon-De Oliveira

    2011-12-01

    Full Text Available Peut-on faire du cerveau, cet « organe de l’âme », un objet scientifique et philosophique ? À l’heure où les certitudes ont peut-être remplacé les doutes et le questionnement sur la légitimité et les conditions rendant possible la poursuite d’un tel objectif, la lecture du Discours de Sténon sur l’anatomie du cerveau semble s’imposer. L’aveu d’ignorance de l’auteur qui ouvre le texte est à la fois déconcertant et extrêmement rassurant. Loin de promettre aux lecteurs d’être en mesure de « cont...

  14. Quantum field theory with infinite component local fields as an alternative to the string theories

    Science.gov (United States)

    Krasnikov, N. V.

    1987-09-01

    We show that the introduction of the infinite component local fields with higher-order derivatives in the interaction makes the theory completely ultraviolet finite. For the γ5-anomalous theories the introduction of the infinite component field makes the theory renormalizable or even superrenormalizable. I am indebted to J. Ambjōrn, P. Di Vecchia, H.B. Nielsen and L. Rozhansky for useful discussions. It is a pleasure to thank the Niels Bohr Institute (Copenhagen) where this work was completed for kind hospitality.

  15. Functional analyses of AtCHR12 and AtCHR23 : plant growth responses upon over-expression of chromatin remodeling ATPase genes

    NARCIS (Netherlands)

    Folta, A.

    2015-01-01

    Living organisms have to deal with changing environmental conditions during their whole life cycle. In contrast to animals, plants are sessile organisms. Therefore they have evolved multiple regulatory mechanisms that help them to cope with changing conditions. One of the first responses to

  16. Topological quantum field theory and the Nielsen-Thurston classification of M(0,4)

    DEFF Research Database (Denmark)

    Andersen, Jørgen Ellegaard; Masbaum, G.; Ueno, K.

    2006-01-01

    We show that the Nielsen–Thurston classification of mapping classes of the sphere with four marked points is determined by the quantum $SU(n)$ representations, for any fixed $n\\geq 2$. In the Pseudo–Anosov case we also show that the stretching factor is a limit of eigenvalues of (non-unitary) $SU......)$-TQFT representation matrices. It follows that at big enough levels, Pseudo–Anosov mapping classes are represented by matrices of infinite order....

  17. Marketing directors earning up to EUR 30K per annum / Ingrid Nielsen

    Index Scriptorium Estoniae

    Nielsen, Ingrid

    2004-01-01

    Eesti personalifirma Baltic Human Resources konsultant Kaja Kaldas ja Fontes Konsultatsioonide konsultant Eva Lelumees reklaami- ja turundusspetsialistide vajadusest ettevõtetes, üldisest kompetentsuse tasemest ja palkadest Eestis. Lisa: Statistics

  18. Adapting Nielsen's Design Heuristics to Dual Processing for Clinical Decision Support.

    Science.gov (United States)

    Taft, Teresa; Staes, Catherine; Slager, Stacey; Weir, Charlene

    2016-01-01

    The study objective was to improve the applicability of Nielson's standard design heuristics for evaluating electronic health record (EHR) alerts and linked ordering support by integrating them with Dual Process theory. Through initial heuristic evaluation and a user study of 7 physicians, usability problems were identified. Through independent mapping of specific usability criteria to support for each of the Dual Cognitive processes (S1 and S2) and deliberation, agreement was reached on mapping criteria. Finally, usability errors from the heuristic and user study were mapped to S1 and S2. Adding a dual process perspective to specific heuristic analysis increases the applicability and relevance of computerized health information design evaluations. This mapping enables designers to measure that their systems are tailored to support attention allocation. System 1 will be supported by improving pattern recognition and saliency, and system 2 through efficiency and control of information access.

  19. BM&A presents Keith Reinhard / Keith Reinhard ; interv. Ingrid Nielsen

    Index Scriptorium Estoniae

    Reinhard, Keith

    2004-01-01

    DDB Worldwide Communications Group esimees Balti- ning Põhjamaade reklaamiturust, rahvusvaheliselt tuntud kaubamärkide põhimõtetest, oskusest teistest erineda, loovusest, uutest ideedest, reklaamiparoodiatest, reklaami harivusest, piiridest, eesmärkidest

  20. Aasta jagu filme linastus pealinnas ühe matsuga / Katrin Nielsen

    Index Scriptorium Estoniae

    Nielsen, Katrin

    2001-01-01

    Pimedate Ööde Filmifestivali huvitavamaid filme : Jan Hrebejk'i "Lahus olles me kaotame" (Tšehhi Vabariik 2000), Oliver Hirschbiegeli "Eksperiment" (Saksamaa 2001) ja Bille Augusti "Laul Martinile" (Rootsi - Taani 2001)

  1. Kolm küsimust Rait Pärgile / Rait Pärg ; interv. Katrin Nielsen

    Index Scriptorium Estoniae

    Pärg, Rait

    2001-01-01

    Skulptor Rait Pärg Pärnu skulptuurikaardi ja selle põhjal skulptuurikontseptsiooni koostamisest (osalevad ka Omar Volmer ja Mark Soosaar), 2.-11. juunini korraldatavatest skulptuuripäevadest "Pärnu - positiivse märgiga linn"

  2. Tulevikuteatri nimel, nüri järjekindlusega - edasi ! / Katrin Nielsen

    Index Scriptorium Estoniae

    Nielsen, Katrin

    2001-01-01

    2001. a. 20. märts oli esimene aasta, mil ülemaailmsesse organisatsiooni ASSITEJ kuuluvad laste- ja noorteteatrid tähistasid lasteteatrite päeva. Eesti ASSITEJsse (asutatud 1992. a.) kuuluvad VAT Teater, Narva Teater Ilmarine, Jõhvi teatrid Tuuleveski ja Lepatriinu, Tartu Minerva, Tallinna Reel, Viljandi Nukuteater ning rida üksikliikmeid. Eesti keskuse tulevikuplaanidest

  3. Molecular Phylogenetic Classification of Streptomycetes Isolated from the Rhizosphere of Tropical Legume (Paraserianthes falcataria (L. Nielsen

    Directory of Open Access Journals (Sweden)

    LANGKAH SEMBIRING

    2009-09-01

    Full Text Available Intrageneric diversity of 556 streptomycetes isolated from the rhizosphere of tropical legume was determined by using molecular taxonomic method based on 16S rDNA. A total of 46 isolates were taken to represent 37 colour groups of the isolates. 16S rDNA were amplified and subsequently sequenced and the sequences data were aligned with streptomycete sequences retrieved from the ribosomal data base project (RDP data. Phylogenetic trees were generated by using the PHYLIP software package and the matrix of nucleotide similarity and nucleotide difference were generated by using PHYDIT software. The results confirmed and extended the value of 16S rDNA sequencing in streptomycete systematic. The 16S rDNA sequence data showed that most of the tested colour group representatives formed new centers of taxonomic variation within the genus Streptomyces. The generic assignment of these organisms was underpinned by 16S rDNA sequence data which also suggested that most of the strains represented new centers of taxonomic variation. The taxonomic data indicate that diverse populations of streptomycetes are associated with the roots of tropical legume (P. falcataria. Therefore, the combination of selective isolation and molecular taxonomic procedures used in this study provide a powerful way of uncovering new centers of taxonomic variation within the genus Streptomyces.

  4. Organic Acid Characteristics and Tolerance of Sengon (Paraserianthes falcataria L Nielsen to Lead

    Directory of Open Access Journals (Sweden)

    Luluk Setyaningsih

    2012-12-01

    Full Text Available This study aimed to find out the lead tolerance of sengon (Paraserianthes falcataria seedling based on growth performance, tolerance index, and secretion and accumulation of organic acids content. Seedlings were exposed to lead (Pb with the concentration of 0, 0.5, 1, 1.5, 5, and 10 mM in liquid nutrient culture for 4 days in order to investigate secretion and accumulation  of  oxalic, malic, and citric content, and for 15 days to examine growth performance and tolerance index. The result showed that tolerance index and growth performance of sengon seedling were insignificant (p > 0.05 to the rising of Pb concentration up to 1.5 mM with tolerance index at least 95%, and even caused an increase of fresh weight.  However, the tolerance index and growth of sengon  decreased significantly due to Pb exposure of 5 and 10 mM.  Among the three organic acids, citrate was most dominant as compared to malate and oxalate.  Secretion of citrate increased significantly (p < 0.05 with the rising concentration of Pb 0.5, 1 and 1.5 mM,  reaching to 0.464, 0.540, and 0.587 µg mℓ-1, respectively, or rising according linear line (r = 0.9, p < 0.5.  Citrate accumulation showed inconsistent pattern with the rising Pb exposure.  The result suggested that sengon seedling have a slightly tolerance to lead by secretion of organic acid especially citric acid.Keywords: lead, sengon, tolerance, organic acid, liquid nutrient culture

  5. Asymptotic analysis for a simple explicit estimator in Barndorff-Nielsen and Shephard stochastic volatility models

    DEFF Research Database (Denmark)

    Hubalek, Friedrich; Posedel, Petra

    expressions for the asymptotic covariance matrix. We develop in detail the martingale estimating function approach for a bivariate model, that is not a diffusion, but admits jumps. We do not use ergodicity arguments. We assume that both, logarithmic returns and instantaneous variance are observed...... on a discrete grid of fixed width, and the observation horizon tends to infinity. This anaysis is a starting point and benchmark for further developments concerning optimal martingale estimating functions, and for theoretical and empirical investigations, that replace the (actually unobserved) variance process...

  6. Pan-Baltic Linas Libikas - sometimes Hobbes, sometimes Calvin / Linas Libikas ; interv. Ingrid Nielsen

    Index Scriptorium Estoniae

    Libikas, Linas

    2004-01-01

    Coca-Cola HBC Eesti AS-i turundusjuht olukorrast Baltimaade reklaamiturul, turundusspetsialistide sagedase töökohavahetamise võimalikest põhjustest ning oma eesmärkidest ettevõtte eesotsas. Lisa: Linas Libikas

  7. Exploring the Multitude of Muslims in Europe. Essays in Honour of Jørgen S. Nielsen

    DEFF Research Database (Denmark)

    through conceptualisations, productions and explorations of the multitudes of Muslims in Europe, and the authors draw on Jørgen S. Nielsen’s own work on the history and challenges of the Muslim community in Europe, critical thinking, ethnicities and theologies of Muslims in Europe, Muslim minorities...

  8. Aeg ei küsi, kelle hinges laulab lind / Katrin Nielsen

    Index Scriptorium Estoniae

    Nielsen, Katrin

    2000-01-01

    Pärnu Mudaravilas avatud nongratalase Asta Isaku maalinäitusest "Looduses ja lootuses" ning Chaplini kunstikeskuses avatud Tammiste hooldekodu elaniku Aivar Kurvitsa maalinäitusest "Ära reosta loodust"

  9. The Progeny Test Half-Sib Paraserianthes falcataria L. Nielsen at Taman Hutan Blok Cikabayan

    Directory of Open Access Journals (Sweden)

    Ali Mukmin

    2012-09-01

    Full Text Available 800x600 Analysis of genetic parameters in seedling seed orchard progeny trial of Paraserianthes falcataria at Taman Hutan Blok Cikabayan are very important to decide to continue  the breeding program.  The analysis was coducted on estimation of individual heritability and genetic correlation between traits. Result of analysis shows that individual heritability for height, diameter and form traits.  Normal 0 false false false IN X-NONE X-NONE MicrosoftInternetExplorer4

  10. Autosomal dominant spastic paraplegia with peripheral neuropathy maps to chr12q23-24.

    Science.gov (United States)

    Schüle, R; Bonin, M; Dürr, A; Forlani, S; Sperfeld, A D; Klimpe, S; Mueller, J C; Seibel, A; van de Warrenburg, B P; Bauer, P; Schöls, L

    2009-06-02

    Hereditary spastic paraplegias (HSP) are genetically exceedingly heterogeneous. To date, 37 genetic loci for HSP have been described (SPG1-41), among them 16 loci for autosomal dominant disease. Notwithstanding, further genetic heterogeneity is to be expected in HSP, as various HSP families do not link to any of the known HSP loci. In this study, we aimed to map the disease locus in a German family segregating autosomal dominant complicated HSP. A genome-wide linkage analysis was performed using the GeneChip Mapping 10Kv2.0 Xba Array containing 10,204 SNP markers. Suggestive loci were further analyzed by mapping of microsatellite markers. One locus on chromosome 12q23-24, termed SPG36, was confirmed by high density microsatellite fine mapping with a significant LOD score of 3.2. SPG36 is flanked by markers D12S318 and D12S79. Linkage to SPG36 was excluded in >20 additional autosomal dominant HSP families. Candidate genes were selected and sequenced. No disease-causing mutations were identified in the coding regions of ATXN2, HSPB8, IFT81, Myo1H, UBE3B, and VPS29. SPG36 is complicated by a sensory and motor neuropathy; it is therefore the eighth autosomal dominant subtype of complicated HSP. We report mapping of a new locus for autosomal dominant hereditary spastic paraplegia (HSP) (SPG36) on chromosome 12q23-24 in a German family with autosomal dominant HSP complicated by peripheral neuropathy.

  11. Autosomal dominant spastic paraplegia with peripheral neuropathy maps to chr12q23-24.

    NARCIS (Netherlands)

    Schule, R.; Bonin, M.; Durr, A.; Forlani, S.; Sperfeld, A.D.; Klimpe, S.; Mueller, J.C.; Seibel, A.; Warrenburg, B.P.C. van de; Bauer, P.; Schols, L.

    2009-01-01

    OBJECTIVE: Hereditary spastic paraplegias (HSP) are genetically exceedingly heterogeneous. To date, 37 genetic loci for HSP have been described (SPG1-41), among them 16 loci for autosomal dominant disease. Notwithstanding, further genetic heterogeneity is to be expected in HSP, as various HSP

  12. Diferenciación adaptativa entre poblaciones de Pinus canariensis Chr. Sm. ex DC

    OpenAIRE

    Lopez Rodriguez, Rosana

    2009-01-01

    RESUMEN En el presente trabajo se han caracterizado la variabilidad genética y la plasticidad fenotípica de caracteres adaptativos en los distintos estados de desarrollo de Pinus canariensis. En dos ensayos de sequía llevados a cabo bajo condiciones controladas, las plántulas de pino canario mostraron adaptaciones morfológicas y fisiológicas adecuadas para la captación de agua y optimización de la fotosíntesis en ambientes áridos. Entre estas respuestas, ...

  13. Marrow, ovary, and breast doses delivered by CHR diagnostic x-ray examinations: an update

    International Nuclear Information System (INIS)

    Schlenker, R.A.; Oltman, B.G.

    1977-01-01

    The mean absorbed dose averaged over the marrow volume in a RANDO phantom is 232 +- 14 mrad and 175 +- 26 mrad when the ANL examination is made using 1 mm Al and 3 mm Al added filtration, respectively; it is 606 +- 69 mrad when the MIT examination is made. The absorbed dose averaged over the ovaries is 243 +- 25 mrad and 162 +- 38 mrad for 1 mm Al and 3 mm Al at ANL and 606 +- 40 mrad for the MIT examination. Breast doses are 388 +- 35 mrad, 226 +- 9 mrad, and 333 +- 103 mrad. Dose reduction could be achieved by using a faster film-screen combination for the MIT examination, by routinely using 3 mm Al added filtration at ANL and by improving the collimation at ANL

  14. Review Of Consultations For Children With Sickle Cell Disease CHR Kenitra Morocco

    Directory of Open Access Journals (Sweden)

    Mouden Samira

    2015-01-01

    Full Text Available Abstract Also called sickle cell anemia Sickle cell anemia is a genetic disease of autosomal recessive linked to abnormal structure of the hemoglobin which leads to the formation of hemoglobin S HbS. The descriptive and cross that we conducted at the pediatric ward of the regional hospital Gharb study Chrarda benihessen Knitra we were enjoying a work force of 164 children with sickle cell disease over a period of twenty four months from June 2010 to June 2012 . On average seven to eight 7-8 new cases per year. The majority of these children admitted to the exhibit acute complications that are typically associated either to a chronic hemolytic anemia vaso -occlusive crisis acute chest syndrome or severe infections which aims to identify factors likely to play a role in the occurrence of the sickle cell crises. This can cause severe functional consequences with renal lung bone etc.. In order to understand the problems and difficulties faced by sickle cell and their families in their daily lives we have established a protocol form of a questionnaire exploring various aspects related to eating habits and lifestyle of these children. and their families as well as family socioeconomic status and the context of environmental life The size of the control group study consists of 60 children aged 7-14 years. Clinical and analytical information is collected from records medical records and doctors during consultations of these patients. The results show that 71 of these children are from rural areas against 20 of children of urban origin while 9 live in suburban area however. The majority of parents have irregular income low educational attainment. 68 of these children use septic false in parallel they use well water in consumption and domestic use. Clinical examination and blood cell abnormalities formula revealed prevalence of 76 for fever cases painful crises severe recurrent and unpredictable also observed as well as acute chest syndrome pneumonia or pulmonary infarction a bone or joint necrosis unpredictable 43 for leukocytosis . As we noted the presence of diarrhea in this sample. In conclusion the present study showed an association between the frequency of sickle cell crises especially infectious presented by the children studied and the environmental quality of family life in which the child develops.

  15. Chrístologie: Die historiese Jesus en die kerugmatiese Christus by ...

    African Journals Online (AJOL)

    dige Here van sy kerk. Die Christelike teologie en die kerk het dus nie 'n ander oprsprong as wat die Christologiese belydenis van die oer-Christendom het nie, naamlik die paasgebeure. Schmithals (1972b:77) wil kerk en teologie aanmoedig om hierdie oorsprong in gedagte te hou en om goed te besef dat die Christus-.

  16. Minimal time spiking in various ChR2-controlled neuron models.

    Science.gov (United States)

    Renault, Vincent; Thieullen, Michèle; Trélat, Emmanuel

    2018-02-01

    We use conductance based neuron models, and the mathematical modeling of optogenetics to define controlled neuron models and we address the minimal time control of these affine systems for the first spike from equilibrium. We apply tools of geometric optimal control theory to study singular extremals, and we implement a direct method to compute optimal controls. When the system is too large to theoretically investigate the existence of singular optimal controls, we observe numerically the optimal bang-bang controls.

  17. V ITER chrání zimu tuna stříbra

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    Říjen (2016) ISSN 2464-7888 Institutional support: RVO:61389021 Keywords : fusion * tokamak * ITER * thermal shield * silver * superconductivity Subject RIV: BL - Plasma and Gas Discharge Physics http://www.3pol.cz/cz/rubriky/jaderna-fyzika-a-energetika/1922-v-iter-chrani-zimu-tuna-stribra

  18. The role of violence in the romances of Chrétien de Troyes

    Directory of Open Access Journals (Sweden)

    Miha Pintarič

    2007-12-01

    Full Text Available Chretien de Troyes, the most famous of the French 12th-century authors of chivalric romaces, comes to a very personal view of violence towards the end of his writing career, in his Perceval or the grail story. While in his previous works, the first of which was Erec and Enid, the object of the present article, he abided by the commonly accepted norms concerning the description of »violence«: there's no »abstract violence«, and it should never befall and idea or a tradition while the violence against the individual is a common occurrence considered "creative" and legitimate, if not indispensable, for the making of social hierarchy and order, violence ceases to be a topic of interest in his last, unfinished text.

  19. Spectrum of hydrogen atom, Niels Bohr and their impact on contemporary science: a glimpse of modern spectroscopy

    International Nuclear Information System (INIS)

    Sastry, M.D.

    2013-01-01

    This contribution reviews developments in the atomic spectroscopy subsequent to Bohr's model. This follows a brief description of Bohr's model of hydrogen atom that accounts for sharp line spectra of hydrogen atom. The developments include the effects of electron and nuclear spins, spectroscopy of multi electron atom which involve electron-electron repulsion and different angular momentum coupling schemes. More recently, Bohr's atom model has found application to processes at nano dimensions of semiconducting materials. It has now become possible to create a hydrogen-like atom, an exciton, with its size comparable or even more than that of the particle it self. This brings in extra quantization and has profound effects on the motion of the particles involved viz electron and hole. (author)

  20. Niels W. Gade, Violin Concerto op. 56: Supplementary comments to the critical edition, NWGW I:12 (2003)

    DEFF Research Database (Denmark)

    Pedersen, Peder Kaj

    2012-01-01

    concertos under the headline: “Danish Romantic Concertos”. The word Romantic is a key word: Romanticism and the part of Danish cultural heritage which could be labeled as romantic, as far as music is concerned, has become a new possibility in recent decades, while being discredited in most part of the 20th...... be better than its reputation’, as one critic put it in a review of the Åstrand-recording, and illuminating the relationship between artistic considerations on the part of the composer and ways of receiving the music by potential performers, critics, and, ultimately, the public....

  1. Lille magt, men stort imperium. Et bidrag til debatten om TV og medieimperialisme

    Directory of Open Access Journals (Sweden)

    Niels-Aage Nielsen

    1987-08-01

    Full Text Available Denne artikel tager fat i alt det svære - det begrebsmæssige - som vi enten springer over eller tager for givet i vores diskussioner af TV som magt- og påvirkningsfaktor. Derfor er den lang og til tider lidt omstændelig, idet den undgår at tage vores umiddelbare antagelser for pålydende. I stedet bliver de endevendt. I de seneste 15 års medieforskning har magten været implicit til stede et eller andet sted i TV. Vi har skiftevis kritiseret mediet, frygtet det, taget afstand fra det og er nu senest med receptionsteorierne blevet beroliget: Enhver TV-seer skaber ud fra sin egen sunde fornuft sin personlige opfattelse af "Dollars". Påvirkningen af hende er ikke længere producen- ternes eller medieforskernes eller Danmarks Radios ansvar, det er seerens eget. Medieimperialismen er dermed opløst, ihvertfald som undertrykkelsessystem. Det første kritikpunkt i Niels-Aage Nielsens diskussion er medie- imperialismeteorien. Den har ikke nogen teori om hvordan magten sætter sig igennem hævder han, idet den alene ved cirkler og pile focuserer på ensidigheden i "flow'et" fra USA med resten af verden som modtagere. Hvis det skal udtrykke en magtposition, må der være en relation mellem varestrømmene (basis og den ideologiske overbygning. Vi er vant til at antage, at denne relation findes, men hvordan sætter den sig igennem? Diskussion heraf er - i bedste fald - gået i stå. For at kunne gå videre her, tager Niels-Aage Nielsen et opgør med receptionsteoriens socialpsykologi og søger at afdække hvilken del af betydningsdannelsen, og dermed påvirkningen, som netop unddrager sig en receptionsanalyse, der bygger på seerens egne udsagn og uden f.eks. en psykoanalytisk tilgang. Betydningsproblemet skal endda diskuteres endnu mere pricipielt: Vi er i dag mindre enige end nogensinde om hvad der er TV's samfunds- mæssige funkitioner. Uklarheden hænger bl.a. sammen med at ideologi- begrebet gradvist forsvandt ud af medieforskningens hovedst

  2. Når det er svært at være ung i DK

    DEFF Research Database (Denmark)

    Nielsen, Jens Christian; Sørensen, Niels Ulrik

    Når det er svært at være ung i DK – viden og råd om unges trivsel og mistrivsel er afslutningen på et større forskningsprojekt om unges trivsel og mistrivsel. Hæftet præsenterer forskningsprojektets hovedkonklusioner og giver desuden en række råd og ideer til, hvordan voksne kan hjælpe unge med...... at håndtere mistrivsel. Hæftet er udarbejdet af forskerne Jens Christian Nielsen og Niels Ulrik Sørensen fra Center for Ungdomsforskning. Det er den sidste publikation i forskningsprojektet Når det er svært at være ung i DK, der fra 2008-2011 har belyst unges trivsel og mistrivsel. Projektet bygger både på en...

  3. A Linguist's life. An English translation of Otto Jespersen' autobiography with notes, photos and a bibliography. EDited by Arne Juul, Hans F. Nielsen, Jørgen Erik Nielsen. Odense university press; Odense 1995

    Directory of Open Access Journals (Sweden)

    Gunver Skytte

    1997-12-01

    Full Text Available È un tratto positivo della linguistica di oggi l'interesse rinnovato per la storia della linguistica e per i grandi classici della linguistica, molti dei quali sono oggetto di un vero revival scientifico. Basti ricordare ii caso di Lucien Tesnière, le cui teorie oggi sono fonte di  ricca  ispirazione,  come testimonia  ii  volume  Linguistica XXX IV, I . M élanges Lucien Tesnière, Ljubljana 1994.

  4. Anaesthesia management of a case of Jervell and Lange-Nielsen syndrome for minimally invasive bilateral thoracoscopic cervicothoracic sympathectomy

    Directory of Open Access Journals (Sweden)

    Preety Mittal Roy

    2016-01-01

    Full Text Available Long QT syndrome (LQTS is an arrhythmogenic cardiac disorder resulting from the malfunction of cardiac ion channels. Patient with LQTS may present with syncope, seizures or sudden cardiac death secondary to polymorphic ventricular tachycardia (VT or torsades de pointes. Patient may be asymptomatic in the pre-operative period but may develop VT for the first time in operation theatre. We are reporting anaesthetic management of a child with LQTS planned for bilateral thoracoscopic cervicothoracic sympathectomy.

  5. Xanthine oxidase inhibitors from Archidendron clypearia (Jack.) I.C. Nielsen: Results from systematic screening of Vietnamese medicinal plants

    Institute of Scientific and Technical Information of China (English)

    Nguyen Thuy Duong; Pham Duc Vinh; Phuong Thien Thuong; Nguyen Thi Hoai; Le Nguyen Thanh; Tran The Bach; Nguyen Hai Nam; Nguyen Hoang Anh

    2017-01-01

    Objective:To screen Vietnamese medicinal plants for xanthine oxidase (XO) inhibitory activity and to isolate XO inhibitor(s) from the most active plant.Methods: The plants materials were extracted by methanol. The active plant materials were fractionated using different organic solvents, includingn-hexane, ethyl acetate, andn-butanol. Bioassay-guided fractionation and column chromatography were used to isolate compounds. The compounds structures were elucidated by analysis of spectroscopic data, including IR, MS, and NMR. Results:Three hundreds and eleven methanol extracts (CME) belonging to 301 Vietnamese herbs were screened for XO inhibitory activity. Among these plants, 57 extracts displayed XO inhibitory activity at 100 μg/mL with inhibition rates of over 50%. The extracts of Archidendron clypearia,Smilax poilanei,Linociera ramiflora and Passiflora foetida exhibited the greatest potency with IC50 values below 30 μg/mL. Chemical study performed on the extract ofArchidendron clypearia resulted in the isolation of six compounds, including 1-octacosanol, docosenoic acid, daucosterol, methyl gallate, quercitrin and (?)-7-O-galloyltricetiflavan. The compound (?)-7-O-galloyltricetiflavan showed the most potent XO inhibitory activity with an IC50 value of 25.5 μmol/L.Conclusions:From this investigation, four Vietnamese medicinal plants were identified to have XO inhibitory effects with IC50 values of the methanol extracts below 30 μg/mL. Compound (?)-7-O-galloyltricetiflavan was identified as an XO inhibitor from Archidendron clypearia with IC50 value of 25.5 μmol/L.

  6. Xanthine oxidase inhibitors from Archidendron clypearia (Jack.) I.C. Nielsen: Results from systematic screening of Vietnamese medicinal plants.

    Science.gov (United States)

    Duong, Nguyen Thuy; Vinh, Pham Duc; Thuong, Phuong Thien; Hoai, Nguyen Thi; Thanh, Le Nguyen; Bach, Tran The; Nam, Nguyen Hai; Anh, Nguyen Hoang

    2017-06-01

    To screen Vietnamese medicinal plants for xanthine oxidase (XO) inhibitory activity and to isolate XO inhibitor(s) from the most active plant. The plants materials were extracted by methanol. The active plant materials were fractionated using different organic solvents, including n-hexane, ethyl acetate, and n-butanol. Bioassay-guided fractionation and column chromatography were used to isolate compounds. The compounds structures were elucidated by analysis of spectroscopic data, including IR, MS, and NMR. Three hundreds and eleven methanol extracts (CME) belonging to 301 Vietnamese herbs were screened for XO inhibitory activity. Among these plants, 57 extracts displayed XO inhibitory activity at 100 μg/mL with inhibition rates of over 50%. The extracts of Archidendron clypearia (A. clypearia), Smilax poilanei, Linociera ramiflora and Passiflora foetida exhibited the greatest potency with IC 50 values below 30 μg/mL. Chemical study performed on the extract of A. clypearia resulted in the isolation of six compounds, including 1-octacosanol, docosenoic acid, daucosterol, methyl gallate, quercitrin and (-)-7-O-galloyltricetiflavan. The compound (-)-7-O-galloyltricetiflavan showed the most potent XO inhibitory activity with an IC 50 value of 25.5 μmol/L. From this investigation, four Vietnamese medicinal plants were identified to have XO inhibitory effects with IC 50 values of the methanol extracts below 30 μg/mL. Compound (-)-7-O- galloyltricetiflavan was identified as an XO inhibitor from A. clypearia with IC 50 value of 25.5 μmol/L. Copyright © 2017 Hainan Medical University. Production and hosting by Elsevier B.V. All rights reserved.

  7. Employer and Employee Opinions About Workplace Health Promotion (Wellness) Programs: Results of the 2015 Harris Poll Nielsen Survey.

    Science.gov (United States)

    McCleary, Katherine; Goetzel, Ron Z; Roemer, Enid Chung; Berko, Jeff; Kent, Karen; Torre, Hector De La

    2017-03-01

    The aim of this study was to provide a current picture of the state of workplace health promotion (wellness) programs in the U.S. from both employer and employee perspectives. We analyzed data from two independent surveys of employers (N = 1500) and the general population (N = 4611). Employers reported offering wellness programs at almost twice the rate of employees who reported having these programs available to them. Most (59.4%) employees felt employers should play a role in improving worker health and nearly three-fourths (72.1%) thought that lower insurance premiums should be offered for participation in wellness programs. However, fewer than half felt that their work environment allows them to maintain good health. Although wellness programs are offered at the majority of workplaces in the U.S., employees are unlikely to be aware of these efforts and would like employers to be forthcoming in providing programs promoting good health.

  8. The standard model and the fine structure constant at Planck distances in Bennet-Brene-Nielsen-Picek random dynamics

    International Nuclear Information System (INIS)

    Laperashvili, L.V.

    1994-01-01

    An overview of papers by Nielson, Bennet, Brene, and Picek, forming the basis of the model called random dynamics, is given in the first part of this work. The fine structure constant is calculated in the second part of this work by using the technique of path integration in the U(1) lattice gauge theory. It is shown that α U(1),crit -1 ∼ 19.8. This value is in agreement with the prediction of random dynamics. The obtained results are compared with the results of Monte Carlo simulations. 20 refs., 3 figs., 1 tab

  9. 78 FR 59690 - Nielsen Holdings N.V., a Corporation and Aribtron Inc., a Corporation; Analysis of Agreement...

    Science.gov (United States)

    2013-09-27

    ... transaction based upon what must be acknowledged as a novel theory--that is, that the merger will... entrants and their likely incentives.\\9\\ Although all merger review necessarily is forward looking, it is... general presumption that economic theory teaches that an increase in market concentration implies a...

  10. Tormi üleelamine pärast peoaastaid / Kristian Lau Nielsen ; tõlkinud Liisa Past

    Index Scriptorium Estoniae

    Nielsen, Kristian Lau

    2009-01-01

    Autor kritiseerib eelarvekärbete tegemist, märkides, et sisuliselt kõigi teiste arenenud riikide valitsused on pöördunud avalike kulutuste suurendamise poole, ning viidates majandusteadlaste seisukohtadele. Kärpele tuleks eelistada lühiajalist eelarvedefitsiiti ja laenamist

  11. S chráněnými živočichy pod jednou střechou

    Czech Academy of Sciences Publication Activity Database

    Zukal, Jan

    2016-01-01

    Roč. 2016, č. 1 (2016), s. 25-26 ISSN 1805-983X Institutional support: RVO:68081766 Keywords : bats Subject RIV: EG - Zoology http://www.pronasdum.cz/images/img/Bulletin_2016_01/bulletin_2016_01.pdf

  12. Analyse physico-chimique de l'eau de l'unité d'hémodialyse du chr ...

    African Journals Online (AJOL)

    The objective of this work is to monitor the effectiveness of the water treatment system for hemodialysis concentrated dilution to ensure its safety. The samples were taken on key issues of hemodialysis water's treatment circuit. Three levels of sampling were selected. At the entrance and at the outlet of the reverse osmosis ...

  13. d ie penne st rydtu sse nd ie chr ist ene en he id eneg ed ur en ded ...

    African Journals Online (AJOL)

    Test

    is so oud as die Christendom self. Die doel van hierdie artikel is om kortliks na te gaan waiter aanvalle die Christene gedurende die eerste drie eeue van die kant van die heidene geleerdes ondervind, en hoe hulle daarop reageer het. Die heidense letterkunde tot ongeveer die middel van die tweede eeu bevat besonder ...

  14. Semeia und Tekmeria im 5. Jahrhundert v. Chr.: Ein Beitrag zur Geschichte der ältesten griechischen Semiotik und Argumentationstechnik

    Czech Academy of Sciences Publication Activity Database

    Klouda, Jiří

    2016-01-01

    Roč. 139, 3/4 (2016), s. 275-299 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : theory of signs * theory of argumentation * the older Attic orators * Hippocratic Prognosticon * Dissoi logoi Subject RIV: AA - Philosophy ; Religion

  15. Mapping cell-specific functional connections in the mouse brain using ChR2-evoked hemodynamics (Conference Presentation)

    Science.gov (United States)

    Bauer, Adam Q.; Kraft, Andrew; Baxter, Grant A.; Bruchas, Michael; Lee, Jin-Moo; Culver, Joseph P.

    2017-02-01

    Functional magnetic resonance imaging (fMRI) has transformed our understanding of the brain's functional organization. However, mapping subunits of a functional network using hemoglobin alone presents several disadvantages. Evoked and spontaneous hemodynamic fluctuations reflect ensemble activity from several populations of neurons making it difficult to discern excitatory vs inhibitory network activity. Still, blood-based methods of brain mapping remain powerful because hemoglobin provides endogenous contrast in all mammalian brains. To add greater specificity to hemoglobin assays, we integrated optical intrinsic signal(OIS) imaging with optogenetic stimulation to create an Opto-OIS mapping tool that combines the cell-specificity of optogenetics with label-free, hemoglobin imaging. Before mapping, titrated photostimuli determined which stimulus parameters elicited linear hemodynamic responses in the cortex. Optimized stimuli were then scanned over the left hemisphere to create a set of optogenetically-defined effective connectivity (Opto-EC) maps. For many sites investigated, Opto-EC maps exhibited higher spatial specificity than those determined using spontaneous hemodynamic fluctuations. For example, resting-state functional connectivity (RS-FC) patterns exhibited widespread ipsilateral connectivity while Opto-EC maps contained distinct short- and long-range constellations of ipsilateral connectivity. Further, RS-FC maps were usually symmetric about midline while Opto-EC maps displayed more heterogeneous contralateral homotopic connectivity. Both Opto-EC and RS-FC patterns were compared to mouse connectivity data from the Allen Institute. Unlike RS-FC maps, Thy1-based maps collected in awake, behaving mice closely recapitulated the connectivity structure derived using ex vivo anatomical tracer methods. Opto-OIS mapping could be a powerful tool for understanding cellular and molecular contributions to network dynamics and processing in the mouse brain.

  16. Primary Eye Irritation Potential of Insect Repellents. Methyl N,N’-Dihexylethylenediaminemonocarbamate (CHR4), (E)-1,2,3,4-Tetrahydro-6-Methyl-1-(2-Methyl-1-Oxo-2-Butenyl) Quinoline (CHR5) and 1,2,3,4-Tetrahydro-6-Methyl-1-(3-Methyl-1-Oxo-2-Butenyl) Quinoline (CHR6).

    Science.gov (United States)

    1983-08-01

    through opacity .................. 4 IRIS Normal ............................................................... I Markedly deepened rugae , congestion...of the rugae or light hyperemia of circumcorneal blood vessels), or obvious swelling of the eyelids were considered to be signs of Positive eye

  17. Does the competition between sea and road transport become more severe? = Uzhestotshenije konkurentsii v dostavke tovarov mezhdu morskimi ja suhhoputnõmi putjami / Niels Harnack

    Index Scriptorium Estoniae

    Harnack, Niels

    2003-01-01

    Ettekanne 3.-4. detsembrini 2003 Tallinnas toimunud rahvusvahelisel konverents-näitusel "Logistics and transport in international trade" prognoosib riikidevaheliste kaubaveomahtude kasvu mõju Läänemere sadamate tegevusele ja konkurentsivõimele

  18. Viscosity overshoot followed by steady state measured in uni-axial elongation of LDPE. Ole Hassager, Henrik Koblitz Rasmussen, Anders Bach and Jens Kromann Nielsen

    DEFF Research Database (Denmark)

    Rasmussen, Henrik Koblitz; Hassager, Ole; Bach, Anders

    2004-01-01

    The transient (e.g. start up of) elongational viscosity of three low-density polyethylene (LDPE) melts (BASF Lupolen 1810H, 1840D and 3020D) was measured using a filament stretching rheometer (FSR) capable of measuring at elevated temperatures. The transient uni-axial elongational viscosity showe...

  19. Ellujääja: George'i sõber Anders on heas kirjas ka Baracki juures / Kristian Lau Nielsen

    Index Scriptorium Estoniae

    Nielsen, Kristian Lau

    2009-01-01

    Taani presidendist Anders Fogh Rasmussenist, kellele ennustatakse NATO peasekretäri kohta. Tema poliitilisest karjäärist, poliitilistest hoiakutest ja nende muutumisest ning välispoliitilistest vaadetest. Vt. samas: Muslimiriigid tahavad vetot

  20. Využití památkově chráněných budov pro cestovní ruch

    OpenAIRE

    Kalkusová, Barbora

    2013-01-01

    The thesis has the purpose of reviewing the problem of the use of historical buildings for the requirements of the tourism in the Prague Heritage Reservation. The heritage property fund is one of the principal parts of our national cultural heritage. The existence of preserved and maintained monuments is the basic requirement for the development of the tourism in city reservations. The theoretical part is dedicated to specify the current issues through the analysis of Prague tourism, heritage...

  1. Allele and haplotype diversity of new multiplex of 19 ChrX-STR loci in Han population from Guanzhong region (China).

    Science.gov (United States)

    Zhang, Yu-Dang; Shen, Chun-Mei; Meng, Hao-Tian; Guo, Yu-Xin; Dong, Qian; Yang, Guang; Yan, Jiang-Wei; Liu, Yao-Shun; Mei, Ting; Huang, Rui-Zhe; Zhu, Bo-Feng

    2016-07-01

    X-chromosomal short tandem repeats (X-STRs) have been proved to be useful for some deficiency paternity cases in recent years. Here, we studied the genetic polymorphisms of 19 X-STR loci (DXS10148-DXS10135-DXS8378, DXS10159-DXS10162-DXS10164, DXS7132-DXS10079-DXS10074-DXS10075, DXS6809-DXS6789, DXS7424-DXS101, DXS10103-HPRTB-DXS10101 and DXS7423-DXS10134) in 252 male and 222 female individuals from Guanzhong Han population, China. No deviation for all 19 loci was observed from the Hardy-Weinberg equilibrium. The polymorphism information content values of the panel of 19 loci were more than 0.5 with the exception of the locus DXS7423. The combined power of discrimination were 0.9999999999999999999994340 in females and 0.9999999999997662 in males, respectively; and the combined mean exclusion chances were 0.999999993764 in duos and 0.999999999997444 in trios, respectively. The haplotype diversities for all the seven clusters of linked loci were more than 0.9. The results showed that the panel of 19 X-STR loci were powerful for forensic applications in Guanzhong Han population. Locus by locus population comparisons showed significant differences at more than seven loci between Guanzhong Han population and the groups from North America, Europe and Africa. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Le rêve entendu par les chrétiens de la Communauté Évangélique du Congo

    OpenAIRE

    MANSIANTIMA MIANKENDA , Alain-Fidèle

    2015-01-01

    International audience; Pour Sigmund FREUD, le rêve est une source de connaissance de soi. C'est la « voie royale » de la connaissance de l'inconscient. Selon lui, le sommeil est un état où le dormeur ne veut rien savoir du monde extérieur. Le rêve est donc le gardien du sommeil, c'est lui qui nous permet de rester endormis puisqu'en réalisant les désirs, il supprime le psychisme de ses excitations. Les fidèles de la Communauté Evangélique du Congo, en particulier ceux de la Paroisse de N'dji...

  3. Juifs, chrétiens et musulmans après l'expulsion d'Espagne : le cas Nord-Africain

    Directory of Open Access Journals (Sweden)

    Michel Abitol

    1993-01-01

    Full Text Available Le 9 février 1616, on assista á la Haye á un spectacle peu commun, celui d'un convoi fúnebre juif, conduit en grande pompe par le Prince Maurice de Nassau, entouré de membres éminents de son Conseil d'Etat et des Etats-Généraux. Le notable honoré de la serte n'était pourtant ni une grande sommité intellectuelle ni méme un personnage natif de Hollando. C'était tout juste un juif du Maroc, nommé Samuel Pallache qui, entre autres activités ténébreuses, faisait fonction d'agent du Rol du Maroc, Mawlay Zidan, aux Pays-Bas.

  4. The SWI/SNF chromatin-remodeling gene AtCHR12 mediates temporary growth arrest in Arabidopsis thaliana upon perceiving environmental stress

    NARCIS (Netherlands)

    Mlynarova, L.; Nap, J.P.H.; Bisseling, T.

    2007-01-01

    One of the earliest responses of plants to environmental stress is establishing a temporary growth arrest that allows adaptation to adverse conditions. The response to abiotic stress requires the modulation of gene expression, which may be mediated by the alteration of chromatin structures. This

  5. Boris Mouravieff, Écrits sur Ouspensky, Gurdjieff et sur la Tradition ésotérique chrétienne

    Directory of Open Access Journals (Sweden)

    Olivier Santamaria

    2009-06-01

    Full Text Available La maison Dervy vient de publier, à l’initiative de l’Association Boris Mouravieff, un recueil d’une dizaine articles parus entre 1954 et 1961 notamment dans la « Revue Suisse d’Histoire » et dans la revue belge « Synthèses », lesquels étaient devenus à peu près introuvables. Les sujets abordés sont divers : certains articles traitent de théologie politique (« Le problème de l’homme nouveau », « Liberté, égalité, fraternité », « L’Histoire a-t-elle un sens ? » ou d’histoire religieuse (« Des...

  6. Belege für die Anwesenheit von Eliten des 6./5. Jahrhunderts v. Chr. am Zusammenfluss von Elbe und Moldau in Mittelböhmen

    Czech Academy of Sciences Publication Activity Database

    Chytráček, Miloslav

    2015-01-01

    Roč. 90, č. 1-2 (2015), s. 271-300 ISSN 0079-4848 Grant - others:Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR(CZ) M300021201 Program:M Institutional support: RVO:67985912 Keywords : Bohemia * Late Hallstatt * Early La Tène * cemetery * settlement * Etruscan bronze basins * drinking horns * amber routes * wreath * cult Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.103, year: 2015

  7. K problematice původu napodobenin řecké keramiky z Plzně-Roudné a Chržína

    Czech Academy of Sciences Publication Activity Database

    Trefný, M.; Kloužková, A.; Chytráček, Miloslav; Hanykýř, V.

    2011-01-01

    Roč. 63, č. 1 (2011), s. 151-161 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Attic pottery * imitation * chemical and mineralogical analysis Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. I prokaryota si chrání svoji RNA – nové typy 5'-RNA čepiček

    Czech Academy of Sciences Publication Activity Database

    Cahová, Hana

    2017-01-01

    Roč. 111, č. 7 (2017), s. 414-423 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GJ16-16358Y Institutional support: RVO:61388963 Keywords : 5'-RNA cap * NAD-RNA * RNA chemical modification Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 0.387, year: 2016 http://www.chemicke-listy.cz/docs/full/2017_07_414-423.pdf

  9. Musikterapiuddannelsen 25 år - Festskrift

    DEFF Research Database (Denmark)

    musikterapeutisk hovedinstrument?  - ændrede studieordninger på musikterapiuddannelsen Lars Ole Bonde: Studieordningen af 2006 i praksis. Erfaringer fra det første år Carl Bergstrøm-Nielsen: En ny musikfaglighed Britta Kvist: Mit liv som UA'er i 24 år Niels Hannibal: Når teori og praksis lever side om side Tony...... Wigram: Doctoral Research School in Music Therapy, Aalborg University Lars Ole Bonde: Forskerskolen i musikterapi - en international succes Peder Kaj Pedersen: Musikterapeutiske forskningsstrategier. Profane replikker fra sidelinien Anne Steen Møller: "Musikterapeut? Hvor spændende! Hvad laver sådan én......?" Helga Pallesen: En ældre studerende på en ung uddannelse Lis Karlsen & Anne Eijgendaal: En historie om hvordan musikterapeuterne blev fagligt organiserede Hanne Mette Ridder: Hvor går kandidaterne hen, når de går ud?           Musiksatser af bl.a. Bo Hulgaard, Bjørn Veierskov Alexandersson, og Carl...

  10. Danish Post‐Secondary Students Use Public Libraries for Study Purposes. A review of: Pors, Niels Ole. “The Public Library and Students’ Information Needs.” New Library World 107.1226/12272 (2006: 275‐85.

    Directory of Open Access Journals (Sweden)

    Julie McKenna

    2007-09-01

    Full Text Available Objective – To determine whether and how Danish university and higher education students use public libraries for studypurposes.Design – Online survey.Setting – Post‐secondary programs in Denmark.Subjects – 1,575 students in university‐level programs or other higher education programs (vocational three‐to‐four‐year programs in Denmark.Methods – A sample of students was drawn from the national database of students by selecting every student born on the 15th of every month (approximately 4,900 students. A letter describing the study and with an invitation to fill out an online questionnaire was sent to all students in the sample. There were 1,694 valid responses (approximately 35% response rate. Students following short vocational programs were deemed to be under‐represented and these subjects were omitted from the analysis of this report,which reflects the response of 1,575 students. The online questionnaire gathered demographic details (gender, age, educational institution, study topic, study year, geographical location, access to the Internet, etc. and used 110 questions or statements to gather information about student information‐seeking behaviour related to study purposes. These included use of the physical library and satisfaction with services, use of search engines, awareness and use of library Web‐based services, study behaviour, and participation in information literacy activities. Main results – For the purposes of this study, “academic library is used as a generic term covering university libraries, research libraries, educational libraries and all other kind of libraries outside the field of public libraries” (p. 278. The survey results confirmed many of the previous international reports of student information‐seeking behaviour: 85% of students use the academic library for study purposes; fewer than 10% of all students are able to cope without any library use; students in technology and engineering, the sciences and arts, architecture and music have a higher rate of non‐use of their academic libraries; a large percentage of students access the electronic resources from home; the physical library is still considered important to students; Google is used extensively and is nearly the exclusive choice for search engine. The public library is used for study purposes by about 58 percent of all students with the highest use (76% by students in higher education institutions (HEI; students of education, social topics and psychology are very frequent public library users. Female students in HEI were the most frequent users of the public library independent of study subject or year, or any other demographic variable. Seven per cent of students rely exclusively on the public library for study purposes and first‐year HEI students in the subject areas of education, social topics and psychology are over‐represented in this group (which additionally has less Internet access from home than the other students. Students perceive nearly all aspects of service in the academic library as superior; HEI students rate ambience, electronic resources and speed of inter‐library loan provision in the public library as higher than the academic. University students give a low rating to the collections of public library, although the students use the public library principally to supplement the collections available in their academic libraries. Another high use of public libraries by HEI students is for interlibrary loans placed through the national resource sharing system. Public library reference services are used often by only one per cent of students and only two per cent use the public library on a regular basis for “study related group activities.” Conclusion – Students use physical libraries to a great extent to support their studies and students have embraced digital access to collections, especially access from home. Google is the most heavily used search engine and is used by nearly all students;use of Google complements and supplements library use. Nearly 60% of all students use public libraries for study purposes and to supplement the collections of their academic library, but they find that the public library collections are insufficient to meet their needs. The inter‐library loan policies of public libraries are more lenient and accommodating to student needs and may drive the high use of public libraries. Students form a large constituency of the public library user population and they generally rate most aspects of service as substandard to those of academic libraries. There is a call for review of the public library’s role in meeting the information needs of students, and in particular, those of HEI programs who are most dependent on the public library.

  11. Niels Hellner: Die Säulenbasen des zweiten Dipteros von Samos. Grundlage für die Rekonstruktion des Tempels in Seinen Bauphasen. Hrsg. von H.J. Kienast

    DEFF Research Database (Denmark)

    Pedersen, Poul

    2015-01-01

    EN anmeldelse af bind XXVI i Samos projektets udgravningsserie. Om søjlebasernes typologi, datering og konsekvenserne heraf for templets og dets betydning for antikkens arkitekturhistorie......EN anmeldelse af bind XXVI i Samos projektets udgravningsserie. Om søjlebasernes typologi, datering og konsekvenserne heraf for templets og dets betydning for antikkens arkitekturhistorie...

  12. Nationale test

    DEFF Research Database (Denmark)

    2009-01-01

    Professor Sven Erik Nordenbo og centerleder Niels Egelund, begge DPU, i samtale om nationale test.......Professor Sven Erik Nordenbo og centerleder Niels Egelund, begge DPU, i samtale om nationale test....

  13. Health care and social care costs of pneumonia in Denmark: a register-based study of all citizens and patients with COPD in three municipalities

    Directory of Open Access Journals (Sweden)

    Brogaard SL

    2015-10-01

    Full Text Available Susanne Lausten Brogaard,1 Maj Britt Dahl Nielsen,1 Lars Ulrik Nielsen,2 Trine Mosegaard Albretsen,3 Morten Bundgaard,4 Niels Anker,1 Maja Appel,1 Kim Gustavsen,1 Rose-Marie Lindkvist,5 Anne Skjoldan,2 Grete Breinhild,3 Peter Bo Poulsen5 1COWI AS, Management - Health, Kongens Lyngby, 2Seniors and Health Department, Gladsaxe Municipality, Welfare Technology, Søborg, 3Elderly and Health Care Department, Lolland Municipality, Maribo, 4Department of Public Health, Holbaek Municipality, Holbaek, 5Pfizer Denmark ApS, Health & Value, Ballerup, Denmark Background: Pneumonia is a frequent lung infection and a serious illness, which is often diagnosed among patients hospitalized with acute exacerbations of COPD. The aim of this study was to estimate the attributable costs due to pneumonia among patients hospitalized with pneumonia compared to a matched general population control group without pneumonia hospitalization.Methods: This study includes citizens older than 18 years from three municipalities (n=142,344. Based on national registers and municipal data, the health and social care costs of pneumonia in the second half of 2013 are estimated and compared with propensity score-matched population controls.Results: The average health care costs of 383 patients hospitalized with pneumonia in the second half of 2013 were US$34,561 per patient. Among pneumonia patients with COPD, the costs were US$35,022. The attributable costs of patients with pneumonia compared to the population control group for the 6-month period were US$24,155 per case. Overall, the attributable costs for the 383 pneumonia cases amounted to US$9.25 million. Subgroup analyses showed that costs increased with age. The attributable costs due to pneumonia were highest among the 18–59-year-old and the 70–79-year-old patients. This difference is likely to reflect an increased risk of mortality among the pneumonia patients. Men have higher costs than women in the pneumonia group

  14. Gamma non-ionizing energy loss: Comparison with the damage factor in silicon devices

    Science.gov (United States)

    El Allam, E.; Inguimbert, C.; Meulenberg, A.; Jorio, A.; Zorkani, I.

    2018-03-01

    The concept of non-ionizing energy loss (NIEL) has been demonstrated to be a successful approach to describe the displacement damage effects in silicon materials and devices. However, some discrepancies exist in the literature between experimental damage factors and theoretical NIELs. 60Co gamma rays having a low NIEL are an interesting particle source that can be used to validate the NIEL scaling approach. This paper presents different 60Co gamma ray NIEL values for silicon targets. They are compared with the radiation-induced increase in the thermal generation rate of carriers per unit fluence. The differences between the different models, including one using molecular dynamics, are discussed.

  15. Horizontal transfer of GM DNA - why is almost no one looking? Open letter to Kaare Nielsen in his capacity as a member of the European Food Safety Authority GMO panel.

    Science.gov (United States)

    Ho, Mae-Wan

    2014-01-01

    A culture of denial over the horizontal spread of genetically modified nucleic acids prevails in the face of direct evidence that it has occurred widely when appropriate methods and molecular probes are used for detection.

  16. Horizontal transfer of GM DNA – why is almost no one looking? Open letter to Kaare Nielsen in his capacity as a member of the European Food Safety Authority GMO panel

    Directory of Open Access Journals (Sweden)

    Mae-Wan Ho

    2014-09-01

    Full Text Available A culture of denial over the horizontal spread of genetically modified nucleic acids prevails in the face of direct evidence that it has occurred widely when appropriate methods and molecular probes are used for detection.

  17. Porovnání modelových chráněných území - hodnocení kvality a konektivity habitatů

    OpenAIRE

    Hrdina, Aleš

    2014-01-01

    This diploma thesis deals with the biodiversity hotspots - high biodiversity areas with a large proportion of endemic species, which also has already lost a significant part of its natural habitat. The historical development of the biodiversity hotspots concept is described, all 34 hotspots is characterized, species diversity and endemism of plants and animals, potential natural vegetation is analysed, as well as threats, anthropogenic impact and conservation considering protected areas, cate...

  18. Characterization and Structure Prediction of Partial Length Protein Sequences of pcoA, pcoR and chrB Genes from Heavy Metal Resistant Bacteria from the Klip River, South Africa

    Directory of Open Access Journals (Sweden)

    Patience Chihomvu

    2015-04-01

    Full Text Available The Klip River has suffered from severe anthropogenic effects from industrial activities such as mining. Long-term exposure to heavy metal pollution has led to the development of heavy metal resistant strains of Pseudomonas sp. KR23, Lysinibacillus sp. KR25, and E. coli KR29. The objectives of this study were to characterize the genetics of copper and chromate resistance of the isolates. Copper and chromate resistance determinants were cloned and sequenced. Open reading frames (ORFs related to the genes CopA and CopR were identified in E. coli KR29, PcoA in Lysinibacillus sp. KR25 and none related to chromate resistance were detected. The 3D-models predicted by I-TASSER disclose that the PcoA proteins consist of β-sheets, which form a part of the cupredoxin domain of the CopA copper resistance family of genes. The model for PcoR_29 revealed the presence of a helix turn helix; this forms part of a DNA binding protein, which is part of a heavy metal transcriptional regulator. The bacterial strains were cured using ethidium bromide. The genes encoding for heavy metal resistance and antibiotic resistance were found to be located on the chromosome for both Pseudomonas sp. (KR23 and E. coli (KR29. For Lysinibacillus (KR25 the heavy metal resistance determinants are suspected to be located on a mobile genetic element, which was not detected using gel electrophoresis.

  19. Characterization and structure prediction of partial length protein sequences of pcoA, pcoR and chrB genes from heavy metal resistant bacteria from the Klip River, South Africa.

    Science.gov (United States)

    Chihomvu, Patience; Stegmann, Peter; Pillay, Michael

    2015-04-01

    The Klip River has suffered from severe anthropogenic effects from industrial activities such as mining. Long-term exposure to heavy metal pollution has led to the development of heavy metal resistant strains of Pseudomonas sp. KR23, Lysinibacillus sp. KR25, and E. coli KR29. The objectives of this study were to characterize the genetics of copper and chromate resistance of the isolates. Copper and chromate resistance determinants were cloned and sequenced. Open reading frames (ORFs) related to the genes CopA and CopR were identified in E. coli KR29, PcoA in Lysinibacillus sp. KR25 and none related to chromate resistance were detected. The 3D-models predicted by I-TASSER disclose that the PcoA proteins consist of β-sheets, which form a part of the cupredoxin domain of the CopA copper resistance family of genes. The model for PcoR_29 revealed the presence of a helix turn helix; this forms part of a DNA binding protein, which is part of a heavy metal transcriptional regulator. The bacterial strains were cured using ethidium bromide. The genes encoding for heavy metal resistance and antibiotic resistance were found to be located on the chromosome for both Pseudomonas sp. (KR23) and E. coli (KR29). For Lysinibacillus (KR25) the heavy metal resistance determinants are suspected to be located on a mobile genetic element, which was not detected using gel electrophoresis.

  20. Marketingová strategie chráněných dílen nestátních neziskových organizací v Jihočeském kraji

    OpenAIRE

    DUŠKOVÁ, Miluše

    2013-01-01

    The theme of the completed diploma thesis is A Marketing Strategy for Protected Work Places of NGOs in South Bohemia. In the theoretical part I focus on the definition and meaning of marketing, stategic management, the marketing process, the marketing environment, the buying behavior of consumers, marketing research. In the next section I describe the legislative basis for protected work places and I name protected work places of NGOs in South Bohemia. Then I describe the employment of people...

  1. Předběžná zpráva o výzkumu mezolitického sídliště v Chržíně, okr. Kladno

    Czech Academy of Sciences Publication Activity Database

    Sýkorová, Ivana; Fridrich, Jan

    2005-01-01

    Roč. 9, č. 1 (2005), s. 67-75 ISSN 1214-3553 R&D Projects: GA ČR(CZ) GA404/03/0157 Institutional research plan: CEZ:AV0Z80020508 Keywords : Mesolithic * settlement * beuronian Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Existe-t-il un ancrage spatial des minorités chrétiennes en Asie centrale ?Le poids du passé russo-soviétique

    Directory of Open Access Journals (Sweden)

    Sébastien Peyrouse

    2012-01-01

    Full Text Available Les cinq républiques musulmanes d’Asie centrale, nées de l’implosion de l’URSS en 1991, constituent des exemples intéressants pour la problématique étudiée ici : elles invitent à reposer la question des minorités religieuses en terre d’islam en ne répondant pas au schéma classique et attendu sur la question. Elles prouvent qu’il existe des pays musulmans sans législation particulière envers les minorités religieuses, où la division entre communautés se fait plus selon des critères nationaux que strictement religieux, et où le marquage de l’espace garde avant tout le souvenir des brutales transformations urbaines exigées par un pouvoir soviétique qui niait toute expression de la foi. On ne peut en effet saisir le cas centrasiatique sans revenir sur le poids du legs russo-soviétique, aussi bien en matière de religion que d’urbanisme : les populations des cinq républiques vivent aujourd’hui dans un environnement urbain essentiellement européanisé, très marqué par la présence des non musulmans et où l’espace n’est que très peu un facteur de différenciation communautaire.

  3. Vliv hlubokého stabilizačního systému páteře na chrápání a syndrom spánkové apnoe

    OpenAIRE

    KOKOŠKOVÁ, Lucie

    2015-01-01

    The Bachelor's thesis questions matter of possibility to decrease apnoic pause or reduce snoring exposures via activation of Deep Stabilization System of the Spine. Findings about sleep, it's particular periods and processes in it, are written in theoretical section. The next topics outlined are snoring issues and sleep apnoe syndrome including available medical options and diagnostical methods. Deep stabilization system, his important structures and ways how to influence it are furthermore d...

  4. Chráněná území ve světle své krajinné historie. Blanský les a tajemství Vyšenských kopců

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2002-01-01

    Roč. 57, č. 6 (2002), s. 179-183 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : Protected Areas * Blanský les Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/data/003/000452.pdf

  5. À propos du lexique juridique en ancien français avant le 13e siècle : la Règle de saint Benoît et le Perceval de Chrétien de Troyes

    Directory of Open Access Journals (Sweden)

    Schauwecker Yela

    2012-07-01

    Full Text Available La plus ancienne traduction de la {em Règle} de saint Benoît en franc{c}ais, rédigée en dialecte picard-wallon, date de la première moitié ou du milieu du {sc xii}$^{m e}$~siècle. On veut montrer que son auteur, pour qui le changement de langue, n'est pas le premier objectif s'efforce de transférer le texte de son milieu originel de l'Antiquité tardive dans le monde chevaleresque-féodal du {sc xii}$^{m e}$~siècle. Même sans nécessité apparente, quand il a eu à sa disposition l'équivalent du mot employé dans la {em Regula}, il substitue aux mots latins des termes juridiques et féodaux franc{c}ais. par Son texte, en tant que document de droit pour les moines, devient ainsi une source de vocabulaire juridique franc{c}ais avant le {sc xiii}$^{m e}$~siècle, c'est-à-dire dans un temps où les documents juridiques en langue vulgaire sont extrêmement rares. Cela est dû au fait que la justice, dans le Nord, fondée sur des coutumes, utilisait la langue vernaculaire à l'oral. La terminologie juridique franc{c}aise est bien enracinée dans la langue courante de l'époque~: leur insertion dans les Lais et les Chansons de geste en fait preuve. Mais cette terminologie est souvent méconnue par la lexicographie traditionnelle de l'ancien franc{c}ais, en raison des contextes littéraires et figurés. par

  6. Antijudaïsme, pouvoir politique et administration de la justice. Juifs, chrétiens et convertis dans l’espace juridictionnel de la Chancillería de Valladolid (xve-xvie siècles

    Directory of Open Access Journals (Sweden)

    Elisa Caselli

    2011-05-01

    Full Text Available Composition du juryMonsieur. Bernard Vincent, Directeur de thèses (ÉHESS,Monsieur. Bartolomé Bennassar (Université de Toulouse le Mirail,Monsieur. Ricardo Garcia Carcel (Université Autonome de Barcelone,Madame. Claude Gauvard (Université de Paris I,Madame. Béatrice Perez (Université de Rennes II,Monsieur. Jean-Paul Zuñiga, (ÉHESSMention très honorable avec félicitation du juryThèse soutenue le 28 juin 2010RésuméÀ travers des procès judiciaires impliquant des juifs, plaidant entre eux ou...

  7. Antické chrámové průčelí v novoklasicistní architektuře českých zemí

    OpenAIRE

    Zyková, Michaela

    2009-01-01

    Focused on Neoclassical architecture, this work is discusing the continuing of classical tradition. Join the ancient art is inquired into the number and form of the temple front in this artstyle in architecture. The temple front may be the personification of the ancient greek and roman art, mainly architecture. For this porpouse it contains a catalogue of buildings with such element. Czech lands, in the time if neoclassicism, were part of Habsburg monarchy, so the problem is solved also in la...

  8. Make academic job advertisements fair to all

    DEFF Research Database (Denmark)

    Nielsen, Mathias Wullum

    2015-01-01

    Too many university posts are given to men without proper competition, says Mathias Wullum Nielsen......Too many university posts are given to men without proper competition, says Mathias Wullum Nielsen...

  9. Metaphilosophy, Pragmatism and a Kind of Critical Theory: Kai ...

    African Journals Online (AJOL)

    For Rorty it is historical narrative and utopian proposals; for Nielsen it is critical theory. Rorty claims this, Nielsen's intentions to the contrary notwithstanding, commits him to enlightenment rationalism. Nielsen replies that his form of critical theory is deeply historicist and contextual without being resolutely atheoretical.

  10. I grandi della fisica da Platone a Heisenberg

    CERN Document Server

    Von Weizsäcker, Carl Friedrich

    2002-01-01

    Parmenide ; Platone ; Aristotele ; Copernico, Keplero, Galilei ; Galileo Galilei ; Cartesio ; Gottfried Wilhelm Leibniz ; Cartesio, Newton, Leibniz, Kant ; Immanuel Kant ; Johann Wolfgang Goethe ; Robert Meyer ; Albert Einstein ; Niels Bohr ; Paul Adrien Maurice Dirac ; Niels Bohr e Werner Heisenberg, un ricordo del 1932 ; Werner Heisenberg ; Heisenberg, fisico e filosofo ; l'interpretazione filosofica della fisica moderna.

  11. Resonance journal of science education

    Indian Academy of Sciences (India)

    IAS Admin

    Sketch made by Niels Bohr in 1944 to illustrate the content of his debate with Einstein on the uncertainty principle at the 6th Solvay Conference in 1930. Niels Bohr (1885–1962). Sketch by Homi Bhabha. (Courtesy: TIFR, Bombay). Front Cover. 871. Science Smiles. Ayan Guha. 876. Back Cover. 948. Classics. Biology and ...

  12. Bohr and Dirac*

    Indian Academy of Sciences (India)

    IAS Admin

    We present an account of the work of Niels Bohr and Paul Dirac, their interactions and personal- ities. 1. Introduction. In this essay I would like to convey to my readers some- thing about the personalities and work of Niels Bohr and Paul Dirac, juxtaposed against one another. Let me hope that the portraits I will paint of these ...

  13. Cohort Profile Update

    DEFF Research Database (Denmark)

    Omland, Lars Haukali; Ahlström, Magnus Glindvad; Obel, Niels

    2014-01-01

    of Causes of Death, the Danish National Prescription Registry, the Attainment Register and the Integrated Database for Labour Market Research to get information on vital status, migration, cancer, hospital contacts, causes of death, dispensed prescriptions, education and employment. Using this design, rates...... the Danish Data Protection Agency. Potential collaborators can contact the study director, Niels Obel (e-mail: niels.obel@regionh.dk)....

  14. AcEST: DK956057 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FIHLYISNCISTCEQIKDKYMQN 228 >tr|B0BNA9|B0BNA9_RAT Similar to DNA segment, Chr 1, Brigham & Women...s Genetics 0212 expressed (Similar to DNA segment, Chr 1, Brigham & Womens Genetics 0212 expr

  15. 12041_2017_864_MOESM1_ESM.docx

    Indian Academy of Sciences (India)

    sony

    6, rs4970834, T/C, chr1:109814880, CELSR2, intronic, TC↓. 7, rs599839, G/A ... 10, rs10127775, T/A, chr1:230295789, GALNT2, intronic, HDL↓. 11, rs780092, G/ ... 18, rs3812316, G/C, chr7:73020337, MLXIPL, coding, TG↑. 19, rs327, G/T ...

  16. Jevropeiskii standart / Aleksei Zhigulin

    Index Scriptorium Estoniae

    Zhigulin, Aleksei

    2005-01-01

    Rahvusvahelise konsultatsioonifirma Carl Bro Intelligent Solution peaspetsialist Paul Nielsen külastas firma Christiansen Consulting Tallinna kontorit, et tutvuda Baltimaade konsultatsiooniteenuste turu eripäraga

  17. Potentially important periods of change in the development of social and role functioning in youth at clinical high risk for psychosis.

    Science.gov (United States)

    Velthorst, Eva; Zinberg, Jamie; Addington, Jean; Cadenhead, Kristin S; Cannon, Tyrone D; Carrión, Ricardo E; Auther, Andrea; Cornblatt, Barbara A; McGlashan, Thomas H; Mathalon, Daniel H; Perkins, Diana O; Seidman, Larry J; Tsuang, Ming T; Walker, Elaine F; Woods, Scott W; Reichenberg, Abraham; Bearden, Carrie E

    2018-02-01

    The developmental course of daily functioning prior to first psychosis-onset remains poorly understood. This study explored age-related periods of change in social and role functioning. The longitudinal study included youth (aged 12-23, mean follow-up years = 1.19) at clinical high risk (CHR) for psychosis (converters [CHR-C], n = 83; nonconverters [CHR-NC], n = 275) and a healthy control group (n = 164). Mixed-model analyses were performed to determine age-related differences in social and role functioning. We limited our analyses to functioning before psychosis conversion; thus, data of CHR-C participants gathered after psychosis onset were excluded. In controls, social and role functioning improved over time. From at least age 12, functioning in CHR was poorer than in controls, and this lag persisted over time. Between ages 15 and 18, social functioning in CHR-C stagnated and diverged from that of CHR-NC, who continued to improve (p = .001). Subsequently, CHR-C lagged behind in improvement between ages 21 and 23, further distinguishing them from CHR-NC (p role functioning, but to a lesser extent (p = .007). The results remained consistent when we accounted for the time to conversion. Our findings suggest that CHR-C start lagging behind CHR-NC in social and role functioning in adolescence, followed by a period of further stagnation in adulthood.

  18. Dicty_cDB: Contig-U16181-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

  19. Linkage group-chromosome correlations in Sordaria macrospora: Chromosome identification by three dimensional reconstruction of their synaptonemal complex.

    Science.gov (United States)

    Zickler, D; Leblon, G; Haedens, V; Collard, A; Thuriaux, P

    1984-01-01

    Reconstruction of serially sectioned zygotene and pachytene nuclei has allowed, by measuring the lengths of synaptonemal complexes, an assignment of the 7 linkage (LG) groups to the 7 chromosomes in the fungus Sordaria macrospora. The 7 LG have been established using 19 mutants showing low second division segregation frequencies. Eight chromosomal rearrangements mapped on the 7 LG were used to identify the chromosomes involved. The following one to one assignment of the 7 LG to specific chromosomes was obtained: LG a: chromosome (chr) 1, LG b: chr5, LG c: chr6, LG d: chr7, LG e: chr4, LG f: chr3 and LG g: chr2 (the chromosome carrying the nucleolus organizer region).

  20. Die Nachahmung einer rotfigurigen Trinkschale aus der frühlatènezeitlichen Flachlandsiedlung von Chržín (Mittelböhmen) und das überregionale Verkehrsnetz der Hallstatt- und Frühlatènezeit in Böhmen

    Czech Academy of Sciences Publication Activity Database

    Chytráček, Miloslav

    2008-01-01

    Roč. 86, č. 2 (2008), s. 47-101 ISSN 0016-8874 R&D Projects: GA AV ČR IAA8002204 Institutional research plan: CEZ:AV0Z80020508 Keywords : Early La Tène period * red -figure decoration * import Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Napodobenina červenofigurové keramiky z časně laténského sídliště v Chržíně s doklady kovolitectví a zpracování jantaru

    Czech Academy of Sciences Publication Activity Database

    Chytráček, Miloslav

    2007-01-01

    Roč. 59, č. 3 (2007), s. 461-516 ISSN 0323-1267 R&D Projects: GA AV ČR IAA8002204 Institutional research plan: CEZ:AV0Z80020508 Keywords : Bohemia * early La Tène period * imitations * red -figure decoration * metallurgy * amber * long-distance roads * imports * Attic ceramic Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Myšlení a netechnický přístup k věcem, jejich chránění a ohleduplné (básnické) zacházení s nimi

    Czech Academy of Sciences Publication Activity Database

    Olšovský, Jiří

    2013-01-01

    Roč. 8, č. 3 (2013), s. 1-13 ISSN 1802-3061 Institutional support: RVO:67985955 Keywords : enframement * technology * vigilance of thinking Subject RIV: AA - Philosophy ; Religion http://envigogika.cuni.cz/index.php/Envigogika/issue/view/22

  3. Květena a vegetace Chráněné krajinné oblasti a Biosférické rezervace Křivoklátsko - současný stav poznání botanického výzkumu

    Czech Academy of Sciences Publication Activity Database

    Kolbek, Jiří

    2011-01-01

    Roč. 2011, č. 31 (2011), s. 147-182 ISSN 0231-5807 Institutional research plan: CEZ:AV0Z60050516 Keywords : vegetation maps * actual vegetation * potentional natural vegetation Subject RIV: EF - Botanics

  4. Reaktivita N-chráněných 3-amino-1,2-epoxy-4-fenylbutanů, klíčových synthonů pro přípravu hyroxyethylaminových isosterů peptidové vazby

    Czech Academy of Sciences Publication Activity Database

    Hradilek, Martin

    2002-01-01

    Roč. 96, č. 4 (2002), s. 218 ISSN 0009-2770. [ Sigma -Aldrich konference mladých chemiků, biochemiků a molekulárních biologů. 22.05.2002-25.05.2002, Velké Meziříčí] R&D Projects: GA ČR GP203/02/P095 Institutional research plan: CEZ:AV0Z4055905 Key words : hyroxyethylamine isosters Subject RIV: CE - Biochemistry

  5. Možnosti uplatnění konceptu biosférické rezervace ve vybraných velkoplošných chráněných územích České republiky

    Czech Academy of Sciences Publication Activity Database

    Těšitel, Jan; Kušová, Drahomíra; Bartoš, Michael

    2006-01-01

    Roč. 40, č. 5 (2006), s. 262-266 ISSN 0044-4863 Institutional research plan: CEZ:AV0Z60870520 Keywords : biosphere reserve * large scale protected areas * sustainable development Subject RIV: EH - Ecology, Behaviour

  6. Orthogonálně chráněný nitrotyrosin jako vhodný stavební blok pro in vitro syntézu proteinů vznikajících oxidativním stresem

    Czech Academy of Sciences Publication Activity Database

    Brichtová, Eva; Niederhafner, Petr; Šafařík, Martin; Šebestík, Jaroslav

    2016-01-01

    Roč. 14, č. 2 (2016), s. 56 ISSN 2336-7202. [Mezioborové setkání mladých biologů, biochemiků a chemiků /16./. 10.05.2016-13.05.2016, Milovy] R&D Projects: GA ČR(CZ) GA14-00431S Institutional support: RVO:61388963 Keywords : nitrotyrosine * peptide synthesis * reaction rate Subject RIV: CC - Organic Chemistry

  7. Haine religieuse: l’action “pank – Te Deum” du groupe “Pussy Riot” 21 Février 2012 dans les locaux de la Cathédrale du Christ-Sauveur de l’Église Chrétienne Orthodoxe Russe

    Directory of Open Access Journals (Sweden)

    Igor V. Ponkine

    2013-02-01

    SOMMAIRE: 1. Introduction – 2. Analyse des actions des participants au groupe “Pussy Riot” accomplies par ceux-ci pendant le temps de la réalisation de l’action – 3. Analyse du texte de la chansonnette interprétée par les participants au groupe “Pussy Riot” au cours de l’action – 4. Les actions des participants au groupe “Pussy Riot” réalisées par ceux-ci le 21 Février 2012 dans la Cathédrale du Christ-Sauveur peuvent être appréciées, à juste titre, comme réalisées en commun selon l’intention unifiée de l’action – 5. Tribunal Khamovniky de la ville de Moscou et Cour de cassation de la ville de Moscou.

  8. Loss of Chromosome 18 in Neuroendocrine Tumors of the Small Intestine: The Enigma Remains.

    Science.gov (United States)

    Nieser, Maike; Henopp, Tobias; Brix, Joachim; Stoß, Laura; Sitek, Barbara; Naboulsi, Wael; Anlauf, Martin; Schlitter, Anna M; Klöppel, Günter; Gress, Thomas; Moll, Roland; Bartsch, Detlef K; Heverhagen, Anna E; Knoefel, Wolfram T; Kaemmerer, Daniel; Haybaeck, Johannes; Fend, Falko; Sperveslage, Jan; Sipos, Bence

    2017-01-01

    Neuroendocrine tumors of the small intestine (SI-NETs) exhibit an increasing incidence and high mortality rate. Until now, no fundamental molecular event has been linked to the tumorigenesis and progression of these tumors. Only the loss of chromosome 18 (Chr18) has been shown in up to two thirds of SI-NETs, whereby the significance of this alteration is still not understood. We therefore performed the first comprehensive study to identify Chr18-related events at the genetic, epigenetic and gene/protein expression levels. We did expression analysis of all seven putative Chr18-related tumor suppressors by quantitative real-time PCR (qRT-PCR), Western blot and immunohistochemistry. Next-generation exome sequencing and SNP array analysis were performed with five SI-NETs with (partial) loss of Chr18. Finally, we analyzed all microRNAs (miRNAs) located on Chr18 by qRT-PCR, comparing Chr18+/- and Chr18+/+ SI-NETs. Only DCC (deleted in colorectal cancer) revealed loss of/greatly reduced expression in 6/21 cases (29%). No relevant loss of SMAD2, SMAD4, elongin A3 and CABLES was detected. PMAIP1 and maspin were absent at the protein level. Next-generation sequencing did not reveal relevant recurrent somatic mutations on Chr18 either in an exploratory cohort of five SI-NETs, or in a validation cohort (n = 30). SNP array analysis showed no additional losses. The quantitative analysis of all 27 Chr18-related miRNAs revealed no difference in expression between Chr18+/- and Chr18+/+ SI-NETs. DCC seems to be the only Chr18-related tumor suppressor affected by the monoallelic loss of Chr18 resulting in a loss of DCC protein expression in one third of SI-NETs. No additional genetic or epigenetic alterations were present on Chr18. © 2016 S. Karger AG, Basel.

  9. Post Traumatic Stress Disorder and psychological functioning in children of parents with acquired brain injury

    DEFF Research Database (Denmark)

    Kieffer, Rikke; Teasdale, Thomas William; Blinkenberg, Niels

    2011-01-01

    RIKKE KIEFFER-KRISTENSEN1, THOMAS W. TEASDALE1, & NIELS BILENBERG2 1Department of Psychology, University of Copenhagen, Copenhagen, Denmark and 2Department of Child and Department of Adolescence Psychiatry, University of Southern Denmark, Odense, Denmark (Received...

  10. Miscasting, TV adaptation inhibit 'Copenhagen' drama

    CERN Multimedia

    Winn, S

    2002-01-01

    Review of a television adaptation of the play 'Copenhagen', produced by Howard Davies for PBS, USA . The play speculates on the real reason that Werner Heisenberg came to see Niels Bohr in Copenhagen in 1941 (1 page).

  11. What hope is there for South Africa? A public theological reflection ...

    African Journals Online (AJOL)

    2015-04-29

    Apr 29, 2015 ... As the Danish physicist, Niels Bohr, rightly said: 'Prediction is very difficult, especially if it ..... sanitation, electricity and refuse removal have also increased in ..... Real final consumption expenditure (FCE) per capita labour force ...

  12. to view fulltext PDF

    Indian Academy of Sciences (India)

    , USA bass@phy.duke.edu. Basu Madhumita, Physics Department, Bangabasi College, Kolkata 700 009. Bearden Ian, Niels Bohr Institute, Blegdamsvej 17, 2100 Kobenhavn, Denmark bearden@nbi.dk. Bhalerao Rajeev, Tata Institute of ...

  13. Book review

    CERN Multimedia

    1967-01-01

    Niels Bohr. His life and work as seen by his friends and colleagues, edited by S. Rozentai. Translated from the Danish edition published in 1964. (Amsterdam, North- Holland Publishing Company, 1967, 58 s.)

  14. Edukus jättis eurost ilma / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2006-01-01

    Euroopa Komisjon lükkas Eesti ja Leedu taotlused eurotsooniga liitumiseks tagasi. Küsimustele vastab Taani majandusprofessor Niels Thygesen. Diagramm: EL-i riikide majanduskasv. Vt. samas: Eurotsooni praeguste liikmete jaoks on reegleid ümber kirjutatud

  15. Back to the Future

    CERN Multimedia

    Collins, Graham

    2004-01-01

    "Predictions are hard to make, especially about the future" said Nobel physicist Niels Bohr, many years ago. But two months ago, 150 leading physicists gathered at the University of California to engage in just that daunting task (1 page)

  16. Inauguration of Proton Synchrotron

    CERN Multimedia

    1960-01-01

    On 5 February 1960, the Proton Synchrotron (PS) was formally inaugurated. The great Danish physicist, Niels Bohr, releases a bottle of champagne against a shielding block to launch the PS on its voyage in physics.

  17. Neurophysiological differences between patients clinically at high risk for schizophrenia and neurotypical controls--first steps in development of a biomarker.

    Science.gov (United States)

    Duffy, Frank H; D'Angelo, Eugene; Rotenberg, Alexander; Gonzalez-Heydrich, Joseph

    2015-11-02

    Schizophrenia is a severe, disabling and prevalent mental disorder without cure and with a variable, incomplete pharmacotherapeutic response. Prior to onset in adolescence or young adulthood a prodromal period of abnormal symptoms lasting weeks to years has been identified and operationalized as clinically high risk (CHR) for schizophrenia. However, only a minority of subjects prospectively identified with CHR convert to schizophrenia, thereby limiting enthusiasm for early intervention(s). This study utilized objective resting electroencephalogram (EEG) quantification to determine whether CHR constitutes a cohesive entity and an evoked potential to assess CHR cortical auditory processing. This study constitutes an EEG-based quantitative neurophysiological comparison between two unmedicated subject groups: 35 neurotypical controls (CON) and 22 CHR patients. After artifact management, principal component analysis (PCA) identified EEG spectral and spectral coherence factors described by associated loading patterns. Discriminant function analysis (DFA) determined factors' discrimination success between subjects in the CON and CHR groups. Loading patterns on DFA-selected factors described CHR-specific spectral and coherence differences when compared to controls. The frequency modulated auditory evoked response (FMAER) explored functional CON-CHR differences within the superior temporal gyri. Variable reduction by PCA identified 40 coherence-based factors explaining 77.8% of the total variance and 40 spectral factors explaining 95.9% of the variance. DFA demonstrated significant CON-CHR group difference (P <0.00001) and successful jackknifed subject classification (CON, 85.7%; CHR, 86.4% correct). The population distribution plotted along the canonical discriminant variable was clearly bimodal. Coherence factors delineated loading patterns of altered connectivity primarily involving the bilateral posterior temporal electrodes. However, FMAER analysis showed no CON-CHR

  18. Computational Fluid Dynamics in Ventilation Design

    DEFF Research Database (Denmark)

    Nielsen, Peter V.

    2008-01-01

    This paper is based on the new REHVA Guidebook Computational Fluid  Dynamics in Ventilation Design (Nielsen et al. 2007) written by Peter V. Nielsen, Francis(Nielsen 2007) written by Peter V. Nielsen, Francis Allard, Hazim B. Awbi, Lars Davidson and Alois Schälin. The guidebook is made for people....... The guidebook introduces rules for good quality prediction work, and it is the purpose of the guidebook to improve the technical level of CFD work in ventilation.......This paper is based on the new REHVA Guidebook Computational Fluid  Dynamics in Ventilation Design (Nielsen et al. 2007) written by Peter V. Nielsen, Francis(Nielsen 2007) written by Peter V. Nielsen, Francis Allard, Hazim B. Awbi, Lars Davidson and Alois Schälin. The guidebook is made for people...... who need to use and discuss results based on CFD predictions, and it gives insight into the subject for those who are not used to work with CFD. The guidebook is also written for people working with CFD who have to be more aware of how this numerical method is applied in the area of ventilation...

  19. Hjemkomst til Homer

    DEFF Research Database (Denmark)

    Skyum-Nielsen, Erik

    2015-01-01

    Erik Skyum-Nielsen beskriver i sin artikel hvordan tre moderne danske forfattere, Bjørnvig, Nordbrandt og Rifbjerg, har henvist til og genbrugt de homeriske digte eller motiver herfra i deres digtning. Med udgangspunkt i Gérard Genettes overbegreb transtekstualitet viser Skyum-Nielsen os først...

  20. Building capacity and capabilty at the front line of care – North Zealand Hospital’s Leadership Program

    DEFF Research Database (Denmark)

    von Plessen, Christian; Ulriksen, Inge; Nielsen, Lisbeth

    24.Ulriksen I, Nielsen L, Plessen von C, . International Forum on Quality and Safety in Health Care, London April 2015......24.Ulriksen I, Nielsen L, Plessen von C, . International Forum on Quality and Safety in Health Care, London April 2015...

  1. Professor om kystsikring: Ingen universelle løsninger

    DEFF Research Database (Denmark)

    Arnbjerg-Nielsen, Karsten

    2017-01-01

    DEBAT: Der findes ikke universalløsninger mod stigende risiko for stormfloder, men løsninger skal findes, skriver Karsten Arnbjerg-Nielsen, professor ved DTU.......DEBAT: Der findes ikke universalløsninger mod stigende risiko for stormfloder, men løsninger skal findes, skriver Karsten Arnbjerg-Nielsen, professor ved DTU....

  2. At være eller ikke at være

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2010-01-01

    ERLEND LOE OG PETTER AMUNDSEN: EKSPEDITION SHAKESPEARE (Oversat fra norsk af Michael Lambæk Nielsen) 420 sider, 299 kr.Gyldendal Er udkommet To stjerner......ERLEND LOE OG PETTER AMUNDSEN: EKSPEDITION SHAKESPEARE (Oversat fra norsk af Michael Lambæk Nielsen) 420 sider, 299 kr.Gyldendal Er udkommet To stjerner...

  3. Bedste bog om Balkans beskidte krig

    DEFF Research Database (Denmark)

    Lund, Joachim

    2018-01-01

    Anmeldelse af: "Vi troede ikke, det kunne ske her. Jugoslaviens sammenbrud 1991-1999" af Christian Axboe Nielsen. Kristeligt Dagblads Forlag, 2018. 410 sider......Anmeldelse af: "Vi troede ikke, det kunne ske her. Jugoslaviens sammenbrud 1991-1999" af Christian Axboe Nielsen. Kristeligt Dagblads Forlag, 2018. 410 sider...

  4. A Trail of Roses

    DEFF Research Database (Denmark)

    Ørum, Tania

    2015-01-01

    Heissenbüttel and Max Bense. The Danish poet and critic Hans-Jørgen Nielsen Nielsen used Gertrude Stein as a prominent example in his campaign to widen the conception of literary texts in the conservative Danish context. In one of his essays he used Stein’s sentence: a rose is a rose is a rose is a rose...

  5. Aid reporting

    DEFF Research Database (Denmark)

    Keijzer, Niels; Fejerskov, Adam Moe

    2016-01-01

    It is disappointing that some member states have chosen to redirect toward domestic expenditure funds that would have otherwise gone to facilitate inclusive and sustainable international development, write Niels Keijzer and Adam Moe Fejerskov.......It is disappointing that some member states have chosen to redirect toward domestic expenditure funds that would have otherwise gone to facilitate inclusive and sustainable international development, write Niels Keijzer and Adam Moe Fejerskov....

  6. Recent developments in quantum field theory

    International Nuclear Information System (INIS)

    Ambjoern, J.; Petersen, J.L.; Durhuus, B.J.

    1985-01-01

    This is the second volume in a set of three containing the proceedings of 3 conferences held in Copenhagen, to mark the centennial of Niels Bohr. The purpose of this symposium was to bring together theoretical particle physicists to discuss the present status and, in particular, the latest developments in quantum field theory, in their broadest aspects. This volume contains the main 19 lectures and reflects the contemporary status of a line of development, one of whose initiators was Niels Bohr. (orig.)

  7. Clinical high risk for psychosis

    DEFF Research Database (Denmark)

    van der Steen, Y; Gimpel-Drees, J; Lataster, T

    2017-01-01

    OBJECTIVE: The aim of this study was to assess associations between momentary stress and both affective and psychotic symptoms in everyday life of individuals at clinical high risk (CHR), compared to chronic psychotic patients and healthy controls, in search for evidence of early stress...... and 26 healthy controls. RESULTS: Multilevel models showed significantly larger associations between negative affect (NA) and activity-related stress for CHR patients than for psychotic patients (P = 0.008) and for CHR compared to controls (P

  8. Constraint-based Word Segmentation for Chinese

    DEFF Research Database (Denmark)

    Christiansen, Henning; Bo, Li

    2014-01-01

    -hoc and statistically based methods. In this paper, we show experiments of implementing different approaches to CWSP in the framework of CHR Grammars [Christiansen, 2005] that provides a constraint solving approach to language analysis. CHR Grammars are based upon Constraint Handling Rules, CHR [Frühwirth, 1998, 2009......], which is a declarative, high-level programming language for specification and implementation of constraint solvers....

  9. Function of C-terminal hydrophobic region in fructose dehydrogenase

    International Nuclear Information System (INIS)

    Sugimoto, Yu; Kawai, Shota; Kitazumi, Yuki; Shirai, Osamu; Kano, Kenji

    2015-01-01

    Fructose dehydrogenase (FDH) catalyzes oxidation of D-fructose into 2-keto-D-fructose and is one of the enzymes allowing a direct electron transfer (DET)-type bioelectrocatalysis. FDH is a heterotrimeric membrane-bound enzyme (subunit I, II, and III) and subunit II has a C terminal hydrophobic region (CHR), which was expected to play a role in anchoring to membranes from the amino acid sequence. We have constructed a mutated FDH lacking of CHRchrFDH). Contrary to the expected function of CHR, ΔchrFDH is expressed in the membrane fraction, and subunit I/III subcomplex (ΔcFDH) is also expressed in a similar activity level but in the soluble fraction. In addition, the enzyme activity of the purified ΔchrFDH is about one twentieth of the native FDH. These results indicate that CHR is concerned with the binding between subunit I(/III) and subunit II and then with the enzyme activity. ΔchrFDH has clear DET activity that is larger than that expected from the solution activity, and the characteristics of the catalytic wave of ΔchrFDH are very similar to those of FDH. The deletion of CHR seems to increase the amounts of the enzyme with the proper orientation for the DET reaction at electrode surfaces. Gel filtration chromatography coupled with urea treatment shows that the binding in ΔchrFDH is stronger than that in FDH. It can be considered that the rigid binding between subunit I(/III) and II without CHR results in a conformation different from the native one, which leads to the decrease in the enzyme activity in solution

  10. Preliminary psychometric properties of the brief Negative Symptom Scale in youth at Clinical High-Risk for psychosis.

    Science.gov (United States)

    Strauss, Gregory P; Chapman, Hannah C

    2018-03-01

    Preliminary psychometric properties of an adapted version of the Brief Negative Symptom Scale (BNSS) are reported in youth at Clinical High-Risk for psychosis (CHR). Participants included 29 CHR youth who met criteria for a prodromal syndrome on the Structured Interview for Prodromal Syndromes (SIPS). The adapted BNSS demonstrated excellent internal consistency, convergent validity, and discriminant validity, suggesting that the BNSS has utility for assessing negative symptoms in a CHR population. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Cross-talk between cognate and noncognate RpoE sigma factors and Zn(2+)-binding anti-sigma factors regulates photooxidative stress response in Azospirillum brasilense.

    Science.gov (United States)

    Gupta, Namrata; Gupta, Ankush; Kumar, Santosh; Mishra, Rajeev; Singh, Chhaya; Tripathi, Anil Kumar

    2014-01-01

    Azospirillum brasilense harbors two redox-sensitive Zinc-binding anti-sigma (ZAS) factors (ChrR1 and ChrR2), which negatively regulate the activity of their cognate extra-cytoplasmic function (ECF) σ factors (RpoE1 and RpoE2) by occluding their binding to the core enzyme. Both pairs of RpoE-ChrR control responses to photooxidative stress. The aim of this study was to investigate whether the two RpoE-ChrR pairs cross-talk while responding to the stress. In silico analysis showed a high sequence similarity between ChrR1 and ChrR2 proteins, but differences in redox sensitivity. Using in silico and in vitro methods of protein-protein interaction, we have shown that both ChrR1 and ChrR2 proteins physically bind to their noncognate RpoE proteins. Restoration of the phenotypes of chrR1::Tn5 and chrR2::Km mutants related to carotenoid biosynthesis and photooxidative stress tolerance by expressing chrR1 or chrR2 provided in vivo evidence for the cross-talk. In addition, up- or down-regulation of several identical proteins by expressing chrR1 or chrR2 in the chrR1::Tn5 mutant provided another in vivo evidence for the cross-talk. Although multiple redox-sensitive ZAS anti-σ factors occur in some Gram-positive bacteria, no cross-talk is reported among them. We report here, for the first time, that the two ZAS anti-σ factors of A. brasilense also interact with their noncognate σ factors and affect gene expression. The two redox-sensitive ZAS anti-σ factors in A. brasilense may interact with their cognate as well as noncognate ECF σ factors to play an important role in redox homeostasis by facilitating recovery from the oxidative stress.

  12. Discontinuous groups of isometries in the hyperbolic plane

    CERN Document Server

    Nielsen, Jakob; Schmidt, Asmus L

    2002-01-01

    Fuchsian groups play a central role in various important fields of mathematics. The current book is based on what became known as the famous Fenchel-Nielsen manuscript. Jakob Nielsen (1890-1959) started this project well before World War II, Werner Fenchel (1905-1988) joined later and overtook the much of the preparation of the manuscript. Professor Asmus Schmidt (University of Copenhagen) is the editor of this first publication in book form of the Fenchel-Nielsen notes. It is on his initiative that the long and difficult way of getting the original notes into the proper shape ready for public

  13. Zhodnocení ekonomických nástrojů v ochraně přírody se zaměřením na systém náhrady škod způsobených zvláště chráněnými živočichy (na příkladu CHKO Třeboňsko)

    OpenAIRE

    KLÍMOVÁ, Blanka

    2012-01-01

    The given Bachelor Thesis deals with the assessment regarding the system of awarding compensatory damages caused by specially protected animal species in the period between 2000 and 2011 within the territory of the Protected Landscape Area of Třeboňsko. Compensatory damages thus represent one of the most important economic instruments in the general scheme of the nature and landscape protection to which the protection of specially protected animal species is being provided. The procedure of a...

  14. Evaluating the relationship between cannabis use and IQ in youth and young adults at clinical high risk of psychosis.

    Science.gov (United States)

    Buchy, Lisa; Seidman, Larry J; Cadenhead, Kristin S; Cannon, Tyrone D; Cornblatt, Barbara A; McGlashan, Thomas H; Perkins, Diana O; Stone, William; Tsuang, Ming T; Walker, Elaine F; Woods, Scott W; Bearden, Carrie E; Mathalon, Daniel H; Addington, Jean

    2015-12-30

    Among people with psychosis, those with a history of cannabis use show better cognitive performance than those who are cannabis naïve. It is unknown whether this pattern is present in youth at clinical high risk (CHR) of psychosis. We evaluated relationships between IQ and cannabis use while controlling for use of other substances known to impact cognition in 678 CHR and 263 healthy control (HC) participants. IQ was estimated using the Vocabulary and Block Design subtests of the Wechsler Abbreviated Scale of Intelligence. Drug and alcohol use severity and frequency were assessed with the Alcohol and Drug Use Scale, and we inquired participants' age at first use. CHR were further separated into early and late age at onset of cannabis use sub-groups, and low-, moderate- and high-frequency sub-groups. No significant differences in IQ emerged between CHR or HC cannabis users vs. non-users, or between use frequency groups. CHR late-onset users showed significantly higher IQ than CHR early-onset users. Age at onset of cannabis use was significantly and positively correlated with IQ in CHR only. Results suggest that age at onset of cannabis may be a more important factor for IQ than use current use or use frequency in CHR. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  15. The Strauss and Carpenter Prognostic Scale in subjects clinically at high risk of psychosis

    NARCIS (Netherlands)

    Nieman, D. H.; Velthorst, E.; Becker, H. E.; de Haan, L.; Dingemans, P. M.; Linszen, D. H.; Birchwood, M.; Patterson, P.; Salokangas, R. K. R.; Heinimaa, M.; Heinz, A.; Juckel, G.; von Reventlow, H. G.; Morrison, A.; Schultze-Lutter, F.; Klosterkötter, J.; Ruhrmann, S.; McGorry, Patrick D.; McGlashan, Thomas H.; Knapp, Martin; van de Fliert, Reinaud; Klaassen, Rianne; Picker, Heinz; Neumann, Meike; Brockhaus-Dumke, Anke; Pukrop, Ralf; Svirskis, Tanja; Huttunen, Jukka; Laine, Tiina; Ilonen, Tuula; Ristkari, Terja; Hietala, Jarmo; Skeate, Amanda; Gudlowski, Yehonala; Ozgürdal, Seza; French, Paul; Stevens, Helen

    2013-01-01

    To investigate the predictive value of the Strauss and Carpenter Prognostic Scale (SCPS) for transition to a first psychotic episode in subjects clinically at high risk (CHR) of psychosis. Two hundred and forty-four CHR subjects participating in the European Prediction of Psychosis Study were

  16. Reference Values of Reticulocyte Hemoglobin Content and Their Relation With Other Indicators of Iron Status in Healthy Children.

    Science.gov (United States)

    López-Ruzafa, Encarnación; Vázquez-López, Maria A; Lendinez-Molinos, Francisco; Poveda-González, Juan; Galera-Martínez, Rafael; Bonillo-Perales, Antonio; Martín-González, Manuel

    2016-10-01

    Reticulocyte hemoglobin content (CHr) is considered an indicator of functional iron deficiency, but is understudied in children. The goals of this study are to determine the reference intervals for CHr in healthy children, and their relation with iron parameters, erythropoiesis, and individual conditions. A total of 902 children without iron deficiency, aged 1 to 11 years were analyzed in a cross-sectional study. Besides a physical examination of the subjects and a questionnaire completed by their parents, the complete blood count, serum transferrin receptor, ferritin, transferrin saturation, erythrocyte protoporphyrin, serum erythropoietin, C-reactive protein, and CHr levels were measured. Changes in CHr, iron status, and erythropoiesis at different age intervals were analyzed and linear multiple regression was used to identify the factors that determine CHr variability. Mean value obtained for CHr was 30.9±1.8 pg (P2.5-P97.5: 26.9 to 34.3 pg), but the influence of age on CHr (the values increased with age) and on the iron parameters justified the establishment of different reference ranges. In addition to age, nutritional status, hematologic measurements, reticulocytes, transferrin saturation, and erythrocyte protoporphyrin accounted for 39% of CHr variability.

  17. GenBank blastx search result: AK059350 [KOME

    Lifescience Database Archive (English)

    Full Text Available r SLU7; DNA segment, Chr 11, ERATO Doi 730, expressed; DNA segment, Chr 3, Brigham & Womens Genetics 0878 expressed, mRNA (cDNA clone IMAGE:6890616), partial cds.|ROD ROD 1e-103 +3 ...

  18. Qualitative and quantitative expression status of the human chromosome 20 genes in cancer tissues and the representative cell lines.

    Science.gov (United States)

    Wang, Quanhui; Wen, Bo; Yan, Guangrong; Wei, Junying; Xie, Liqi; Xu, Shaohang; Jiang, Dahai; Wang, Tingyou; Lin, Liang; Zi, Jin; Zhang, Ju; Zhou, Ruo; Zhao, Haiyi; Ren, Zhe; Qu, Nengrong; Lou, Xiaomin; Sun, Haidan; Du, Chaoqin; Chen, Chuangbin; Zhang, Shenyan; Tan, Fengji; Xian, Youqi; Gao, Zhibo; He, Minghui; Chen, Longyun; Zhao, Xiaohang; Xu, Ping; Zhu, Yunping; Yin, Xingfeng; Shen, Huali; Zhang, Yang; Jiang, Jing; Zhang, Chengpu; Li, Liwei; Chang, Cheng; Ma, Jie; Yan, Guoquan; Yao, Jun; Lu, Haojie; Ying, Wantao; Zhong, Fan; He, Qing-Yu; Liu, Siqi

    2013-01-04

    Under the guidance of the Chromosome-centric Human Proteome Project (C-HPP), (1, 2) we conducted a systematic survey of the expression status of genes located at human chromosome 20 (Chr.20) in three cancer tissues, gastric, colon, and liver carcinoma, and their representative cell lines. We have globally profiled proteomes in these samples with combined technology of LC-MS/MS and acquired the corresponding mRNA information upon RNA-seq and RNAchip. In total, 323 unique proteins were identified, covering 60% of the coding genes (323/547) in Chr.20. With regards to qualitative information of proteomics, we overall evaluated the correlation of the identified Chr.20 proteins with target genes of transcription factors or of microRNA, conserved genes and cancer-related genes. As for quantitative information, the expression abundances of Chr.20 genes were found to be almost consistent in both tissues and cell lines of mRNA in all individual chromosome regions, whereas those of Chr.20 proteins in cells are different from tissues, especially in the region of 20q13.33. Furthermore, the abundances of Chr.20 proteins were hierarchically evaluated according to tissue- or cancer-related distribution. The analysis revealed several cancer-related proteins in Chr.20 are tissue- or cell-type dependent. With integration of all the acquired data, for the first time we established a solid database of the Chr.20 proteome.

  19. Refinement of genotype-phenotype correlation in 18 patients carrying a 1q24q25 deletion

    DEFF Research Database (Denmark)

    Chatron, Nicolas; Haddad, Véronique; Andrieux, Joris

    2015-01-01

    of different sizes (490 kb to 20.95 Mb) localized within chromosome bands 1q23.3-q31.2 (chr1:160797550-192912120, hg19). The 490 kb deletion is the smallest deletion reported to date associated with this phenotype. We delineated three regions that may contribute to the phenotype: a proximal one (chr1...

  20. Chardonnay grape seed flour ameliorates hepatic steatosis and insulin resistance via altered hepatic gene expression for oxidative stress, inflammation, and lipid and ceramide synthesis in diet-induced obese mice

    Science.gov (United States)

    Diet-induced obese (DIO) mice were fed high-fat (HF) diets containing either partially defatted flavonoid-rich Chardonnay grape seed flour (ChrSd) or microcrystalline cellulose (MCC, control) for 5 weeks in order to determine whether ChrSd improved insulin resistance and the pathogenesis of hepatic ...

  1. Domain Modeling: NP_001034750.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001034750.1 chr11 Solution NMR structure of human myeloid differentiation primary response (MyD88). North...east Structural Genomics target HR2869A p2js7a_ chr11/NP_001034750.1/NP_001034750.1_apo_70-218.pdb psi-blast 0 ...

  2. Domain Modeling: NP_064572.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available theast Structural Genomics Consortium Target BoR24. c2bdva_ chr3/NP_064572.2/NP_064572.2_apo_2-265.pdb psi-blast 0 ... ...NP_064572.2 chr3 X-Ray Crystal Structure of Phage-related Protein BB2244 from Bordetella bronchiseptica. Nor

  3. Domain Modeling: NP_001103132.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001103132.1 chr12 CRYSTAL STRUCTURE OF THE SECA PROTEIN TRANSLOCATION ATPASE FROM MYCOBACTERIUM TUBERCULO...SIS COMPLEX WITH ADPBS d1nkta_ chr12/NP_001103132.1/NP_001103132.1_holo_1997-2946.p

  4. Does the competition between sea and road transport become more severe? / Niels Harnack = Ужесточение конкуренции в доставке товаров между морскими и сухопутными путями / Нильс

    Index Scriptorium Estoniae

    Harnack, Niels

    2003-01-01

    Ettekanne 3.-4. detsembrini 2003 Tallinnas toimunud rahvusvahelisel konverents-näitusel "Logistics and transport in international trade" prognoosib riikidevaheliste kaubaveomahtude kasvu mõju Läänemere sadamate tegevusele ja konkurentsivõimele

  5. 75 FR 65323 - The Tennis Channel, Inc. v. Comcast Cable Communications, LLC; File No. CSR-8258-P

    Science.gov (United States)

    2010-10-22

    ... (formerly, Nielsen Media Research). There are 210 DMAs in the United States. In addition to its role as a... Starter tier. 9. In 2005, The Tennis Channel executed an affiliation agreement with Comcast that provided...

  6. Notes on the fishes collected by the R.V. “TRIDENS” on the North West African shelf, 19-25 January 1969

    NARCIS (Netherlands)

    Groot, de S.J.; Nijssen, H.

    1971-01-01

    On the North West African shelf 98 species of fishes were collected of which a classification is given. Three species have hitherto been recorded only farther South. The status of Platophrys podas africanus (Nielsen, 1961) is discussed.

  7. Multifidelity Robust Aeroelastic Design, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Nielsen Engineering & Research (NEAR) proposes a new method to generate mathematical models of wind-tunnel models and flight vehicles for robust aeroelastic...

  8. New Releases

    Index Scriptorium Estoniae

    2005-01-01

    Heliplaatidel Grieg "Peer Gynt" dirigeerib Paavo Järvi; Medtner "Pf Concs Nos 1-3. Sonate-Ballade", Rachmaninov "Bells", Various Cpsrs "Estonian Orch Wks" ja Nielsen "Syms Nos 1-6" dirigeerib Neeme Järvi

  9. Effects of different irrigation regimes and nitrogen levels on yield and ...

    African Journals Online (AJOL)

    Jane

    2011-08-31

    Aug 31, 2011 ... levels on yield and quality of melon (Cucumis melo L.) M. Simsek1* and N. ... fertilization have significant adverse effects on water resources ... usage of water to meet the needs of plants (Stewart and. Nielsen, 1990).

  10. The influence of atomic coherence and dipole–dipole interaction on ...

    Indian Academy of Sciences (India)

    Entanglement is an essential feature of quantum mechanics. ... entanglement in a system of two identical two-level atoms with one-photon ..... [1] M A Nielsen and I L Chuang, Quantum computation and quantum information (Cambridge.

  11. Rational Planning and Politicians' Preferences for Spending and Reform

    DEFF Research Database (Denmark)

    George, Bert; Deschmidt, Sebastian; Nielsen, Poul Aaes

    2017-01-01

    The rational planning cycle of formulating strategic goals and using performance information to assess goal implementation is assumed to assist decision-making by politicians. Empirical evidence supporting this assumption is scarce. Our study replicates Nielsen and Baekgaard's (2015) experiment...

  12. On the monodromy group for the super Schwarzian differential equation

    International Nuclear Information System (INIS)

    Uehara, Shozo; Yasui, Yukinori.

    1991-03-01

    We calculate the first variation of the monodromy group associated with a super Schwarzian differential equation. The relation between the monodromy period and the Fenchel-Nielsen deformation of a super Riemann surface is presented. (author)

  13. Neuropsychology of the Prodrome to Psychosis in the NAPLS Consortium: Relationship to Family History and Conversion to Psychosis

    Science.gov (United States)

    Seidman, Larry J.; Giuliano, Anthony J.; Meyer, Eric C.; Addington, Jean; Cadenhead, Kristin S.; Cannon, Tyrone D.; McGlashan, Thomas H.; Perkins, Diana O.; Tsuang, Ming T.; Walker, Elaine F.; Woods, Scott W.; Bearden, Carrie E.; Christensen, Bruce K.; Hawkins, Keith; Heaton, Robert; Keefe, Richard S. E.; Heinssen, Robert; Cornblatt, Barbara A.

    2011-01-01

    Context Early detection and prospective evaluation of clinical high-risk (CHR) individuals who may develop schizophrenia or other psychotic disorders is critical for predicting psychosis onset and for testing preventive interventions. Objective To elucidate the neuropsychology of the CHR syndrome, to determine the association of neuropsychological function with conversion to psychosis and family history (FH) of psychosis, and to examine whether baseline neuropsychological functioning predicts subsequent psychosis. Design, Setting, and Participants Longitudinal study with 2 1/2 years follow-up of 304 prospectively identified CHR individuals meeting Structured Interview for Prodromal Syndromes (SIPS) criteria, 52 non-CHR persons with a FH of psychosis in first- or second-degree relatives (“family HR”/FHR), and 193 normal controls with neither a FH of psychosis nor a CHR syndrome, all of whom had baseline neuropsychological evaluations, recruited across eight centers as part of the North American Prodrome Longitudinal Study (NAPLS). Main Measures A neurocognitive composite score, eight individual neuropsychological measures, an IQ estimate, and HR status. Results Global (“composite”) neuropsychological functioning was comparably impaired in CHR and FHR groups compared to controls, but profiles differed significantly between groups. Neuropsychological functioning in the CHR group was significantly lower in persons who progressed to psychosis than in those who did not, and worst in the subgroup with a FH of psychosis. Tests of processing speed and verbal learning and memory were most sensitive in discriminating CHR from controls, although reductions were less severe than in established schizophrenia. Neuropsychological functioning did not contribute uniquely to the prediction of psychosis beyond clinical criteria, but worse verbal memory predicted more rapid conversion. Conclusion These findings document that CHR individuals have significant neuropsychological

  14. Mapping of murine radiation-induced acute myeloid leukaemia susceptibility loci

    International Nuclear Information System (INIS)

    Darakhshan, F.

    2001-01-01

    Studies on radiation-induced AML have shown characteristic phenotypic variation in susceptibility amongst inbred mouse strains, suggesting the involvement of genetic factors in determining the development of AML post-irradiation exposure. The main objective of the present study therefore was to identify and map markers in linkage disequilibrium with gene variants associated with influencing susceptibility to radiation induced AML in mice. Given Chr 2 abnormalities are characteristic of AML in mice, this feature was exploited in an effort to overcome the long latency for AML development. Analysis of Chr 2 aberrations at 24 and 48 h following irradiation established a positive correlation between Chr 2 radiosensitivity and radiation-AML susceptibility thus validating the choice of substitute assay. The analysis also resulted in the identification of a further trait, additional to Chr 2 radiosensitivity, termed overall chromosome radiosensitivity. Genetic mapping of Chr 2 radiosensitivity using public domain microsatellite database information resulted in the definition of cluster regions on 7 different chromosomes. Further genotyping reduced the candidate regions to 3 specific regions of interest. A test of allelic association could not ascertain a conclusive link between markers at these regions and the Chr 2 radiosensitivity/radiation-AML susceptibility phenotype. However, a region on Chr 4 around D4Mit221 appears to be most strongly associated. Similar studies identified three chromosomal regions of interest (on Chrs 4, 8 and 16) associated with overall chromosome radiosensitivity trait. An independent mapping strategy using F3 RCS confirmed the likely involvement of two of the candidate Chr 2 radiosensitivity regions identified by the inbred analysis including that on Chr 4 and also highlighted phenotypic heterogeneity amongst resistant RC strains, suggesting the influence of multiple alleles in specific phenotypes. RFLP analysis of candidate genes, localised on

  15. Identification of novel genes associated with renal tertiary lymphoid organ formation in aging mice.

    Science.gov (United States)

    Huang, Yuan; Caputo, Christina R; Noordmans, Gerda A; Yazdani, Saleh; Monteiro, Luiz Henrique; van den Born, Jaap; van Goor, Harry; Heeringa, Peter; Korstanje, Ron; Hillebrands, Jan-Luuk

    2014-01-01

    A hallmark of aging-related organ deterioration is a dysregulated immune response characterized by pathologic leukocyte infiltration of affected tissues. Mechanisms and genes involved are as yet unknown. To identify genes associated with aging-related renal infiltration, we analyzed kidneys from aged mice (≥20 strains) for infiltrating leukocytes followed by Haplotype Association Mapping (HAM) analysis. Immunohistochemistry revealed CD45+ cell clusters (predominantly T and B cells) in perivascular areas coinciding with PNAd+ high endothelial venules and podoplanin+ lymph vessels indicative of tertiary lymphoid organs. Cumulative cluster size increased with age (analyzed at 6, 12 and 20 months). Based on the presence or absence of clusters in male and female mice at 20 months, HAM analysis revealed significant associations with loci on Chr1, Chr2, Chr8 and Chr14 in male mice, and with loci on Chr4, Chr7, Chr13 and Chr14 in female mice. Wisp2 (Chr2) showed the strongest association (P = 5.00×10(-137)) in male mice; Ctnnbip1 (P = 6.42×10(-267)) and Tnfrsf8 (P = 5.42×10(-245)) (both on Chr4) showed the strongest association in female mice. Both Wisp2 and Ctnnbip1 are part of the Wnt-signaling pathway and the encoded proteins were expressed within the tertiary lymphoid organs. In conclusion, this study revealed differential lymphocytic infiltration and tertiary lymphoid organ formation in aged mouse kidneys across different inbred mouse strains. HAM analysis identified candidate genes involved in the Wnt-signaling pathway that may be causally linked to tertiary lymphoid organ formation.

  16. Family Perception and 6-Month Symptomatic and Functioning Outcomes in Young Adolescents at Clinical High Risk for Psychosis in a General Population in China.

    Directory of Open Access Journals (Sweden)

    Lu Wang

    Full Text Available Given the difficulty of treating schizophrenia and other forms of psychosis, researchers have shifted focus to early detection and intervention of individuals at clinical high risk (CHR for psychosis. Previous studies have shown that elements in family functioning could predict symptom outcome in CHR individuals. However, associations between self reported family functioning and symptom or functioning outcome of CHR individuals was rarely reported. Our study aimed to investigate the characteristics and the role of family functioning in the development of CHR individuals among young adolescents.A sample of 32 CHR individuals was recruited from 2800 university students. The characteristics of family perception were evaluated by both Family Assessment Device (FAD and Family cohesion and adaptability evaluation Scale II (FACES II. 6 month follow up data was available with 25 of the recruited CHR individuals. Baseline socio-demographic characteristics and family functioning were compared between CHR and control group. We also measured the associations between different dimensions of perceived family functioning and both severity of prodromal symptoms and global functioning at baseline and 6-month follow up.CHR individuals showed more maladaptive family functioning compared to control in nearly all of the dimensions of FAD and FACES II except for Affective Involvement. Better Problem Solving and Affective Responsiveness predicted less severe positive and negative symptoms respectively. Family cohesion and adaptability were not only correlated with the baseline severity of general symptoms, but also positively associated with the general and disorganized symptom outcome.This study contributed preliminary evidence towards the associations between family perception and symptom outcome of CHR individuals. It also provided evidence for the importance of family interventions on CHR individuals.

  17. The relations of age and pubertal development with cortisol and daily stress in youth at clinical risk for psychosis.

    Science.gov (United States)

    Moskow, Danielle M; Addington, Jean; Bearden, Carrie E; Cadenhead, Kristin S; Cornblatt, Barbara A; Heinssen, Robert; Mathalon, Daniel H; McGlashan, Thomas H; Perkins, Diana O; Seidman, Larry J; Tsuang, Ming T; Cannon, Tyrone D; Woods, Scott W; Walker, Elaine F

    2016-04-01

    Prodromal syndromes often begin in adolescence - a period of neurodevelopmental changes and heightened stress sensitivity. Research has shown elevated stress and cortisol in individuals at clinical high risk (CHR) for psychosis. This cross-sectional study examined relations of age and pubertal status with cortisol and self-reported stress in healthy controls (HCs) and CHR adolescents. It was hypothesized that the relations of age and pubertal stage with cortisol and stress would be more pronounced in CHR youth. Participants were 93 HCs and 348 CHR adolescents from the North American Prodrome Longitudinal Study (NAPLS). At baseline, measures of stress (Daily Stress Inventory - DSI), Tanner stage (TS), and salivary cortisol were obtained. ANCOVA revealed increased DSI scores with age for both groups, and higher DSI scores in CHR adolescents than HCs, with a more pronounced difference for females. Contrary to prediction, with age controlled, HCs showed greater TS-related DSI increases. Analysis of cortisol showed no significant interactions, but a main effect of age and a trend toward higher cortisol in the CHR group. Correlations of cortisol with TS were higher in HC than CHR group. Stress measures increased with age in HC and CHR adolescents, and DSI scores also increased with TS in HCs. The results do not support a more pronounced age or TS increase in stress measures in CHR adolescents, but instead suggest that stress indices tend to be elevated earlier in adolescence in the CHR group. Potential determinants of findings and future directions are discussed. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. National culture and business model change: a framework for successful expansions

    DEFF Research Database (Denmark)

    Dalby, J.; Nielsen, L.S.; Lueg, Rainer

    2014-01-01

    Dalby, J., Nielsen, Lueg, R., L. S., Pedersen, L., Tomoni, A. C. 2014. National culture and business model change: a framework for successful expansions. Journal of Enterprising Culture, 22(4): 379-498.......Dalby, J., Nielsen, Lueg, R., L. S., Pedersen, L., Tomoni, A. C. 2014. National culture and business model change: a framework for successful expansions. Journal of Enterprising Culture, 22(4): 379-498....

  19. Poetiske livtag med kristendommen

    DEFF Research Database (Denmark)

    Larsen, Peter Stein

    2015-01-01

    Færøerne har to betydelige nulevende digtere, der adskillige gange er blevet oversat til dansk og flere gange Fer blevet nomineret til Nordisk Råds Pris, nemlig Jóannes Nielsen og Tóroddur Poulsen.......Færøerne har to betydelige nulevende digtere, der adskillige gange er blevet oversat til dansk og flere gange Fer blevet nomineret til Nordisk Råds Pris, nemlig Jóannes Nielsen og Tóroddur Poulsen....

  20. Overview of Organic Marketing Initiatives in Europe

    DEFF Research Database (Denmark)

    Nielsen, Thorkild; Kristensen, Niels Heine; Hansen, Mette Weinreich

    2004-01-01

    Nielsen T, Kristensen NH, Hansen MW (2004): Overview of Organic Marketing Initiatives in Europe. Chapter in: Organic Marketing Initiatives and Rural Development. Volume 7, from the OMIaRD project. University of Wales, Aberystwyth, UK. ISBN: 0-9543279-7-1......Nielsen T, Kristensen NH, Hansen MW (2004): Overview of Organic Marketing Initiatives in Europe. Chapter in: Organic Marketing Initiatives and Rural Development. Volume 7, from the OMIaRD project. University of Wales, Aberystwyth, UK. ISBN: 0-9543279-7-1...

  1. Die Asta and the Avant-Garde

    DEFF Research Database (Denmark)

    Thomsen, Bodil Marie Stavning

    2013-01-01

    The Danish film actress, Asta Nielsen, who became the first world famous film star after her success with The Abyss (1910), had a remarcable influence on what became the European avant-garde.......The Danish film actress, Asta Nielsen, who became the first world famous film star after her success with The Abyss (1910), had a remarcable influence on what became the European avant-garde....

  2. The Organic Food Market and Marketing Initiatives in Europe: a Preliminary Analysis

    DEFF Research Database (Denmark)

    Kristensen, Niels Heine; Nielsen, Thorkild; Bruselius-Jensen, Maria Louisa

    2003-01-01

    Kristensen NH, Nielsen T, Bruselius-Jensen M, Scheperlen-Bøgh P, Beckie M, Foster C, Midmore P, Padel S (2002): The Organic Food Market and Marketing Initiatives in Europe: a Preliminary Analysis. Final Report to the EU Commission......Kristensen NH, Nielsen T, Bruselius-Jensen M, Scheperlen-Bøgh P, Beckie M, Foster C, Midmore P, Padel S (2002): The Organic Food Market and Marketing Initiatives in Europe: a Preliminary Analysis. Final Report to the EU Commission...

  3. Cloning and sequence analysis demonstrate the chromate reduction ability of a novel chromate reductase gene from Serratia sp.

    Science.gov (United States)

    Deng, Peng; Tan, Xiaoqing; Wu, Ying; Bai, Qunhua; Jia, Yan; Xiao, Hong

    2015-03-01

    The ChrT gene encodes a chromate reductase enzyme which catalyzes the reduction of Cr(VI). The chromate reductase is also known as flavin mononucleotide (FMN) reductase (FMN_red). The aim of the present study was to clone the full-length ChrT DNA from Serratia sp. CQMUS2 and analyze the deduced amino acid sequence and three-dimensional structure. The putative ChrT gene fragment of Serratia sp. CQMUS2 was isolated by polymerase chain reaction (PCR), according to the known FMN_red gene sequence from Serratia sp. AS13. The flanking sequences of the ChrT gene were obtained by high efficiency TAIL-PCR, while the full-length gene of ChrT was cloned in Escherichia coli for subsequent sequencing. The nucleotide sequence of ChrT was submitted onto GenBank under the accession number, KF211434. Sequence analysis of the gene and amino acids was conducted using the Basic Local Alignment Search Tool, and open reading frame (ORF) analysis was performed using ORF Finder software. The ChrT gene was found to be an ORF of 567 bp that encodes a 188-amino acid enzyme with a calculated molecular weight of 20.4 kDa. In addition, the ChrT protein was hypothesized to be an NADPH-dependent FMN_red and a member of the flavodoxin-2 superfamily. The amino acid sequence of ChrT showed high sequence similarity to the FMN reductase genes of Klebsiella pneumonia and Raoultella ornithinolytica , which belong to the flavodoxin-2 superfamily. Furthermore, ChrT was shown to have a 85.6% similarity to the three-dimensional structure of Escherichia coli ChrR, sharing four common enzyme active sites for chromate reduction. Therefore, ChrT gene cloning and protein structure determination demonstrated the ability of the gene for chromate reduction. The results of the present study provide a basis for further studies on ChrT gene expression and protein function.

  4. Cloning and sequence analysis demonstrate the chromate reduction ability of a novel chromate reductase gene from Serratia sp

    Science.gov (United States)

    DENG, PENG; TAN, XIAOQING; WU, YING; BAI, QUNHUA; JIA, YAN; XIAO, HONG

    2015-01-01

    The ChrT gene encodes a chromate reductase enzyme which catalyzes the reduction of Cr(VI). The chromate reductase is also known as flavin mononucleotide (FMN) reductase (FMN_red). The aim of the present study was to clone the full-length ChrT DNA from Serratia sp. CQMUS2 and analyze the deduced amino acid sequence and three-dimensional structure. The putative ChrT gene fragment of Serratia sp. CQMUS2 was isolated by polymerase chain reaction (PCR), according to the known FMN_red gene sequence from Serratia sp. AS13. The flanking sequences of the ChrT gene were obtained by high efficiency TAIL-PCR, while the full-length gene of ChrT was cloned in Escherichia coli for subsequent sequencing. The nucleotide sequence of ChrT was submitted onto GenBank under the accession number, KF211434. Sequence analysis of the gene and amino acids was conducted using the Basic Local Alignment Search Tool, and open reading frame (ORF) analysis was performed using ORF Finder software. The ChrT gene was found to be an ORF of 567 bp that encodes a 188-amino acid enzyme with a calculated molecular weight of 20.4 kDa. In addition, the ChrT protein was hypothesized to be an NADPH-dependent FMN_red and a member of the flavodoxin-2 superfamily. The amino acid sequence of ChrT showed high sequence similarity to the FMN reductase genes of Klebsiella pneumonia and Raoultella ornithinolytica, which belong to the flavodoxin-2 superfamily. Furthermore, ChrT was shown to have a 85.6% similarity to the three-dimensional structure of Escherichia coli ChrR, sharing four common enzyme active sites for chromate reduction. Therefore, ChrT gene cloning and protein structure determination demonstrated the ability of the gene for chromate reduction. The results of the present study provide a basis for further studies on ChrT gene expression and protein function. PMID:25667630

  5. Religion

    DEFF Research Database (Denmark)

    Jensen, Niels Rosendal

    2017-01-01

    Anmeldelse af Niels Reehs "Secularization Revisited. Teaching of Religion and the State of Denmark" med afsæt i de nutidige kampe om kristendom og islam og med fremhævelse af Reehs forståelse af staten/religionen som en 'survival unit'.......Anmeldelse af Niels Reehs "Secularization Revisited. Teaching of Religion and the State of Denmark" med afsæt i de nutidige kampe om kristendom og islam og med fremhævelse af Reehs forståelse af staten/religionen som en 'survival unit'....

  6. Padre Pio - stigmatiseret præst

    DEFF Research Database (Denmark)

    Hvidt, Niels Christian

    2010-01-01

    Verden er fuld af spændende beretninger om mænd og kvinder, der menes at have særlig kontakt til det guddommelige. Teolog Niels Christian Hvidt beretter om helgendyrkelsen af en af disse, den navnkundige italienske munk: Padre Pio.......Verden er fuld af spændende beretninger om mænd og kvinder, der menes at have særlig kontakt til det guddommelige. Teolog Niels Christian Hvidt beretter om helgendyrkelsen af en af disse, den navnkundige italienske munk: Padre Pio....

  7. Channelrhodopsin-2 localised to the axon initial segment.

    Directory of Open Access Journals (Sweden)

    Matthew S Grubb

    2010-10-01

    Full Text Available The light-gated cation channel Channelrhodopsin-2 (ChR2 is a powerful and versatile tool for controlling neuronal activity. Currently available versions of ChR2 either distribute uniformly throughout the plasma membrane or are localised specifically to somatodendritic or synaptic domains. Localising ChR2 instead to the axon initial segment (AIS could prove an extremely useful addition to the optogenetic repertoire, targeting the channel directly to the site of action potential initiation, and limiting depolarisation and associated calcium entry elsewhere in the neuron. Here, we describe a ChR2 construct that we localised specifically to the AIS by adding the ankyrinG-binding loop of voltage-gated sodium channels (Na(vII-III to its intracellular terminus. Expression of ChR2-YFP-Na(vII-III did not significantly affect the passive or active electrical properties of cultured rat hippocampal neurons. However, the tiny ChR2 currents and small membrane depolarisations resulting from AIS targeting meant that optogenetic control of action potential firing with ChR2-YFP-Na(vII-III was unsuccessful in baseline conditions. We did succeed in stimulating action potentials with light in some ChR2-YFP-Na(vII-III-expressing neurons, but only when blocking KCNQ voltage-gated potassium channels. We discuss possible alternative approaches to obtaining precise control of neuronal spiking with AIS-targeted optogenetic constructs and propose potential uses for our ChR2-YFP-Na(vII-III probe where subthreshold modulation of action potential initiation is desirable.

  8. Adolescents at clinical-high risk for psychosis: Circadian rhythm disturbances predict worsened prognosis at 1-year follow-up.

    Science.gov (United States)

    Lunsford-Avery, Jessica R; Gonçalves, Bruno da Silva Brandão; Brietzke, Elisa; Bressan, Rodrigo A; Gadelha, Ary; Auerbach, Randy P; Mittal, Vijay A

    2017-11-01

    Individuals with psychotic disorders experience disruptions to both the sleep and circadian components of the sleep/wake cycle. Recent evidence has supported a role of sleep disturbances in emerging psychosis. However, less is known about how circadian rhythm disruptions may relate to psychosis symptoms and prognosis for adolescents with clinical high-risk (CHR) syndromes. The present study examines circadian rest/activity rhythms in CHR and healthy control (HC) youth to clarify the relationships among circadian rhythm disturbance, psychosis symptoms, psychosocial functioning, and the longitudinal course of illness. Thirty-four CHR and 32 HC participants were administered a baseline evaluation, which included clinical interviews, 5days of actigraphy, and a sleep/activity diary. CHR (n=29) participants were re-administered clinical interviews at a 1-year follow-up assessment. Relative to HC, CHR youth exhibited more fragmented circadian rhythms and later onset of nocturnal rest. Circadian disturbances (fragmented rhythms, low daily activity) were associated with increased psychotic symptom severity among CHR participants at baseline. Circadian disruptions (lower daily activity, rhythms that were more fragmented and/or desynchronized with the light/dark cycle) also predicted severity of psychosis symptoms and psychosocial impairment at 1-year follow-up among CHR youth. Circadian rhythm disturbances may represent a potential vulnerability marker for emergence of psychosis, and thus, rest/activity rhythm stabilization has promise to inform early-identification and prevention/intervention strategies for CHR youth. Future studies with longer study designs are necessary to further examine circadian rhythms in the prodromal period and rates of conversion to psychosis among CHR teens. Copyright © 2017. Published by Elsevier B.V.

  9. Genetic analysis of autoimmune sialadenitis in nonobese diabetic mice: a major susceptibility region on chromosome 1.

    Science.gov (United States)

    Boulard, Olivier; Fluteau, Guy; Eloy, Laure; Damotte, Diane; Bedossa, Pierre; Garchon, Henri-Jean

    2002-04-15

    The nonobese diabetic (NOD) mouse strain provides a good study model for Sjögren's syndrome (SS). The genetic control of SS was investigated in this model using different matings, including a (NOD x C57BL/6 (B6))F(2) cross, a (NOD x NZW)F(2) cross, and ((NOD x B6) x NOD) backcross. Multiple and different loci were detected depending on parent strain combination and sex. Despite significant complexity, two main features were prominent. First, the middle region of chromosome 1 (chr.1) was detected in all crosses. Its effect was most visible in the (NOD x B6)F(2) cross and dominated over that of other loci, including those mapping on chr.8, 9, 10, and 16; the effect of these minor loci was observed only in the absence of the NOD haplotype on chr.1. Most critically, the chr.1 region was sufficient to trigger an SS-like inflammatory infiltrate of salivary glands as shown by the study of a new C57BL/6 congenic strain carrying a restricted segment derived from NOD chr.1. Second, several chromosomal regions were previously associated with NOD autoimmune phenotypes, including Iddm (chr.1, 2, 3, 9, and 17, corresponding to Idd5, Idd13, Idd3, Idd2, and Idd1, respectively), accounting for the strong linkage previously reported between insulitis and sialitis, and autoantibody production (chr.10 and 16, corresponding to Bana2 and Bah2, respectively). Interestingly, only two loci were detected in the (NOD x NZW)F(2) cross, on chr.1 in females and on chr.7 in males, probably because of the latent autoimmune predisposition of the NZW strain. Altogether these findings reflect the complexity and heterogeneity of human SS.

  10. On proving confluence modulo equivalence for Constraint Handling Rules

    DEFF Research Database (Denmark)

    Christiansen, Henning; Kirkeby, Maja Hanne

    2017-01-01

    -logical built-in predicates such as var/1 and incomplete ones such as is/2, that are ignored in previous work on confluence. To this end, a new operational semantics for CHR is developed which includes such predicates. In addition, this semantics differs from earlier approaches by its simplicity without loss......Previous results on proving confluence for Constraint Handling Rules are extended in two ways in order to allow a larger and more realistic class of CHR programs to be considered confluent. Firstly, we introduce the relaxed notion of confluence modulo equivalence into the context of CHR: while...

  11. Executable specifications for hypothesis-based reasoning with Prolog and Constraint Handling Rules

    DEFF Research Database (Denmark)

    Christiansen, Henning

    2009-01-01

    Constraint Handling Rules (CHR) is an extension to Prolog which opens up a  spectrum of hypotheses-based reasoning in logic programs without additional interpretation overhead. Abduction with integrity constraints is one example of hypotheses-based reasoning which can be implemented directly...... in Prolog and CHR with a straightforward use of available and efficiently implemented facilities The present paper clarifies the semantic foundations for this way of doing abduction in CHR and Prolog as well as other examples  of hypotheses-based reasoning that is possible, including assumptive logic...

  12. Charabias et magiciens dans le théâtre des xiie-xiiie siècles

    OpenAIRE

    Revol, Thierry

    2014-01-01

    S’intéressant à l’imaginaire médiéval, Jacques Le Goff a mis en valeur trois domaines dans lesquels se manifeste le merveilleux. Le mirabilis correspond au merveilleux pré-chrétien, le magicus au surnaturel maléfique et satanique, et enfin le miraculosus au surnaturel chrétien. Dans la logique chrétienne, le dernier tend à repousser les deux autres dans le domaine de la superstition, ce qui, paradoxalement, légitime leur existence, puisque celle-ci n’est pas niée. Miraculosus et magicus appar...

  13. Spinal pain in Danish school children – how often and how long?

    DEFF Research Database (Denmark)

    Dissing, Kristina Boe; Hartvigsen, Jan; Wedderkopp, Niels

    Title Spinal pain in Danish school children – how often and how long? The CHAMPS Study-DK Authors First author: Kristina Boe Dissing1 Last author: Lise Hestbæk1,2 Co-authors: Jan Hartvigsen1,2, Christopher Williams3,4, Steven Kamper5, Eleanor Boyle1, Niels Wedderkopp6,7 Affiliations 1 Department...

  14. Fulltext PDF

    Indian Academy of Sciences (India)

    The attitude of slightly flippant irreverence for dogma reflected in Ghalib's lines, and indeed in his life, has played an important role in the development of every scientific discipline. The physicist Niels Bohr is said to have once remarked that the opposite of a great truth was usually another great truth. Scientific belief, once it ...

  15. Conversazioni con la sfinge il ruolo dei paradossi nelle rivoluzioni scientifiche

    CERN Document Server

    Klein, Etienne

    1993-01-01

    Niels Bohr rifiutava ogni idea troppo conservatrice con il lapidario giudizio "Non è abbastanza folle". La fisica moderna ha dimostrato l'inefficacia del buon senso per costruire teorie o comprendere particolari risultati sperimentali. In rottura con l'esperenzia comune, ha contrapposto l'inaudito all'abitudine, i concetti delicati agli archetipi classici, le ipotesi piu ardite alle apparenze rassicuranti.

  16. Report of the Army Science Board Summer Study on Installations 2025

    Science.gov (United States)

    2009-12-01

    stresses , beha- vioral health problems, and injuries associated with war. Transform: IMCOM is modernizing installation management processes, policies...well. For example, "Prediction is very difficult, especially about the future" (Niels Bohr). Others stress that the future will be a lot like the...34homogenization" Endangered species Continuous and ubiquitous of society Islanding computing Telecommuting Wireless proliferation across appliances

  17. Proceedings of the Twenty Second Nordic Seminar on Computational Mechanics

    DEFF Research Database (Denmark)

    This book contains the proceedings of the Twenty Second Nordic Seminar on Computational Mechanics (NSCM22), taking event 22-23 October 2009 at Aalborg University, Denmark. The papers presented at the Optimization Seminar in Honour of Niels Olhoff, held 21 October 2009 at Aalborg University, Denmark...

  18. Bedre trafikuheldsdata: Danske erfaringer med brug af forskellige typer trafikuheldsdata

    DEFF Research Database (Denmark)

    Møller, Mette; Clemmensen, Mikkel Bøg; Janstrup, Kira Hyldekær

    bidraget til kvalitetssikring af projektets forskellige dele, og seniorforsker Mette Møller har været overordnet projektansvarlig. Stud. BEng Lars Finn Jensen og stud. BEng Niels Klindt Andersen har varetaget dataindsamling i forbindelse med rundspørgen blandt kommunerne. Vi vil gerne udtrykke en stor tak...

  19. Word - Gift - Being

    DEFF Research Database (Denmark)

    Bogen diskuterer retfærdiggørelsens forhold til gave-økonomi og ontologi i nutidig luthersk teologi. Især diskussionen og gave-givningens og gensidighedens rolle åbner nye perspektiver for reformatorisk teologi. Bidragydere: Oswald Bayer, Ingolf U. Dalferth, Niels Henrik Gregersen, Bo Kristian Ho...

  20. Proceedings of the symposium on the foundations of modern physics, 1987

    International Nuclear Information System (INIS)

    Lahti, P.

    1987-01-01

    This book discusses the following subjects: The Quantum Postulate and atomic theory; modern mathematics in formulation of basic laws of physics; uncertainty principles, Quantum systems; Niels Bohr's concept of reality; Quantum theory; language and reality in Quantum physics; Wolfgang Pauli's conception of reality; interpretation of Quantum mechanics; varieties of realism; and many-Hilbert-spaces theory of Quantum measurements

  1. Measurement of Forward-Backward Charged Particle Correlations with ALICE

    DEFF Research Database (Denmark)

    Søgaard, Carsten

    Part I of the defence covers experimental development carried out in the ALICE experiment at the Large Hadron Collider at the European Organisation for Nuclear Research - CERN. For the Time Projection Chamber a sophisticated laser calibration system has been developed by the Niels Bohr Institute...

  2. Epistemology and Probability

    CERN Document Server

    Plotnitsky, Arkady

    2010-01-01

    Offers an exploration of the relationships between epistemology and probability in the work of Niels Bohr, Werner Heisenberg, and Erwin Schrodinger; in quantum mechanics; and in modern physics. This book considers the implications of these relationships and of quantum theory for our understanding of the nature of thinking and knowledge in general

  3. The "Special" World: Stalin's Power Apparatus and the Soviet System's Secret Structures of Communication"

    DEFF Research Database (Denmark)

    Villaume, Poul

    2009-01-01

    Bogomtale - aspekter af Niels Erik Rosenfeldts store disputats om Stalin-tidens hemmelige magt- og kommunikationsapparat diskuteres. Bogen fokuserer på systemets struktur, anatomi, procedurer og beslutningsprocesser, men sociologisk bureaukrati-teori kunne med fordel være anvendt. Værket vil være...

  4. Fulltext PDF

    Indian Academy of Sciences (India)

    1932, he attended the opening address by Niels Bohr at the 'International Congress on Light Therapy' on the topic ... understanding of the molecular processes taking place in the cell in term of atomic physics, might be ... Delbriick recalls in a few well-chosen words the paradoxes that gave rise to the quantum mechanical.

  5. PÖFFi eelsoojendus on tehtud / Margit Adorf

    Index Scriptorium Estoniae

    Adorf, Margit, 1974-

    2006-01-01

    PÖFFi laste- ja noortefilmide festivali "Just Film" filmides: "Me saame sellest üle" (rezh. Niels Arden Oplev, Taani 2006), "Tommy põrgu" (rezh. Ove Raymond Gyldenas, Norra), "Pilv" (rezh. Gregor Schnitzler, Saksamaa 2006) ja dokumemtaalfilmist "Kurikuulus". Lisatud nimekiri "Just Film'il" linastunud filmidest põhiprogrammis

  6. Cern collisions light up Copenhagen

    CERN Multimedia

    Banks, Michael

    2010-01-01

    "Anyone passing by the Niels Bohr Institute in Copenhagen, Denmark, might be startled by some strange moving lights on the facade of the institute's main building. In fact, the dancing beams show, almost in real time, collisions form the Atlas experiment at Cern's Large Hadron Collider (LHC)" (1 paragraph)

  7. The Question of Sharīʿa in Denmark

    DEFF Research Database (Denmark)

    Vinding, Niels Valdemar

    2016-01-01

    Denmark contributor Niels V. Vinding comments on recent discussions of sharīʿa in Denmark that have arisen on the basis of uninformed media reporting, which has had the consequence of sparking legislation that may have discriminatory effects on Muslims. These developments come in the wake of the ...

  8. Pædagogisk forskning for alle og enhver

    DEFF Research Database (Denmark)

    Larsen, Steen Nepper

    2018-01-01

    Tredobbelt anmeldelse i avisens tillæg Moderne tider af: Hans Vejleskov og Thyge Winther-Jensen: De pædagogiske fags grundlag og anvendelse. Aarhus Universitetsforlag Kjeld Kjertmann: Indkulturering – en ny læsestart i takt med tiden. Syddansk Universitetsforlag. Niels Jakob Pasgaard: FAQ – om...

  9. Modeling of Aircraft Deicing Fluid Induced Biochemical Oxygen Demand in Subsurface-Flow Constructed Treatment Wetlands

    Science.gov (United States)

    2009-03-01

    Jukka A. Rintala, Christof Holliger, and Alla N. Nozhevnikova. “Evaluation of Kinetic Coefficients Using Intergrated Monod and Haldane Models for...Rousseau, Diederik P. L., Peter A Vanrolleghem, and Niels De Pauw. “Model-Based Design of Horizontal Subsurface Flow constructed Treatment

  10. RE-SONAN--CEIFeb-ru-aN

    Indian Academy of Sciences (India)

    discovery of energy quanta"; 1921 - to Albert Einstein "for services to theoretical physics, and especially for his discovery of the law of the photoelectric effect"; 1922 - to Niels Bohr" for his investigations of the structure of atoms, and ofthe radiation emanating from them"; 1929 - to Louis Victor de Broglie "for his discovery of the ...

  11. Nuclear structure 1985

    International Nuclear Information System (INIS)

    Broglia, R.; Hagemann, G.; Herskind, B.

    1985-01-01

    These proceedings of the Niels Bohr Centennial Conference contains 40 lectures in nuclear physics ranging over the following subjects: single particle motion; collective motion at low excitation energy; collective motion at high angular momentum; giant resonances and nuclear forces. (G.J.P.)

  12. Kunstens Mirakler

    DEFF Research Database (Denmark)

    Hvidt, Niels Christian; Assing Hvidt, Elisabeth

    Evangeliernes mirakelberetninger har spillet en væsentlig rolle i europæisk kultur og malerkunst. Religionshistorikeren Elisabeth Assing Hvidt og teologen Niels Christian Hvidt sammenstiller malerier af Rembrandt, El Greco m.fl., som skildrer nogle af disse beretninger (bl.a. Bebudelsen og...

  13. Gymnastics and politics

    DEFF Research Database (Denmark)

    Bonde, Hans

    The first international biography of Niels Bukh (1880-1950), the charismatic founder of the special Danish school of modern gymnastics. His team of young elite gymnasts travelled around the world demonstrating his gymnastics, making Bukh reputably the most internationally well-known Dane during t...

  14. Virkelighed er noget vi leger frem, når vi leger med magten

    DEFF Research Database (Denmark)

    Holm, Claus

    2008-01-01

    I ny bog analyserer professor Niels Åkerstrøm Andersen fra CBS, hvordan organisationer forsøger at bruge den ellers uskyldige leg i magtens tjeneste. Men legen er ikke kun en loyal tjener, legen laver sine egne regler og risikerer at tage magten fra magthaverne, når de mægtiggør os gennem legen....

  15. In Situ Flash Pyrolysis of Straw

    DEFF Research Database (Denmark)

    Bech, Niels

    In-Situ Flash Pyrolysis of Straw Ph.D. dissertation by Niels Bech Submitted: April 2007. Supervisors: Professor Kim Dam-Johansen, Associate Professor Peter Arendt Jensen Erfaringerne med forbrænding af halm opnået gennem et årti har vist, at en proces der kan koncentrere energien på marken, fjerne...

  16. Firmaets Største Bedrift

    DEFF Research Database (Denmark)

    Hansen, Peer Henrik

    fortæller, hvordan de tidligere modstandsfolk Arne Sejr og Niels Frommelt få år efter befrielsen etablerede deres såkaldte Firma for med støtte fra ledende danske politikere, Forsvarets Efterretningstjeneste og CIA at organisere en hemmelig krig mod Sovjetunionens danske støtter. Meget tyder på, at både...

  17. Er gulvet grim og skummel, så ring til Hummel

    DEFF Research Database (Denmark)

    Brügger, Niels

    for at komme med et bud på. Bogen bygger på over 300 slogans, som forfatteren har indsamlet gennem flere år. Niels Brügger er lektor i medievidenskab ved Institut for Informations- og Medievidenskab, Aarhus Universitet. Til daglig forsker han i internettets historie — de sjove slogans er en hobby....

  18. African Journal of Drug & Alcohol Studies, 12(2), 2013 Copyright ...

    African Journals Online (AJOL)

    corresponding author: Derrick Ssewanyana, M.Sc., Public Health, University of Southern Denmark, Esbjerg, Niels ... Of significant public health im- .... fears among the general public and policy ... integration of harm reduction in services .... sion of HIV to PWIDs' sexual partners and ... sensitivity to cultural, racial, ethnic and.

  19. Three-Dimensional Model Test Study of Modified Caisson Breakwater at Port of Castellon, Spain

    DEFF Research Database (Denmark)

    Nørgaard, Jørgen Harck; Andersen, Thomas Lykke

    caisson breakwater at Port of Castellon, Spain, tested earlier (Nørgaard & Lykke Andersen, 2013). Associate Prof. Thomas Lykke Andersen and M.Sc. Jørgen Quvang Harck Nørgaard were in charge of the model tests. Engineer assistant Niels Drustrup assisted in the laboratory with the construction...

  20. Neutrons as Party Animals: An Analogy for Understanding Heavy-Element Fissility

    Science.gov (United States)

    Reed, B. Cameron

    2012-01-01

    I teach a general education class on the history of nuclear physics and the Manhattan Project. About halfway through the course we come to the discovery of fission and Niels Bohr's insight that it is the rare isotope of uranium, U-235, which fissions under slow-neutron bombardment as opposed to the much more common U-238 isotope. As an…

  1. Euroopa abiraha igatseb taotlejaid / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

  2. Framing the Life-Rhythm

    DEFF Research Database (Denmark)

    Munch, Anders V.

    2011-01-01

    Tracing of the notion 'rhytm' among the neo classicist architect in Denmark around 1920 that tried to vitalize the pure forms of architecture. Several of the project contributed to the artistic competions being part of the Olympic Games in that period.Both the gymnastic programme of Niels Bukh...

  3. Kvantemekanik

    DEFF Research Database (Denmark)

    Mølmer, Klaus

    enorm succes, men fortolkningen af den splittede samtidig tidens største videnskabsmænd, særligt Niels Bohr og Albert Einstein. Denne bog gennemgår kvantemekanikkens og fysikkens udvikling i det 20. århundrede - og giver indblik i de nyeste opdagelser af, hvordan den atomare verden fungerer...

  4. Nicholas Steno and Renè Descartes

    DEFF Research Database (Denmark)

    Olden-Jørgensen, Sebastian

    2009-01-01

    Den danske videnskabsmand Niels Steensen (1638-86) læste allerede som ung student Renè Descartes og blev grebet af hans metode, som han forblev tro i hele sit videnskabelige virke. Cartesianismen kan beskrives som Steensens videnskabelige paradigme (Kuhn), men det var også et paradigme, han testede...

  5. At WA7

    CERN Multimedia

    1977-01-01

    The CERN-Genoa-Annecy(LAPP)- Niels Bohr Institute, Copenhagen-Oslo-University College,London Collaboration set-up the experiment WA7 to study two-body reactions at large transverse momentum. Here, Michel Yvert, Alberto Santronico, Per Carlson

  6. The Marian Feasts Across the Lutheran Reformation in Denmark

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2015-01-01

    A discussion of continuities and changes in conceptions and celebrations of Marian feasts across the Danish Lutheran reformation, based in particular on discussions of Hans Tausen's sermons at Marian feasts from his published sermon collection (1536) and the liturgical documentation in Niels...

  7. 19 November 2014 - C. Staur Ambassador Permanent Representative of Denmark to the United Nations Office and other international organisations in Geneva

    CERN Multimedia

    Brice, Maximilien

    2014-01-01

    signing the Guest book with CERN Director-General R. Heuer and visiting the ATLAS cavern with ATLAS Collaboration, Former Spokesperson P. Jenni, ATLAS Collaboration, University of Copenhagen M. Dam and Niels Bohr Institute, University of Copenhagen, senior ATLAS Denmark member P. Hansen.

  8. På sporet af 5. C

    DEFF Research Database (Denmark)

    Krøgholt, Ida; Christoffersen, Erik Exe

    2016-01-01

    Borgerscener er landsdelsscenernes niche. Præmissen for scenerne er at bruge teatermediet til at skildre mennesker i deres autentiske liv, og i Lars Ole 5. C på Aarhus Teater leges der med Niels Malmros’ film fra 1973, som 10 århusianske børn i 12 årsalderen bruger som filter for deres egne...

  9. Drug: D08209 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ... Muscarinic cholinergic receptor antagonist ... DG01745 ... Anticholinergic antiparkinson agent ... DG01967 ... Antiparkinson... agent ... DG01745 ... Anticholinergic antiparkinson agent ATC code: N04AA03 Chemical group: DG00853 ... CHR

  10. Chromosome Y variants from different inbred mouse strains are linked to differences in the morphologic and molecular responses of cardiac cells to postpubertal testosterone

    Directory of Open Access Journals (Sweden)

    Churchill Gary A

    2009-04-01

    Full Text Available Abstract Background We have reported previously that when chromosome Y (chrY from the mouse strain C57BL/6J (ChrYC57 was substituted for that of A/J mice (ChrYA, cardiomyocytes from the resulting "chromosome substitution" C57BL/6J-chrYA strain were smaller than that of their C57BL/6J counterparts. In reverse, when chrYA from A/J mice was substituted for that of chrYC57, cardiomyocytes from the resulting A/J-chrYC57 strain were larger than in their A/J counterparts. We further used these strains to test whether: 1 the origin of chrY could also be linked to differences in the profile of gene expression in the hearts of adult male mice, and 2 post-pubertal testosterone could play a role in the differential morphologic and/or molecular effects of chrYC57 and chrYA. Results The increased size of cardiomyocytes from adult male C57BL/6J mice compared to C57BL/6J-chrYA resulted from the absence of hypertrophic effects of post-pubertal testosterone on cells from the latter strain. However, gene profiling revealed that the latter effect could not be explained on the basis of an insensitivity of cells from C57BL/6J-chrYA to androgens, since even more cardiac genes were affected by post-pubertal testosterone in C57BL/6J-chrYA hearts than in C57BL/6J. By testing for interaction between the effects of surgery and strain, we identified 249 "interaction genes" whose expression was affected by post-pubertal testosterone differentially according to the genetic origin of chrY. These interaction genes were found to be enriched within a limited number of signaling pathways, including: 1 p53 signaling, which comprises the interacting genes Ccnd1, Pten and Cdkn1a that are also potential co-regulators of the androgen receptors, and 2 circadian rhythm, which comprises Arntl/Bmal1, which may in turn regulate cell growth via the control of Cdkn1a. Conclusion Although post-pubertal testosterone increased the size of cardiomyocytes from male C56BL/6J mice but not that from

  11. GETDB: 114163 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. FM7c - 1 - - 0 - weak - sg - - - - - - - - Show 114163 DGRC Number 11...nal Number 7232 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  12. GETDB: 114099 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. FM7c - 2 - - 0 - muscle subset - sg - - - - - - - - Show 114099 DGRC ...s - Original Number 7140 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  13. Characterization and prognostic implication of 17 chromosome abnormalities in myelodysplastic syndrome.

    Science.gov (United States)

    Sánchez-Castro, Judit; Marco-Betés, Víctor; Gómez-Arbonés, Xavier; Arenillas, Leonor; Valcarcel, David; Vallespí, Teresa; Costa, Dolors; Nomdedeu, Benet; Jimenez, María José; Granada, Isabel; Grau, Javier; Ardanaz, María T; de la Serna, Javier; Carbonell, Félix; Cervera, José; Sierra, Adriana; Luño, Elisa; Cervero, Carlos J; Falantes, José; Calasanz, María J; González-Porrás, José R; Bailén, Alicia; Amigo, M Luz; Sanz, Guillermo; Solé, Francesc

    2013-07-01

    The prognosis of chromosome 17 (chr17) abnormalities in patients with primary myelodysplastic syndrome (MDS) remains unclear. The revised International Prognostic Scoring System (IPSS-R) includes these abnormalities within the intermediate cytogenetic risk group. This study assessed the impact on overall survival (OS) and risk of acute myeloid leukemia transformation (AMLt) of chr17 abnormalities in 88 patients with primary MDS. We have compared this group with 1346 patients with primary MDS and abnormal karyotype without chr17 involved. The alterations of chr17 should be considered within group of poor prognosis. The different types of alterations of chromosome 17 behave different prognosis. The study confirms the intermediate prognostic impact of the i(17q), as stated in IPSS-R. The results of the study, however, provide valuable new information on the prognostic impact of alterations of chromosome 17 in complex karyotypes. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. GETDB: 114196 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. FM7c - 3 - - 0 - weak - sg - - - - - - - - Show 114196 DGRC Number 11...nal Number 7276 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  15. GETDB: 114179 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. FM7c - - - - 0 - - - - - - - - - - - - Show 114179 DGRC Number 114179...Number 7253 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  16. GETDB: 112868 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. CyO - 2 - - 0 - sg sg sg internal - - - d1 - - - Show 112868 DGRC Num... Original Number 2297 Chr. 2 Comments NP line. Received from the National Institute of Genetics

  17. GETDB: 112421 [GETDB

    Lifescience Database Archive (English)

    Full Text Available m the National Institute of Genetics. CyO - 2 - - 0 - a small # of cells - sg - lethal - - - - - - Show 1124...ted Genes - Original Number 963 Chr. 2 Comments NP line. Received from the National Institute of Genetics

  18. GETDB: 112845 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. FM7c - 2 - - 0 - sg cns fb, tr - - - - - - - - Show 112845 DGRC Numbe...riginal Number 2258 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  19. GETDB: 112260 [GETDB

    Lifescience Database Archive (English)

    Full Text Available from the National Institute of Genetics. TM3 Ser - 1 - - 0 - cns - sg, epi, tr - - - - d1 - - - Show 112260...lated Genes - Original Number 634 Chr. 3 Comments NP line. Received from the National Institute of Genetic

  20. GETDB: 114081 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. FM7c - 2 - - 0 - a small # of cells - sg - - - - - - - - Show 114081 ... Genes - Original Number 7116 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  1. GETDB: 112660 [GETDB

    Lifescience Database Archive (English)

    Full Text Available m the National Institute of Genetics. - - 1 - - 0 - - - sg, DT, epi (stripe) - - - - - - - - Show 112660 DGR...es - Original Number 1379 Chr. - Comments NP line. Received from the National Institute of Genetics

  2. The High resolution Coronal Imager Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The telescope design is a direct continuation of the development from NIXT to TRACE and AIA: we propose a Ritchey-Chr´etien with plate scale sufficient to...

  3. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available Samples were stored at 8C after harvest, until analyzed on November. After 24 hours of the cooking, discolouration was evaluated. 1,4,6 ... Chr06 ... 10.1007/s00122-013-2254-y 24408376

  4. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available Samples were stored at 8C after harvest, until analyzed on November. After 24 hours of the cooking, discolouration was evaluated. 1,4,6 ... Chr01 ... 10.1007/s00122-013-2254-y 24408376

  5. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available Samples were stored at 8C after harvest, until analyzed on November. After 24 hours of the cooking, discolouration was evaluated. 1,4,6 ... Chr04 ... 10.1007/s00122-013-2254-y 24408376

  6. Empathy in individuals clinically at risk for psychosis

    DEFF Research Database (Denmark)

    Derntl, B.; Michel, T. M.; Prempeh, P.

    2015-01-01

    no significant deficit in the CHR group. Functional data analysis revealed hyperactivation in a frontotemporoparietal network including the amygdala in the CHR group compared with the other two groups. Conclusions Despite normal behavioural performance, the CHR group activated the neural empathy network...... differently and specifically showed hyperactivation in regions critical for emotion processing. This could suggest a compensatory mechanism reflecting emotional hypersensitivity or dysfunctional emotion regulation. Further investigations should clarify the role of these neural alterations for development...... high risk for psychosis. Method Using functional magnetic resonance imaging, we measured 15 individuals at clinical high risk of psychosis (CHR group) and compared their empathy performance with 15 healthy volunteers and 15 patients with schizophrenia. Results Behavioural data analysis indicated...

  7. Science, Technology, and Innovation in Chile | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Book cover Science, Technology, and Innovation in Chile ... With this in mind, and following a conversation between Canadian Prime Minister Jean Chrétien and ... Call for new OWSD Fellowships for Early Career Women Scientists now open.

  8. Carbon flows in the planktonic food web of temperate estuaries:A combined approach using stable isotopes, biomarkers and modeling

    NARCIS (Netherlands)

    Van den Meersche, K.

    2009-01-01

    Heip, C.H.R., Netherlands Institute of Ecology (NIOO-KNAW Yerseke) Middelburg, J.J., Netherlands Institute of Ecology (NIOO-KNAW Yerseke) Soetaert, K., Netherlands Institute of Ecology (NIOO-KNAW Yerseke)

  9. GETDB: 113246 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. FM7c - - - - 0 - weak epi stripe sg internal - - - - - - - Show 11324...ed Genes - Original Number 3373 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  10. GETDB: 114207 [GETDB

    Lifescience Database Archive (English)

    Full Text Available om the National Institute of Genetics. FM7c - 1 - - 0 - sg - sg - - - - - - - - Show 114207 DGRC Number 1142...l Number 7291 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  11. GETDB: 112240 [GETDB

    Lifescience Database Archive (English)

    Full Text Available m the National Institute of Genetics. FM7c - 2 - - 0 - tarchea dlt - sg, tr - - - - d1 - - - Show 112240 DGR...nes - Original Number 596 Chr. 1 Comments NP line. Received from the National Institute of Genetics

  12. GETDB: 112219 [GETDB

    Lifescience Database Archive (English)

    Full Text Available m the National Institute of Genetics. FM7c - 1 - - 0 - a small # of cells tr sg, cns - - - - - - - - Show 11...lated Genes - Original Number 561 Chr. 1 Comments NP line. Received from the National Institute of Genetic

  13. Gclust Server: 160316 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available annotation hypothetical protein chr_0_8254730_654; no annotation Number of Sequences 1 Homologs 1 Clusteri...ng threshold 1.00e-08 Plants and algae (7species) (%) 0.0 Other Bikonts (Chromalveo

  14. Knowledge sharing through social media: Investigating trends and technologies in a global marketing and advertising research company

    Directory of Open Access Journals (Sweden)

    Dina Adamovic

    2012-07-01

    Objective: The objective of this study was to investigate trends in knowledge-sharing technologies in Nielsen. Method: The researchers distributed semi-structured questionnaires to a sample of employees in Nielsen’s Television Audience Measurement Department. They also conducted interviews with specific employees in this department to gain a better understanding of employees’ attitudes toward, and perceptions of, the use of social media tools for creating a knowledgesharing culture at Nielsen. The researchers validated the data to see whether it could support the research and used triangulation to create a holistic view of the data they received from the questionnaires. Results: The findings of the study revealed that respondents had a positive attitude to sharing knowledge with one another through using social media tools. However, some respondents thought that technology, in general, was ‘the tree of good and evil’. The survey findings showed that Nielsen did have social media tools. However, not all employees were aware of these tools or were willing to use the tools to share knowledge. This study highlighted the possible advantages of the social media for sharing knowledge and how Nielsen could use the tools more widely. Conclusion: In order for a knowledge sharing culture to thrive at Nielsen, its employees need to engage more with social media tools in their business practices.

  15. Review of Middle Eastern Cities 1900-1950. Public Places and Public Spheres in Transformation

    DEFF Research Database (Denmark)

    Vacher, Helene

    2004-01-01

    Hans Chr. Korsholm and Jacob Skovgaard Petersen (Ed.)Middle Eastern Cities 1900-1950. Public Places and Public Spheres in Transformation.Proceedings of the Danish Institute in Damascus I. Aarhus, Aarhus University Press, 2001......Hans Chr. Korsholm and Jacob Skovgaard Petersen (Ed.)Middle Eastern Cities 1900-1950. Public Places and Public Spheres in Transformation.Proceedings of the Danish Institute in Damascus I. Aarhus, Aarhus University Press, 2001...

  16. New Targets for Prevention of Schizophrenia

    DEFF Research Database (Denmark)

    Seidman, Larry J; Nordentoft, Merete

    2015-01-01

    A number of influences have converged that make this Special Theme Issue timely: "A New Direction: Considering Developmentally Sensitive Targets for Very Early Intervention in Schizophrenia". These factors include: 1. the substantial knowledge about premorbid developmental vulnerabilities...... to psychosis, especially regarding schizophrenia; 2. the promising results emerging from interventions during the clinical high-risk (CHR) phase of psychosis and; 3. the recognition that the CHR period is a relatively late phase of developmental derailment. These factors have together led to a perspective...

  17. Gclust Server: 39396 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 39396 TET_110.m00120 Cluster Sequences Related Sequences(590) 150 hypothetical protein chr_0_825439...1_110; no annotation 2 1.00e-10 0.0 11.11 0.0 0.0 0.0 0.0 Show 39396 Cluster ID 39396 Sequen...(590) Sequence length 150 Representative annotation hypothetical protein chr_0_825439

  18. Regulatory cross-talk links Vibrio cholerae chromosome II replication and segregation.

    Directory of Open Access Journals (Sweden)

    Yoshiharu Yamaichi

    2011-07-01

    Full Text Available There is little knowledge of factors and mechanisms for coordinating bacterial chromosome replication and segregation. Previous studies have revealed that genes (and their products that surround the origin of replication (oriCII of Vibrio cholerae chromosome II (chrII are critical for controlling the replication and segregation of this chromosome. rctB, which flanks one side of oriCII, encodes a protein that initiates chrII replication; rctA, which flanks the other side of oriCII, inhibits rctB activity. The chrII parAB2 operon, which is essential for chrII partitioning, is located immediately downstream of rctA. Here, we explored how rctA exerts negative control over chrII replication. Our observations suggest that RctB has at least two DNA binding domains--one for binding to oriCII and initiating replication and the other for binding to rctA and thereby inhibiting RctB's ability to initiate replication. Notably, the inhibitory effect of rctA could be alleviated by binding of ParB2 to a centromere-like parS site within rctA. Furthermore, by binding to rctA, ParB2 and RctB inversely regulate expression of the parAB2 genes. Together, our findings suggest that fluctuations in binding of the partitioning protein ParB2 and the chrII initiator RctB to rctA underlie a regulatory network controlling both oriCII firing and the production of the essential chrII partitioning proteins. Thus, by binding both RctB and ParB2, rctA serves as a nexus for regulatory cross-talk coordinating chrII replication and segregation.

  19. Differential relations of locus of control to perceived social stress among help-seeking adolescents at low vs. high clinical risk of psychosis.

    Science.gov (United States)

    Millman, Zachary B; Weintraub, Marc J; Bentley, Eryn; DeVylder, Jordan E; Mittal, Vijay A; Pitts, Steven C; Thompson, Elizabeth; Demro, Caroline; Reeves, Gloria M; Schiffman, Jason

    2017-06-01

    Research suggests that perceived social stress influences illness presentation and course among youth in the clinical high-risk (CHR) phase of psychosis. Little is known, however, about the social cognitive factors associated with social stress perception in this population, particularly relative to youth with non-CHR psychopathology. Individuals with psychosis tend to endorse an external locus of control (LOC), which is associated with the stress response in healthy individuals. LOC may therefore be related to perceived social stress in youth at CHR. We examined the differential relations of self-reported LOC and perceived social stress, as measured by the Behavior Assessment System for Children, Second Edition, across 45 CHR and 65 help-seeking control (HSC) participants. Youth at CHR reported more social stress (F[1, 107]=6.28, p=0.01) and a more external LOC (F[1, 107]=4.98, p=0.03) than HSCs. Further, external LOC was more strongly associated with feelings of social stress in the CHR group relative to the HSC group (interaction: b=0.35, t[105]=2.32, psocial stress, however, were nonsignificant at internal levels of LOC (b=-2.0, t[105]=-0.72, p=0.48; f 2 =0.00). Results suggest that perceptions of uncontrollability over one's social environment may more often induce or exacerbate feelings of stress and tension in CHR youth relative to HSCs. A better understanding of the social cognition-stress relation may improve understanding of CHR phenomenology, etiology, and treatment. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. A chimeric receptor of the insulin-like growth factor receptor type 1 (IGFR1) and a single chain antibody specific to myelin oligodendrocyte glycoprotein activates the IGF1R signalling cascade in CG4 oligodendrocyte progenitors.

    Science.gov (United States)

    Annenkov, Alexander; Rigby, Anne; Amor, Sandra; Zhou, Dun; Yousaf, Nasim; Hemmer, Bernhard; Chernajovsky, Yuti

    2011-08-01

    In order to generate neural stem cells with increased ability to survive after transplantation in brain parenchyma we developed a chimeric receptor (ChR) that binds to myelin oligodendrocyte glycoprotein (MOG) via its ectodomain and activates the insulin-like growth factor receptor type 1 ‎‎(IGF1R) signalling cascade. Activation of this pro-survival pathway in response to ligand broadly available in the brain might increase neuroregenerative potential of transplanted precursors. The ChR was produced by fusing a MOG-specific single ‎chain antibody with the extracellular boundary of the IGF1R transmembrane segment. The ChR is expressed on the cellular surface, predominantly as a monomer, and is not N-glycosylated. To show MOG-dependent functionality of the ChR, neuroblastoma cells B104 expressing this ChR were stimulated with monolayers of cells expressing recombinant MOG. The ChR undergoes MOG-dependent tyrosine phosphorylation and homodimerisation. It promotes insulin and IGF-independent growth of the oligodendrocyte progenitor cell line CG4. The proposed mode of the ChR activation is by MOG-induced dimerisation which promotes kinase domain transphosphorylation, by-passing the requirement of conformation changes known to be important for IGF1R activation. Another ChR, which contains a segment of the β-chain ectodomain, was produced in an attempt to recapitulate some of these conformational changes, but proved non-functional. 2011 Elsevier B.V. All rights reserved.

  1. Learning to trust: social feedback normalizes trust behavior in first-episode psychosis and clinical high risk.

    Science.gov (United States)

    Lemmers-Jansen, Imke L J; Fett, Anne-Kathrin J; Hanssen, Esther; Veltman, Dick J; Krabbendam, Lydia

    2018-06-13

    Psychosis is characterized by problems in social functioning that exist well before illness onset, and in individuals at clinical high risk (CHR) for psychosis. Trust is an essential element for social interactions that is impaired in psychosis. In the trust game, chronic patients showed reduced baseline trust, impaired response to positive social feedback, and attenuated brain activation in reward and mentalizing areas. We investigated whether first-episode psychosis patients (FEP) and CHR show similar abnormalities in the neural and behavioral mechanisms underlying trust. Twenty-two FEP, 17 CHR, and 43 healthy controls performed two trust games, with a cooperative and an unfair partner in the fMRI scanner. Region of interest analyses were performed on mentalizing and reward processing areas, during the investment and outcome phases of the games. Compared with healthy controls, FEP and CHR showed reduced baseline trust, but like controls, learned to trust in response to cooperative and unfair feedback. Symptom severity was not associated with baseline trust, however in FEP associated with reduced response to feedback. The only group differences in brain activation were that CHR recruited the temporo-parietal junction (TPJ) more than FEP and controls during investment in the unfair condition. This hyper-activation in CHR was associated with greater symptom severity. Reduced baseline trust may be associated with risk for psychotic illness, or generally with poor mental health. Feedback learning is still intact in CHR and FEP, as opposed to chronic patients. CHR however show distinct neural activation patterns of hyper-activation of the TPJ.

  2. Synthesis and electro-optic properties of the chromophore-containing NLO polyarylate polymers

    Science.gov (United States)

    Ren, Haohui; Peng, Chengcheng; Bo, Shuhui; Fan, Guofang; Xu, Guangming; Zhao, Hui; Zhen, Zhen; Liu, Xinhou

    2014-03-01

    Base on the same two monomers, diphenolic acid (DPA) and isophthaloyl chloride (IPC), three chromophore-containing nonlinear optical (NLO) polyarylate polymers were prepared. A tricyanofuran (TCF)-acceptor type chromophore group was in main-chain (mPAR-chr1), side-chain (sPAR-chr1) and side-chain with a 1,1-bis(4-hydroxyphenyl)-1-phenyl-2,2,2-trifluoroethane (BPAPF) group (sPAR-F-chr1), respectively. The obtained polymers were characterized and evaluated by UV-Vis, 1H NMR, DSC and TGA. All the polymers exhibited good electro-optic (EO) activity. The relationship between EO coefficients (r33) and the chromophore concentration of the three polymers were also characterized and discussed. There were no obvious differences found in EO activity between mPAR-chr1 and sPAR-chr1 polyarylates with the same chromophore. The fluorinated block polyarylate sPAR-F-chr1 has the largest r33 value in these three polyarylates which is 52 pm/V at the wavelength of 1310 nm (which is almost twice the r33 value of normal polymers contained the same chormophore at the same content), when the concentration of chromophore 1 is 18wt.%. 85% of the r33 value was retained in the sPAR-F-chr1 after being heated at 85°C for 600 hours. The polymer sPAR-F-chr1, with good solubility, high Tg (above 200 °C) and side functional group at the same time, may probably be a practical NLO material. These properties make the new polyarylates have potential applications in EO devices such as EO modulators and switches.

  3. Unigene BLAST: CBRC-DMEL-03-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0012 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 0.64 34% ...

  4. Unigene BLAST: CBRC-DMEL-01-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0039 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-11 25% ...

  5. Unigene BLAST: CBRC-DMEL-04-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0014 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-37 49% ...

  6. Unigene BLAST: CBRC-DMEL-01-0065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0065 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-11 29% ...

  7. Unigene BLAST: CBRC-DMEL-03-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0057 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 6e-13 25% ...

  8. Unigene BLAST: CBRC-DMEL-01-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0038 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-84 95% ...

  9. Unigene BLAST: CBRC-DMEL-03-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0039 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-31 40% ...

  10. Unigene BLAST: CBRC-DMEL-02-0074 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0074 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-09 28% ...

  11. Unigene BLAST: CBRC-DMEL-01-0066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0066 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 3e-14 34% ...

  12. Unigene BLAST: CBRC-DMEL-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0056 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-11 26% ...

  13. Unigene BLAST: CBRC-DMEL-06-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-06-0041 gnl|UG|Dm#S40592667 DMG1A.1_1.E02.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.6.106.a, mRNA sequence /clone=DMG1-chr2L.6.106.a /gb=EW712706 /gi=156141512 /ug=Dm.26303 /len=1270 0.17 28% ...

  14. Unigene BLAST: CBRC-DMEL-08-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0015 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 35% ...

  15. Unigene BLAST: CBRC-DMEL-03-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0045 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-23 38% ...

  16. Unigene BLAST: CBRC-DMEL-02-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0034 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 8e-12 25% ...

  17. Unigene BLAST: CBRC-DMEL-04-0013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0013 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-29 43% ...

  18. Unigene BLAST: CBRC-DMEL-08-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0038 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 6e-10 32% ...

  19. Unigene BLAST: CBRC-DMEL-08-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0039 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 39% ...

  20. Unigene BLAST: CBRC-DMEL-04-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-04 26% ...

  1. Unigene BLAST: CBRC-DMEL-04-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0005 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-06 20% ...

  2. Unigene BLAST: CBRC-DMEL-03-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-03-0071 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 3e-07 47% ...

  3. Unigene BLAST: CBRC-DMEL-02-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0008 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 3e-12 22% ...

  4. Unigene BLAST: CBRC-DMEL-08-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-08-0057 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 2e-06 22% ...

  5. Unigene BLAST: CBRC-DMEL-02-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0075 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-66 93% ...

  6. Unigene BLAST: CBRC-DMEL-02-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-12 26% ...

  7. Unigene BLAST: CBRC-DMEL-04-0058 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0058 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-26 32% ...

  8. Unigene BLAST: CBRC-DMEL-02-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0018 gnl|UG|Dm#S40592688 DMG1A.1_1.C09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.19.066.a, mRNA sequence /clone=DMG1-chr3L.19.066.a /gb=EW712727 /gi=156141533 /ug=Dm.35847 /len=1518 1.4 35% ...

  9. Unigene BLAST: CBRC-DMEL-04-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0021 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-16 32% ...

  10. Unigene BLAST: CBRC-DMEL-01-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0040 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 2e-05 30% ...

  11. Unigene BLAST: CBRC-DMEL-04-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0006 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 0.048 17% ...

  12. Unigene BLAST: CBRC-DMEL-01-0067 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0067 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-10 31% ...

  13. Unigene BLAST: CBRC-DMEL-04-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0010 gnl|UG|Dm#S40593089 DMG1C.2_1.B05.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.17.035.a, mRNA sequence /clone=DMG1-chr3L.17.035.a /gb=EW713128 /gi=156142082 /ug=Dm.15247 /len=1404 1.8 29% ...

  14. Unigene BLAST: CBRC-DMEL-04-0015 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0015 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-82 98% ...

  15. The Role of Trauma and Stressful Life Events among Individuals at Clinical High Risk for Psychosis: A Review

    Directory of Open Access Journals (Sweden)

    Danessa Mayo

    2017-04-01

    Full Text Available The experience of childhood trauma (CT and stressful life events (SLEs is associated with subsequent development of a variety of mental health conditions, including psychotic illness. Recent research identifying adolescents and young adults at clinical high risk (CHR for psychosis allows for prospective evaluation of the impact of trauma and adverse life events on psychosis onset and other outcomes, addressing etiological questions that cannot be answered in studies of fully psychotic or non-clinical populations. This article provides a comprehensive review of the current emerging literature on trauma and adverse life events in the CHR population. Up to 80% of CHR youth endorse a lifetime history of childhood traumatic events and victimization (e.g., bullying. Several studies have shown that the experience of CT predicts psychosis onset among CHR individuals, while the literature on the influence of recent SLEs (e.g., death of a loved one remains inconclusive. Multiple models have been proposed to explain the link between trauma and psychosis, including the stress-vulnerability and stress-sensitivity hypotheses, with emphases on both cognitive processes and neurobiological mechanisms (e.g., the hypothalamic–pituitary–adrenal axis. Despite the preponderance of CHR individuals who endorse either CT or SLEs, no clinical trials have been conducted evaluating interventions for trauma in CHR youth to date. Furthermore, the current process of formal identification and assessment of trauma, SLEs, and their impact on CHR youth is inconsistent in research and clinical practice. Recommendations for improving trauma assessment, treatment, and future research directions in the CHR field are provided.

  16. From lumping to splitting and back again: Atypical social and language development in individuals with clinical-high-risk for psychosis, first episode schizophrenia, and autism spectrum disorders

    Science.gov (United States)

    Solomon, Marjorie; Olsen, Emily; Niendam, Tara; Ragland, J. Daniel; Yoon, Jong; Minzenberg, Michael; Carter, Cameron S.

    2011-01-01

    Objective Individuals with autism and schizophrenia exhibit atypical language and social symptoms. The extent to which these symptoms are evident during development and in current functioning is unclear. Method Three groups of patients aged 11–20 diagnosed as clinical-high-risk for psychosis (CHR; n = 15), first episode psychosis (FEP; n = 16), and autism spectrum disorders (ASD; n = 20), plus typically developing individuals (TYP; n = 20) were compared on common autism parent-report questionnaires assessing social and language development and current functioning including the Social Communication Questionnaire, the Children’s Communication Checklist, and the Social Reciprocity Scale. Results All clinical groups demonstrated atypical social and language development, with social impairment highest in ASD. Twenty percent of participants with CHR and FEP met diagnostic criteria for ASD as assessed by parent-report. ASD exhibited greater current syntactic, and pragmatic language symptoms including delayed echolalia, pedantic speech, and deficits in appreciating irony and sarcasm. All clinical groups exhibited current deficits in social functioning. CHR and FE had similar and intermediate levels of functioning relative to ASD and TYP, with CHR generally scoring closer to TYP, providing construct validity for the CHR diagnostic label. Conclusions The results of this study suggest that ASDs, CHR, and FEP share common features of atypical neurodevelopment of language and social function. Evidence of impaired social reciprocity across both disorders and distinct language symptoms in ASDs provides important information for differential diagnosis and psychosis prevention, as well as leads for future investigations of comparative genetics and pathophysiology. PMID:21458242

  17. Reasons for cannabis use among youths at ultra high risk for psychosis.

    Science.gov (United States)

    Gill, Kelly E; Poe, Lucy; Azimov, Neyra; Ben-David, Shelly; Vadhan, Nehal P; Girgis, Ragy; Moore, Holly; Cressman, Victoria; Corcoran, Cheryl M

    2015-06-01

    Cannabis use is prevalent in schizophrenia and its risk states, despite its association with anxiety and positive symptoms. While schizophrenia patients report using cannabis for mood enhancement and social motives, it is not known what motivates clinical high risk (CHR) patients to use cannabis. Among 102 CHR patients, 24 (23%) endorsed cannabis use, and were queried as to reasons for use, using a scale previously administered in schizophrenia patients. We hypothesized a primary motivation for mood enhancement related to anhedonia. We evaluated the 'self-medication' hypothesis by examining if motivation for symptom relief was associated with concurrent severity of symptoms. The rank order of reasons for use in CHR patients was similar to that previously reported by schizophrenia patients, with mood enhancement and social motives as primary reasons for use, and the motivation to use cannabis for symptom relief comparatively less common. Motivation for mood enhancement had a trend association with anhedonia. Motivation for symptom relief was entirely unrelated to concurrent severity of positive and anxiety symptoms. As in schizophrenia, CHR patients primarily use cannabis for mood enhancement, especially in the context of decreased motivation to seek pleasure otherwise. Negative symptoms may drive cannabis use in schizophrenia and its risk states, which may exacerbate positive symptoms. By contrast, CHR patients do not report using cannabis to 'self-medicate' emergent positive symptoms. The understanding of motives for cannabis use among CHR patients may be informative for treatments aimed at reducing use, such as motivational interviewing. © 2013 Wiley Publishing Asia Pty Ltd.

  18. Luminance and chromatic contributions to a hyperacuity task: isolation by contrast polarity and target separation.

    Science.gov (United States)

    Sun, Hao; Cooper, Bonnie; Lee, Barry B

    2012-03-01

    Vernier thresholds are known to be elevated when a target pair has opposite contrast polarity. Polarity reversal is used to assess the role of luminance and chromatic pathways in hyperacuity performance. Psychophysical hyperacuity thresholds were measured for pairs of gratings of various combinations of luminance (Lum) and chromatic (Chr) contrast polarities, at different ratios of luminance to chromatic contrast. With two red-green gratings of matched luminance and chromatic polarity (+Lum+Chr), there was an elevation of threshold at isoluminance. When both luminance and chromatic polarity were mismatched (-Lum-Chr), thresholds were substantially elevated under all conditions. With the same luminance contrast polarity and opposite chromatic polarity (+Lum-Chr) thresholds were only elevated close to isoluminance; in the reverse condition (-Lum+Chr), thresholds were elevated as in the -Lum-Chr condition except close to equiluminance. Similar data were obtained for gratings isolating the short-wavelength cone mechanism. Further psychophysical measurements assessed the role of target separation with matched or mismatched contrast polarity; similar results were found for luminance and chromatic gratings. Comparison physiological data were collected from parafoveal ganglion cells of the macaque retina. Positional precision of ganglion cell signals was assessed under conditions related to the psychophysical measurements. On the basis of these combined observations, it is argued that both magnocellular, parvocellular, and koniocellular pathways have access to cortical positional mechanisms associated with vernier acuity. Copyright © 2012 Elsevier Ltd. All rights reserved.

  19. Monitoring light-induced structural changes of Channelrhodopsin-2 by UV-visible and Fourier transform infrared spectroscopy.

    Science.gov (United States)

    Ritter, Eglof; Stehfest, Katja; Berndt, Andre; Hegemann, Peter; Bartl, Franz J

    2008-12-12

    Channelrhodopsin-2 (ChR2) is a microbial type rhodopsin and a light-gated cation channel that controls phototaxis in Chlamydomonas. We expressed ChR2 in COS-cells, purified it, and subsequently investigated this unusual photoreceptor by flash photolysis and UV-visible and Fourier transform infrared difference spectroscopy. Several transient photoproducts of the wild type ChR2 were identified, and their kinetics and molecular properties were compared with those of the ChR2 mutant E90Q. Based on the spectroscopic data we developed a model of the photocycle comprising six distinguishable intermediates. This photocycle shows similarities to the photocycle of the ChR2-related Channelrhodopsin of Volvox but also displays significant differences. We show that molecular changes include retinal isomerization, changes in hydrogen bonding of carboxylic acids, and large alterations of the protein backbone structure. These alterations are stronger than those observed in the photocycle of other microbial rhodopsins like bacteriorhodopsin and are related to those occurring in animal rhodopsins. UV-visible and Fourier transform infrared difference spectroscopy revealed two late intermediates with different time constants of tau = 6 and 40 s that exist during the recovery of the dark state. The carboxylic side chain of Glu(90) is involved in the slow transition. The molecular changes during the ChR2 photocycle are discussed with respect to other members of the rhodopsin family.

  20. Tumor-specific chromosome mis-segregation controls cancer plasticity by maintaining tumor heterogeneity.

    Directory of Open Access Journals (Sweden)

    Yuanjie Hu

    Full Text Available Aneuploidy with chromosome instability is a cancer hallmark. We studied chromosome 7 (Chr7 copy number variation (CNV in gliomas and in primary cultures derived from them. We found tumor heterogeneity with cells having Chr7-CNV commonly occurs in gliomas, with a higher percentage of cells in high-grade gliomas carrying more than 2 copies of Chr7, as compared to low-grade gliomas. Interestingly, all Chr7-aneuploid cell types in the parental culture of established glioma cell lines reappeared in single-cell-derived subcultures. We then characterized the biology of three syngeneic glioma cultures dominated by different Chr7-aneuploid cell types. We found phenotypic divergence for cells following Chr7 mis-segregation, which benefited overall tumor growth in vitro and in vivo. Mathematical modeling suggested the involvement of chromosome instability and interactions among cell subpopulations in restoring the optimal equilibrium of tumor cell types. Both our experimental data and mathematical modeling demonstrated that the complexity of tumor heterogeneity could be enhanced by the existence of chromosomes with structural abnormality, in addition to their mis-segregations. Overall, our findings show, for the first time, the involvement of chromosome instability in maintaining tumor heterogeneity, which underlies the enhanced growth, persistence and treatment resistance of cancers.

  1. Clinical Significance of Reticulocyte Hemoglobin Content in the Diagnosis of Iron Deficiency Anemia

    Directory of Open Access Journals (Sweden)

    Mustafa Karagülle

    2013-06-01

    Full Text Available OBJECTIVE: The aim of this study was to evaluate the clinical significance of reticulocyte hemoglobin content (CHr in the diagnosis of iron deficiency anemia (IDA and to compare it with other conventional iron parameters. METHODS: A total of 32 female patients with IDA (serum hemoglobin 120 g/L and serum ferritin <20 ng/mL were enrolled. RESULTS: CHr was 24.95±3.92 pg in female patients with IDA and 29.93±2.96 pg in female patients with iron deficiency. CHr showed a significant positive correlation with hemoglobin, mean corpuscular volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration, serum iron, and transferrin saturation and a significant negative correlation with transferrin and total iron-binding capacity. The cut-off value of CHr for detecting IDA was 29 pg. CONCLUSION: Our data demonstrate that CHr is a useful parameter that can be confidently used in the diagnosis of IDA, and a CHr cut-off value of 29 pg predicts IDA.

  2. Identification of quantitative trait loci underlying seed protein content of soybean including main, epistatic, and QTL × environment effects in different regions of Northeast China.

    Science.gov (United States)

    Teng, Weili; Li, Wen; Zhang, Qi; Wu, Depeng; Zhao, Xue; Li, Haiyan; Han, Yingpeng; Li, Wenbin

    2017-08-01

    The objective here was to identify QTL underlying soybean protein content (PC), and to evaluate the additive and epistatic effects of the QTLs. A mapping population, consisting of 129 recombinant inbred lines (RILs), was created by crossing 'Dongnong 46' and 'L-100'. Phenotypic data of the parents and RILs were collected for 4 years in three locations of Heilongjiang Province of China. A total of 213 SSR markers were used to construct a genetic linkage map. Eight QTLs, located on seven chromosomes (Chr), were identified to be associated with PC among the 10 tested environments. Of the seven QTLs, five QTLs, qPR-2 (Satt710, on Chr9), qPR-3 (Sat_122, on Chr12), qPR-5 (Satt543, on Chr17), qPR-7 (Satt163, on Chr18), and qPR-8 (Satt614, on Chr20), were detected in six, seven, seven, six, and seven environments, respectively, implying relatively stable QTLs. qPR-3 could explain 3.33%-11.26% of the phenotypic variation across eight tested environments. qPR-5 and qPR-8 explained 3.64%-10.1% and 11.86%-18.40% of the phenotypic variation, respectively, across seven tested environments. Eight QTLs associated with PC exhibited additive and (or) additive × environment interaction effects. The results showed that environment-independent QTLs often had higher additive effects. Moreover, five epistatic pairwise QTLs were identified in the 10 environments.

  3. Global changes in Staphylococcus aureus gene expression during human prosthetic joint infection

    DEFF Research Database (Denmark)

    Xu, Yijuan; Nielsen, Per Halkjær; Nielsen, Jeppe Lund

    2016-01-01

    and Environmental Engineering, Aalborg University, Denmark 2: Danish Technological Institute, Aarhus, Denmark Aim: ”The aim of this study was to gain insight into the in vivo expression of virulence and metabolic genes of Staphylococcus aureus in a prosthetic joint infection in a human subject” Method: ”Deep RNA......Global changes in Staphylococcus aureus gene expression during human prosthetic joint infection Xu, Yijuan1; Nielsen, Per H.1; Nielsen, Jeppe L.1; Thomsen, Trine R. 1,2; Nielsen, Kåre L.1 and the PRIS study group 1: Center for Microbial Communities, Department of Biotechnology, Chemistry...... involved overexpression of various enzymes related to cell-wall synthesis and multidrug efflux pumps. Interestingly, these efflux pumps are only known to be related to fluoroquinolone resistance. Many of the genes encoding virulence factors were upregulated, including toxins and superantigen-like proteins...

  4. Thermopower of dilute alloys of indium

    International Nuclear Information System (INIS)

    Dudenhoeffer, A.W.

    1974-01-01

    An experimental investigation of a new theory of electron-diffusion thermopower is discussed. A figure of merit for this ''Nielsen--Taylor'' theory in various metals is established, and it indicates that the effect should be largest in lead, indium, thallium, and aluminum, in that order. Previous investigations have been carried out for lead and aluminum. The thermopower of indium (or any metal) changes when impurity scattering centers are introduced into it. This change in the thermopower as a function of temperature is analyzed in terms of the Nielsen--Taylor theory and in terms of the competing process known as ''phonon drag.'' Definite conclusions as to the validity of the new theory are hampered by the complex nature of this phonon drag, but the experimental data is consistent with the Nielsen--Taylor theory. (Diss. Abstr. Int., B)

  5. Tenofovir treatment in an unselected cohort of highly antiretroviral experienced HIV positive patients

    DEFF Research Database (Denmark)

    Lerbaek, A; Kristiansen, Thomas Birk; Katzenstein, TL

    2004-01-01

    Tenofovir treatment in an unselected cohort of highly antiretroviral experienced HIV positive patients.Lerbaek A, Kristiansen TB, Katzenstein TL, Mathiesen L, Gerstoft J, Nielsen C, Larsen K, Nielsen JO, Obel N, Laursen AL, Nielsen SD. Department of Infectious Diseases, Hvidovre Hospital......, HIV-RNA levels and genotypic resistance were determined at baseline and after 3 and 6 months. After initiation of tenofovir treatment, a mean decrease in HIV-RNA for all 34 patients was observed (-0.43 log1o copies/ml (+/- 1.22) and -0.49 log10 copies/ml (+/- 1.36) after 3 and 6 months, respectively......, respectively). After initiation of tenofovir treatment, no significant increases in CD4 count were observed. All new NRTI-associated mutations could be explained by the background treatment. In conclusion, we observed a significant decrease in HIV-RNA only when tenofovir was prescribed, in conjunction...

  6. Knowledge sharing through social media: Investigating trends and technologies in a global marketing and advertising research company

    Directory of Open Access Journals (Sweden)

    Dina Adamovic

    2012-02-01

    Full Text Available Background: The purpose of this study was to investigate social media technology trends in Nielsen – a global information and measurement company – and to establish how these technologies can help the company to create a knowledge-sharing culture.Objective: The objective of this study was to investigate trends in knowledge-sharing technologies in Nielsen.Method: The researchers distributed semi-structured questionnaires to a sample of employees in Nielsen’s Television Audience Measurement Department. They also conducted interviews with specific employees in this department to gain a better understanding of employees’ attitudes toward, and perceptions of, the use of social media tools for creating a knowledgesharing culture at Nielsen. The researchers validated the data to see whether it could support the research and used triangulation to create a holistic view of the data they received from the questionnaires.Results: The findings of the study revealed that respondents had a positive attitude to sharing knowledge with one another through using social media tools. However, some respondents thought that technology, in general, was ‘the tree of good and evil’. The survey findings showed that Nielsen did have social media tools. However, not all employees were aware of these tools or were willing to use the tools to share knowledge. This study highlighted the possible advantages of the social media for sharing knowledge and how Nielsen could use the tools more widely.Conclusion: In order for a knowledge sharing culture to thrive at Nielsen, its employees need to engage more with social media tools in their business practices. 

  7. Ground Wars

    DEFF Research Database (Denmark)

    Nielsen, Rasmus Kleis

    infrastructures that utilize large databases with detailed individual-level information for targeting voters, and armies of dedicated volunteers and paid part-timers. Nielsen challenges the notion that political communication in America must be tightly scripted, controlled, and conducted by a select coterie...... reveals how personalized political communication is profoundly influencing electoral outcomes and transforming American democracy. Rasmus Kleis Nielsen is research fellow at the Reuters Institute for the Study of Journalism at the University of Oxford and assistant professor at Roskilde University...

  8. Udvidelsen af relationsfeltets didaktik – med religionsundervisningen som eksempel

    DEFF Research Database (Denmark)

    Skovmand, Keld

    beskrive denne dobbeltbevægelse som en almen fagdidaktik (Nielsen 1998 [1994]) eller – med inspiration fra Klafki – en relationsfeltets didaktik (Nielsen 2012). Dobbeltblikket på didaktikken som et relationsfelt kan kvalificeres ved hjælp af de fire kriterier for indholdsvalg, som er udformet af Frede V...... specificere indhold (DuFour & Marzano 2011). Referencer DuFour, Richard & Marzano, Robert J. 2011: Leaders of learning. How district, school, and classroom leaders improve student achievement. Bloomington, IN: Solution Tree Press. Hattie, John 2009: Visible learning. A synthesis of over 800 meta...

  9. Substructural Logical Specifications

    Science.gov (United States)

    2012-11-14

    and independently in the context of CLF by Schack-Nielsen [SN07] and by Cruz and Hou [CH12]; Schack-Nielsen proves the equivalence of the two specifi...cations, whereas Cruz and Hou used the connection informally. The contribution of this section is to describe a general transformation (of which...Functional Programming (LFP’86), pages 13–27. ACM, 1986. 5.1 [CDE+11] Manuel Clavel, Francisco Durán, Steven Eker, Patrick Lincoln, Narciso Martı́- 290 Oliet

  10. Proceedings of the 5th Danish Human-Computer Interaction Research Symposium

    DEFF Research Database (Denmark)

    Clemmensen, Torkil; Nielsen, Lene

    2005-01-01

    Lene Nielsen DEALING WITH REALITY - IN THEORY Gitte Skou PetersenA NEW IFIP WORKING GROUP - HUMAN WORK INTERACTION DESIGN Rikke Ørngreen, Torkil Clemmensen & Annelise Mark-Pejtersen CLASSIFICATION OF DESCRIPTIONS USED IN SOFTWARE AND INTERACTION DESIGN Georg Strøm OBSTACLES TO DESIGN IN VOLUNTEER BASED...... for the symposium, of which 14 were presented orally in four panel sessions. Previously the symposium has been held at University of Aarhus 2001, University of Copenhagen 2002, Roskilde University Center 2003, Aalborg University 2004. Torkil Clemmensen & Lene Nielsen Copenhagen, November 2005 CONTENT INTRODUCTION...

  11. CCR 20th Anniversary Commentary: The Development of Breast Cancer Molecular Subtyping.

    Science.gov (United States)

    Nielsen, Torsten O; Perou, Charles M

    2015-04-15

    In the August 15, 2004, issue of Clinical Cancer Research, Nielsen and colleagues demonstrated how a cancer subtype identified by gene expression profiling could be validated using a widely accessible technology (immunohistochemistry). This opened the door to large-scale studies of archival cohorts and clinical trials, which allowed detailed clinical understanding of a new genomic discovery. Clin Cancer Res; 21(8); 1779-81. ©2015 AACR. See related article by Nielsen et al., Clin Cancer Res 2004;10(16) Aug 15, 2004;5367-74. ©2015 American Association for Cancer Research.

  12. Estimation of the Reliability of Plastic Slabs

    DEFF Research Database (Denmark)

    Pirzada, G. B. : Ph.D.

    In this thesis, work related to fundamental conditions has been extended to non-fundamental or the general case of probabilistic analysis. Finally, using the ss-unzipping technique a door has been opened to system reliability analysis of plastic slabs. An attempt has been made in this thesis...... to give a probabilistic treatment of plastic slabs which is parallel to the deterministic and systematic treatment of plastic slabs by Nielsen (3). The fundamental reason is that in Nielsen (3) the treatment is based on a deterministic modelling of the basic material properties for the reinforced...

  13. VENEZUELANS´ APPROPRIATION OF SOCIAL MEDIA FOR E-GOVERNMENT

    Directory of Open Access Journals (Sweden)

    María Isabel Neuman

    2015-04-01

    Full Text Available In this paper we analyze actual figures of the use of twitter which are contrasted with the theory of virtual communities of Nielsen (2006, with emphasis on the analysis of the account @chavezcandanga of former president Hugo Chavez. The data was obtained from the analytical social networking platforms that processes the Twitter API and international research centers. We conclude that in the case of the virtual community of the @chavezcandanga account the characteristics of social networks are harnessed as an innovative practice in e-government and Nielsen formulations are met.

  14. Systemic Therapy for Youth at Clinical High Risk for Psychosis: A Pilot Study

    Directory of Open Access Journals (Sweden)

    Jingyu Shi

    2017-10-01

    Full Text Available Psychosocial intervention trials for youth at clinical high risk (CHR for psychosis have shown promising effects on treating psychotic symptoms but have not focused on psychosocial functional outcomes, and those studies have been conducted among help-seeking patients; there is a lack of research on non-clinical young CHR individuals. Systemic therapy (ST is grounded in systemic-constructivist and psychosocial resilience theories. It has a number of advantages that makes it attractive for use with CHR individuals in non-clinical context. The present study evaluated the effect of ST for students at CHR on reducing symptoms and enhancing psychosocial function. This was a single-blind randomized controlled trial for CHR young people comparing ST to supportive therapy with a 6-month treatment. Psychotic and depressive symptoms (DS as well as self-esteem and social support (SS were assessed at pre- and posttreatment. 26 CHR individuals were randomly divided into intervention group (n = 13 and control group (n = 13. There were no significant differences in severity of symptoms, level of SS and self-esteem at baseline between the two groups (P > 0.05. At posttreatment, significant improvements in positive and DS as well as SS and self-esteem were observed in the ST group (P < 0.05; in the control group, these improvements were not significant (P > 0.05. The findings indicated that systemic intervention for university students at CHR for psychosis may have a positive effect on symptoms and self-esteem as well as SS in short term. More long-term research is needed to further evaluate this intervention.

  15. Deficient Suppression of Default Mode Regions during Working Memory in Individuals with Early Psychosis and at Clinical High-Risk for Psychosis.

    Science.gov (United States)

    Fryer, Susanna L; Woods, Scott W; Kiehl, Kent A; Calhoun, Vince D; Pearlson, Godfrey D; Roach, Brian J; Ford, Judith M; Srihari, Vinod H; McGlashan, Thomas H; Mathalon, Daniel H

    2013-01-01

    The default mode network (DMN) is a set of brain regions typically activated at rest and suppressed during extrinsic cognition. Schizophrenia has been associated with deficient DMN suppression, though the extent to which DMN dysfunction predates psychosis onset is unclear. This study examined DMN suppression during working memory (WM) performance in youth at clinical high-risk (CHR) for psychosis, early schizophrenia (ESZ) patients, and healthy controls (HC). We hypothesized that the DMN would show load-dependent suppression during WM retrieval in HC but not in ESZ, with CHR participants showing an intermediate pattern. fMRI data were collected from CHR (n = 32), ESZ (n = 22), and HC (n = 54) participants, ages 12-30. DMN regions were defined via seed-based connectivity analysis of resting-state fMRI data from an independent HC sample. Load-dependent deactivations of these DMN regions in response to WM probes were interrogated. Healthy controls showed linear load-dependent increases in DMN deactivation. Significant Group-by-Load interactions were observed in DMN regions including medial prefrontal and lateral posterior parietal cortices. Group-by-Load effects in posterior DMN nodes resulted from less suppression at higher WM loads in ESZ relative to HC, with CHR differing from neither group. In medial prefrontal cortex, suppression of activity at higher WM loads was significantly diminished in both CHR and ESZ groups, relative to HC. In addition, investigation of dorsolateral prefrontal cortex (DLPFC) activations revealed that ESZ activated right DLPFC significantly more than HC, with CHR differing from neither group. While HC showed WM load-dependent modulation of DMN suppression, CHR individuals had deficient higher-load DMN suppression that was similar to, but less pronounced than, the distributed suppression deficits evident in ESZ patients. These results suggest that DMN dysregulation associated with schizophrenia predates psychosis onset.

  16. Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

    Science.gov (United States)

    Flachs, Petr; Bhattacharyya, Tanmoy; Mihola, Ondřej; Piálek, Jaroslav; Forejt, Jiří; Trachtulec, Zdenek

    2014-01-01

    PR-domain 9 (Prdm9) is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain) and the Hstx2 region of chromosome (Chr) X from M. m. musculus (Mmm; the PWD strain) participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6)F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6)F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6)F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6)F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

  17. Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

    Directory of Open Access Journals (Sweden)

    Petr Flachs

    Full Text Available PR-domain 9 (Prdm9 is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain and the Hstx2 region of chromosome (Chr X from M. m. musculus (Mmm; the PWD strain participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

  18. Perceived social stress and symptom severity among help-seeking adolescents with versus without clinical high-risk for psychosis.

    Science.gov (United States)

    Millman, Zachary B; Pitts, Steven C; Thompson, Elizabeth; Kline, Emily R; Demro, Caroline; Weintraub, Marc J; DeVylder, Jordan E; Mittal, Vijay A; Reeves, Gloria M; Schiffman, Jason

    2018-02-01

    Research suggests that social stress exposure influences illness presentation and course among youth at clinical high-risk (CHR) for psychosis, though less is known about the extent to which self-reported perceptions of social stress relate to the severity of positive symptoms. Importantly, despite the notion that youth at CHR are especially susceptible to elevations in positive symptoms under conditions of stress, no study has examined this presumption relative to other psychiatric groups. Extending previous work demonstrating that perceived social stress was higher in a CHR group than in a clinical group of non-CHR, help-seeking controls, the current study aimed to: (1) examine whether perceived social stress is related to the severity of attenuated positive symptoms in the full sample (N=110); and (2) determine whether CHR status moderates the stress-symptom relation. Exploratory analyses examined relations of perceived social stress to negative, disorganized, and general symptoms. Greater perceptions of social stress were associated with more severe positive symptoms in the entire sample; however, although positive symptoms and perceived social stress were higher in the CHR group, the strength of this relation was statistically indistinguishable across groups. No differential effect of perceived social stress was observed for any symptom domain. Results provide some support for the diathesis-stress model of psychosis, while also suggesting that social stress and symptomatology are related independent of clinical vulnerability to psychosis. Future research would benefit from longitudinal studies of stress-symptom relations across CHR and help-seeking control groups. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Arrays of microLEDs and astrocytes: biological amplifiers to optogenetically modulate neuronal networks reducing light requirement.

    Directory of Open Access Journals (Sweden)

    Rolando Berlinguer-Palmini

    Full Text Available In the modern view of synaptic transmission, astrocytes are no longer confined to the role of merely supportive cells. Although they do not generate action potentials, they nonetheless exhibit electrical activity and can influence surrounding neurons through gliotransmitter release. In this work, we explored whether optogenetic activation of glial cells could act as an amplification mechanism to optical neural stimulation via gliotransmission to the neural network. We studied the modulation of gliotransmission by selective photo-activation of channelrhodopsin-2 (ChR2 and by means of a matrix of individually addressable super-bright microLEDs (μLEDs with an excitation peak at 470 nm. We combined Ca2+ imaging techniques and concurrent patch-clamp electrophysiology to obtain subsequent glia/neural activity. First, we tested the μLEDs efficacy in stimulating ChR2-transfected astrocyte. ChR2-induced astrocytic current did not desensitize overtime, and was linearly increased and prolonged by increasing μLED irradiance in terms of intensity and surface illumination. Subsequently, ChR2 astrocytic stimulation by broad-field LED illumination with the same spectral profile, increased both glial cells and neuronal calcium transient frequency and sEPSCs suggesting that few ChR2-transfected astrocytes were able to excite surrounding not-ChR2-transfected astrocytes and neurons. Finally, by using the μLEDs array to selectively light stimulate ChR2 positive astrocytes we were able to increase the synaptic activity of single neurons surrounding it. In conclusion, ChR2-transfected astrocytes and μLEDs system were shown to be an amplifier of synaptic activity in mixed corticalneuronal and glial cells culture.

  20. Arrays of microLEDs and astrocytes: biological amplifiers to optogenetically modulate neuronal networks reducing light requirement.

    Science.gov (United States)

    Berlinguer-Palmini, Rolando; Narducci, Roberto; Merhan, Kamyar; Dilaghi, Arianna; Moroni, Flavio; Masi, Alessio; Scartabelli, Tania; Landucci, Elisa; Sili, Maria; Schettini, Antonio; McGovern, Brian; Maskaant, Pleun; Degenaar, Patrick; Mannaioni, Guido

    2014-01-01

    In the modern view of synaptic transmission, astrocytes are no longer confined to the role of merely supportive cells. Although they do not generate action potentials, they nonetheless exhibit electrical activity and can influence surrounding neurons through gliotransmitter release. In this work, we explored whether optogenetic activation of glial cells could act as an amplification mechanism to optical neural stimulation via gliotransmission to the neural network. We studied the modulation of gliotransmission by selective photo-activation of channelrhodopsin-2 (ChR2) and by means of a matrix of individually addressable super-bright microLEDs (μLEDs) with an excitation peak at 470 nm. We combined Ca2+ imaging techniques and concurrent patch-clamp electrophysiology to obtain subsequent glia/neural activity. First, we tested the μLEDs efficacy in stimulating ChR2-transfected astrocyte. ChR2-induced astrocytic current did not desensitize overtime, and was linearly increased and prolonged by increasing μLED irradiance in terms of intensity and surface illumination. Subsequently, ChR2 astrocytic stimulation by broad-field LED illumination with the same spectral profile, increased both glial cells and neuronal calcium transient frequency and sEPSCs suggesting that few ChR2-transfected astrocytes were able to excite surrounding not-ChR2-transfected astrocytes and neurons. Finally, by using the μLEDs array to selectively light stimulate ChR2 positive astrocytes we were able to increase the synaptic activity of single neurons surrounding it. In conclusion, ChR2-transfected astrocytes and μLEDs system were shown to be an amplifier of synaptic activity in mixed corticalneuronal and glial cells culture.

  1. Neuroanatomical and Symptomatic Sex Differences in Individuals at Clinical High Risk for Psychosis

    Directory of Open Access Journals (Sweden)

    Elisa Guma

    2017-12-01

    Full Text Available Sex differences have been widely observed in clinical presentation, functional outcome and neuroanatomy in individuals with a first-episode of psychosis, and chronic patients suffering from schizophrenia. However, little is known about sex differences in the high-risk stages for psychosis. The present study investigated sex differences in cortical and subcortical neuroanatomy in individuals at clinical high risk (CHR for psychosis and healthy controls (CTL, and the relationship between anatomy and clinical symptoms in males at CHR. Magnetic resonance images were collected in 26 individuals at CHR (13 men and 29 CTLs (15 men to determine total and regional brain volumes and morphology, cortical thickness, and surface area (SA. Clinical symptoms were assessed with the brief psychiatric rating scale. Significant sex-by-diagnosis interactions were observed with opposite directions of effect in male and female CHR subjects relative to their same-sex controls in multiple cortical and subcortical areas. The right postcentral, left superior parietal, inferior parietal supramarginal, and angular gyri [<5% false discovery rate (FDR] were thicker in male and thinner in female CHR subjects compared with their same-sex CTLs. The same pattern was observed in the right superior parietal gyrus SA at the regional and vertex level. Using a recently developed surface-based morphology pipeline, we observed sex-specific shape differences in the left hippocampus (<5% FDR and amygdala (<10% FDR. Negative symptom burden was significantly higher in male compared with female CHR subjects (p = 0.04 and was positively associated with areal expansion of the left amygdala in males (<5% FDR. Some limitations of the study include the sample size, and data acquisition at 1.5 T. This study demonstrates neuroanatomical sex differences in CHR subjects, which may be associated with variations in symptomatology in men and women with psychotic symptoms.

  2. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2002-01-01

    Full Text Available -Stephen J. Appold, Heidi Dahles ,Tourism and small entrepreneurs; Development, national policy, and entrepreneurial culture: Indonesian cases. Elmsford, New York: Cognizant Communication Corporation, 1999, vi + 165 pp., Karin Bras (eds -Jean-Pascal Bassino, Peter Boothroyd ,Socioeconomic renovation in Vietnam; The origin, evolution and impact of Doi Moi. Singapore: Institute of Southeast Asian Studies, 2001, xv + 175 pp., Pham Xuan Nam (eds -Peter Boomgaard, Patrick Vinton Kirch, The wet and the dry; Irrigation and agricultural intensification in Polynesia. Chicago: The University of Chicago Press, 1994, xxii + 385 pp. -A.Th. Boone, Chr.G.F. de Jong, De Gereformeerde Zending in Midden-Java 1931-1975; Een bronnenpublicatie. Zoetermeer: Boekencentrum, 1997, xxiv + 890 pp. [Uitgaven van de Werkgroep voor de Geschiedenis van de Nederlandse Zending en Overzeese Kerken, Grote Reeks 6.] -Okke Braadbaart, Colin Barlow, Institutions and economic change in Southeast Asia; The context of development from the 1960s to the 1990s. Cheltenham: Edward Elgar, xi + 204 pp. -Freek Colombijn, Abidin Kusno, Behind the postcolonial; Architecture, urban space, and political cultures in Indonesia. London: Routledge, 2000, xiv + 250 pp. -Raymond Corbey, Michael O'Hanlon ,Hunting the gatherers; Ethnographic collectors, agents and agency in Melanesia, 1870s -1930s. Oxford: Bergahn Books, 2000, xviii + 286 pp. [Methodology and History in Anthropology 6.], Robert L. Welsch (eds -Olga Deshpande, Hans Penth, A brief histroy of Lan Na; Civilizations of North Thailand. Chiang Mai: Silkworm Books, 2000, v + 74 pp. -Aone van Engelenhoven, I Ketut Artawa, Ergativity and Balinese syntax. Jakarta: Badan Penyelenggaran Seri NUSA, Universitas Katolik Indonesia Atma Jaya, 1998, v + 169 pp (in 3 volumes. [NUSA Linguistic Studies of Indonesian and Other Languages in Indonesia 42, 43, 44.] -Rens Heringa, Jill Forshee, Between the folds; Stories of cloth, lives, and travels from Sumba

  3. Identifying functional network changing patterns in individuals at clinical high-risk for psychosis and patients with early illness schizophrenia: A group ICA study

    Directory of Open Access Journals (Sweden)

    Yuhui Du

    2018-01-01

    Full Text Available Although individuals at clinical high risk (CHR for psychosis exhibit a psychosis-risk syndrome involving attenuated forms of the positive symptoms typical of schizophrenia (SZ, it remains unclear whether their resting-state brain intrinsic functional networks (INs show attenuated or qualitatively distinct patterns of functional dysconnectivity relative to SZ patients. Based on resting-state functional magnetic imaging data from 70 healthy controls (HCs, 53 CHR individuals (among which 41 subjects were antipsychotic medication-naive, and 58 early illness SZ (ESZ patients (among which 53 patients took antipsychotic medication within five years of illness onset, we estimated subject-specific INs using a novel group information guided independent component analysis (GIG-ICA and investigated group differences in INs. We found that when compared to HCs, both CHR and ESZ groups showed significant differences, primarily in default mode, salience, auditory-related, visuospatial, sensory-motor, and parietal INs. Our findings suggest that widespread INs were diversely impacted. More than 25% of voxels in the identified significant discriminative regions (obtained using all 19 possible changing patterns excepting the no-difference pattern from six of the 15 interrogated INs exhibited monotonically decreasing Z-scores (in INs from the HC to CHR to ESZ, and the related regions included the left lingual gyrus of two vision-related networks, the right postcentral cortex of the visuospatial network, the left thalamus region of the salience network, the left calcarine region of the fronto-occipital network and fronto-parieto-occipital network. Compared to HCs and CHR individuals, ESZ patients showed both increasing and decreasing connectivity, mainly hypo-connectivity involving 15% of the altered voxels from four INs. The left supplementary motor area from the sensory-motor network and the right inferior occipital gyrus in the vision-related network showed a

  4. Automated brightfield dual-color in situ hybridization for detection of mouse double minute 2 gene amplification in sarcomas.

    Science.gov (United States)

    Zhang, Wenjun; McElhinny, Abigail; Nielsen, Alma; Wang, Maria; Miller, Melanie; Singh, Shalini; Rueger, Ruediger; Rubin, Brian P; Wang, Zhen; Tubbs, Raymond R; Nagle, Raymond B; Roche, Pat; Wu, Ping; Pestic-Dragovich, Lidija

    2011-01-01

    The human homolog of the mouse double minute 2 (MDM2) oncogene is amplified in about 20% of sarcomas. The measurement of the MDM2 amplification can aid in classification and may provide a predictive value for recently formulated therapies targeting MDM2. We have developed and validated an automated bright field dual-color in situ hybridization application to detect MDM2 gene amplification. A repeat-depleted MDM2 probe was constructed to target the MDM2 gene region at 12q15. A chromosome 12-specific probe (CHR12) was generated from a pα12H8 plasmid. The in situ hybridization assay was developed by using a dinitrophenyl-labeled MDM2 probe and a digoxigenin-labeled CHR12 probe on the Ventana Medical Systems' automated slide-staining platforms. The specificity of the MDM2 and CHR12 probes was shown on metaphase spreads and further validated against controls, including normal human tonsil and known MDM2-amplified samples. The assay performance was evaluated on a cohort of 100 formalin-fixed, paraffin-embedded specimens by using a conventional bright field microscope. Simultaneous hybridization and signal detection for MDM2 and CHR12 showed that both DNA targets were present in the same cells. One hundred soft tissue specimens were stained for MDM2 and CHR12. Although 26 of 29 lipomas were nonamplified and eusomic, MDM2 amplification was noted in 78% of atypical lipomatous tumors or well-differentiated liposarcomas. Five of 6 dedifferentiated liposarcoma cases were amplified for MDM2. MDM2 amplification was observed in 1 of 8 osteosarcomas; 3 showed CHR12 aneusomy. MDM2 amplification was present in 1 of 4 chondrosarcomas. Nine of 10 synovial sarcomas displayed no evidence of MDM2 amplification in most tumor cells. In pleomorphic sarcoma, not otherwise specified (pleomorphic malignant fibrous histiocytoma), MDM2 was amplified in 38% of cases, whereas 92% were aneusomic for CHR12. One alveolar rhabdomyosarcoma and 2 embryonal rhabdomyosarcomas displayed low-level aneusomy

  5. Characterization of genomic instability in Saccharomyces cerevisiae and engaging teaching strategies described in two curricula

    Science.gov (United States)

    Keller, Alexandra P.

    Cancer arises through an accumulation of mutations in the genome. In cancer cells, mutations are frequently caused by DNA rearrangements, which include chromosomal breakages, deletions, insertions, and translocations. Such events contribute to genomic instability, a known hallmark of cancer. To study cycles of chromosomal instability, we are using baker's yeast as a model organism. In yeast, a ChrVII system was previously developed (Admire et al., 2006), in which a disomic yeast strain was used to identify regions of instability on ChrVII. Using this system, a fragile site on the left arm of ChrVII (Admire et al., 2006) was identified and characterized. This study led to insight into mechanisms involved in chromosomal rearrangements and mutations that arise from them as well as to an understanding of mechanisms involved in genomic instability. To further our understanding of genomic instability, I devised a strategy to study instability on a different chromosome (ChrV) (Figure 3), so that we could determine whether lessons learned from the ChrVII system are applicable to other chromosomes, and/or whether other mechanisms of instability could be identified. A suitable strain was generated and analyzed, and our findings suggest that frequencies of instability on the right arm of ChrV are similar to those found in ChrVII. The results from the work in ChrV described in this paper support the idea that the instability found on ChrVII is not an isolated occurrence. My research was supported by an NSF GK-12 grant. The aim of this grant is to improve science education in middle schools, and as part of my participation in this program, I studied and practiced effective science communication methodologies. In attempts to explain my research to middle school students, I collaborated with others to develop methods for explaining genetics and the most important techniques I used in my research. While developing these methods, I learned more about what motivates people to learn

  6. Measurements on irradiated L1 sensor prototypes for the D0 Run IIb silicon detector project

    Energy Technology Data Exchange (ETDEWEB)

    Ahsan, M.; Bolton, T.; Carnes, K.; /Kansas State U.; Demarteau, M.; /Fermilab; Demina, R.; /Rochester U.; Gray, T.; /Kansas State U.; Korjenevski, S.; /Rochester U.; Lehner, F.; /Zurich U.; Lipton, R.; Mao, H.S.; /Fermilab; McCarthy, R.; /SUNY, Stony Brook /Kansas State U. /Fermilab

    2010-01-01

    We report on irradiation studies of Hamamatsu prototype silicon microstrip detectors for layer 1 of the D0 upgrade project for Run IIb. The irradiation was carried out with 10 MeV protons up to proton fluence of 10{sup 14} p/cm{sup 2} at the J.R. Macdonald Laboratory, Manhatten, KS. The flux calibration was carefully checked using different dose normalization techniques. The results based on the obtained sensor leakage currents after irradiation show that the NIEL scaling hypothesis for low energy protons has to be applied with great care. We observe 30-40% less radiation damage in silicon for 10 MeV proton exposure than is expected from the predicted NIEL scaling.

  7. Trying to explain Copenhagen

    CERN Document Server

    2003-01-01

    The documentary "The Copenhagen Fallout" recounts the friendship and "falling out" of Niels Bohr and Werner Heisenberg, two of the greatest contemporary physicists - friends whom war turned into enemies. It will be shown at CERN on 1st December. During a lecture in Germany towards the end of 1922, a 20-year-old physicist dared to interrupt Physics Nobel-Prize winner Niels Bohr with the words "There is a mathematical error in what you have said." The young scientist in question was none other than Werner Heisenberg. From this audacious beginning a fruitful collaboration and great friendship grew. But World War II threw up a wall of incomprehension between the two scientists, as one worked for the Nazi regime and the other opened his Copenhagen institute to German Jewish scientists. Then came their famous meeting in September 1941, dramatised by the no less famous play "Copenhagen", currently being performed in association with CERN at th...

  8. CMS Centre at CERN

    CERN Multimedia

    2007-01-01

    A new "CMS Centre" is being established on the CERN Meyrin site by the CMS collaboration. It will be a focal point for communications, where physicists will work together on data quality monitoring, detector calibration, offline analysis of physics events, and CMS computing operations. Construction of the CMS Centre begins in the historic Proton Synchrotron (PS) control room. The historic Proton Synchrotron (PS) control room, Opened by Niels Bohr in 1960, will be reused by CMS to built its control centre. TThe LHC@FNAL Centre, in operation at Fermilab in the US, will work very closely with the CMS Centre, as well as the CERN Control Centre. (Photo Fermilab)The historic Proton Synchrotron (PS) control room is about to start a new life. Opened by Niels Bohr in 1960, the room will be reused by CMS to built its control centre. When finished, it will resemble the CERN Contro...

  9. Survey of the Use of Steganography over the Internet

    Directory of Open Access Journals (Sweden)

    Lavinia Mihaela DINCA

    2011-01-01

    Full Text Available This paper addressesthe use of Steganography over the Internet by terrorists. There were ru-mors in the newspapers that Steganography is being used to covert communication between terrorists, without presenting any scientific proof. Niels Provos and Peter Honeyman conducted an extensive Internet search where they analyzed over 2 million images and didn’t find a single hidden image. After this study the scientific community was divided: some believed that Niels Provos and Peter Honeyman was conclusive enough other did not. This paper describes what Steganography is and what can be used for, various Steganography techniques and also presents the studies made regarding the use of Steganography on the Internet.

  10. Poetikkens kunstformer

    DEFF Research Database (Denmark)

    Schweppenhäuser, Jakob

    2009-01-01

    Art Forms in Poetics: On the Relationship between Poetry and Poetics in Niels Lyngsø’s MORFEUS In Denmark, the genre of poetics has to a high degree developed into poets’ own reflections on their literary work and working process. This turn has resulted in a textual hybridity, restlessly oscillat......Art Forms in Poetics: On the Relationship between Poetry and Poetics in Niels Lyngsø’s MORFEUS In Denmark, the genre of poetics has to a high degree developed into poets’ own reflections on their literary work and working process. This turn has resulted in a textual hybridity, restlessly......, complex and ambitious bastard piece MORFEUS from 2004 – a blend of visual poetry, sonnets, associative lists, essays on literature and the arts and many other forms. Inserted in a slipcase, the large quadratic, unpaged sheets, fastened with metal rings, seem extremely tactile; the reader becomes...

  11. Measurements on irradiated L1 sensor prototypes for the D0 Run IIb silicon detector project

    International Nuclear Information System (INIS)

    Ahsan, M.; Bolton, T.; Carnes, K.; Demarteau, M.; Demina, R.; Gray, T.; Korjenevski, S.; Lehner, F.; Lipton, R.; Mao, H.S.; McCarthy, R.

    2010-01-01

    We report on irradiation studies of Hamamatsu prototype silicon microstrip detectors for layer 1 of the D0 upgrade project for Run IIb. The irradiation was carried out with 10 MeV protons up to proton fluence of 10 14 p/cm 2 at the J.R. Macdonald Laboratory, Manhatten, KS. The flux calibration was carefully checked using different dose normalization techniques. The results based on the obtained sensor leakage currents after irradiation show that the NIEL scaling hypothesis for low energy protons has to be applied with great care. We observe 30-40% less radiation damage in silicon for 10 MeV proton exposure than is expected from the predicted NIEL scaling.

  12. An overexpression of chalcone reductase of Pueraria montana var. lobata alters biosynthesis of anthocyanin and 5'-deoxyflavonoids in transgenic tobacco.

    Science.gov (United States)

    Joung, Jae-youl; Kasthuri, G Mangai; Park, Ji-young; Kang, Won-jin; Kim, Hyun-soon; Yoon, Bong-sik; Joung, Hyouk; Jeon, Jae-heung

    2003-03-28

    We isolated the chalcone reductase (pl-chr) gene of Pueraria montana var. lobata by using a PCR strategy from cDNA pools of storage roots. A high level of expression of RNA was found in both stems and roots. The genomic Southern blot result suggests that pl-chr exists as a member of a small gene family. By introducing a pl-chr gene under the control of the 35S CaMV promoter into the pink-flowering Xanthi line of Nicotiana tabacum, the flower color was changed from pink to white-to-pink. The contents of anthocyanin in the flowers of the transgenic lines were dramatically decreased by 40%, but the total UV absorption compounds remained unchanged. The production of liquiritigenin in pl-chr overexpressed transgenic tobacco lines was confirmed by HPLC and MS analysis. The introduction of pl-chr gene provides a method to redirect the flavonoid pathway into 5'-deoxyflavonoid production in non-legume crops, in order to manipulate the phenylpropanoid pathway for isoflavonoid production.

  13. Spatiotemporal Control of GPR37 Signaling and Its Behavioral Effects by Optogenetics

    Directory of Open Access Journals (Sweden)

    Wu Zheng

    2018-03-01

    Full Text Available Despite the progress in deorphanization of G Protein-Coupled Receptors (GPCRs, ≈100 GPCRs are still classified as orphan receptors without identified endogenous ligands and with unknown physiological functions. The lack of endogenous ligands triggering GPCR signaling has hampered the study of orphan GPCR functions. Using GPR37 as an example, we provide here the first demonstration of the channelrhodopsin 2 (ChR2-GPCR approach to bypass the endogenous ligand and selectively activate the orphan GPCR signal by optogenetics. Inspired by the opto-XR approach, we designed the ChR2-GPR37 chimera, in which the corresponding parts of GPR37 replaced the intracellular portions of ChR2. We showed that optogenetic activation of ChR2/opto-GPR37 elicited specific GPR37 signaling, as evidenced by reduced cAMP level, enhanced ERK phosphorylation and increased motor activity, confirming the specificity of opto-GPR37 signaling. Besides, optogenetic activation of opto-GPR37 uncovered novel aspects of GPR37 signaling (such as IP-3 signaling and anxiety-related behavior. Optogenetic activation of opto-GPR37 permits the causal analysis of GPR37 activity in the defined cells and behavioral responses of freely moving animals. Importantly, given the evolutionarily conserved seven-helix transmembrane structures of ChR2 and orphan GPCRs, we propose that opto-GPR37 approach can be readily applied to other orphan GPCRs for their deorphanization in freely moving animals.

  14. Identification of genetic modifiers of behavioral phenotypes in serotonin transporter knockout rats

    Directory of Open Access Journals (Sweden)

    Nijman Isaäc J

    2010-05-01

    Full Text Available Abstract Background Genetic variation in the regulatory region of the human serotonin transporter gene (SLC6A4 has been shown to affect brain functionality and personality. However, large heterogeneity in its biological effects is observed, which is at least partially due to genetic modifiers. To gain insight into serotonin transporter (SERT-specific genetic modifiers, we studied an intercross between the Wistar SERT-/- rat and the behaviorally and genetically divergent Brown Norway rat, and performed a QTL analysis. Results In a cohort of >150 intercross SERT-/- and control (SERT+/+ rats we characterized 12 traits that were previously associated with SERT deficiency, including activity, exploratory pattern, cocaine-induced locomotor activity, and abdominal and subcutaneous fat. Using 325 genetic markers, 10 SERT-/--specific quantitative trait loci (QTLs for parameters related to activity and exploratory pattern (Chr.1,9,11,14, and cocaine-induced anxiety and locomotor activity (Chr.5,8 were identified. No significant QTLs were found for fat parameters. Using in silico approaches we explored potential causal genes within modifier QTL regions and found interesting candidates, amongst others, the 5-HT1D receptor (Chr. 5, dopamine D2 receptor (Chr. 8, cannabinoid receptor 2 (Chr. 5, and genes involved in fetal development and plasticity (across chromosomes. Conclusions We anticipate that the SERT-/--specific QTLs may lead to the identification of new modulators of serotonergic signaling, which may be targets for pharmacogenetic and therapeutic approaches.

  15. High-risk diagnosis, social stress, and parent-child relationships: A moderation model.

    Science.gov (United States)

    Bentley, Eryn; Millman, Zachary B; Thompson, Elizabeth; Demro, Caroline; Kline, Emily; Pitts, Steven C; DeVylder, Jordan E; Smith, Melissa Edmondson; Reeves, Gloria; Schiffman, Jason

    2016-07-01

    Stress is related to symptom severity among youth at clinical high-risk (CHR) for psychosis, although this relation may be influenced by protective factors. We explored whether the association of CHR diagnosis with social stress is moderated by the quality of parent-child relationships in a sample of 96 (36 CHR; 60 help-seeking controls) adolescents and young adults receiving mental health services. We examined self-reported social stress and parent-child relationships as measured by the Behavior Assessment System for Children, Second Edition (BASC-2), and determined CHR status from the clinician-administered Structured Interview for Psychosis-Risk Syndrome (SIPS). The social stress subscale, part of the clinical domain of the BASC-2, assesses feelings of stress and tension in personal relationships and the relations with parents subscale, part of the adaptive domain of the BASC-2, assesses perceptions of importance in family and quality of parent-child relationship. There was a modest direct relation between risk diagnosis and social stress. Among those at CHR, however, there was a significant relation between parent-child relationships and social stress (b=-0.73, t[92]=-3.77, psocial stress for those at risk for psychosis. Findings provide additional evidence to suggest that interventions that simultaneously target both social stress and parent-child relationships might be relevant for adolescents and young adults at clinical high-risk for psychosis. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. Predicting the onset of psychosis in patients at clinical high risk: practical guide to probabilistic prognostic reasoning.

    Science.gov (United States)

    Fusar-Poli, P; Schultze-Lutter, F

    2016-02-01

    Prediction of psychosis in patients at clinical high risk (CHR) has become a mainstream focus of clinical and research interest worldwide. When using CHR instruments for clinical purposes, the predicted outcome is but only a probability; and, consequently, any therapeutic action following the assessment is based on probabilistic prognostic reasoning. Yet, probabilistic reasoning makes considerable demands on the clinicians. We provide here a scholarly practical guide summarising the key concepts to support clinicians with probabilistic prognostic reasoning in the CHR state. We review risk or cumulative incidence of psychosis in, person-time rate of psychosis, Kaplan-Meier estimates of psychosis risk, measures of prognostic accuracy, sensitivity and specificity in receiver operator characteristic curves, positive and negative predictive values, Bayes' theorem, likelihood ratios, potentials and limits of real-life applications of prognostic probabilistic reasoning in the CHR state. Understanding basic measures used for prognostic probabilistic reasoning is a prerequisite for successfully implementing the early detection and prevention of psychosis in clinical practice. Future refinement of these measures for CHR patients may actually influence risk management, especially as regards initiating or withholding treatment. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  17. Change of CD20 Expression in Diffuse Large B-Cell Lymphoma Treated with Rituximab, an Anti-CD20 Monoclonal Antibody: A Study of the Osaka Lymphoma Study Group

    Directory of Open Access Journals (Sweden)

    Naoki Wada

    2009-10-01

    Full Text Available Change of CD20 expression was examined in cases of diffuse large B-cell lymphoma (DLBCL. CD20 expression after treatment with anti-CD20 antibody (rituximab, Rx for DLBCL was examined in 23 cases who received serial biopsy by immunohistochemistry (IHC and flow cytometry (FCM. CD20– by IHC and/or FCM was defined as CD20–. Four cases were CD20– at initial biopsy but became CD20+ after chemotherapy with Rx (CH-R (group A. Recurrent tumors in three group A cases became resistant to CH-R. Initial and recurrent tumors were CD20+ before and after CH-R in 17 cases (group B. Tumors before CH-R were CD20– in two cases (group C and continued to be CD20– in one and turned CD20+ in the other with survival time after the relapse of 8 and 23 months, respectively. Evaluation of CD20 expression with immunohistochemical and flow cytometric methods is used for the prediction of responsiveness of relapsed DLBCL for CH-R.

  18. Negative schemata about the self and others and paranoid ideation in at-risk states and those with persisting positive symptoms.

    Science.gov (United States)

    Müller, Hendrik; de Millas, Walter; Gaebel, Wolfgang; Herrlich, Jutta; Hasan, Alkomiet; Janssen, Birgit; Juckel, Georg; Karow, Anne; Kircher, Tilo; Kiszkenow-Bäker, Stefanie; Klingberg, Stefan; Klosterkötter, Joachim; Krüger-Özgürdal, Seza; Lambert, Martin; Lautenschlager, Marion; Maier, Wolfgang; Michel, Tanja Maria; Mehl, Stefanie; Müller, Bernhard W; Pützfeld, Verena; Rausch, Franziska; Riedel, Michael; Sartory, Gudrun; Schneider, Frank; Wagner, Michael; Wiedemann, Georg; Wittorf, Andreas; Wobrock, Thomas; Wölwer, Wolfgang; Zink, Mathias; Bechdolf, Andreas

    2017-05-19

    The objective of this study is to test the conflicting theories concerning the association of negative self and other schemata and paranoid ideation. A risk-based approach, including risk stratification, is used to gain insight into the association of the negative self and other schemata that may be shared by individuals or differentiate between individuals at clinical high risk (CHR) for a first-episode psychosis and those with full-blown psychosis. The dataset includes a sample of individuals at CHR (n = 137) and a sample of individuals with persisting positive symptoms (PPS, n = 211). The CHR sample was subdivided according to a prognostic index yielding 4 CHR sub-classes with increasing risk for transition to psychosis. Negative beliefs about the self were associated with paranoid ideation in CHR and a lower risk state. In the highest risk state and full-blown psychosis, there is an association with negative beliefs about others. These findings are in line with theories suggesting a switch from a predominantly activated negative self-schema to a malevolent others-schema in association with paranoid ideation along the risk-continuum. However, due to methodological limitations these results should be replicated by future studies. © 2017 John Wiley & Sons Australia, Ltd.

  19. Gene divergence of homeologous regions associated with a major seed protein content QTL in soybean

    Directory of Open Access Journals (Sweden)

    Puji eLestari

    2013-06-01

    Full Text Available Understanding several modes of duplication contributing on the present genome structure is getting an attention because it could be related to numerous agronomically important traits. Since soybean serves as a rich protein source for animal feeds and human consumption, breeding efforts in soybean have been directed toward enhancing seed protein content. The publicly available soybean sequences and its genomically featured elements facilitate comprehending of quantitative trait loci (QTL for seed protein content in concordance with homeologous regions in soybean genome. Although parts of chromosome (Chr 20 and Chr 10 showed synteny, QTLs for seed protein content present only on Chr 20. Using comparative analysis of gene contents in recently duplicated genomic regions harboring QTL for protein/oil content on Chrs 20 and 10, a total of 27 genes are present in duplicated regions of both chromosomes. Notably, 4 tandem duplicates of the putative homeobox protein 22 (HB22 are present only on Chr 20 and this Medicago truncatula homolog expressed in endosperm at seed filling stage. These tandem duplicates could contribute on the protein/oil QTL of Chr 20. Our study suggests that non-shared gene contents within the duplicated genomic regions might lead to absence/presence of QTL related to protein/oil content.

  20. Binding of radiolabeled asbestos fibers to guinea pig (gp) alveolar macrophages (AM)

    International Nuclear Information System (INIS)

    Giannotti, M.A.; Tewson, T.J.; Francsechini, M.P.; Scheule, R.K.; Holian, A.

    1990-01-01

    The mechanism by which fibrogenic particulates cause pulmonary fibrosis in humans is not understood, but is likely to involve the AM. Using two fibrogenic particulates, namely, chrysotile (CHR) and crocidolite (CRO) asbestos and gpAM as components of an in vitro model system, the authors have shown that CHR stimulates the gpAM to release superoxide anion, but CRO does not. To examine whether this difference in stimulatory abilities is a result of differences in cell-asbestos binding they have developed an efficient procedure that radiolabels asbestos fibers while retaining their bioactivity. The fibers are labeled with 68 Ge. The 68 Ge decays into 68 Ga, which then can be detected by its characteristic position emission. Both CHR and CRO asbestos were radiolabled successfully. Mild reaction conditions and short reaction times were found under which >90% of the added 68 Ge and 68 Ga bound to the fibers. The radiolabel was retained even after washing the fibers extensively with physiologic buffers. A density gradient procedure was developed to quantitate the binding of asbestos to gpAM in suspension. The binding of both fibers increased with time over one hr. Thus, these results indicate that although both CHR and CRO interact with the gpAM, only CHR interacts productively to stimulate superoxide anion release