Nielsen number and differential equations

Directory of Open Access Journals (Sweden)

Andres Jan

2005-01-01

Full Text Available In reply to a problem of Jean Leray (application of the Nielsen theory to differential equations, two main approaches are presented. The first is via Poincaré's translation operator, while the second one is based on the Hammerstein-type solution operator. The applicability of various Nielsen theories is discussed with respect to several sorts of differential equations and inclusions. Links with the Sharkovskii-like theorems (a finite number of periodic solutions imply infinitely many subharmonics are indicated, jointly with some further consequences like the nontrivial -structure of solutions of initial value problems. Some illustrating examples are supplied and open problems are formulated.

Niels Bukh's gymnastics school in Denmark, 1912–1933

DEFF Research Database (Denmark)

Bonde, Hans

2015-01-01

Around 1916–1917 the Danish gymnastics pedagogue Niels Bukh (1880–1950) created, in an international sense, a revolutionary men's gymnastics, and in 1920 he established Denmark's and the world's first folk high school of physical education and sport. During the 1930s, Niels Bukh and his team...... of gymnasts first became a symbol for the dynamic Danish farming community, and then for the face of Denmark both at home and abroad. Bukh changed the stereotypical male expression of bodily dynamics, which in Danish rural gymnastics had been almost military. He made it legitimate for the young lads to get...

Jakob Nielsen and his Contributions to Topology

DEFF Research Database (Denmark)

Hansen, Vagn Lundsgaard

1996-01-01

The Danish mathematician Jakob Nielsen won international recognitionas one of the developers of combinatiorial group theory and the topologyof surfaces. This article describes the life and work of Jakob Nielsenwith emphasis on his contributions to topology.The biography is to be included in the b......The Danish mathematician Jakob Nielsen won international recognitionas one of the developers of combinatiorial group theory and the topologyof surfaces. This article describes the life and work of Jakob Nielsenwith emphasis on his contributions to topology.The biography is to be included...

The language of Orthodox theology & quantum mechanics: St Gregory Palamas and Niels Bohr

DEFF Research Database (Denmark)

Tanev, Stoyan

2013-01-01

The objective of this chapter is to provide an analytical framework that would enable the comparison of the ways of using words and language in the cases of St. Gregory Palamas and Niels Bohr. The main motivation will be to explore Christos Yannaras’ point about the opportunity of using quantum....... The focus on epistemological issues could be justified by the fact that both St. Gregory Palamas and Niels Bohr have been acknowledged for their epistemological insights....

Niels Bohr - his life and scientific achievements

International Nuclear Information System (INIS)

Kailas, S.

2013-01-01

Niels Bohr, a Nobel laureate and a celebrated scientist of the 20th century is remembered for his lasting contributions to atomic and nuclear physics. His pioneering works on Energy loss by charged particles, the structure of the atom, the compound nucleus model and the mechanism of nuclear fission are indeed remarkable. In this article a brief account of his life and scientific achievements is provided. (author)

Prioritized Abduction with CHR

DEFF Research Database (Denmark)

Christiansen, Henning

2008-01-01

A class of Prioritized Abductive Logic Programs (PrioALPs) is introduced and an implementation is developed in CHR for solving abductive problems, providing minimal explanations with best-first search. Priorities may represent probabilities or a cost function to be optimized. Compared with other...

Niels Bohr and Complementarity An Introduction

CERN Document Server

Plotnitsky, Arkady

2012-01-01

This book offers a discussion of Niels Bohr’s conception of “complementarity,” arguably his greatest contribution to physics and philosophy. By tracing Bohr’s work from his 1913 atomic theory to the introduction and then refinement of the idea of complementarity, and by explicating different meanings of “complementarity” in Bohr and the relationships between it and Bohr’s other concepts, the book aims to offer a contained and accessible, and yet sufficiently comprehensive account of Bohr’s work on complementarity and its significance.

Dicty_cDB: CHR241 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

Adjusted NIEL calculations for estimating proton-induced degradation of GaInP/GaAs/Ge space solar cells

International Nuclear Information System (INIS)

Lu Ming; Wang Rong; Liu Yunhong; Hu Wentao; Feng Zhao; Han Zhaolei

2011-01-01

The non-ionizing energy loss (NIEL) values for protons in solar cells should be modified by taking into account the distribution of the Bragg damage peak in the active region to calculate the corresponding displacement damage dose. In this paper, based upon a thin target approximation, a new approach is presented to modify NIEL values for protons on a GaAs sub-cell. Adjusted NIEL values can be used to estimate the degradation induced by protons on GaInP/GaAs/Ge triple-junction space solar cells.

A sensitive chemiluminescent immunoassay to detect Chromotrope FB (Chr FB) in foods.

Science.gov (United States)

Xu, Kun; Long, Hao; Xing, Rongge; Yin, Yongmei; Eremin, Sergei A; Meng, Meng; Xi, Rimo

2017-03-01

Chromotrope FB (Chr FB) is a synthetic azo dye permitted for use in foods and medicines. An acceptable daily intake (ADI) of Chr FB was 0-0.5mg/kg in China. In this study, we synthesized a Chr FB hapten with an amino group to prepare its artificial immunogen. Polyclonal antibodies obtained from New Zealand rabbits were applied to develop an indirect competitive chemiluminescent immunoassay (icCLIA) to detect Chr FB in foods. A horseradish peroxidase (HRP)-luminol-H 2 O 2 system was used to yield CL signal with p-iodophenol as an enhancement reagent. The method showed good specificity towards Chr FB and could detect as low as 0.02ngmL -1 Chr FB in buffer, 0.07ngg -1 in yoghurt candy, 0.07ngg -1 in vitamin drink and 0.13ngg -1 in bread. Compared with HPLC method, the proposed method is more sensitive by two orders of magnitude. The accuracy and precision of this method are acceptable and comparable with HPLC method. Therefore, the proposed method could be used for rapid screening of Chr FB in the mentioned foodstuffs. Copyright © 2016. Published by Elsevier B.V.

GaAs Led based NIEL spectrometer for the space radiation environment

International Nuclear Information System (INIS)

Houdayer, A.J.; Hinrichsen, P.F.; Barry, A.L.; Ng, A.

1999-01-01

A NIEL (non-ionizing-energy-loss) spectrometer for the Mir space station is described. The NIEL spectrometer package contained 20 GaAs LEDs, 10 SiC LEDs and 13 locations for TLD-700s. In order to probe different energy regions of the radiation field, the package is divided into 4 compartments covered by absorbers of varying thicknesses. This device has been submitted to proton irradiation. The effects on both the response time and the intensity of the light were measured as a function of the fluence. One of the advantages of LEDs as radiation monitors is their sensitivity and it is shown that it would be possible to detect a fluence of 4*10 7 p/cm 2 of 10 MeV protons, with sensitivity scaled as 1/E for other energies. (A.C.)

Gauge invariance and Nielsen identities

International Nuclear Information System (INIS)

Lima, A.F. de; Bazaia, D.

1989-01-01

The one-loop contribution to the effective potential and mass are computed within the context of scalar electrodynamics for the class of general R gauges in the MS scheme. These calculations are performed in order to construct a non-trivial verification of the corresponding Nielsen identities within the context of the Higgs model. Some brief comments on the Coleman-Weinberg model are also included. (author) [pt

Julia Sloth-Nielsen and Jacqui Gallinetti

African Journals Online (AJOL)

juliasn

The history of the development and passage through Parliament of the Child Justice ... Sloth-Nielsen J The Role of International law in Juvenile Justice Reform in .... rehabilitation and reintegration of children; balancing the interests of children and ... African Charter on the Rights and Welfare of the Child (African Children's ...

Carl Nielsen and the Idea of English National Music

DEFF Research Database (Denmark)

Fjeldsøe, Michael; Boeg, Jens

2012-01-01

between Vaughan Williams’ image of English national music and perceived characteristics of Nielsen’s style made it easier for English listeners and critics to appreciate Nielsen’s music than for those on the European Continent, and this might help explain the rather favourable reception of Nielsen......Why did Carl Nielsen achieve such a favourable reception in England from the 1950s on, compared to the rather reluctant recognition in continental Europe? We would suggest that one reason could be an affi nity of features in his music with the concept of English national music. The affi nity...

Genetics Home Reference: Jervell and Lange-Nielsen syndrome

Science.gov (United States)

... Home Edition for Patients and Caregivers: Long QT Syndrome and Torsades de Pointes Ventricular Tachycardia Orphanet: Familial long QT syndrome Orphanet: Jervell and Lange-Nielsen syndrome Patient Support ...

Froggatt-Nielsen hierarchy and the neutrino mass matrix

International Nuclear Information System (INIS)

Kamikado, H.; Takasugi, E.

2008-05-01

We study the neutrino mass matrix derived from the seesaw mechanism in which the neutrino Yukawa couplings and the heavy Majorana neutrino mass matrix are controlled by the Froggatt-Nielsen mechanism. In order to obtain the large neutrino mixings, two Froggatt-Nielsen fields are introduced with a complex vacuum expectation values. As a by-product, CP violation is systematically induced even if the order one couplings of FN fields are real. We show several predictions of this model, such as θ 13 , the Dirac CP phase, two Majorana CP phases, the effective mass of the neutrinoless double beta decay and the leptogenesis. The prediction of the branching ratio of μ→eγ is also given in SUSY model. (orig.)

The Life and Work of Niels Bohr – A Brief Sketch

Indian Academy of Sciences (India)

IAS Admin

Niels Henrik David Bohr was born to affluent parents on. 7 October 1885 in ... two years older; while his brother Harald, to whom he was ... sions from a very young age. ... married on 1 August 1912, the beginning of a 50-year relationship.

Niels Bohr and the philosophy of physics twenty-first century perspectives

CERN Document Server

Folse, Henry

2017-01-01

Niels Bohr and Philosophy of Physics: Twenty-First Century Perspectives examines the philosophical views, influences and legacy of the Nobel Prize physicist and philosophical spokesman of the quantum revolution, Niels Bohr. The sixteen contributions in this collection by some of the best contemporary philosophers and physicists writing on Bohr's philosophy today all carefully distinguish his subtle and unique interpretation of quantum mechanics from views often imputed to him under the banner of the “Copenhagen Interpretation.” With respect to philosophical influences on Bohr's outlook, the contributors analyse prominent similarities between his viewpoint and Kantian ways of thinking, the views of the Danish philosopher Harald Høffding, and themes characteristic of American pragmatism. In recognizing the importance of Bohr's epistemological naturalism they examine his defence of the indispensability of classical concepts from a variety of different perspectives. This collection shows us that Bohr's int...

Atoms, metaphors and paradoxes Niels Bohr and the construction of a new physics

CERN Document Server

Petruccioli, Sandro

2006-01-01

This book gives a detailed study of the development and the interpretation given to Niels Bohr's Principle of Correspondence. It also describes the role that this principle played in guiding Bohr's research over the critical period from 1920 to 1927. Quantum mechanics, developed in the 1920s and 1930s by Bohr, Heisenberg, Born, Schrödinger and Dirac, represents one of the most profound turning points in science. This theory required a wholly new kind of physics in which many of the principles, concepts and models representing reality, that had formed the basis of classical physics since Galileo and Newton, had to be abandoned. This book re-examines the birth of quantum mechanics, in particular examining the development of crucial and original insights of Niels Bohr.

An algorithm using reticulocyte hemoglobin content (CHr) measurement in screening adolescents for iron deficiency.

Science.gov (United States)

Stoffman, Nava; Brugnara, Carlo; Woods, Elizabeth R

2005-06-01

To evaluate whether the use of an algorithm including reticulocyte hemoglobin content (CHr), a new hematologic parameter, in addition to the screening complete blood count (CBC), improves detection of iron deficiency and iron deficiency anemia in healthy adolescents. After initiation of an algorithm using CHr in addition to CBC results for identifying iron-deficient patients in a primary care hospital-based adolescent clinic, we reviewed results of all hematological tests performed in the clinic during an 8-month period. Electronic medical records were screened for health status and inclusion criteria. We determined the number of patients with low hematocrit values, low mean cell volume (MCV), and low CHr. To evaluate the impact of the protocol, we calculated the percentage of cases in which the CHr results suggested a management plan different from that which would have been formulated using the CBC results only. A total of 381 patients (mean age 16.8 +/- 3.1 years) were included in the study. Anemia was diagnosed by the Centers for Disease Control (CDC) guidelines in 63 patients (16.5%), low MCV in 170 patients (44.6%), and a low CHr in 80 (21%) patients. In 68% of anemia cases, a normal CHr suggested that iron deficiency was not the cause of the anemia. Although low MCV values were found in 38 (60.4%) of all anemic cases, mean MCV was significantly (p < 0.001) lower in the 19 cases with a low CHr as well. In 19% of 318 patients with a normal hematocrit (HCT), a low CHr suggested the need for treatment of early iron deficiency. In 103 (27%) cases, CHr suggested a different treatment plan from that which would have been formulated using the screening CBC only. The use of an algorithm including CHr to screen for iron deficiency anemia may increase the accuracy of diagnosis, enabling early detection and treatment of iron deficiency in adolescents without the need for additional costly iron studies.

ChR2 transgenic animals in peripheral sensory system: Sensing light as various sensations.

Science.gov (United States)

Ji, Zhi-Gang; Wang, Hongxia

2016-04-01

Since the introduction of Channelrhodopsin-2 (ChR2) to neuroscience, optogenetics technology was developed, making it possible to activate specific neurons or circuits with spatial and temporal precision. Various ChR2 transgenic animal models have been generated and are playing important roles in revealing the mechanisms of neural activities, mapping neural circuits, controlling the behaviors of animals as well as exploring new strategy for treating the neurological diseases in both central and peripheral nervous system. An animal including humans senses environments through Aristotle's five senses (sight, hearing, smell, taste and touch). Usually, each sense is associated with a kind of sensory organ (eyes, ears, nose, tongue and skin). Is it possible that one could hear light, smell light, taste light and touch light? When ChR2 is targeted to different peripheral sensory neurons by viral vectors or generating ChR2 transgenic animals, the animals can sense the light as various sensations such as hearing, touch, pain, smell and taste. In this review, we focus on ChR2 transgenic animals in the peripheral nervous system. Firstly the working principle of ChR2 as an optogenetic actuator is simply described. Then the current transgenic animal lines where ChR2 was expressed in peripheral sensory neurons are presented and the findings obtained by these animal models are reviewed. Copyright © 2016 Elsevier Inc. All rights reserved.

Kommunikation erstatter transport

DEFF Research Database (Denmark)

Indhold: Kim Østrup: På vej mod vidensamfundet : fra grusvej til informationsmotorvej. En revolutions historie i overblik / af Erland Kolding Nielsen og Niels Mark. Annette Winkel Schwarz: Når du ser den rigtige retning, vent da ikke på ordrer. Søren Clausen: Den ministerielle jordemodergerning. ...

"J. Chr. Brotze. Estonica" esitlused Poolas

Index Scriptorium Estoniae

2007-01-01

TLÜ emeriitprofessori Raimo Pullati juhtimisel ja TLÜ teadlaste ühistööna valminud entsüklopeedilise suurteose "J. Chr. Brotze. Estonica" esitlused Johannes Paulus II nim. Lublini Katoliiklikus Ülikoolis seminaril "Eesti kultuur ja kunst" ning Poola Rahvusraamatukogus, kus toimub ka Brotze kollektsiooni näituse avamine

Some New Transformation Properties of the Nielsen Generalized Polylogarithm

Directory of Open Access Journals (Sweden)

Nina Shang

2014-01-01

Full Text Available Many of the properties of Nielsen generalized polylogarithm Sn,p(z, for example, the special value and the transformation formulas, play important roles in the computation of higher order radiative corrections in quantum electrodynamics. In this paper, some transformation formulas of z→p(z,p(z=1-z,1/z,1/(1-z,z/(z-1, and (1-z/z are obtained. In particular, the last three transformation formulas are new results so far in the literature. By use of these transformation formulas presented, new fast algorithms for Nielsen generalized polylogarithm Sn,p(z can be designed. For sn,p=Sn,p(1, a new recurrence formula is also given. The identities and the calculation of σn,p and an,p are also investigated.

A Museum for Palle Nielsen

DEFF Research Database (Denmark)

Thorborg, Christoffer

2016-01-01

The present project attempts to articulate architecturally the psychic content in the danish graphic artist and draftsman Palle Nielsen's oeuvre. The museum inscribes itself within the city of Copenhagen as a part of it, but simultaneously establishes a taut vacuum between the city's buildings......, thereby setting these existing, surrounding monumental buildings in relief. The interior of the museum manifests itself as a dramatic, labyrinthine course of empty spaces, within which the visitor is deprived of contact with the city, and potentially loses his or her sense of place....

Niels Bohr. Physicist and philospher of the atomic era

International Nuclear Information System (INIS)

Fischer, Ernst Peter

2012-01-01

The physicist and Nobel-prize carrier Niels Bohr (1885-1962) changed by his research our view to the world. By his atomic model for the first time the stability of matter could be explained, but simultaneously the atomic physics and nuclear technique based on this made our world so dangerous as never before. In an impressive portrait Ernst Peter Fischer describes the life and action of this fascinating man, his great physical finding, as well as his political engagement.

Den sene Derrida, eller: Er Claus Beck-Nielsen et spøgelse?

DEFF Research Database (Denmark)

Rösing, Lilian Munk

2009-01-01

This article is about hosting the ghost. In Spectres de Marx (1993) Derrida introduces the ghost which seems to condense in one figure the important themes of his late writings: the address, the other, the ethical turn, the event, the mourning, the reality of immateriality, the guest. The article...... turns to the paternal ghost from Shakespeare's Hamlet, as well as to the most ghost-like artist on the Danish contemporary art scene: Claus Beck-Nielsen, who some years ago declared himself dead. Is Claus Beck-Nielsen really a ghost? That is the question....

Multimerized CHR-derived peptides as HIV-1 fusion inhibitors.

Science.gov (United States)

Nomura, Wataru; Hashimoto, Chie; Suzuki, Takaharu; Ohashi, Nami; Fujino, Masayuki; Murakami, Tsutomu; Yamamoto, Naoki; Tamamura, Hirokazu

2013-08-01

To date, several HIV-1 fusion inhibitors based on the carboxy-terminal leucine/isoleucine heptad repeat (CHR) region of an HIV-1 envelope protein gp41 have been discovered. We have shown that a synthetic peptide mimetic of a trimer form of the CHR-derived peptide C34 has potent inhibitory activity against the HIV-1 fusion mechanism, compared to a monomer C34 peptide. The present study revealed that a dimeric form of C34 is evidently structurally critical for fusion inhibitors, and that the activity of multimerized CHR-derived peptides in fusion inhibition is affected by the properties of the unit peptides C34, SC34EK, and T20. The fluorescence-based study suggested that the N36-interactive sites of the C34 trimer, including hydrophobic residues, are exposed outside the trimer and that trimerization of C34 caused a remarkable increase in fusion inhibitory activity. The present results could be useful in the design of fusion inhibitors against viral infections which proceed via membrane fusion with host cells. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

Die ware rede agter Niels Bukh se besoek aan Suid-Afrika in 1939 ...

African Journals Online (AJOL)

Gymnastics and politics: Niels Bukh and male aesthetics” is an excellent work by ... the Afrikaners were anti-British and therefore pro-German, it was easy for Bonde to ... War left a large component of the European minority in a poor state of health. Apart

Identification and functional analysis of a CDE/CHR element in the POLDI promoter

Institute of Scientific and Technical Information of China (English)

SONG NanMeng; ZHU XiaoYu; SHI Lei; AN Jing; WU YanWei; SANG JianLi

2009-01-01

Chinese Center for Disease Control and Prevention, Beijing 102206, China DNA polymerase delta is encoded by the POLD1 gene, the transcription of which is strictly cell cy-cle-dependent. However, the means by which POLD1 transcription is regulated by the cell cycle mechanism is currently unknown. We discovered a novel element in the POLD1 promoter known as a CDE(cell cycle-dependent element)lCHR(cell cycle gene homology region) element. A series of luci-ferase reporter constructs containing various POLD1 promoter mutations were used to investigate the role of the CDF_JCHR element in POLD1 transcription. When the CDE/CHR element was mutated, the promoter activity was up-regulated, and the cell-cycle related factors E2F1 and p21 stopped regulating the promoter. Furthermore, cell cycle-dependent changes in the promoter activity required the integra-tive CDE/CHR element. Electrophoretic mobility shift assay (EMSA) revealed the presence of at least three types of DNA/protein complexes binding to the CDE/CHR element. Our findings provide strong evidence that the CDE/CHR-like sequence is an active functional element in the POLD1 promoter, which is important for the cell cycle regulation of the POLD1 gene.

Nielsen PrimeLocation Web/Desktop: Assessing and GIS Mapping Market Area

Data.gov (United States)

Social Security Administration — Nielsen PrimeLocation Web and Desktop Software Licensed for Internal Use only: Pop-Facts Demographics Database, Geographic Mapping Data Layers, Geo-Coding locations.

What Does it Take to Travel Philosophically Light? A Response to Nielsen

Directory of Open Access Journals (Sweden)

Idil Boran

2008-10-01

Full Text Available In his reply to criticism raised against his reading of Rawls’s constructivist method in light of Rorty’s pragmatism, Kai Nielsen defends his position on the basis that it provides the tools for an external defence of liberalism. An external defence seeks to justify a liberal conception of justice in a way that will be acceptable not only to those who have already accepted the core substantive principles of liberal theory, but to those who reject these core principles. This paper assesses Nielsen’s proposal and shows that Rortian pragmatism is a limited way of achieving an external defence of liberal political and legal institutions. I propose to develop instead the idea of Kantian constructivism to this end. This discussion also brings to light broader questions about the idea of practical philosophy, and thus pays tribute to the works of John Rawls, Richard Rorty, and Kai Nielsen. Dans sa réplique à la critique faite de son interprétation de la méthode constructiviste de Rawls à la lumière du pragmatisme de Rorty, Kai Nielsen défend sa position en indiquant qu’elle offre des outils pour faire une défense externe du libéralisme. Une défence externe cherche à justifier une conception libérale de la justice d’une façon qui sera acceptable non seulement par ceux qui ont déjà accepté les principes importants de fond de la théorie libérale, mais par ceux qui rejettent ces principes de fond. Cet article évalue la proposition de Nielsen et démontre que le pragmatisme de Rorty est une façon limitée d’en arriver à une défense externe des institutions politiques et juridiques libérales. Je propose de développer plutôt l’idée de constructivisme kantien à cette fin. Cette discussion fait aussi ressortir des questions de plus grande envergure au sujet de l’idée de philosophie pratique et rend ainsi hommage aux oeuvres de John Rawls, Richard Rorty et Kai Nielsen.

Expansion of the CHR bone code system

International Nuclear Information System (INIS)

Farnham, J.E.; Schlenker, R.A.

1976-01-01

This report describes the coding system used in the Center for Human Radiobiology (CHR) to identify individual bones and portions of bones of a complete skeletal system. It includes illustrations of various bones and bone segments with their respective code numbers. Codes are also presented for bone groups and for nonbone materials

Nielsen: Aladdin-Suite, FS89. Maskarade-Overture / Robert Layton

Index Scriptorium Estoniae

Layton, Robert

1996-01-01

Uuest heliplaadist "Nielsen: Aladdin-Suite, FS89. Maskarade-Overture, Prelude, Act 2. The Cockerels' Dance. Rhapsody Overture: An imaginary journey to the Faroe Islands, FS123. Helios Overture, FS32. Saga-Drom, FS46. Pan and Syrinx, FS87. Gothenburg Symphony Orchestra, Neeme Järvi" DG 447 757-2GH (72 minutes: DDD)

Complementarity beyond physics Niels Bohr's parallels

CERN Document Server

Bala, Arun

2017-01-01

In this study Arun Bala examines the implications that Niels Bohr’s principle of complementarity holds for fields beyond physics. Bohr, one of the founding figures of modern quantum physics, argued that the principle of complementarity he proposed for understanding atomic processes has parallels in psychology, biology, and social science, as well as in Buddhist and Taoist thought. But Bohr failed to offer any explanation for why complementarity might extend beyond physics, and his claims have been widely rejected by scientists as empty speculation. Scientific scepticism has only been reinforced by the naïve enthusiasm of postmodern relativists and New Age intuitionists, who seize upon Bohr’s ideas to justify anti-realist and mystical positions. Arun Bala offers a detailed defence of Bohr’s claim that complementarity has far-reaching implications for the biological and social sciences, as well as for comparative philosophies of science, by explaining Bohr’s parallels as responses to the omnipresence...

Baltika CHR/Evermani asemele tuleb Mosaic / Liis Kängsepp

Index Scriptorium Estoniae

Kängsepp, Liis, 1981-

2006-01-01

Ilmunud ka: Delovõje Vedomosti 22. veebr. lk. 6. AS Baltika annab kaubamärgile CHR/Evermen uue nime Mosaic. Diagramm: Kaupluste arv ja käive. Vt. samas: Klementi juht kiidab Baltika brändivahetuse heaks

Nielsen's identity and gluon condensation at finite temperature

International Nuclear Information System (INIS)

Skalozub, V.V.

1992-11-01

The gauge dependence problem of the gluon field zero component condensate, A 0 =const, is investigated in finite temperature SU(3) gluodynamics. The two-loop effective action W(A 0 ,ξ) is recalculated in the background R ξ gauge. The obtained result somewhat differs from that of other authors. By straightforward calculation it is shown that W(A 0 ,ξ) satisfies the Nielsen (the Ward type) identity. Thus, the gauge invariance of the gluon condensation phenomenon is proved. (author). 14 refs

Niels Hemmingsen and the Construction of a Seventeenth-Century Protestant Memory

DEFF Research Database (Denmark)

Sommer, Mattias Skat

2017-01-01

Danish reformer Niels Hemmingsen was a Lutheran, but owing to Pan-Protestant sentiments that became apparent in his later writings, he found an appreciative audience in non-Lutheran Western Europe during the late sixteenth and early seventeenth centuries. This article argues that the early modern...... European reception of Hemmingsen and his theology should be seen as an attempt to construct him as part of a Protestant memory. It also argues that in order to understand the dynamics behind the reception of Hemmingsen’s ideas, one has to consider the geopolitics of early modern Denmark. Due to her...

A constitutively expressed pair of rpoE2-chrR2 in Azospirillum brasilense Sp7 is required for survival under antibiotic and oxidative stress.

Science.gov (United States)

Gupta, Namrata; Kumar, Santosh; Mishra, Mukti Nath; Tripathi, Anil Kumar

2013-02-01

Extracytoplasmic function (ECF) sigma factors (σ(E)) are known to bring about changes in gene expression to enable bacteria to adapt to different stresses. The Azospirillum brasilense Sp245 genome harbours nine genes encoding σ(E), of which two are adjacent to the genes encoding ChrR-type zinc-binding anti-sigma (ZAS) factors. We describe here the role and regulation of a new pair of rpoE-chrR, which was found in the genome of A. brasilense Sp7 in addition to the previously described rpoE-chrR pair (designated rpoE1-chrR1). The rpoE2-chrR2 pair is also cotranscribed, and their products show protein-protein interaction. The -10 and -35 promoter elements of rpoE2-chrR2 and rpoE1-chrR1 were similar but not identical. Unlike the promoter of rpoE1-chrR1, the rpoE2-chrR2 promoter was neither autoregulated nor induced by oxidative stress. Inactivation of chrR2 or overexpression of rpoE2 in A. brasilense Sp7 resulted in an overproduction of carotenoids. It also conferred resistance to oxidative stresses and antibiotics. By controlling the synthesis of carotenoids, initiation and elongation of translation, protein folding and purine biosynthesis, RpoE2 seems to play a crucial role in preventing and repairing the cellular damage caused by oxidative stress. Lack of autoregulation and constitutive expression of rpoE2-chrR2 suggest that RpoE2-ChrR2 may provide a rapid mechanism to cope with oxidative stress, wherein singlet oxygen ((1)O(2))-mediated dissociation of the RpoE2-ChrR2 complex might release RpoE2 to drive the expression of its target genes.

FN-2HDM: Two Higgs Doublet Models with Froggatt-Nielsen symmetry

Energy Technology Data Exchange (ETDEWEB)

Dery, Avital; Nir, Yosef [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, Herzl 234, Rehovot 76100 (Israel)

2017-04-03

We embed Two Higgs Doublet Models (2HDMs) in the Froggatt Nielsen (FN) framework. We find that the approximate FN symmetry predicts i) approximate Natural Flavor Conservation (NFC) of Types II or IV in the Yukawa sector, and ii) approximate Peccei-Quinn (PQ) symmetry in the scalar sector. We discuss the phenomenological consequences of these features.

O Concerto para Clarineta, Op.57 de Carl Nielsen: contexto, análises e interpretações Carl Nielsen's Clarinet Concerto, Op.57: context, analysis and performance

Directory of Open Access Journals (Sweden)

Vinicius de Sousa Fraga

2013-06-01

Full Text Available Composto em 1928, o Concerto para Clarineta, Op.57, de Carl Nielsen (1865-1931 tornou-se uma obra fundamental na literatura da clarineta no século XX. A presente pesquisa procura discutir algumas de suas questões de performance através de uma contextualização da época em que foi escrito, com ênfase nos aspectos relevantes sobre o compositor e a produção da obra. São observadas as divergências entre a edição da Samfundet e os originais manuscritos. Por meio de uma análise da obra, busca-se discutir sua recepção inicial e seu papel na literatura da clarineta.Composed in 1928, Carl Nielsen's Clarinet Concerto, Op.57 became a fundamental work in the twentieth century clarinet literature. This study discusses some of the work's performance aspects by means of examining its context related to its composer and compositional procedures. The discrepancies between the Sanfundet edition and the composer's manuscripts are observed. Analysis aspects of the work support the discussion about its initial reception and its role in the clarinet literature.

Dynamical basis for Koba-Nielsen-Olesen scaling and its violation

International Nuclear Information System (INIS)

Hinz, D.C.; Lam, C.S.

1986-01-01

We discuss a class of dynamical models motivated by Koba-Nielsen-Olesen (KNO) scaling and phase-space considerations. These modified phase-space models (MPSM's) generalize some of the existing models and provide them with a dynamical basis. Multiplicity distributions in MPSM's can be obtained by solving an appropriate evolution equation, from which kinematical KNO-scaling violations before the asymptotic scaling energy is reached can be calculated. Possible causes for dynamical KNO-scaling violations are also discussed

Love, literature and the quantum atom Niels Bohr's 1913 trilogy revisited

CERN Document Server

Aaserud, Finn

2013-01-01

Niels Bohr ranks with Einstein among the physicists of the 20th century. He rose to this status through his invention of the quantum theory of the atom and his leadership in its defense and development. He also ranks with Einstein in his humanism and his sense of responsibility to his science and the society that enabled him to create it. Our book presents unpublished excerpts from extensive correspondence between Bohr and his immediate family, and uses it to describe and analyze the psychological and cultural background to his invention. The book also contains a reprinting of the three papers of 1913 - the "Trilogy" - in which Bohr worked out the provisional basis of a quantum theory of the atom.

Gravity and absolute space. The works of Niels Bjern (1865-1909)

International Nuclear Information System (INIS)

Burlankov, Dmitrii E

2004-01-01

Nearly 20 years before Einstein, Niels Bjern developed a theory of gravity based on what is today known as the equivalence principle - but naturally without invoking the ideas of the special relativity theory. Bjern predicted almost all the effects considered to be tests for general relativity, his calculation formulas for the effects being identical to those of general relativity. An advocate of the absolute space concept, Bjern described the gravitational field in terms of the field of absolute velocities of an inertial space. He only used the ideas of general relativity to describe the precession of the perihelion of Mercury. The reason why Bjern's predictions and those of general relativity are identical is discussed. (from the history of physics)

CHR729 Is a CHD3 Protein That Controls Seedling Development in Rice.

Science.gov (United States)

Ma, Xiaoding; Ma, Jian; Zhai, Honghong; Xin, Peiyong; Chu, Jinfang; Qiao, Yongli; Han, Longzhi

2015-01-01

CHD3 is one of the chromatin-remodeling factors that contribute to controlling the expression of genes associated with plant development. Loss-of-function mutants display morphological and growth defects. However, the molecular mechanisms underlying CHD3 regulation of plant development remain unclear. In this study, a rice CHD3 protein, CHR729, was identified. The corresponding mutant line (t483) exhibited late seed germination, low germination rate, dwarfism, low tiller number, root growth inhibition, adaxial albino leaves, and short and narrow leaves. CHR729 encoded a nuclear protein and was expressed in almost all organs. RNA-sequencing analysis showed that several plant hormone-related genes were up- or down-regulated in t483 compared to wild type. In particular, expression of the gibberellin synthetase gibberellin 20 oxidase 4 gene was elevated in the mutant. Endogenous gibberellin assays demonstrated that the content of bioactive GA3 was reduced in t483 compared to wild type. Moreover, the seedling dwarfism, late seed germination, and short root length phenotypes of t483 were partially rescued by treatment with exogenous GA3. These results suggest that the rice CHD3 protein CHR729 plays an important role in many aspects of seedling development and controls this development via the gibberellin pathway.

CHR729 Is a CHD3 Protein That Controls Seedling Development in Rice.

Directory of Open Access Journals (Sweden)

Xiaoding Ma

Full Text Available CHD3 is one of the chromatin-remodeling factors that contribute to controlling the expression of genes associated with plant development. Loss-of-function mutants display morphological and growth defects. However, the molecular mechanisms underlying CHD3 regulation of plant development remain unclear. In this study, a rice CHD3 protein, CHR729, was identified. The corresponding mutant line (t483 exhibited late seed germination, low germination rate, dwarfism, low tiller number, root growth inhibition, adaxial albino leaves, and short and narrow leaves. CHR729 encoded a nuclear protein and was expressed in almost all organs. RNA-sequencing analysis showed that several plant hormone-related genes were up- or down-regulated in t483 compared to wild type. In particular, expression of the gibberellin synthetase gibberellin 20 oxidase 4 gene was elevated in the mutant. Endogenous gibberellin assays demonstrated that the content of bioactive GA3 was reduced in t483 compared to wild type. Moreover, the seedling dwarfism, late seed germination, and short root length phenotypes of t483 were partially rescued by treatment with exogenous GA3. These results suggest that the rice CHD3 protein CHR729 plays an important role in many aspects of seedling development and controls this development via the gibberellin pathway.

Lille magt, men stort imperium. Et bidrag til debatten om TV og medieimperialisme

Directory of Open Access Journals (Sweden)

Niels-Aage Nielsen

1987-08-01

Full Text Available Denne artikel tager fat i alt det svære - det begrebsmæssige - som vi enten springer over eller tager for givet i vores diskussioner af TV som magt- og påvirkningsfaktor. Derfor er den lang og til tider lidt omstændelig, idet den undgår at tage vores umiddelbare antagelser for pålydende. I stedet bliver de endevendt. I de seneste 15 års medieforskning har magten været implicit til stede et eller andet sted i TV. Vi har skiftevis kritiseret mediet, frygtet det, taget afstand fra det og er nu senest med receptionsteorierne blevet beroliget: Enhver TV-seer skaber ud fra sin egen sunde fornuft sin personlige opfattelse af "Dollars". Påvirkningen af hende er ikke længere producen- ternes eller medieforskernes eller Danmarks Radios ansvar, det er seerens eget. Medieimperialismen er dermed opløst, ihvertfald som undertrykkelsessystem. Det første kritikpunkt i Niels-Aage Nielsens diskussion er medie- imperialismeteorien. Den har ikke nogen teori om hvordan magten sætter sig igennem hævder han, idet den alene ved cirkler og pile focuserer på ensidigheden i "flow'et" fra USA med resten af verden som modtagere. Hvis det skal udtrykke en magtposition, må der være en relation mellem varestrømmene (basis og den ideologiske overbygning. Vi er vant til at antage, at denne relation findes, men hvordan sætter den sig igennem? Diskussion heraf er - i bedste fald - gået i stå. For at kunne gå videre her, tager Niels-Aage Nielsen et opgør med receptionsteoriens socialpsykologi og søger at afdække hvilken del af betydningsdannelsen, og dermed påvirkningen, som netop unddrager sig en receptionsanalyse, der bygger på seerens egne udsagn og uden f.eks. en psykoanalytisk tilgang. Betydningsproblemet skal endda diskuteres endnu mere pricipielt: Vi er i dag mindre enige end nogensinde om hvad der er TV's samfunds- mæssige funkitioner. Uklarheden hænger bl.a. sammen med at ideologi- begrebet gradvist forsvandt ud af medieforskningens hovedst

Synthesis and spectroscopic studies of silver and rhodium mono- and polynuclear complexes with multidentate phosphines (Ph2P)2CHR (R = H, Me, PPh2)

NARCIS (Netherlands)

Koten, G. van; Ploeg, A.F.M.J. van der

1981-01-01

Trinuclear [{(Ph{2}P){3}CH}Ag{3}(O{2}CR'){3}], dinuclear [{(Ph{2}P){2}CHR}Ag{2}(O{2}CR'){2}], [{(Ph{2}P){2}CHR}{2}Ag{2}](BF{4}){2} and (Rh{2}(Cl)(CO){2}{(Ph{2}P){2}CHMe}{2}][RhCl{2}(CO){2}], and mononuclear (Rh{(Ph{2}P){2}CHR}{2}](BF{4}), (Rh{(Ph{2}P){2}CHR}{2}HCl](BF{4}), d

Baltika muudab CHR/Evermeni kaubamärgi Mosaiciks / Anneli Lepp

Index Scriptorium Estoniae

Lepp, Anneli

2006-01-01

Ilmunud ka: Postimees : na russkom jazõke 15. veebr. lk. 7. Baltika muudab rõivamärgi CHR/Everman nime Mosaiciks, et anda viimastel aastatel kõige kiiremini kasvanud poeketile ühtne identiteet ja kergem kirjapilt, mis võimaldaks ka välisturul edukamalt läbi lüüa. Lisa: Baltika uus kaubamärk Mosaic

Audiovisual work- Interview with Niels Thygesen, Copenhagen 9 April 2016 (Lenght 02:35:03)

OpenAIRE

Danescu, Elena; Klein, Francois; Thygesen, Niels

2017-01-01

In the framework of the research project "Pierre Werner and Europe, Interview with Niels Thygesen, Professor of Economics at the University of Copenhagen from 1964 to 1969 and from 1971 to 2004, Adviser to the Governor of the Danmarks Nationalbank from 1973 to 1983 and a member of the Delors Committee set up to study and propose practical steps that would lead to the gradual establishment of Economic and Monetary Union (EMU) from 1988 to 1989, carried out by the Centre Virtuel de la Connaissa...

Editors’ Introduction: The life and work of Jørgen S. Nielsen

DEFF Research Database (Denmark)

Vinding, Niels Valdemar

2018-01-01

In September 2016, Jørgen S. Nielsen celebrated his 70th birthday. The articles in the present volume are collected in expectation of that joyous occasion. As often is in academia, it is only now that we have been able to gather and publish all the contributions from friends and colleagues. As wi...... they indeed echo the themes and curiosity in Jørgen S. Nielsen’s own exploration of the multitude of Muslims in Europe....

Gewaltenteilung im Rechsstaat und europäische Geschichte. 3 : Vorträge am Staatsgerichtshof und am Historischen Seminar der Universität Tartu (Dorpat)/Estland / Ingo von Münch, Niels von Redecker ; Forum Academicum Inter Nationes ; Roela Uemõisa

Index Scriptorium Estoniae

Münch, Ingo von

1998-01-01

Sisaldab: Die Gewaltenteilung im Rechtstaat = Võimude lahususe printsiip õigusriigis / Ingo von Münch ; Can we have a European history / Niels von Redecker ; The Ostpolitik of Willy Brandt / Niels von Redecker

Lie symmetry and the generalized Hojman conserved quantity of Nielsen equations for a variable mass holonomic system of relative motion

International Nuclear Information System (INIS)

Zhang Mei-Ling; Wang Xiao-Xiao; Xie Yin-Li; Jia Li-Qun; Sun Xian-Ting

2011-01-01

Lie symmetry and the generalized Hojman conserved quantity of Nielsen equations for a variable mass holonomic system of relative motion are studied. The determining equation of Lie symmetry of Nielsen equations for a variable mass holonomic system of relative motion under the infinitesimal transformations of groups is given. The expression of generalized Hojman conserved quantity deduced directly from Lie symmetry for a variable mass holonomic system of relative motion is obtained. An example is given to illustrate the application of the results. (general)

GAME STUDIES ENCONTRAM JOGOS PARA SAÚDE: Uma entrevista com Espen Aarseth e Rune Nielsen

Directory of Open Access Journals (Sweden)

Luiz Adolfo Andrade

2018-06-01

Full Text Available Os pesquisadores do Centro para Pesquisas em Jogos de Computador da IT – Universidade de Copenhagen, Espen Aarseth e Rune Nielsen, discutem nesta entrevista a relação entre jogos e cuidados com a saúde.

A Genome-wide Association Study Provides Evidence of Sex-specific Involvement of Chr1p35.1 (ZSCAN20-TLR12P and Chr8p23.1 (HMGB1P46 With Diabetic Neuropathic Pain

Directory of Open Access Journals (Sweden)

Weihua Meng

2015-10-01

Full Text Available Neuropathic pain is defined as pain arising as a direct consequence of a lesion or a disease affecting the somatosensory system and it affects around 1 in 4 diabetic patients in the UK. The purpose of this genome-wide association study (GWAS was to identify genetic contributors to this disorder. Cases of neuropathic pain were defined as diabetic patients with a multiple prescription history of at least one of five drugs specifically indicated for the treatment of neuropathic pain. Controls were diabetic individuals who were not prescribed any of these drugs, nor amitriptyline, carbamazepine, or nortriptyline. Overall, 961 diabetic neuropathic pain cases and 3260 diabetic controls in the Genetics of Diabetes Audit and Research Tayside (GoDARTS cohort were identified. We found a cluster in the Chr1p35.1 (ZSCAN20-TLR12P with a lowest P value of 2.74 × 10−7 at rs71647933 in females and a cluster in the Chr8p23.1, next to HMGB1P46 with a lowest P value of 8.02 × 10−7 at rs6986153 in males. Sex-specific narrow sense heritability was higher in males (30.0% than in females (14.7%. This GWAS on diabetic neuropathic pain provides evidence for the sex-specific involvement of Chr1p35.1 (ZSCAN20-TLR12P and Chr8p23.1 (HMGB1P46 with the disorder, indicating the need for further research.

Quantum field theory with infinite component local fields as an alternative to the string theories

Science.gov (United States)

Krasnikov, N. V.

1987-09-01

We show that the introduction of the infinite component local fields with higher-order derivatives in the interaction makes the theory completely ultraviolet finite. For the γ5-anomalous theories the introduction of the infinite component field makes the theory renormalizable or even superrenormalizable. I am indebted to J. Ambjōrn, P. Di Vecchia, H.B. Nielsen and L. Rozhansky for useful discussions. It is a pleasure to thank the Niels Bohr Institute (Copenhagen) where this work was completed for kind hospitality.

Creation and annihilation operators for Nielsen-Olesen vortices in the coherent state approximation

International Nuclear Information System (INIS)

Pottinger, D.E.L.

1978-01-01

Using the standard techniques of canonical quantization, the author constructs approximate expressions for the creation and annihilation operators for Nielsen-Olesen vortices. The forms for the creation and annihilation operators are appropriate to situations where large-scale vortex condensation takes place. In particular, a phenomenon such as this is basic in the quark confinement schemes of Mandelstam and 't Hooft. (Auth.)

Il danese tranquillo Niels Bohr, un fisico e il suo tempo, 1885-1962

CERN Document Server

Pais, Abraham

1993-01-01

Niels Bohr è una figura centrale nella fisica del Novecento, padre fondatore della teoria atomica e della meccanica quantistica. La storia della sua vita, ricca e piena anche sul piano affettivo e personale, non può dunque ridursi a un resoconto dei suoi successi scientifici e Pais, allievo e poi amico di Bohr, ne è perfettamente consapevole. Il libro si sviluppa su vari piani: capitoli strettamente biografici o storico-scientifici si alternano a discussioni sulle idee di Bohr in campo politico e filosofico, sui suoi rapporti con Einstein, sul suo ruolo nei drammatici anni della guerra e su molti altri aspetti della vicenda umana.

Froggatt-Nielsen models from E8 in F-theory GUTs

CERN Document Server

Dudas, Emilian; 10.1007

2009-01-01

This paper studies F-theory SU(5) GUT models where the three generations of the standard model come from three different curves. All the matter is taken to come from curves intersecting at a point of enhanced E8 gauge symmetry. Giving a vev to some of the GUT singlets naturally implements a Froggatt-Nielsen approach to flavour structure. A scan is performed over all possible models and the results are filtered using phenomenological constraints. We find a unique model that fits observations of quark and lepton masses and mixing well. This model suffers from two drawbacks: R-parity must be imposed by hand and there is a doublet-triplet splitting problem.

Transverse momentum distribution in the Nielsen-Olesen model

Energy Technology Data Exchange (ETDEWEB)

Sakai, S [Tokyo Univ. of Education (Japan). Dept. of Physics

1976-05-01

The power dependence in the inclusive ksub(T)-distribution in the large ksub(T)-region is derived in the extended hadron model of Nielsen and Olesen without relying upon hard scattering of hadron constituents. The ksub(T)-dependence behaves like -- -ln ksub(T) when ksub(T) is small, then it becomes exp(-..gamma..ksub(T)) in the medium ksub(T) region (ksub(T)<=1.5(GeV/c)), and further it changes to behave like (ksub(T))sup(-n(ksub(T)), when ksub(T) becomes much larger. Our ksub(T)-dependence is consistent with the experimental data. This ksub(T)-distribution is derived by the strong repulsive force between two vortex lines (identified as hadron). This repulsive force is caused by the pressure of the spontaneously broken vacuum state which is necessary to confine the vector field. Our model on the ksub(T)-distribution is very analogous to the production of massive resonances and their successive decay.

Hamiltonian quantization of self-dual tensor fields and a bosonic Nielsen-Ninomiya theorem

International Nuclear Information System (INIS)

Tang Waikeung

1989-01-01

The quantization of self-dual tensor fields is carried out following the procedure of Batalin and Fradkin. The (anti) self-duality constraints (either fermionic or bosonic) in the action leads to the gravitational anomaly. In the process of gauge fixing, the impossibility of the co-existence of a positive hamiltonian and covariant action is shown. A version of the Nielsen-Ninomiya theorem applies to self-dual tensor fields viz. the lattice version of the theory shows species doubling with zero net chirality. (orig.)

The bishop and anatomist Niels Stensen (1638-1686) and his contributions to our early understanding of the brain.

Science.gov (United States)

Tubbs, R Shane; Mortazavi, Martin M; Shoja, Mohammadali M; Loukas, Marios; Cohen-Gadol, Aaron A

2011-01-01

Many physicians are familiar with the parotid duct and the Danish physician/anatomist's name associated with it. However, most are unaware of Niels Stensen's life and his significant contributions to the early study of the brain. This physician of the Medici court was clearly ahead of his time and found errors in the publications of such giants as Varolius and Willis. The present review discusses the life of this seventeenth century anatomist, physician, and priest/bishop and highlights his contributions to neuroanatomy.

D branes in background fluxes and Nielsen-Olesen instabilities

International Nuclear Information System (INIS)

Russo, Jorge G.

2016-01-01

In quantum field theory, charged particles with spin ≥1 may become tachyonic in the present of magnetic fluxes above some critical field, signaling an instability of the vacuum. The phenomenon is generic, in particular, similar instabilities are known to exist in open and closed string theory, where a spinning string state can become tachyonic above a critical field. In compactifications involving RR fluxes F_p_+_2, the quantum states which could become tachyonic by the same Nielsen-Olesen mechanism are Dp branes. By constructing an appropriate background with RR magnetic flux that takes into account back-reaction, we identify the possible tachyonic Dp brane states and compute the formula for the energy spectrum in a sector. More generally, we argue that in any background RR magnetic flux, there are high spin Dp quantum states which become very light at critical fields.

D branes in background fluxes and Nielsen-Olesen instabilities

Energy Technology Data Exchange (ETDEWEB)

Russo, Jorge G. [Institució Catalana de Recerca i Estudis Avançats (ICREA),Pg. Lluis Companys, 23, 08010 Barcelona (Spain); Department de Fisica Cuantica i Astrofisica and Institut de Ciències del Cosmos,Universitat de Barcelona, Martí Franquès, 1, 08028 Barcelona (Spain)

2016-06-06

In quantum field theory, charged particles with spin ≥1 may become tachyonic in the present of magnetic fluxes above some critical field, signaling an instability of the vacuum. The phenomenon is generic, in particular, similar instabilities are known to exist in open and closed string theory, where a spinning string state can become tachyonic above a critical field. In compactifications involving RR fluxes F{sub p+2}, the quantum states which could become tachyonic by the same Nielsen-Olesen mechanism are Dp branes. By constructing an appropriate background with RR magnetic flux that takes into account back-reaction, we identify the possible tachyonic Dp brane states and compute the formula for the energy spectrum in a sector. More generally, we argue that in any background RR magnetic flux, there are high spin Dp quantum states which become very light at critical fields.

Los orígenes del grial en la literatura medieval: de Chrétien de Troyes a Robert de Boron

Directory of Open Access Journals (Sweden)

Mario Martín Botero

2010-12-01

Full Text Available Este artículo muestra el origen literario del tema del Grial en la literatura medieval francesa, abordando dos textos esenciales para el surgimiento y consolidación de la “literatura del Grial”: Le Conte du Graal de Chrétien de Troyes y Le Roman de l’Estoire dou Graal de Robert de Boron. Los autores de estas obras establecen las bases para el desarrollo de toda una temática que gira alrededor del Grial a partir del siglo XII hasta nuestros días. El artículo muestra cómo de un objeto apenas sagrado en el texto de Chrétien de Troyes se pasa a una reliquia de la sangre de Cristo en la versión de Robert de Boron.This paper studies the literary origin of the Grail legend in medieval French literature, taking into account two important romances: Le Conte du Graal by Chrétien de Troyes and Le Roman de l’Estoire dou Graal by Robert de Boron. In these two texts the authors established the basis for the development of a new subject matter around the mysterious object called “Grail” from the Middle Ages to the present times. It will also be shown how an object, not totally sacred in Chrétien de Troyes, becomes a relic related with Jesus’s blood in Robert de Boron.

Niels Bohr collected works, volume 9: Nuclear physics (1929-1952)

International Nuclear Information System (INIS)

Peierls, R.

1985-01-01

This volume deals with Bohr's work on nuclear physics which began in the pre-1932 days with his thinking deeply, but inconclusively about the seeming contradictions then presented by the evidence about the nucleus. In 1936 Bohr recognized and described the insights provided by neutron scattering experiments and the excitement of this new understanding and its extension and consolidation occupied much of the subsequent years. In 1939 he was again first in understanding the essential features of the newly discovered phenomenon of fission, applying successfully the point of view of nuclear reactions which he had developed over the past three years. Later, in 1949-50, he was impressed by the success of the nuclear shell model, which on the face of it seemed hard to reconcile with the picture of the closely interacting nucleons which he had pioneered in 1936 and he put much effort into clarifying this paradox. As in earlier volumes the published papers are supported by appropriate selections from unpublished notes and drafts, and by relevant correspondence. CONTENTS: Foreword. Part I: Papers and Manuscripts Related to Nuclear Physics. Part II: Selected Correspondence (1929-1949). Inventory of Relevant Manuscripts in the Niels Bohr Archive. Index

Standard model and fine structure constant at Planck distances in the Bennett-Brene-Nielsen-Picek random dynamics

International Nuclear Information System (INIS)

Laperashvili, L.V.

1994-01-01

The first part of the present paper contains a review of papers by Nielsen, Bennett, Brene and Picek which underly the model called random dynamics. The second part of the paper is devoted to calculating the fine structure constant by means of the path integration in the U(1)-lattice gauge theory

Improving the Yule-Nielsen modified Neugebauer model by dot surface coverages depending on the ink superposition conditions

Science.gov (United States)

Hersch, Roger David; Crete, Frederique

2005-01-01

Dot gain is different when dots are printed alone, printed in superposition with one ink or printed in superposition with two inks. In addition, the dot gain may also differ depending on which solid ink the considered halftone layer is superposed. In a previous research project, we developed a model for computing the effective surface coverage of a dot according to its superposition conditions. In the present contribution, we improve the Yule-Nielsen modified Neugebauer model by integrating into it our effective dot surface coverage computation model. Calibration of the reproduction curves mapping nominal to effective surface coverages in every superposition condition is carried out by fitting effective dot surfaces which minimize the sum of square differences between the measured reflection density spectra and reflection density spectra predicted according to the Yule-Nielsen modified Neugebauer model. In order to predict the reflection spectrum of a patch, its known nominal surface coverage values are converted into effective coverage values by weighting the contributions from different reproduction curves according to the weights of the contributing superposition conditions. We analyze the colorimetric prediction improvement brought by our extended dot surface coverage model for clustered-dot offset prints, thermal transfer prints and ink-jet prints. The color differences induced by the differences between measured reflection spectra and reflection spectra predicted according to the new dot surface estimation model are quantified on 729 different cyan, magenta, yellow patches covering the full color gamut. As a reference, these differences are also computed for the classical Yule-Nielsen modified spectral Neugebauer model incorporating a single halftone reproduction curve for each ink. Taking into account dot surface coverages according to different superposition conditions considerably improves the predictions of the Yule-Nielsen modified Neugebauer model. In

Recessive cardiac phenotypes in induced pluripotent stem cell models of Jervell and Lange-Nielsen syndrome: disease mechanisms and pharmacological rescue

NARCIS (Netherlands)

Zhang, Miao; D'Aniello, Cristina; Verkerk, Arie O.; Wrobel, Eva; Frank, Stefan; Ward-van Oostwaard, Dorien; Piccini, Ilaria; Freund, Christian; Rao, Jyoti; Seebohm, Guiscard; Atsma, Douwe E.; Schulze-Bahr, Eric; Mummery, Christine L.; Greber, Boris; Bellin, Milena

2014-01-01

Jervell and Lange-Nielsen syndrome (JLNS) is one of the most severe life-threatening cardiac arrhythmias. Patients display delayed cardiac repolarization, associated high risk of sudden death due to ventricular tachycardia, and congenital bilateral deafness. In contrast to the autosomal dominant

Flavor cosmology. Dynamical Yukawas in the Froggatt-Nielsen mechanism

Energy Technology Data Exchange (ETDEWEB)

Baldes, Iason; Konstandin, Thomas [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Servant, Geraldine [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik

2016-12-02

Can the cosmological dynamics responsible for settling down the present values of the Cabibbo-Kobayashi-Maskawa matrix be related to electroweak symmetry breaking? If the Standard Model Yukawa couplings varied in the early universe and started with order one values before electroweak symmetry breaking, the CP violation associated with the CKM matrix could be the origin of the matter-antimatter asymmetry. The large effective Yukawa couplings which lead to the enhanced CP violation can also help in achieving a strong first-order electroweak phase transition. We study in detail the feasibility of this idea by implementing dynamical Yukawa couplings in the context of the Froggatt-Nielsen mechanism. We discuss two main realizations of such a mechanism, related phenomenology, cosmological and collider bounds, and provide an estimate of the baryonic yield. A generic prediction is that this scenario always features a new scalar field below the electroweak scale. We point out ways to get around this conclusion.

Flavor cosmology: dynamical yukawas in the Froggatt-Nielsen mechanism

Energy Technology Data Exchange (ETDEWEB)

Baldes, Iason; Konstandin, Thomas [DESY,Notkestraße 85, Hamburg, D-22607 (Germany); Servant, Géraldine [DESY,Notkestraße 85, Hamburg, D-22607 (Germany); II. Institute for Theoretical Physics, University of Hamburg,Luruper Chaussee 149, Hamburg, D-22761 (Germany)

2016-12-15

Can the cosmological dynamics responsible for settling down the present values of the Cabibbo-Kobayashi-Maskawa matrix be related to electroweak symmetry breaking? If the Standard Model Yukawa couplings varied in the early universe and started with order one values before electroweak symmetry breaking, the CP violation associated with the CKM matrix could be the origin of the matter-antimatter asymmetry. The large effective Yukawa couplings which lead to the enhanced CP violation can also help in achieving a strong first-order electroweak phase transition. We study in detail the feasibility of this idea by implementing dynamical Yukawa couplings in the context of the Froggatt-Nielsen mechanism. We discuss two main realizations of such a mechanism, related phenomenology, cosmological and collider bounds, and provide an estimate of the baryonic yield. A generic prediction is that this scenario always features a new scalar field below the electroweak scale. We point out ways to get around this conclusion.

Erik Rasmussen, Niels Bohr og Værdirelativismen - i anledning af Kasper Lippert-Rasmussens bog om Erik Rasmussen

DEFF Research Database (Denmark)

Ougaard, Morten

2015-01-01

En svaghed ved Kasper Lippert-Rasmussens i øvrigt udmærkede bog om Erik Rasmussen er, at den forbigår den sene Rasmussens bog om komplementaritet og statskundskab. Bogen var vigtig for Rasmussen, og den bør indgå i hans faglige eftermæle. Den rummer videnskabsteoretiske argumenter af stor relevans...... ikke mindst forholdet mellem normative og kognitive udsagn. Efter mødet med Niels Bohrs filosofi står Rasmussens værdirelativisme både skarpere og stærkere end før, og Kasper Lippert-Rasmussens karakteristik af denne position som et ubegrundet dogme i dansk politologi er ikke overbevisende....

The Nielsen identities for the two-point functions of QED and QCD

International Nuclear Information System (INIS)

Breckenridge, J.C.; Sasketchewan Univ., Saskatoon, SK; Lavelle, M.J.; Steele, T.G.; Sasketchewan Univ., Saskatoon, SK

1995-01-01

We consider the Nielsen identities for the two-point functions of full QCD and QED in the class of Lorentz gauges. For pedagogical reasons the identities are first derived in QED to demonstrate the gauge independence of the photon self-energy, and of the electron mass shell. In QCD we derive the general identity and hence the identities for the quark, gluon and ghost propagators. The explicit contributions to the gluon and ghost identities are calculated to one-loop order, and then we show that the quark identity requires that in on-shell schemes the quark mass renormalisation must be gauge independent. Furthermore, we obtain formal solutions for the gluon self-energy and ghost propagator in terms of the gauge dependence of other, independent Green functions. (orig.)

Niels Stensen: a 17th century scientist with a modern view of brain organization.

Science.gov (United States)

Parent, André

2013-07-01

In 1665 the Danish scholar Niels Stensen (1638-1686) reached Paris, where he pronounced a discourse on brain anatomy that was to orient neuroscientists for years to come. In his lecture, Stensen rejected ancient speculations about animal spirits and criticized René Descartes and his followers who, despite a poor knowledge of brain anatomy, elaborated complex models to explain the multifaceted function of what he considered the principal organ of the human mind. He advocated the need for studying the brain through a comparative, developmental and pathological convergent approach and called for appropriate dissection methods and accurate illustrations. His own careful anatomical studies permitted him to precisely depict many brain structures. After pioneering works in paleontology and geology, he devoted himself to theology. In 1677 Stensen converted from Lutheranism to Catholicism and, while working relentlessly as a bishop and apostolic vicar in Northern Europe, he died in self-imposed poverty at age 48.

Anatomy of a reindeer dissected in Copenhagen in 1672 by Niels Stensen as reported by Thomas Bartholin. I. Introduction by Troels Kardel. II. Translation by Paul Maquet

Directory of Open Access Journals (Sweden)

Troels Kardel

2013-03-01

Full Text Available A report by Professor Thomas Bartholin on the dissection of a reindeer performed in 1672 by his former student Niels Stensen as Royal Anatomist in Copenhagen is presented in English translation with biographical introduction and bibliographical notes. The report is most likely the first of its kind being an early contribution to comparative anatomy.

Anomaly-free discrete gauge symmetries in Froggatt-Nielsen models

International Nuclear Information System (INIS)

Luhn, C.

2006-05-01

Discrete symmetries (DS) can forbid dangerous B- and L-violating operators in the supersymmetric Lagrangian. Due to the violation of global DSs by quantum gravity effects, the introduced DS should be a remnant of a spontaneously broken local gauge symmetry. Demanding anomaly freedom of the high-energy gauge theory, we determine all family-independent anomaly-free Z N symmetries which are consistent with the trilinear MSSM superpotential terms in Part I. We find one outstanding Z 6 symmetry, proton hexality P 6 , which prohibits all B- and L-violating operators up to dimension five, except for the Majorana neutrino mass terms LH u LH u . In Part II, we combine the idea that a DS should have a gauge origin with the scenario of Froggatt and Nielsen (FN). We construct concise U(1) X FN models in which the Z 3 symmetry baryon triality, B 3 , arises from U(1) X breaking. We choose this specific DGS because it allows for R-parity violating interactions; thus neutrino masses can be explained without introducing right-handed neutrinos. We find six phenomenologically viable B 3 -conserving FN models. (orig.)

Anomaly-free discrete gauge symmetries in Froggatt-Nielsen models

Energy Technology Data Exchange (ETDEWEB)

Luhn, C.

2006-05-15

Discrete symmetries (DS) can forbid dangerous B- and L-violating operators in the supersymmetric Lagrangian. Due to the violation of global DSs by quantum gravity effects, the introduced DS should be a remnant of a spontaneously broken local gauge symmetry. Demanding anomaly freedom of the high-energy gauge theory, we determine all family-independent anomaly-free Z{sub N} symmetries which are consistent with the trilinear MSSM superpotential terms in Part I. We find one outstanding Z{sub 6} symmetry, proton hexality P{sub 6}, which prohibits all B- and L-violating operators up to dimension five, except for the Majorana neutrino mass terms LH{sub u}LH{sub u}. In Part II, we combine the idea that a DS should have a gauge origin with the scenario of Froggatt and Nielsen (FN). We construct concise U(1){sub X} FN models in which the Z{sub 3} symmetry baryon triality, B{sub 3}, arises from U(1){sub X} breaking. We choose this specific DGS because it allows for R-parity violating interactions; thus neutrino masses can be explained without introducing right-handed neutrinos. We find six phenomenologically viable B{sub 3}-conserving FN models. (orig.)

Jeux et enjeux d’écriture chez Chrétien de Troyes: l’exemple de «Cligès»

Directory of Open Access Journals (Sweden)

Ida Lucia Machado

2011-10-01

Full Text Available Neste artigo, nos propomos descrever a estética da trama irônica presente na escritura de Chrétien de Troyes, tomando por base seu romance Cligès. A destacar algumas estratégias passíveis de criar o fenômeno irônico, estaremos também mostrando o poder de sedução que emana desta escritura.Nous nous proposons, dans cet artible, de décrire l’esthétique du jeu ironique chez Chrétien de Troyes, em puisant dans son roman Cligès. Enn dégageant qulques unes dês stratégies susceptibles de créer le phénomène ironique, nous montrerons, à la fois, le pouvoir de séduction qui emane de cette écriture.

El pabellón Niels Bohr. Tradición Danesa y Modernidad

Directory of Open Access Journals (Sweden)

Carmen García Sánchez

2015-12-01

Full Text Available La casa de invitados de Niels Bohr fue el primer edificio del arquitecto danés Vilhelm Wohlert (1920-2007. Arraigado a la tradición danesa, representa una renovación basada en la absorción de influencias extranjeras: la arquitectura americana y la tradición japonesa. La caja de madera tiene el carácter sensible de un organismo vivo, siempre cambiante según las variaciones de luz del día o temperatura. Puertas plegables y contraventanas generan extensiones de las habitaciones. Cuando se abren, crean una prolongación del espacio interior, que se extiende a la naturaleza circundante, y se expande hacia el espacio exterior, permitiendo su movilización. Se establece una arquitectura de flujos. Protagoniza un ejemplo de la modernidad como refinamiento en la técnica de los límites y la idea de que la arquitectura no es un objeto material, sino el espacio generado en su interior. Podría ser visto como un ikebana; “el arte del espacio”, donde se produce una circulación de aire entre sus componentes; algo vivo que expresa la tercera dimensión, el equilibrio asimétrico, un interés por la materia, su textura y efecto emocional que emana. Hay armonía y equilibrio, que transmiten serenidad y belleza; un encuentro con la naturaleza; un mundo de relaciones amable al ser humano.

Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148

NARCIS (Netherlands)

Fang, Jun; Jia, Jinping; Makowski, Matthew; Xu, Mai; Wang, Zhaoming; Zhang, Tongwu; Hoskins, Jason W; Choi, Jiyeon; Han, Younghun; Zhang, Mingfeng; Thomas, Janelle; Kovacs, Michael; Collins, Irene; Dzyadyk, Marta; Thompson, Abbey; O'Neill, Maura; Das, Sudipto; Lan, Qi; Koster, Roelof; Stolzenberg-Solomon, Rachael S; Kraft, Peter; Wolpin, Brian M; Jansen, Pascal W T C; Olson, Sara H; McGlynn, Katherine A; Kanetsky, Peter A; Chatterjee, Nilanjan; Barrett, Jennifer H.; Dunning, Alison M.; Taylor, John C.; Newton-Bishop, Julia A; Bishop, D. Timothy; Andresson, Thorkell; Petersen, Gloria M; Amos, Christopher I; Iles, Mark M.; Nathanson, Katherine L.; Landi, Maria Teresa; Vermeulen, Michiel; Brown, Kevin M; Amundadottir, Laufey T; Peeters, P

2017-01-01

Genome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of these,

Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148

NARCIS (Netherlands)

Fang, J. (Jun); Jia, J. (Jinping); Makowski, M. (Matthew); Xu, M. (Mai); Z. Wang (Zhaoming); Zhang, T. (Tongwu); Hoskins, J.W. (Jason W.); Choi, J. (Jiyeon); Han, Y. (Younghun); M. Zhang (Mingfeng); Thomas, J. (Janelle); Kovacs, M. (Michael); Collins, I. (Irene); Dzyadyk, M. (Marta); Thompson, A. (Abbey); O'Neill, M. (Maura); Das, S. (Sudipto); Lan, Q. (Qi); Koster, R. (Roelof); Stolzenberg-Solomon, R.S. (Rachael S.); P. Kraft (Peter); Wolpin, B.M. (Brian M.); P. Jansen; Olson, S. (Sara); K.A. McGlynn; P.P. Kanetsky (Peter P.); N. Chatterjee (Nilanjan); J.H. Barrett (Jennifer H.); A.M. Dunning (Alison); Taylor, J.C. (John C.); J.A. Newton Bishop (Julia); Timothy Bishop, D. (D.); Andresson, T. (Thorkell); Petersen, G.M. (Gloria M.); W. Amos; M.M. Iles (Mark M.); K.L. Nathanson (Katherine); Landi, M.T. (Maria Teresa); M. Vermeulen (Michiel); Brown, K.M. (Kevin M.); Amundadottir, L.T. (Laufey T.)

2017-01-01

textabstractGenome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of

Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148.

NARCIS (Netherlands)

Fang, Jun; Jia, Jinping; Makowski, Matthew; Xu, Mai; Wang, Zhaoming; Zhang, Tongwu; Hoskins, Jason W; Choi, Jiyeon; Han, Younghun; Zhang, Mingfeng; Thomas, Janelle; Kovacs, Michael; Collins, Irene; Dzyadyk, Marta; Thompson, Abbey; O'Neill, Maura; Das, Sudipto; Lan, Qi; Koster, Roelof; Stolzenberg-Solomon, Rachael S; Kraft, Peter; Wolpin, Brian M; Jansen, Pascal W T C; Olson, Sara; McGlynn, Katherine A; Kanetsky, Peter A; Chatterjee, Nilanjan; Barrett, Jennifer H; Dunning, Alison M; Taylor, John C; Newton-Bishop, Julia A; Bishop, D Timothy; Andresson, Thorkell; Petersen, Gloria M; Amos, Christopher I; Iles, Mark M; Nathanson, Katherine L; Landi, Maria Teresa; Vermeulen, Michiel; Brown, Kevin M; Amundadottir, Laufey T

2017-01-01

Genome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of these,

Implementation and Analysis of the Chromakey Augmented Virtual Environment (ChrAVE) Version 3.0 and Virtual Environment Helicopter (VEHELO) Version 2.0 in Simulated Helicopter Training

National Research Council Canada - National Science Library

Hahn, M. E

2005-01-01

The Chromakey Augmented Virtual Environment (ChrAVE) 3.0 System is a training system created to augment initial, refresher, and proficiency training in helicopter aviation using accurate simulation...

La cinéphilie chrétienne : Amédée Ayfre (1922-1964), sulpicien et critique de cinéma1

OpenAIRE

Rocher, Philippe

2012-01-01

Prêtre français de saint Sulpice et chrétien cinéphile, Amédée Ayfre a défendu l’esthétique et le réalisme cinématographiques contre le cinéma religieux du « Cinéma catholique ». Le « réalisme cinématographique » est un instrument de révélation chrétienne du Prochain. Brusquement décédé, Amédée Ayfre n’a pas eu la possibilité de dépasser ses premiers « Jalons pour une théologie de l’image ». In the middle Twentieth century, Amédée Ayfre, French priest of the Society of saint Sulpice and Ch...

Da Chrétien de Troyes a Shakespeare («The tragedy of King Richard the Third», a. I, sc. 2

Directory of Open Access Journals (Sweden)

Alfonso D'Agostino

2015-07-01

Full Text Available L’articolo si propone di considerare le somiglianze fra alcune vicende antico-francesi (l’Yvain di Chrétien de Troyes e il fabliau anonimo De celle que se fist foutre sur la fosse son mari con una scena del Riccardo III di Shakespeare. Anche se non si può dire che il dramma inglese dipenda dai testi narrativi oitanici, esso sviluppa lo stesso motivo della vedova consolata e una serie di motivi secondarî, di immagini (il sangue, il diavolo, la seduzione e di espressioni letterarie in modo sintomaticamente affine. The paper aims to evaluate similarities between some Old-French narratives (Chrétien de Troyes’ Yvain and the anonymous fabliau De celle que se fist foutre sur la fosse son mari and a scene from Shakespeare’s Richard III. Although we cannot affirm that Shakespeare’s play derives from the French narratives, it develops the same theme of “comforted widow” along with a series of secondary themes, of images (the blood, the devil, the seduction and literary expressions in a symptomatically, very similar way.

Application of response surface methodology for rapid chrysene biodegradation by newly isolated marine-derived fungus Cochliobolus lunatus strain CHR4D.

Science.gov (United States)

Bhatt, Jwalant K; Ghevariya, Chirag M; Dudhagara, Dushyant R; Rajpara, Rahul K; Dave, Bharti P

2014-11-01

For the first time, Cochliobolus lunatus strain CHR4D, a marine-derived ascomycete fungus isolated from historically contaminated crude oil polluted shoreline of Alang-Sosiya ship-breaking yard, at Bhavnagar coast, Gujarat has been reported showing the rapid and enhanced biodegradation of chrysene, a four ringed high molecular weight (HMW) polycyclic aromatic hydrocarbon (PAH). Mineral Salt Broth (MSB) components such as ammonium tartrate and glucose along with chrysene, pH and trace metal solution have been successfully optimized by Response Surface Methodology (RSM) using central composite design (CCD). A validated, two-step optimization protocol has yielded a substantial 93.10% chrysene degradation on the 4(th) day, against unoptimized 56.37% degradation on the 14(th) day. The results depict 1.65 fold increase in chrysene degradation and 1.40 fold increase in biomass with a considerable decrement in time. Based on the successful laboratory experiments, C. lunatus strain CHR4D can thus be predicted as a potential candidate for mycoremediation of HMW PAHs impacted environments.

Width and partial widths of unstable particles in the light of the Nielsen identities

International Nuclear Information System (INIS)

Grassi, P.A.; Sirlin, A.; Kniehl, B.A.; Hamburg Univ.

2001-09-01

Fundamental properties of unstable particles, including mass, width, and partial widths, are examined on the basis of the Nielsen identities (NI) that describe the gauge dependence of Green functions. In particular, we prove that the pole residues and associated definitions of branching ratios and partial widths are gauge independent to all orders. A simpler, previously discussed definition of branching ratios and partial widths is found to be gauge independent through next-to-next-to-leading order. It is then explained how it may be modified in order to extend the gauge independence to all orders. We also show that the physical scattering amplitude is the most general combination of self-energy, vertex, and box contributions that is gauge independent for arbitrary s, discuss the analytical properties of the NI functions, and exhibit explicitly their one-loop expressions in the Z-γ sector of the Standard Model. (orig.)

Width and partial widths of unstable particles in the light of the Nielsen identities

International Nuclear Information System (INIS)

Grassi, Pietro A.; Kniehl, Bernd A.; Sirlin, Alberto

2002-01-01

Fundamental properties of unstable particles, including mass, width, and partial widths, are examined on the basis of the Nielsen identities (NI) that describe the gauge dependence of Green functions. In particular, we prove that the pole residues and associated definitions of branching ratios and partial widths are gauge independent to all orders. A simpler, previously discussed definition of branching ratios and partial widths is found to be gauge independent through next-to-next-to-leading order. It is then explained how it may be modified in order to extend the gauge independence to all orders. We also show that the physical scattering amplitude is the most general combination of self-energy, vertex, and box contributions that is gauge independent for arbitrary s, discuss the analytical properties of the NI functions, and exhibit explicitly their one-loop expressions in the Z-γ sector of the standard model

Når det er svært at være ung i DK

DEFF Research Database (Denmark)

Nielsen, Jens Christian; Sørensen, Niels Ulrik

Når det er svært at være ung i DK – viden og råd om unges trivsel og mistrivsel er afslutningen på et større forskningsprojekt om unges trivsel og mistrivsel. Hæftet præsenterer forskningsprojektets hovedkonklusioner og giver desuden en række råd og ideer til, hvordan voksne kan hjælpe unge med...... at håndtere mistrivsel. Hæftet er udarbejdet af forskerne Jens Christian Nielsen og Niels Ulrik Sørensen fra Center for Ungdomsforskning. Det er den sidste publikation i forskningsprojektet Når det er svært at være ung i DK, der fra 2008-2011 har belyst unges trivsel og mistrivsel. Projektet bygger både på en...

Paul Ehrenfest, Niels Bohr, and Albert Einstein: Colleagues and Friends

Science.gov (United States)

Klein, Martin J.

2010-09-01

In May 1918 Paul Ehrenfest received a monograph from Niels Bohr in which Bohr had used Ehrenfest's adiabatic principle as an essential assumption for understanding atomic structure. Ehrenfest responded by inviting Bohr, whom he had never met, to give a talk at a meeting in Leiden in late April 1919, which Bohr accepted; he lived with Ehrenfest, his mathematician wife Tatyana, and their young family for two weeks. Albert Einstein was unable to attend this meeting, but in October 1919 he visited his old friend Ehrenfest and his family in Leiden, where Ehrenfest told him how much he had enjoyed and profited from Bohr's visit. Einstein first met Bohr when Bohr gave a lecture in Berlin at the end of April 1920, and the two immediately proclaimed unbounded admiration for each other as physicists and as human beings. Ehrenfest hoped that he and they would meet at the Third Solvay Conference in Brussels in early April 1921, but his hope was unfulfilled. Einstein, the only physicist from Germany who was invited to it in this bitter postwar atmosphere, decided instead to accompany Chaim Weizmann on a trip to the United States to help raise money for the new Hebrew University in Jerusalem. Bohr became so overworked with the planning and construction of his new Institute for Theoretical Physics in Copenhagen that he could only draft the first part of his Solvay report and ask Ehrenfest to present it, which Ehrenfest agreed to do following the presentation of his own report. After recovering his strength, Bohr invited Ehrenfest to give a lecture in Copenhagen that fall, and Ehrenfest, battling his deep-seated self-doubts, spent three weeks in Copenhagen in December 1921 accompanied by his daughter Tanya and her future husband, the two Ehrenfests staying with the Bohrs in their apartment in Bohr's new Institute for Theoretical Physics. Immediately after leaving Copenhagen, Ehrenfest wrote to Einstein, telling him once again that Bohr was a prodigious physicist, and again

Des images et des paraboles : Niels Bohr et le discours descriptif en physique quantique

Directory of Open Access Journals (Sweden)

Ilias Yocaris

2011-01-01

Full Text Available Cette étude porte sur l’importance accordée aux images verbales dans le discours descriptif utilisé en mécanique quantique, et plus précisément sur la conception de la langue scientifique qui est celle de Niels Bohr (1885-1962 : en raison d’une série de considérations techniques, méthodologiques et épistémologiques que nous nous proposons d’analyser in extenso, Bohr considère effectivement que les phénomènes subatomiques ne peuvent être évoqués directement (sans référence au contexte observationnel, par le biais d’un langage dénotatif non figural, mais uniquement de manière métaphorique, détournée, ce qui réduit à ses yeux le discours descriptif des physiciens à « des images et des paraboles ». En examinant les textes de Bohr à la lumière d’un certain nombre de travaux épistémologiques, de commentaires et d’expérimentations auxquels ils ont donné lieu ultérieurement, nous nous proposons de décrire les implications conceptuelles d’une telle prise de position, qui constitue une vraie révolution sur le plan philosophique.

Du neuf dans les relations de l'Église orthodoxe avec les autres chrétiens

OpenAIRE

Famerée, Joseph

2015-01-01

Cette note évoque quatre réunions scientifiques (Athènes, Chambésy, Thessalonique, Iasi) qui, coup sur coup, de mai 2013 à mai 2014, ont permis à des Orthodoxes d’échanger avec d’autres chrétiens, catholiques notamment, sur des sujets théologiques et œcuméniques importants pour l’évolution des différentes Églises. Une nouvelle génération de théologiens orthodoxes se lève, osant parler librement à propos de leur Église et montrer l’écart entre l’Orthodoxie idéale et l’Orthodoxie réelle, spécia...

Merton's problem for an investor with a benchmark in a Barndorff-Nielsen and Shephard market.

Science.gov (United States)

Lennartsson, Jan; Lindberg, Carl

2015-01-01

To try to outperform an externally given benchmark with known weights is the most common equity mandate in the financial industry. For quantitative investors, this task is predominantly approached by optimizing their portfolios consecutively over short time horizons with one-period models. We seek in this paper to provide a theoretical justification to this practice when the underlying market is of Barndorff-Nielsen and Shephard type. This is done by verifying that an investor who seeks to maximize her expected terminal exponential utility of wealth in excess of her benchmark will in fact use an optimal portfolio equivalent to the one-period Markowitz mean-variance problem in continuum under the corresponding Black-Scholes market. Further, we can represent the solution to the optimization problem as in Feynman-Kac form. Hence, the problem, and its solution, is analogous to Merton's classical portfolio problem, with the main difference that Merton maximizes expected utility of terminal wealth, not wealth in excess of a benchmark.

Optimization of spectral printer modeling based on a modified cellular Yule-Nielsen spectral Neugebauer model.

Science.gov (United States)

Liu, Qiang; Wan, Xiaoxia; Xie, Dehong

2014-06-01

The study presented here optimizes several steps in the spectral printer modeling workflow based on a cellular Yule-Nielsen spectral Neugebauer (CYNSN) model. First, a printer subdividing method was developed that reduces the number of sub-models while maintaining the maximum device gamut. Second, the forward spectral prediction accuracy of the CYNSN model for each subspace of the printer was improved using back propagation artificial neural network (BPANN) estimated n values. Third, a sequential gamut judging method, which clearly reduced the complexity of the optimal sub-model and cell searching process during printer backward modeling, was proposed. After that, we further modified the use of the modeling color metric and comprehensively improved the spectral and perceptual accuracy of the spectral printer model. The experimental results show that the proposed optimization approaches provide obvious improvements in aspects of the modeling accuracy or efficiency for each of the corresponding steps, and an overall improvement of the optimized spectral printer modeling workflow was also demonstrated.

Ora et labora. Paradigmes du modèle monacal médiéval chez Chrétien de Troyes / Ora et labora. Paradigms of the Medieval Monastic Model in Chrétien de Troyes’s Work

Directory of Open Access Journals (Sweden)

Diana Gradu

2015-05-01

Full Text Available The medieval monachal model is marked out by the faith, by the power, by the morality. It is also shared between confidence and fear with regard to the power on the earth, but, certainly, all the clerks and the monks of the Middle Age know and assume the rule Redde Caesari quae sunt Cesaris and quae sunt Dei Deo. The medieval literature, the unfaithful mirror, is reflected in an incomplete and sometimes idealized way, the example of the hermit, but it constitutes in the essential source of its paradigm. I shall stop to Chrétien of Troyes and to its novels, they are the most glorious proof of the Renaissance of the 12th century.

Cochlear implantation in children with Jervell and Lange-Nielsen syndrome - a cautionary tale.

Science.gov (United States)

Broomfield, Stephen J; Bruce, Iain A; Henderson, Lise; Ramsden, Richard T; Green, Kevin M J

2012-08-01

Jervell and Lange-Nielsen (JLN) syndrome is a rare cause of congenital profound hearing loss associated with a prolonged QT interval on the electrocardiogram. Children presenting for cochlear implantation with this condition may be asymptomatic but are at risk of sudden death. SCREENING AND SUBSEQUENT: careful management is therefore required to ensure a successful outcome. We present our experience of cochlear implantation in children with JLN syndrome, including two who died unexpectedly, and suggest a protocol for management of such cases. Clinical presentation Four cases of cochlear implantation in JLN syndrome are described. None had any previous cardiological family history. Two were diagnosed pre-operatively but, despite appropriate management under a cardiologist, died from cardiac arrest; the first in the perioperative period following reimplantation for infection, and the second unrelated to his cochlear implant surgery. The other two patients were diagnosed only subsequent to their implantation and continue to use their implants successfully. These cases highlight the variation in presentation of JLN syndrome, and the spectrum of disease severity that exists. Our protocol stresses the importance of careful assessment and counselling of parents by an experienced implant team.

Surface coating of jeungjing wood (Paraserianthes Falcataria (L) NIELSEN) with acrylate resins by using radiation technique

International Nuclear Information System (INIS)

Suhariyono, Gatot

1998-01-01

An experiment on surface coating with acrylate resins has been done by using radiation technique to improve the quality and added value of jeunjing wood (Paraserianthes Falcataria (L) NIELSEN). Doses used in Electron Beam (BE) radiation were 20, 40, and 60 kGy. Epoxy acrylate and ester acrylate resins were used as coating materials after added with tripropylene glycol diacylate (TPGDA) monomer, 2,2-dimethyl-2hidroxy acetophenone (Darocur 1173) photoinitiator and talc as base coat. Top coat consists of este acrylate Setacure AM 548, after added with titanium dioxide OK 412 as additive respectively. Titanium dioxides in the mixture were varied at the concentration level of 0, 2, 4 and 6 % by weight. Conventional coating as comparison was carried out by using varnish as coating material. The results showed that the properties of film on jeunjing wood by EB curing are better than that of conventional one. (authors)

Le Mouvement républicain populaire (MRP : l’expérience singulière d’un parti d’inspiration démocrate chrétienne en République française (1944-1965

Directory of Open Access Journals (Sweden)

Isabelle Clavel

2016-05-01

Full Text Available En 1944, le Mouvement républicain populaire (MRP est créé par un groupe d’hommes et de femmes, apparenté à la famille démocrate-chrétienne. Dans le contexte de libération du territoire français, il s’agit pour ceux qui ont pris part aux mouvements de Résistance contre l’occupation nazie et le régime collaborateur de Vichy, de contribuer à la reconstruction du pays après le second conflit mondial. L’émergence de ce parti « d’inspiration chrétienne » constitue une nouveauté dans le paysage politique français. Jusqu’alors, aucun parti confessionnel n’était parvenu à peser électoralement au point de devenir l’un des principaux acteurs des gouvernements. Malgré une existence relativement brève de 1944 à 1965, cette trajectoire singulière permet d’étudier comment les catholiques, qui se reconnaissent dans la famille démocrate-chrétienne, ont achevé un processus d’acculturation au régime républicain, dont l’un des principes fondamentaux est la laïcité.

A Phase Ib dose-escalation study to evaluate safety and tolerability of the addition of the aminopeptidase inhibitor tosedostat (CHR-2797) to paclitaxel in patients with advanced solid tumours

NARCIS (Netherlands)

C.M.L. Herpen (Carla); F.A.L.M. Eskens (Ferry); M.J.A. de Jonge (Maja); I.M.E. Desar (Ingrid); L. Hooftman (Leon); E. Bone (Elisabeth); J.N.H. Timmerbonte (Johanna); J. Verweij (Jaap)

2010-01-01

textabstractBackground: This Phase Ib dose-escalating study investigated safety, maximum tolerated dose (MTD), dose-limiting toxicity (DLT), pharmacokinetics (PK) and clinical antitumour activity of tosedostat (CHR-2797), an orally bioavailable aminopeptidase inhibitor, in combination with

A Phase Ib dose-escalation study to evaluate safety and tolerability of the addition of the aminopeptidase inhibitor tosedostat (CHR-2797) to paclitaxel in patients with advanced solid tumours.

NARCIS (Netherlands)

Herpen, C.M.L. van; Eskens, F.A.; Jonge, M. de; Desar, I.M.E.; Hooftman, L.; Bone, E.A.; Timmer-Bonte, J.N.H.; Verweij, J.

2010-01-01

BACKGROUND: This Phase Ib dose-escalating study investigated safety, maximum tolerated dose (MTD), dose-limiting toxicity (DLT), pharmacokinetics (PK) and clinical antitumour activity of tosedostat (CHR-2797), an orally bioavailable aminopeptidase inhibitor, in combination with paclitaxel. METHODS:

Comprehensive fine mapping of chr12q12-14 and follow-up replication identify activin receptor 1B (ACVR1B) as a muscle strength gene

NARCIS (Netherlands)

Windelinckx, An; De Mars, Gunther; Huygens, Wim; Peeters, Maarten W.; Vincent, Barbara; Wijmenga, Cisca; Lambrechts, Diether; Delecluse, Christophe; Roth, Stephen M.; Metter, E. Jeffrey; Ferrucci, Luigi; Aerssens, Jeroen; Vlietinck, Robert; Beunen, Gaston P.; Thomis, Martine A.

Muscle strength is important in functional activities of daily living and the prevention of common pathologies. We describe the two-staged fine mapping of a previously identified linkage peak for knee strength on chr12q12-14. First, 209 tagSNPs in/around 74 prioritized genes were genotyped in 500

Aarhus Conference on Probability, Statistics and Their Applications : Celebrating the Scientific Achievements of Ole E. Barndorff-Nielsen

CERN Document Server

Stelzer, Robert; Thorbjørnsen, Steen; Veraart, Almut

2016-01-01

Collecting together twenty-three self-contained articles, this volume presents the current research of a number of renowned scientists in both probability theory and statistics as well as their various applications in economics, finance, the physics of wind-blown sand, queueing systems, risk assessment, turbulence and other areas. The contributions are dedicated to and inspired by the research of Ole E. Barndorff-Nielsen who, since the early 1960s, has been and continues to be a very active and influential researcher working on a wide range of important problems. The topics covered include, but are not limited to, econometrics, exponential families, Lévy processes and infinitely divisible distributions, limit theory, mathematical finance, random matrices, risk assessment, statistical inference for stochastic processes, stochastic analysis and optimal control, time series, and turbulence. The book will be of interest to researchers and graduate students in probability, statistics and their applications. .

Une catastrophe glorieuse : le martyre des premiers chrétiens du Japon, Nagasaki, 1597

Directory of Open Access Journals (Sweden)

Clotilde Jacquelard

2011-11-01

Full Text Available Le naufrage du galion San Felipe dans le port de Urado (Shikoku, Japon en octobre 1596 fut le déclencheur d’un désastre missionnaire : le martyre de vingt-six chrétiens, franciscains espagnols et chrétiens japonais, à Nagasaki, le 5 février 1597. Cet article s’attache à examiner la relation dialectique entre les deux événements par l’étude de deux discours missionnaires franciscains hagiographiques. Il s’agit tout d’abord de rappeler la lecture providentialiste du temps à travers la perception de présages matériels et spirituels de la part des acteurs, puis de montrer que ces évènements paroxystiques révèlent en même temps qu’ils résolvent – temporairement – des tensions et des crises latentes, résultat de la confrontation entre plusieurs communautés culturelles comme la japonaise, l’espagnole et la portugaise, autour de prétentions géopolitiques, commerciales et religieuses dans cette zone de frontière de l’antiméridien du Pacifique nord.El naufragio del galeón San Felipe en el puerto de Urado (Shikoku, Japón en octubre de 1596 desembocó en un desastre misionero : el martirio de veintiséis cristianos, franciscanos españoles y cristianos japoneses, en Nagasaki, el 5 de febrero de 1597. Este artículo quiere examinar la relación dialéctica entre ambos acontecimientos, mediante el estudio de dos discursos misioneros franciscanos hagiográficos. Se trata de recordar primero la lectura providencialista de la época a través de la percepción de presagios tanto materiales como espirituales por parte de los actores, y mostrar luego que estos acontecimientos paroxísticos revelan, al mismo tiempo que resuelven –temporalmente– tensiones y crisis latentes, resultados de la confrontación de varias comunidades culturales como la japonesa, la española y la portuguesa, en torno a pretensiones geopolíticas, comerciales y religiosas en la zona fronteriza del antimeridiano del Pacífico norte.

Reduction of patient dose delivered by CHR diagnostic x-ray examinations

International Nuclear Information System (INIS)

Evans, R.D.; Schlenker, R.A.

1978-01-01

Three changes in technique have been made which reduce the x-ray dose delivered by diagnostic examinations of patients of the Center for Human Radiobiology (CHR): Kodak Lanex Regular screens and Kodak Ortho G film have been substituted for DuPont Cronex Parspeed screens and DuPont Cronex 4 film for five projections in the MIT examinations; 3 mm Al added filtration is now used in place of 1 mm Al added filtration in the ANL examination; improvements in collimation for the ANL examination have been made. Use of the new screen-film combination at MIT has reduced the mean dose to the active marrow of the female RANDO phantom from 606 +- 69 mrad to 235 +- 16 mrad; it has reduced the ovary dose from 606 +- 40 mrad to 291 +- 19 mrad and has left the breast dose unchanged at 333 +- 103 mrad. The change from 1 mm Al to 3 mm Al added filtration at ANL, without changes in collimation, would reduce the mean marrow dose in the phantom from 232 +- 14 mrad to 175 +- 26 mrad, reduce the ovary dose from 243 +- 25 mrad to 162 +- 38 mrad and reduce the breast dose from 388 +- 35 mrad to 226 +- 9 mrad. The changes in collimation at ANL should reduce these doses even further but the quantitative effect has not been ascertained

A progressively reduced pretension method to fabricate Bradbury-Nielsen gates with uniform tension

International Nuclear Information System (INIS)

Ni, Kai; Guo, Jingran; Yu, Zhou; Cao, Like; Yu, Quan; Qian, Xiang; Wang, Xiaohao

2015-01-01

A Bradbury-Nielsen gate (BNG) is often used to modulate ion beams. It consists of two interleaved and electrically isolated sets of wires with uniform tension, which ideally keep parallel, equidistant, and coplanar over a wide temperature range, making the BNG reliable and robust. We have previously analyzed the non-uniformity problem of wire tensions with sequentially winding method and developed a template-based transfer method to solve this problem. In this paper, we introduced a progressively reduced pretension method, which allows directly and sequentially fixing wires onto the substrate without using a template. Theoretical analysis shows that by applying proper pretension to each wire when fixing it, the final wire tensions of all wires can be uniform. The algorithm and flowchart to calculate the pretension sequence are given, and the fabrication process is introduced in detail. Pretensions are generated by weight combination with a weaving device. A BNG with stainless steel wire and a printed circuit board substrate is constructed with this method. The non-uniformity of the final wire tensions is less than 2.5% in theory. The BNG is successfully employed in our ion mobility spectrometer, and the measured resolution is 33.5 at a gate opening time of 350 μs. Compared to the template-based method, this method is simpler, faster, and more flexible with comparable production quality when manufacturing BNGs with different configurations

Musikterapiuddannelsen 25 år - Festskrift

DEFF Research Database (Denmark)

musikterapeutisk hovedinstrument?  - ændrede studieordninger på musikterapiuddannelsen Lars Ole Bonde: Studieordningen af 2006 i praksis. Erfaringer fra det første år Carl Bergstrøm-Nielsen: En ny musikfaglighed Britta Kvist: Mit liv som UA'er i 24 år Niels Hannibal: Når teori og praksis lever side om side Tony...... Wigram: Doctoral Research School in Music Therapy, Aalborg University Lars Ole Bonde: Forskerskolen i musikterapi - en international succes Peder Kaj Pedersen: Musikterapeutiske forskningsstrategier. Profane replikker fra sidelinien Anne Steen Møller: "Musikterapeut? Hvor spændende! Hvad laver sådan én......?" Helga Pallesen: En ældre studerende på en ung uddannelse Lis Karlsen & Anne Eijgendaal: En historie om hvordan musikterapeuterne blev fagligt organiserede Hanne Mette Ridder: Hvor går kandidaterne hen, når de går ud?           Musiksatser af bl.a. Bo Hulgaard, Bjørn Veierskov Alexandersson, og Carl...

Living Joyfully after Losing Social Hope: Kierkegaard and Chrétien on Selfhood and Eschatological Expectation

Directory of Open Access Journals (Sweden)

J. Aaron Simmons

2017-02-01

Full Text Available In this essay, I offer an existential-phenomenological consideration of what it might look like to live joyfully after losing social hope. Using the example of the widespread hopelessness that many are feeling in light of the election of Donald Trump, I suggest that the danger of losing hope is that we can also lose our selfhood in the process. In order to develop a conception of “eschatological hope” that would be resistant to the loss of such social and political expectations, I draw specifically on Søren Kierkegaard’s notion that “the expectancy of faith is victory,” and Jean-Louis Chrétien’s idea of “the unhoped for,” in order to develop a model of hope that remains when it seems like all other hope has been lost. Rather than being overcome by anxiety about the future, eschatological hope fosters joy in the present.

Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency

NARCIS (Netherlands)

Prins, M.; van Leeuwen, M.W.; Teske, E.

2009-01-01

Tijdschr Diergeneeskd. 2009 Apr 1;134(7):272-8. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency. Prins M, van Leeuwen MW, Teske E.

Reduction of Hexavalent Chromium and Detection of Chromate Reductase (ChrR in Stenotrophomonas maltophilia

Directory of Open Access Journals (Sweden)

Rosa Baldiris

2018-02-01

Full Text Available An Gram negative strain of S. maltophilia, indigenous to environments contaminated by Cr(VI and identified by biochemical methods and 16S rRNA gene analysis, reduced chromate by 100%, 98–99% and 92% at concentrations in the 10–70, 80–300, and 500 mg/L range, respectively at pH 7 and temperature 37 °C. Increasing concentrations of Cr(VI in the medium lowered the growth rate but could not be directly correlated with the amount of Cr(VI reduced. The strain also exhibited multiple resistance to antibiotics and tolerance and resistance to various heavy metals (Ni, Zn and Cu, with the exception of Hg. Hexavalent chromium reduction was mainly associated with the soluble fraction of the cell evaluated with crude cell-free extracts. A protein of molecular weight around 25 kDa was detected on SDS-PAGE gel depending on the concentration of hexavalent chromium in the medium (0, 100 and 500 mg/L. In silico analysis in this contribution, revealed the presence of the chromate reductase gene ChrR in S. maltophilia, evidenced through a fragment of around 468 bp obtained experimentally. High Cr(VI concentration resistance and high Cr(VI reducing ability of the strain make it a suitable candidate for bioremediation.

Jervell and Lange-Nielsen syndrome in a father and daughter from a large highly inbred family: a 16-year follow-up of 59 living members.

Science.gov (United States)

Sanyal, Shyamal Kumar; Kaul, Kanwar K; Hussein, Akhtar; Wilroy, Robert S; Agarwal, Kisan; Sohel, Saira

2013-08-01

To report the autosomal dominant inheritance of the Jervell and Lange-Nielsen syndrome in a highly inbred family, the initiation of Torsades de Pointes, and the natural history of the syndrome based on a 16-year follow-up of the kindred. A family tree was constructed that included 66 blood relatives from three successive generations. Electrocardiograms were obtained from 59 living members including the proband, four members from a nuclear family, and 54 from the extended family. Evoked response audiometry was recorded for the proband and the nuclear family. All 59 family members were followed up regularly for 16 years. A total of 24 living members were affected--QTc: 480-680 ms. The proband had long QTc, bilateral high-tone sensorineural deafness, recurrent syncope, and Torsades de Pointes. The asymptomatic father had long QTc and unilateral high-tone sensorineural deafness that involved specifically the left ear. One asymptomatic sibling of the proband had long QTc and normal hearing. The mother and another sibling were asymptomatic; QTc and hearing were normal in both. A total of 21 affected members from the extended family had only long QTc, and all were asymptomatic. There were three congenitally deaf first cousins who had recurrent syncope and adrenergic-triggered sudden death. In all, seven of 10 parents had consanguineous marriage to a first cousin. Each affected offspring had at least one affected parent. The severely symptomatic proband who received only β-blocker therapy and the 23 affected members without antiadrenergic therapy, all remained asymptomatic throughout the 16-year follow-up period. Jervell and Lange-Nielsen syndrome was inherited as autosomal dominant in this kindred. The majority of the affected members had a mild phenotype. The severity of auditory and cardiac phenotypes corresponded.

Review: Niels C. Taubert (2006. Produktive Anarchie? Netzwerke freier Softwareentwicklung [Productive Anarchy? Networks of Open Source Software Development

Directory of Open Access Journals (Sweden)

Matthias Groß

2007-01-01

Full Text Available Open source software is software designed to allow anyone to use and make changes in the software. This practice often renders the product superior to more centralized models such as those used in commercial software companies. How is such a phenomenon possible in a time where nothing seems to be acquirable save by purchase? Niels C. TAUBERT's book Productive Anarchy? Networks of Open Source Software Development aims at a sociological understanding of the prerequisites and conditions for the success of open source software. One of the conclusions of TAUBERT's book is that the process of open software development needs to be understood as adaptive and experimental. A continuous feedback between the context of production and the context of application is the basis for robust and successful software production. One of the surprising results of the book is that the most important requirement for this feedback process is a set of norms—neutrality, communism, disinterestedness, and universalism—norms that Robert MERTON associated with academic science in the 1940s. If TAUBERT is right that these norms are to be found outside the world of institutional science in open source software development projects today, then his case study can be seen as an indicator for a new form of knowledge production in the 21st century, where the social relevance and responsibility of a research process are keys to successful innovation. With this book, which deserves a wide readership, TAUBERT makes an important contribution to our understanding of the successful organization of technology development. URN: urn:nbn:de:0114-fqs0701109

Orelhas de elefante, olhos de coruja, dentes de javali: maravilhoso e descritivo em Yvain ou le chevalier au lion, de Chrétien de Troyes

OpenAIRE

Luis Claudio Kinker Caliendo

2009-01-01

No final do século XII, Chrétien de Troyes considerado por muitos críticos o maior poeta francês da chamada Idade Média compõe um poema narrativo Yvain ou le Chevalier au Lion no qual se percebem elementos tidos como característicos do gênero maravilhoso, tais quais objetos mágicos e seres extraordinários, como monstros e gigantes. Esses elementos entre outros fatores levaram boa parte da crítica a enxergar na poesia medieval, durante muito tempo, uma certa ingenuidade, típica de uma in...

Los enigmas del Grial. En torno a la polémica sobre la unidad de El Cuento del Grial de Chrétien de Troyes

Directory of Open Access Journals (Sweden)

Victoria Cirlot

2014-12-01

Full Text Available Relectura de la polémica acerca de la unidad del último roman de Chrétien de Troyes, Li Contes del Graal que tuvo lugar a finales de los años cincuenta entre Martín de Riquer, Jean Frappier y Erich Köhler. Más de cincuenta años después se trata de valorar las aportaciones que dicha polémica supuso para la filología románica y, en concreto, para la valoración de la última obra del escritor de la Champaña.

A 'college of astrology and medicine'? Charles V, Gervais Chrétien, and the scientific manuscripts of Maître Gervais's College.

Science.gov (United States)

Boudet, Jean-Patrice

2010-06-01

Considered an institution mainly devoted to astrology and medicine by Simon de Phares and by some historians who believe that he was reliable, the college founded in 1371 by Charles V's first physician, Gervais Chrétien, was in fact primarily dedicated to theological students. It was not before 1377 that there were created there two bursaries for scholares regis, specialising in 'licit mathematical sciences', and two medical fellowships. Yet the influence of the activity of these fellows seems to have been rather moderate and-as far as we can learn from the material still extant, notably from manuscripts that belonged to Maître Gervais' College and to some of its members-this institution was devoted much more to theological studies than to medicine and the quadrivium.

De la chair imbibée de foi : la viande comme marqueur de la frontière entre chrétiens et musulmans en Éthiopie

Directory of Open Access Journals (Sweden)

Éloi Ficquet

2006-05-01

Full Text Available Jamais en Éthiopie un chrétien et un musulman ne mangent de viande ensemble. Consommer de la viande qui n’a pas été consacrée à sa propre foi est appréhendé comme un acte hautement sacrilège équivalent à une apostasie. Cet interdit doit être compris dans une perspective comparative large sur les pratiques et les débats qui restreignent la commensalité de la viande entre les chrétiens et les musulmans. Les usages éthiopiens ont accentué cette question pour en faire un interdit puissant, marqueur d’une frontière interreligieuse. Comme toute frontière, cette « frontière carnée » a été le lieu de confrontations, d’aménagements et de transgressions dont les effets ont contribué à la construction de l’espace national éthiopien contemporain.Christians and Muslims in Ethiopia never eat meat together. Consuming meat that was not consecrated to one’s faith is seen as a highly sacrilegious act equal to apostasy. This interdict must be understood in comparative perspective that looks at the restrictions regarding the sharing of meat between Christians and Muslims. Ethiopian customs have emphasized this issue to turn it into a powerful interdict, tracing an inter-religious boundary. Like any boundary, this “dietary boundary” has been the site of confrontations, readjustments and transgressions whose effects have contributed to the building of a contemporary Ethiopian national space.

Froggatt-Nielsen meets Mordell-Weil: a phenomenological survey of global F-theory GUTs with U(1)s

International Nuclear Information System (INIS)

Krippendorf, Sven; Schäfer-Nameki, Sakura; Wong, Jin-Mann

2015-01-01

In F-theory, U(1) gauge symmetries are encoded in rational sections, which generate the Mordell-Weil group of the elliptic fibration of the compactification space. Recently the possible U(1) charges for global SU(5) F-theory GUTs with smooth rational sections were classified http://dx.doi.org/10.1007/JHEP09(2015)144. In this paper we utilize this classification to probe global F-theory models for their phenomenological viability. After imposing an exotic-free MSSM spectrum, anomaly cancellation (related to hypercharge flux GUT breaking in the presence of U(1) gauge symmetries), absence of dimension four and five proton decay operators and other R-parity violating couplings, and the presence of at least the third generation top Yukawa coupling, we generate the remaining quark and lepton Yukawa textures by a Froggatt-Nielsen mechanism. In this process we require that the dangerous couplings are forbidden at leading order, and when re-generated by singlet vevs, lie within the experimental bounds. We scan over all possible configurations, and show that only a small class of U(1) charge assignments and matter distributions satisfy all the requirements. The solutions give rise to the exact MSSM spectrum with realistic quark and lepton Yukawa textures, which are consistent with the CKM and PMNS mixing matrices. We also discuss the geometric realization of these models, and provide pointers to the class of elliptic fibrations with good phenomenological properties.

“Et qui or me vaurra entendre, cuer et oreilles me doit rendre”: espacios de lectura y público de los roman courtois de Chrétien de Troyes (siglos XII-XIII

Directory of Open Access Journals (Sweden)

Diego Carlo Améndolla Spinola

2016-06-01

Full Text Available Basado en los planteamientos de la lógica social del texto, este artículo presenta un estudio del público que escuchaba los romances corteses entre los siglo XII y XIII, específicamente los realizados por Chrétien de Troyes –clérigo lector de la Corte de Leonor de Aquitania y de Enrique II Plantagenet–, además de establecer y analizar las diversas salas de los castillos donde estas obras literarias eran narradas.

La Fábula Ovidiana de Filomela revisada por la Edad Media: de Chrétien de Troyes a Alfonso x

Directory of Open Access Journals (Sweden)

Mario Martín Botero García

2014-12-01

Full Text Available En este trabajo se expone el contraste entre las dos traducciones al francés y al castellano de Filomela, una de las fábulas de las Metamorfosis de Ovidio, realizadas en los siglos xii y xiii por Chrétien de Troyes y Alfonso X. Por medio del análisis y cotejo de tres momentos narrativos, veremos la forma en que la materia antigua es tratada según el contexto determinado en el que se producen las traducciones. La versión francesa hace énfasis en una dimensión cortés en donde el personaje femenino es altamente valorado; por su parte, la versión castellana reivindica una racionalización de la fábula ovidiana, supeditada a una visión política e histórica. Se puede constatar así que las traducciones medievales no son serviles con respecto a la fuente latina sino que demuestran una gran libertad en la selección y combinación de elementos.

Gamma non-ionizing energy loss: Comparison with the damage factor in silicon devices

Science.gov (United States)

El Allam, E.; Inguimbert, C.; Meulenberg, A.; Jorio, A.; Zorkani, I.

2018-03-01

The concept of non-ionizing energy loss (NIEL) has been demonstrated to be a successful approach to describe the displacement damage effects in silicon materials and devices. However, some discrepancies exist in the literature between experimental damage factors and theoretical NIELs. 60Co gamma rays having a low NIEL are an interesting particle source that can be used to validate the NIEL scaling approach. This paper presents different 60Co gamma ray NIEL values for silicon targets. They are compared with the radiation-induced increase in the thermal generation rate of carriers per unit fluence. The differences between the different models, including one using molecular dynamics, are discussed.

Nanocompósitos de PEAD/PEBDL: avaliação da esfoliação da argila organofílica pela aplicação do modelo de Nielsen e das propriedades mecânicas, ópticas e permeabilidade PEAD/PEBDL composites: evaluation of the exfoliation of organophilic clay using the Nielsen model and of the mechanical, optical and permeability properties

Directory of Open Access Journals (Sweden)

Ana R. Morales

2010-01-01

Full Text Available Uma blenda de polietileno de alta densidade e polietileno de baixa densidade (PEAD/PEBDL comumente utilizada em filmes de embalagem foi modificada com argila montmorilonita organofílica comercial para obter nanocompósitos com melhores propriedades de barreira. Amostras com 5 e 7,5% de argila (em massa foram estudadas em diferentes condições de processamento. Filmes produzidos com os nanocompósitos foram avaliados quanto à dispersão da argila por difração de raio X e Microscopia Eletrônica de Transmissão. As propriedades de barreira dos filmes foram determinadas pelas medições de permeabilidade ao oxigênio e ao vapor d'água. As propriedades mecânicas e ópticas também foram determinadas. Observou-se uma estrutura com a argila parcialmente esfoliada e intercalada. A permeabilidade ao oxigênio diminuiu significativamente enquanto a permeabilidade à água foi pouco influenciada. As propriedades mecânicas e a transparência dos filmes foram pouco alteradas. O modelo de Nielsen foi aplicado para os dados de permeabilidade relativa e demonstrou ser um ótimo recurso para a avaliação do grau de esfoliação da argila para as diferentes amostras, que foram confirmadas pelas análises realizadas em microscopia eletrônica de transmissão.A typical high density polyethylene and linear low density polyethylene (HDPE/LLDPE blend used in flexible packaging was modified with commercial organophylic montmorilonite clay to obtain nanocomposites with superior barrier properties. Samples with 5 and 7.5% of clay were prepared under different processing conditions. Films produced from the nanocomposites were evaluated in terms of oxygen and water vapor permeation and also by X-ray diffraction and Transmission Electron Microscopy. Tensile and optical properties were also evaluated. The clay showed to be intercalated and partially exfoliated. The oxygen permeation was mainly reduced and the vapor permeation was weakly modified. The mechanical

Reseña de: Caselli, Elisa, Antijudaïsme, pouvoir politique et administration de la justice. Juifs, chrétiens et converts dans l’ espace jurisdictionnel de la Chancillería de Valladolid (XVe-XVIe siècles.Villeneuve d’Ascq...

Directory of Open Access Journals (Sweden)

Enrique Cantera Montenegro

2017-05-01

Full Text Available Caselli, Elisa, Antijudaïsme, pouvoir politique et administration de la justice. Juifs, chrétiens et converts dans l’ espace jurisdictionnel de la Chancillería de Valladolid (XV^e-XVI^e siècles. Villeneuve d’Ascq Cedex. Atelier National de Reproduction des Thèses, 2016. 396 págs. isbn: 978-2-7295-8891-5.

Odd Bed-fellows: British Christians and Communists in the Struggle for Peace D’étranges compagnons : chrétiens et communistes britanniques dans la lutte pour la paix

Directory of Open Access Journals (Sweden)

Jeremy Tranmer

2011-04-01

Full Text Available Au début des années 1950, le doyen de l’archevêché de Cantorbéry œuvra au sein du mouvement pour la paix et participa à des activités organisées par le parti communiste britannique. En 1983, le prêtre catholique Bruce Kent, leader de la Campagne pour le Désarmement Nucléaire, loua l’engagement des communistes britanniques en faveur de la paix. Cet article cherche à examiner pourquoi et comment chrétiens et communistes surmontèrent leurs différences et coopérèrent dans la lutte contre l’arme nucléaire.

La cinéphilie chrétienne : Amédée Ayfre (1922-1964, sulpicien et critique de cinéma The Christian cinema enthusiasm: Amédée Ayfre (1922-1964, priest of the Society of saint Sulpice and film critic

Directory of Open Access Journals (Sweden)

Philippe Rocher

2012-06-01

Full Text Available Prêtre français de saint Sulpice et chrétien cinéphile, Amédée Ayfre a défendu l’esthétique et le réalisme cinématographiques contre le cinéma religieux du « Cinéma catholique ». Le « réalisme cinématographique » est un instrument de révélation chrétienne du Prochain. Brusquement décédé, Amédée Ayfre n’a pas eu la possibilité de dépasser ses premiers « Jalons pour une théologie de l’image ».In the middle Twentieth century, Amédée Ayfre, French priest of the Society of saint Sulpice and Christian cinema enthusiast, defended esthetic and realism cinema against the religious cinema of « Catholic cinema ». For him, realist Cinema is the Christian revelation instrument of fellow man. Brusquely to die, he can’t proposed any more his first “Jalons pour une théologie de l’image”.

Nielsen: Homescan

Data.gov (United States)

Department of Agriculture — Contains information on household based purchases for about 400,000 UPC’s and non-UPC coded random weight items, including prices, quantities, purchase date, product...

Nationale test

DEFF Research Database (Denmark)

2009-01-01

Professor Sven Erik Nordenbo og centerleder Niels Egelund, begge DPU, i samtale om nationale test.......Professor Sven Erik Nordenbo og centerleder Niels Egelund, begge DPU, i samtale om nationale test....

30 January 2012 - Danish National Research Foundation Chairman of board K. Bock and University of Copenhagen Rector R. Hemmingsen visiting ATLAS underground experimental area, CERN Control Centre and ALICE underground experimental area, throughout accompanied by J. Dines Hansen and B. Svane Nielsen; signing the guest book with CERN Director for Research and Scientific Computing S. Bertolucci and Head of International Relations F. Pauss.

CERN Document Server

Jean-Claude Gadmer

2012-01-01

30 January 2012 - Danish National Research Foundation Chairman of board K. Bock and University of Copenhagen Rector R. Hemmingsen visiting ATLAS underground experimental area, CERN Control Centre and ALICE underground experimental area, throughout accompanied by J. Dines Hansen and B. Svane Nielsen; signing the guest book with CERN Director for Research and Scientific Computing S. Bertolucci and Head of International Relations F. Pauss.

Computational Fluid Dynamics in Ventilation Design

DEFF Research Database (Denmark)

Nielsen, Peter V.

2008-01-01

This paper is based on the new REHVA Guidebook Computational Fluid  Dynamics in Ventilation Design (Nielsen et al. 2007) written by Peter V. Nielsen, Francis(Nielsen 2007) written by Peter V. Nielsen, Francis Allard, Hazim B. Awbi, Lars Davidson and Alois Schälin. The guidebook is made for people....... The guidebook introduces rules for good quality prediction work, and it is the purpose of the guidebook to improve the technical level of CFD work in ventilation.......This paper is based on the new REHVA Guidebook Computational Fluid  Dynamics in Ventilation Design (Nielsen et al. 2007) written by Peter V. Nielsen, Francis(Nielsen 2007) written by Peter V. Nielsen, Francis Allard, Hazim B. Awbi, Lars Davidson and Alois Schälin. The guidebook is made for people...... who need to use and discuss results based on CFD predictions, and it gives insight into the subject for those who are not used to work with CFD. The guidebook is also written for people working with CFD who have to be more aware of how this numerical method is applied in the area of ventilation...

Recessive cardiac phenotypes in induced pluripotent stem cell models of Jervell and Lange-Nielsen syndrome: disease mechanisms and pharmacological rescue.

Science.gov (United States)

Zhang, Miao; D'Aniello, Cristina; Verkerk, Arie O; Wrobel, Eva; Frank, Stefan; Ward-van Oostwaard, Dorien; Piccini, Ilaria; Freund, Christian; Rao, Jyoti; Seebohm, Guiscard; Atsma, Douwe E; Schulze-Bahr, Eric; Mummery, Christine L; Greber, Boris; Bellin, Milena

2014-12-16

Jervell and Lange-Nielsen syndrome (JLNS) is one of the most severe life-threatening cardiac arrhythmias. Patients display delayed cardiac repolarization, associated high risk of sudden death due to ventricular tachycardia, and congenital bilateral deafness. In contrast to the autosomal dominant forms of long QT syndrome, JLNS is a recessive trait, resulting from homozygous (or compound heterozygous) mutations in KCNQ1 or KCNE1. These genes encode the α and β subunits, respectively, of the ion channel conducting the slow component of the delayed rectifier K(+) current, IKs. We used complementary approaches, reprogramming patient cells and genetic engineering, to generate human induced pluripotent stem cell (hiPSC) models of JLNS, covering splice site (c.478-2A>T) and missense (c.1781G>A) mutations, the two major classes of JLNS-causing defects in KCNQ1. Electrophysiological comparison of hiPSC-derived cardiomyocytes (CMs) from homozygous JLNS, heterozygous, and wild-type lines recapitulated the typical and severe features of JLNS, including pronounced action and field potential prolongation and severe reduction or absence of IKs. We show that this phenotype had distinct underlying molecular mechanisms in the two sets of cell lines: the previously unidentified c.478-2A>T mutation was amorphic and gave rise to a strictly recessive phenotype in JLNS-CMs, whereas the missense c.1781G>A lesion caused a gene dosage-dependent channel reduction at the cell membrane. Moreover, adrenergic stimulation caused action potential prolongation specifically in JLNS-CMs. Furthermore, sensitivity to proarrhythmic drugs was strongly enhanced in JLNS-CMs but could be pharmacologically corrected. Our data provide mechanistic insight into distinct classes of JLNS-causing mutations and demonstrate the potential of hiPSC-CMs in drug evaluation.

Niels Juels sidste togt

DEFF Research Database (Denmark)

Nørby, Søren

2017-01-01

Den 29. august 1943 var en af de mest dramatiske dage under den tyske besættelse af Danmark. Denne dag brød samarbejdspolitikken sammen, og tyske styrker satte sig derfor i besiddelse af den danske hær og flådes materiel. Enkelte steder kom det til kamp mellem danske og tyske styrker, og en af de...

Metaphilosophy, Pragmatism and a Kind of Critical Theory: Kai ...

African Journals Online (AJOL)

For Rorty it is historical narrative and utopian proposals; for Nielsen it is critical theory. Rorty claims this, Nielsen's intentions to the contrary notwithstanding, commits him to enlightenment rationalism. Nielsen replies that his form of critical theory is deeply historicist and contextual without being resolutely atheoretical.

Cross-talk between cognate and noncognate RpoE sigma factors and Zn(2+)-binding anti-sigma factors regulates photooxidative stress response in Azospirillum brasilense.

Science.gov (United States)

Gupta, Namrata; Gupta, Ankush; Kumar, Santosh; Mishra, Rajeev; Singh, Chhaya; Tripathi, Anil Kumar

2014-01-01

Azospirillum brasilense harbors two redox-sensitive Zinc-binding anti-sigma (ZAS) factors (ChrR1 and ChrR2), which negatively regulate the activity of their cognate extra-cytoplasmic function (ECF) σ factors (RpoE1 and RpoE2) by occluding their binding to the core enzyme. Both pairs of RpoE-ChrR control responses to photooxidative stress. The aim of this study was to investigate whether the two RpoE-ChrR pairs cross-talk while responding to the stress. In silico analysis showed a high sequence similarity between ChrR1 and ChrR2 proteins, but differences in redox sensitivity. Using in silico and in vitro methods of protein-protein interaction, we have shown that both ChrR1 and ChrR2 proteins physically bind to their noncognate RpoE proteins. Restoration of the phenotypes of chrR1::Tn5 and chrR2::Km mutants related to carotenoid biosynthesis and photooxidative stress tolerance by expressing chrR1 or chrR2 provided in vivo evidence for the cross-talk. In addition, up- or down-regulation of several identical proteins by expressing chrR1 or chrR2 in the chrR1::Tn5 mutant provided another in vivo evidence for the cross-talk. Although multiple redox-sensitive ZAS anti-σ factors occur in some Gram-positive bacteria, no cross-talk is reported among them. We report here, for the first time, that the two ZAS anti-σ factors of A. brasilense also interact with their noncognate σ factors and affect gene expression. The two redox-sensitive ZAS anti-σ factors in A. brasilense may interact with their cognate as well as noncognate ECF σ factors to play an important role in redox homeostasis by facilitating recovery from the oxidative stress.

Virally mediated Kcnq1 gene replacement therapy in the immature scala media restores hearing in a mouse model of human Jervell and Lange-Nielsen deafness syndrome.

Science.gov (United States)

Chang, Qing; Wang, Jianjun; Li, Qi; Kim, Yeunjung; Zhou, Binfei; Wang, Yunfeng; Li, Huawei; Lin, Xi

2015-08-01

Mutations in the potassium channel subunit KCNQ1 cause the human severe congenital deafness Jervell and Lange-Nielsen (JLN) syndrome. We applied a gene therapy approach in a mouse model of JLN syndrome (Kcnq1(-/-) mice) to prevent the development of deafness in the adult stage. A modified adeno-associated virus construct carrying a Kcnq1 expression cassette was injected postnatally (P0-P2) into the endolymph, which resulted in Kcnq1 expression in most cochlear marginal cells where native Kcnq1 is exclusively expressed. We also found that extensive ectopic virally mediated Kcnq1 transgene expression did not affect normal cochlear functions. Examination of cochlear morphology showed that the collapse of the Reissner's membrane and degeneration of hair cells (HCs) and cells in the spiral ganglia were corrected in Kcnq1(-/-) mice. Electrophysiological tests showed normal endocochlear potential in treated ears. In addition, auditory brainstem responses showed significant hearing preservation in the injected ears, ranging from 20 dB improvement to complete correction of the deafness phenotype. Our results demonstrate the first successful gene therapy treatment for gene defects specifically affecting the function of the stria vascularis, which is a major site affected by genetic mutations in inherited hearing loss. © 2015 The Authors. Published under the terms of the CC BY 4.0 license.

ANDERS GAMMELGAARD NIELSEN

DEFF Research Database (Denmark)

Gammelgaard Nielsen, Anders

2015-01-01

conducting research in this field. His research work is especially directed towards the perceptual relationship to materials as well as the opportunities of creating atmospheres through e use of building materials. As a practicing architect, he designed a series of smaller buildings and structures. Parallel...... to his work as an architect, he has a career as a sculptor. He received his basic teaching in sculpture at Edinburgh College of Art and has since been autodidact. He has exhibited in numerous national exhibitions and is currently a member of the artist group "Guirlanden". He is a member of the Danish...... Moore and Barbara Heptworth, whereas the later have a strong affinity to the works of Constantin Brancusi and Eduardo Chillida. The developments in the sculptural works can be seen with a parallel to the architectural research in materials and tectonics. Thus his research work has resulted in artefacts...

Loss of Chromosome 18 in Neuroendocrine Tumors of the Small Intestine: The Enigma Remains.

Science.gov (United States)

Nieser, Maike; Henopp, Tobias; Brix, Joachim; Stoß, Laura; Sitek, Barbara; Naboulsi, Wael; Anlauf, Martin; Schlitter, Anna M; Klöppel, Günter; Gress, Thomas; Moll, Roland; Bartsch, Detlef K; Heverhagen, Anna E; Knoefel, Wolfram T; Kaemmerer, Daniel; Haybaeck, Johannes; Fend, Falko; Sperveslage, Jan; Sipos, Bence

2017-01-01

Neuroendocrine tumors of the small intestine (SI-NETs) exhibit an increasing incidence and high mortality rate. Until now, no fundamental molecular event has been linked to the tumorigenesis and progression of these tumors. Only the loss of chromosome 18 (Chr18) has been shown in up to two thirds of SI-NETs, whereby the significance of this alteration is still not understood. We therefore performed the first comprehensive study to identify Chr18-related events at the genetic, epigenetic and gene/protein expression levels. We did expression analysis of all seven putative Chr18-related tumor suppressors by quantitative real-time PCR (qRT-PCR), Western blot and immunohistochemistry. Next-generation exome sequencing and SNP array analysis were performed with five SI-NETs with (partial) loss of Chr18. Finally, we analyzed all microRNAs (miRNAs) located on Chr18 by qRT-PCR, comparing Chr18+/- and Chr18+/+ SI-NETs. Only DCC (deleted in colorectal cancer) revealed loss of/greatly reduced expression in 6/21 cases (29%). No relevant loss of SMAD2, SMAD4, elongin A3 and CABLES was detected. PMAIP1 and maspin were absent at the protein level. Next-generation sequencing did not reveal relevant recurrent somatic mutations on Chr18 either in an exploratory cohort of five SI-NETs, or in a validation cohort (n = 30). SNP array analysis showed no additional losses. The quantitative analysis of all 27 Chr18-related miRNAs revealed no difference in expression between Chr18+/- and Chr18+/+ SI-NETs. DCC seems to be the only Chr18-related tumor suppressor affected by the monoallelic loss of Chr18 resulting in a loss of DCC protein expression in one third of SI-NETs. No additional genetic or epigenetic alterations were present on Chr18. © 2016 S. Karger AG, Basel.

I grandi della fisica da Platone a Heisenberg

CERN Document Server

Von Weizsäcker, Carl Friedrich

2002-01-01

Parmenide ; Platone ; Aristotele ; Copernico, Keplero, Galilei ; Galileo Galilei ; Cartesio ; Gottfried Wilhelm Leibniz ; Cartesio, Newton, Leibniz, Kant ; Immanuel Kant ; Johann Wolfgang Goethe ; Robert Meyer ; Albert Einstein ; Niels Bohr ; Paul Adrien Maurice Dirac ; Niels Bohr e Werner Heisenberg, un ricordo del 1932 ; Werner Heisenberg ; Heisenberg, fisico e filosofo ; l'interpretazione filosofica della fisica moderna.

Linkage group-chromosome correlations in Sordaria macrospora: Chromosome identification by three dimensional reconstruction of their synaptonemal complex.

Science.gov (United States)

Zickler, D; Leblon, G; Haedens, V; Collard, A; Thuriaux, P

1984-01-01

Reconstruction of serially sectioned zygotene and pachytene nuclei has allowed, by measuring the lengths of synaptonemal complexes, an assignment of the 7 linkage (LG) groups to the 7 chromosomes in the fungus Sordaria macrospora. The 7 LG have been established using 19 mutants showing low second division segregation frequencies. Eight chromosomal rearrangements mapped on the 7 LG were used to identify the chromosomes involved. The following one to one assignment of the 7 LG to specific chromosomes was obtained: LG a: chromosome (chr) 1, LG b: chr5, LG c: chr6, LG d: chr7, LG e: chr4, LG f: chr3 and LG g: chr2 (the chromosome carrying the nucleolus organizer region).

Potentially important periods of change in the development of social and role functioning in youth at clinical high risk for psychosis.

Science.gov (United States)

Velthorst, Eva; Zinberg, Jamie; Addington, Jean; Cadenhead, Kristin S; Cannon, Tyrone D; Carrión, Ricardo E; Auther, Andrea; Cornblatt, Barbara A; McGlashan, Thomas H; Mathalon, Daniel H; Perkins, Diana O; Seidman, Larry J; Tsuang, Ming T; Walker, Elaine F; Woods, Scott W; Reichenberg, Abraham; Bearden, Carrie E

2018-02-01

The developmental course of daily functioning prior to first psychosis-onset remains poorly understood. This study explored age-related periods of change in social and role functioning. The longitudinal study included youth (aged 12-23, mean follow-up years = 1.19) at clinical high risk (CHR) for psychosis (converters [CHR-C], n = 83; nonconverters [CHR-NC], n = 275) and a healthy control group (n = 164). Mixed-model analyses were performed to determine age-related differences in social and role functioning. We limited our analyses to functioning before psychosis conversion; thus, data of CHR-C participants gathered after psychosis onset were excluded. In controls, social and role functioning improved over time. From at least age 12, functioning in CHR was poorer than in controls, and this lag persisted over time. Between ages 15 and 18, social functioning in CHR-C stagnated and diverged from that of CHR-NC, who continued to improve (p = .001). Subsequently, CHR-C lagged behind in improvement between ages 21 and 23, further distinguishing them from CHR-NC (p role functioning, but to a lesser extent (p = .007). The results remained consistent when we accounted for the time to conversion. Our findings suggest that CHR-C start lagging behind CHR-NC in social and role functioning in adolescence, followed by a period of further stagnation in adulthood.

Resonance journal of science education

Indian Academy of Sciences (India)

IAS Admin

Sketch made by Niels Bohr in 1944 to illustrate the content of his debate with Einstein on the uncertainty principle at the 6th Solvay Conference in 1930. Niels Bohr (1885–1962). Sketch by Homi Bhabha. (Courtesy: TIFR, Bombay). Front Cover. 871. Science Smiles. Ayan Guha. 876. Back Cover. 948. Classics. Biology and ...

Dicty_cDB: Contig-U16181-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

Om Chr. Petersen

DEFF Research Database (Denmark)

Rasborg, Klaus

1992-01-01

Om en i dag næsten glemt skikkelse i dansk sociologi, der i sin samtid især blev kendt for sin doktordisputats om den franske sociolog Émile Durkheim......Om en i dag næsten glemt skikkelse i dansk sociologi, der i sin samtid især blev kendt for sin doktordisputats om den franske sociolog Émile Durkheim...

Neurophysiological differences between patients clinically at high risk for schizophrenia and neurotypical controls--first steps in development of a biomarker.

Science.gov (United States)

Duffy, Frank H; D'Angelo, Eugene; Rotenberg, Alexander; Gonzalez-Heydrich, Joseph

2015-11-02

Schizophrenia is a severe, disabling and prevalent mental disorder without cure and with a variable, incomplete pharmacotherapeutic response. Prior to onset in adolescence or young adulthood a prodromal period of abnormal symptoms lasting weeks to years has been identified and operationalized as clinically high risk (CHR) for schizophrenia. However, only a minority of subjects prospectively identified with CHR convert to schizophrenia, thereby limiting enthusiasm for early intervention(s). This study utilized objective resting electroencephalogram (EEG) quantification to determine whether CHR constitutes a cohesive entity and an evoked potential to assess CHR cortical auditory processing. This study constitutes an EEG-based quantitative neurophysiological comparison between two unmedicated subject groups: 35 neurotypical controls (CON) and 22 CHR patients. After artifact management, principal component analysis (PCA) identified EEG spectral and spectral coherence factors described by associated loading patterns. Discriminant function analysis (DFA) determined factors' discrimination success between subjects in the CON and CHR groups. Loading patterns on DFA-selected factors described CHR-specific spectral and coherence differences when compared to controls. The frequency modulated auditory evoked response (FMAER) explored functional CON-CHR differences within the superior temporal gyri. Variable reduction by PCA identified 40 coherence-based factors explaining 77.8% of the total variance and 40 spectral factors explaining 95.9% of the variance. DFA demonstrated significant CON-CHR group difference (P <0.00001) and successful jackknifed subject classification (CON, 85.7%; CHR, 86.4% correct). The population distribution plotted along the canonical discriminant variable was clearly bimodal. Coherence factors delineated loading patterns of altered connectivity primarily involving the bilateral posterior temporal electrodes. However, FMAER analysis showed no CON-CHR

Function of C-terminal hydrophobic region in fructose dehydrogenase

International Nuclear Information System (INIS)

Sugimoto, Yu; Kawai, Shota; Kitazumi, Yuki; Shirai, Osamu; Kano, Kenji

2015-01-01

Fructose dehydrogenase (FDH) catalyzes oxidation of D-fructose into 2-keto-D-fructose and is one of the enzymes allowing a direct electron transfer (DET)-type bioelectrocatalysis. FDH is a heterotrimeric membrane-bound enzyme (subunit I, II, and III) and subunit II has a C terminal hydrophobic region (CHR), which was expected to play a role in anchoring to membranes from the amino acid sequence. We have constructed a mutated FDH lacking of CHR (ΔchrFDH). Contrary to the expected function of CHR, ΔchrFDH is expressed in the membrane fraction, and subunit I/III subcomplex (ΔcFDH) is also expressed in a similar activity level but in the soluble fraction. In addition, the enzyme activity of the purified ΔchrFDH is about one twentieth of the native FDH. These results indicate that CHR is concerned with the binding between subunit I(/III) and subunit II and then with the enzyme activity. ΔchrFDH has clear DET activity that is larger than that expected from the solution activity, and the characteristics of the catalytic wave of ΔchrFDH are very similar to those of FDH. The deletion of CHR seems to increase the amounts of the enzyme with the proper orientation for the DET reaction at electrode surfaces. Gel filtration chromatography coupled with urea treatment shows that the binding in ΔchrFDH is stronger than that in FDH. It can be considered that the rigid binding between subunit I(/III) and II without CHR results in a conformation different from the native one, which leads to the decrease in the enzyme activity in solution

Bohr and Dirac*

Indian Academy of Sciences (India)

IAS Admin

We present an account of the work of Niels Bohr and Paul Dirac, their interactions and personal- ities. 1. Introduction. In this essay I would like to convey to my readers some- thing about the personalities and work of Niels Bohr and Paul Dirac, juxtaposed against one another. Let me hope that the portraits I will paint of these ...

Cohort Profile Update

DEFF Research Database (Denmark)

Omland, Lars Haukali; Ahlström, Magnus Glindvad; Obel, Niels

2014-01-01

of Causes of Death, the Danish National Prescription Registry, the Attainment Register and the Integrated Database for Labour Market Research to get information on vital status, migration, cancer, hospital contacts, causes of death, dispensed prescriptions, education and employment. Using this design, rates...... the Danish Data Protection Agency. Potential collaborators can contact the study director, Niels Obel (e-mail: niels.obel@regionh.dk)....

De l’utopie socialiste au réalisme chrétien

Directory of Open Access Journals (Sweden)

Isabelle Richet

2006-03-01

Full Text Available Le New Deal est le premier mouvement réformiste d’ampleur dans l’histoire des Etats‑Unis qui n’ait pas été inspiré, ni soutenu, par les forces du protestantisme. Si une majorité des protestants et de leur clergé se sont opposés au New Deal à partir de positions conservatrices, le théologien Reinhold Niebuhr en a développé au départ une virulente critique de gauche avant de finalement rallier le président démocrate à la fin des années trente. Nourrie par le rejet de l’idéalisme du Social Gospel, incapable à ses yeux de comprendre les rapports sociaux en terme de classe et de pouvoir, la critique de Niebuhr emprunte les outils d’analyse marxistes pour développer une approche réaliste, tant du point de vue des fins que des moyens de la lutte politique. Le New Deal lui apparaît avant tout comme un programme visant à sauver le capitalisme, alors que la société fondée sur la justice qu’il envisage passe par la socialisation des moyens de production qui ne pourra émerger qu’à travers des conflits sociaux au cours desquels les moyens de lutte même violents sont justifiés. Mais sous l’influence des évènements en Europe au lendemain de la victoire d’Hitler, Reinhold Niebuhr se tourne au milieu des années trente vers une réflexion théologique inspirée de l’orthodoxie de Karl Barth et de son frère Richard Niebuhr, qui l’amène à réintroduire le péché comme la limite absolue de toute l’expérience humaine, interdisant d’envisager la création d’une société de paix et de justice. Ce nouvel absolutisme théologique nourrit un relativisme politique, le réalisme chrétien consistant désormais à choisir la moins mauvaise des options en présence. De ce point de vue, le président démocrate qui appelle à la préparation militaire s’impose désormais comme le choix le plus réaliste face à la montée du fascisme en Europe.The New Deal was the first major reformist experiment in the

Cloning and sequence analysis demonstrate the chromate reduction ability of a novel chromate reductase gene from Serratia sp.

Science.gov (United States)

Deng, Peng; Tan, Xiaoqing; Wu, Ying; Bai, Qunhua; Jia, Yan; Xiao, Hong

2015-03-01

The ChrT gene encodes a chromate reductase enzyme which catalyzes the reduction of Cr(VI). The chromate reductase is also known as flavin mononucleotide (FMN) reductase (FMN_red). The aim of the present study was to clone the full-length ChrT DNA from Serratia sp. CQMUS2 and analyze the deduced amino acid sequence and three-dimensional structure. The putative ChrT gene fragment of Serratia sp. CQMUS2 was isolated by polymerase chain reaction (PCR), according to the known FMN_red gene sequence from Serratia sp. AS13. The flanking sequences of the ChrT gene were obtained by high efficiency TAIL-PCR, while the full-length gene of ChrT was cloned in Escherichia coli for subsequent sequencing. The nucleotide sequence of ChrT was submitted onto GenBank under the accession number, KF211434. Sequence analysis of the gene and amino acids was conducted using the Basic Local Alignment Search Tool, and open reading frame (ORF) analysis was performed using ORF Finder software. The ChrT gene was found to be an ORF of 567 bp that encodes a 188-amino acid enzyme with a calculated molecular weight of 20.4 kDa. In addition, the ChrT protein was hypothesized to be an NADPH-dependent FMN_red and a member of the flavodoxin-2 superfamily. The amino acid sequence of ChrT showed high sequence similarity to the FMN reductase genes of Klebsiella pneumonia and Raoultella ornithinolytica , which belong to the flavodoxin-2 superfamily. Furthermore, ChrT was shown to have a 85.6% similarity to the three-dimensional structure of Escherichia coli ChrR, sharing four common enzyme active sites for chromate reduction. Therefore, ChrT gene cloning and protein structure determination demonstrated the ability of the gene for chromate reduction. The results of the present study provide a basis for further studies on ChrT gene expression and protein function.

Cloning and sequence analysis demonstrate the chromate reduction ability of a novel chromate reductase gene from Serratia sp

Science.gov (United States)

DENG, PENG; TAN, XIAOQING; WU, YING; BAI, QUNHUA; JIA, YAN; XIAO, HONG

2015-01-01

The ChrT gene encodes a chromate reductase enzyme which catalyzes the reduction of Cr(VI). The chromate reductase is also known as flavin mononucleotide (FMN) reductase (FMN_red). The aim of the present study was to clone the full-length ChrT DNA from Serratia sp. CQMUS2 and analyze the deduced amino acid sequence and three-dimensional structure. The putative ChrT gene fragment of Serratia sp. CQMUS2 was isolated by polymerase chain reaction (PCR), according to the known FMN_red gene sequence from Serratia sp. AS13. The flanking sequences of the ChrT gene were obtained by high efficiency TAIL-PCR, while the full-length gene of ChrT was cloned in Escherichia coli for subsequent sequencing. The nucleotide sequence of ChrT was submitted onto GenBank under the accession number, KF211434. Sequence analysis of the gene and amino acids was conducted using the Basic Local Alignment Search Tool, and open reading frame (ORF) analysis was performed using ORF Finder software. The ChrT gene was found to be an ORF of 567 bp that encodes a 188-amino acid enzyme with a calculated molecular weight of 20.4 kDa. In addition, the ChrT protein was hypothesized to be an NADPH-dependent FMN_red and a member of the flavodoxin-2 superfamily. The amino acid sequence of ChrT showed high sequence similarity to the FMN reductase genes of Klebsiella pneumonia and Raoultella ornithinolytica, which belong to the flavodoxin-2 superfamily. Furthermore, ChrT was shown to have a 85.6% similarity to the three-dimensional structure of Escherichia coli ChrR, sharing four common enzyme active sites for chromate reduction. Therefore, ChrT gene cloning and protein structure determination demonstrated the ability of the gene for chromate reduction. The results of the present study provide a basis for further studies on ChrT gene expression and protein function. PMID:25667630

A tribute to Niels Bohr

International Nuclear Information System (INIS)

Kubbinga, H.

2008-01-01

The 3 most important scientific achievements of N.Bohr follow. First, the Bohr-Rutherford atomic model in which Thomson's electrons, Rutherford's nucleus and Planck's quanta merged together to explain the line spectra of atoms. Secondly, the compound nucleus model in which Bohr explained nuclear reactions by the production of an intermediate state by the impact of an incident nucleus: the entering projectile would hit one or more nucleons, its energy and momentum being spread over them and after a while when one or more nucleons have acquired sufficient energy they escape from the compound nucleus. And thirdly, the drop model that presents the nucleus as behaving like a liquid, with modes of surface and volume oscillations of its own, ready to become excited isotopes by incoming neutrons. (A.C.)

Chromosome Y variants from different inbred mouse strains are linked to differences in the morphologic and molecular responses of cardiac cells to postpubertal testosterone

Directory of Open Access Journals (Sweden)

Churchill Gary A

2009-04-01

Full Text Available Abstract Background We have reported previously that when chromosome Y (chrY from the mouse strain C57BL/6J (ChrYC57 was substituted for that of A/J mice (ChrYA, cardiomyocytes from the resulting "chromosome substitution" C57BL/6J-chrYA strain were smaller than that of their C57BL/6J counterparts. In reverse, when chrYA from A/J mice was substituted for that of chrYC57, cardiomyocytes from the resulting A/J-chrYC57 strain were larger than in their A/J counterparts. We further used these strains to test whether: 1 the origin of chrY could also be linked to differences in the profile of gene expression in the hearts of adult male mice, and 2 post-pubertal testosterone could play a role in the differential morphologic and/or molecular effects of chrYC57 and chrYA. Results The increased size of cardiomyocytes from adult male C57BL/6J mice compared to C57BL/6J-chrYA resulted from the absence of hypertrophic effects of post-pubertal testosterone on cells from the latter strain. However, gene profiling revealed that the latter effect could not be explained on the basis of an insensitivity of cells from C57BL/6J-chrYA to androgens, since even more cardiac genes were affected by post-pubertal testosterone in C57BL/6J-chrYA hearts than in C57BL/6J. By testing for interaction between the effects of surgery and strain, we identified 249 "interaction genes" whose expression was affected by post-pubertal testosterone differentially according to the genetic origin of chrY. These interaction genes were found to be enriched within a limited number of signaling pathways, including: 1 p53 signaling, which comprises the interacting genes Ccnd1, Pten and Cdkn1a that are also potential co-regulators of the androgen receptors, and 2 circadian rhythm, which comprises Arntl/Bmal1, which may in turn regulate cell growth via the control of Cdkn1a. Conclusion Although post-pubertal testosterone increased the size of cardiomyocytes from male C56BL/6J mice but not that from

Reference Values of Reticulocyte Hemoglobin Content and Their Relation With Other Indicators of Iron Status in Healthy Children.

Science.gov (United States)

López-Ruzafa, Encarnación; Vázquez-López, Maria A; Lendinez-Molinos, Francisco; Poveda-González, Juan; Galera-Martínez, Rafael; Bonillo-Perales, Antonio; Martín-González, Manuel

2016-10-01

Reticulocyte hemoglobin content (CHr) is considered an indicator of functional iron deficiency, but is understudied in children. The goals of this study are to determine the reference intervals for CHr in healthy children, and their relation with iron parameters, erythropoiesis, and individual conditions. A total of 902 children without iron deficiency, aged 1 to 11 years were analyzed in a cross-sectional study. Besides a physical examination of the subjects and a questionnaire completed by their parents, the complete blood count, serum transferrin receptor, ferritin, transferrin saturation, erythrocyte protoporphyrin, serum erythropoietin, C-reactive protein, and CHr levels were measured. Changes in CHr, iron status, and erythropoiesis at different age intervals were analyzed and linear multiple regression was used to identify the factors that determine CHr variability. Mean value obtained for CHr was 30.9±1.8 pg (P2.5-P97.5: 26.9 to 34.3 pg), but the influence of age on CHr (the values increased with age) and on the iron parameters justified the establishment of different reference ranges. In addition to age, nutritional status, hematologic measurements, reticulocytes, transferrin saturation, and erythrocyte protoporphyrin accounted for 39% of CHr variability.

Make academic job advertisements fair to all

DEFF Research Database (Denmark)

Nielsen, Mathias Wullum

2015-01-01

Too many university posts are given to men without proper competition, says Mathias Wullum Nielsen......Too many university posts are given to men without proper competition, says Mathias Wullum Nielsen...

The relations of age and pubertal development with cortisol and daily stress in youth at clinical risk for psychosis.

Science.gov (United States)

Moskow, Danielle M; Addington, Jean; Bearden, Carrie E; Cadenhead, Kristin S; Cornblatt, Barbara A; Heinssen, Robert; Mathalon, Daniel H; McGlashan, Thomas H; Perkins, Diana O; Seidman, Larry J; Tsuang, Ming T; Cannon, Tyrone D; Woods, Scott W; Walker, Elaine F

2016-04-01

Prodromal syndromes often begin in adolescence - a period of neurodevelopmental changes and heightened stress sensitivity. Research has shown elevated stress and cortisol in individuals at clinical high risk (CHR) for psychosis. This cross-sectional study examined relations of age and pubertal status with cortisol and self-reported stress in healthy controls (HCs) and CHR adolescents. It was hypothesized that the relations of age and pubertal stage with cortisol and stress would be more pronounced in CHR youth. Participants were 93 HCs and 348 CHR adolescents from the North American Prodrome Longitudinal Study (NAPLS). At baseline, measures of stress (Daily Stress Inventory - DSI), Tanner stage (TS), and salivary cortisol were obtained. ANCOVA revealed increased DSI scores with age for both groups, and higher DSI scores in CHR adolescents than HCs, with a more pronounced difference for females. Contrary to prediction, with age controlled, HCs showed greater TS-related DSI increases. Analysis of cortisol showed no significant interactions, but a main effect of age and a trend toward higher cortisol in the CHR group. Correlations of cortisol with TS were higher in HC than CHR group. Stress measures increased with age in HC and CHR adolescents, and DSI scores also increased with TS in HCs. The results do not support a more pronounced age or TS increase in stress measures in CHR adolescents, but instead suggest that stress indices tend to be elevated earlier in adolescence in the CHR group. Potential determinants of findings and future directions are discussed. Copyright © 2016 Elsevier B.V. All rights reserved.

Aid reporting

DEFF Research Database (Denmark)

Keijzer, Niels; Fejerskov, Adam Moe

2016-01-01

It is disappointing that some member states have chosen to redirect toward domestic expenditure funds that would have otherwise gone to facilitate inclusive and sustainable international development, write Niels Keijzer and Adam Moe Fejerskov.......It is disappointing that some member states have chosen to redirect toward domestic expenditure funds that would have otherwise gone to facilitate inclusive and sustainable international development, write Niels Keijzer and Adam Moe Fejerskov....

Identification of novel genes associated with renal tertiary lymphoid organ formation in aging mice.

Science.gov (United States)

Huang, Yuan; Caputo, Christina R; Noordmans, Gerda A; Yazdani, Saleh; Monteiro, Luiz Henrique; van den Born, Jaap; van Goor, Harry; Heeringa, Peter; Korstanje, Ron; Hillebrands, Jan-Luuk

2014-01-01

A hallmark of aging-related organ deterioration is a dysregulated immune response characterized by pathologic leukocyte infiltration of affected tissues. Mechanisms and genes involved are as yet unknown. To identify genes associated with aging-related renal infiltration, we analyzed kidneys from aged mice (≥20 strains) for infiltrating leukocytes followed by Haplotype Association Mapping (HAM) analysis. Immunohistochemistry revealed CD45+ cell clusters (predominantly T and B cells) in perivascular areas coinciding with PNAd+ high endothelial venules and podoplanin+ lymph vessels indicative of tertiary lymphoid organs. Cumulative cluster size increased with age (analyzed at 6, 12 and 20 months). Based on the presence or absence of clusters in male and female mice at 20 months, HAM analysis revealed significant associations with loci on Chr1, Chr2, Chr8 and Chr14 in male mice, and with loci on Chr4, Chr7, Chr13 and Chr14 in female mice. Wisp2 (Chr2) showed the strongest association (P = 5.00×10(-137)) in male mice; Ctnnbip1 (P = 6.42×10(-267)) and Tnfrsf8 (P = 5.42×10(-245)) (both on Chr4) showed the strongest association in female mice. Both Wisp2 and Ctnnbip1 are part of the Wnt-signaling pathway and the encoded proteins were expressed within the tertiary lymphoid organs. In conclusion, this study revealed differential lymphocytic infiltration and tertiary lymphoid organ formation in aged mouse kidneys across different inbred mouse strains. HAM analysis identified candidate genes involved in the Wnt-signaling pathway that may be causally linked to tertiary lymphoid organ formation.

Family Perception and 6-Month Symptomatic and Functioning Outcomes in Young Adolescents at Clinical High Risk for Psychosis in a General Population in China.

Directory of Open Access Journals (Sweden)

Lu Wang

Full Text Available Given the difficulty of treating schizophrenia and other forms of psychosis, researchers have shifted focus to early detection and intervention of individuals at clinical high risk (CHR for psychosis. Previous studies have shown that elements in family functioning could predict symptom outcome in CHR individuals. However, associations between self reported family functioning and symptom or functioning outcome of CHR individuals was rarely reported. Our study aimed to investigate the characteristics and the role of family functioning in the development of CHR individuals among young adolescents.A sample of 32 CHR individuals was recruited from 2800 university students. The characteristics of family perception were evaluated by both Family Assessment Device (FAD and Family cohesion and adaptability evaluation Scale II (FACES II. 6 month follow up data was available with 25 of the recruited CHR individuals. Baseline socio-demographic characteristics and family functioning were compared between CHR and control group. We also measured the associations between different dimensions of perceived family functioning and both severity of prodromal symptoms and global functioning at baseline and 6-month follow up.CHR individuals showed more maladaptive family functioning compared to control in nearly all of the dimensions of FAD and FACES II except for Affective Involvement. Better Problem Solving and Affective Responsiveness predicted less severe positive and negative symptoms respectively. Family cohesion and adaptability were not only correlated with the baseline severity of general symptoms, but also positively associated with the general and disorganized symptom outcome.This study contributed preliminary evidence towards the associations between family perception and symptom outcome of CHR individuals. It also provided evidence for the importance of family interventions on CHR individuals.

Neuropsychology of the Prodrome to Psychosis in the NAPLS Consortium: Relationship to Family History and Conversion to Psychosis

Science.gov (United States)

Seidman, Larry J.; Giuliano, Anthony J.; Meyer, Eric C.; Addington, Jean; Cadenhead, Kristin S.; Cannon, Tyrone D.; McGlashan, Thomas H.; Perkins, Diana O.; Tsuang, Ming T.; Walker, Elaine F.; Woods, Scott W.; Bearden, Carrie E.; Christensen, Bruce K.; Hawkins, Keith; Heaton, Robert; Keefe, Richard S. E.; Heinssen, Robert; Cornblatt, Barbara A.

2011-01-01

Context Early detection and prospective evaluation of clinical high-risk (CHR) individuals who may develop schizophrenia or other psychotic disorders is critical for predicting psychosis onset and for testing preventive interventions. Objective To elucidate the neuropsychology of the CHR syndrome, to determine the association of neuropsychological function with conversion to psychosis and family history (FH) of psychosis, and to examine whether baseline neuropsychological functioning predicts subsequent psychosis. Design, Setting, and Participants Longitudinal study with 2 1/2 years follow-up of 304 prospectively identified CHR individuals meeting Structured Interview for Prodromal Syndromes (SIPS) criteria, 52 non-CHR persons with a FH of psychosis in first- or second-degree relatives (“family HR”/FHR), and 193 normal controls with neither a FH of psychosis nor a CHR syndrome, all of whom had baseline neuropsychological evaluations, recruited across eight centers as part of the North American Prodrome Longitudinal Study (NAPLS). Main Measures A neurocognitive composite score, eight individual neuropsychological measures, an IQ estimate, and HR status. Results Global (“composite”) neuropsychological functioning was comparably impaired in CHR and FHR groups compared to controls, but profiles differed significantly between groups. Neuropsychological functioning in the CHR group was significantly lower in persons who progressed to psychosis than in those who did not, and worst in the subgroup with a FH of psychosis. Tests of processing speed and verbal learning and memory were most sensitive in discriminating CHR from controls, although reductions were less severe than in established schizophrenia. Neuropsychological functioning did not contribute uniquely to the prediction of psychosis beyond clinical criteria, but worse verbal memory predicted more rapid conversion. Conclusion These findings document that CHR individuals have significant neuropsychological

The Jervell and Lange-Nielsen syndrome; atrial pacing combined with ß-blocker therapy, a favorable approach in young high-risk patients with long QT syndrome?

Science.gov (United States)

Früh, Andreas; Siem, Geir; Holmström, Henrik; Døhlen, Gaute; Haugaa, Kristina H

2016-11-01

Patients with Jervell and Lange-Nielsen syndrome (JLNS) exhibit severe phenotypes that are characterized by congenital deafness, very long QT intervals, and high risk of life-threatening arrhythmias. Current treatment strategies include high doses of beta-blocker medication, left cardiac sympathetic denervation, and ICD placement, which is challenging in young children. The purpose of this study was to evaluate the safety and effect of pacing in addition to beta-blocker treatment in children with JLNS. All genetically confirmed patients with JLNS born since 1999 in Norway were included in the study. Data on history of long QT syndrome-related symptoms, QT interval, and beta-blocker and pacemaker treatment were recorded. A total of 9 patients with QT intervals ranging from 510 to 660 ms were identified. Eight patients developed long QT syndrome-related symptoms, and 1 patient died before diagnosis. The survivors received beta-blocker medication. Seven patients also received a pacemaker; 1 had a ventricular lead and 6 had atrial leads. The patient with the ventricular lead died during follow-up. The 6 patients with atrial leads survived without events at a mean follow-up of 6.9 years after pacemaker implantation. Two patients received prophylactic upgrade to a 2-chamber ICD. No arrhythmic events occurred in 6 very young JLNS patients who received atrial pacing in combination with increased doses of beta-blockers during 7-year follow-up. If confirmed in additional patients, this treatment strategy may prevent life-threatening arrhythmias in this high-risk patient group and may act as a bridge to insertion of a 2-chamber ICD when left cardiac sympathetic denervation is not available. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

Channelrhodopsin-2 localised to the axon initial segment.

Directory of Open Access Journals (Sweden)

Matthew S Grubb

2010-10-01

Full Text Available The light-gated cation channel Channelrhodopsin-2 (ChR2 is a powerful and versatile tool for controlling neuronal activity. Currently available versions of ChR2 either distribute uniformly throughout the plasma membrane or are localised specifically to somatodendritic or synaptic domains. Localising ChR2 instead to the axon initial segment (AIS could prove an extremely useful addition to the optogenetic repertoire, targeting the channel directly to the site of action potential initiation, and limiting depolarisation and associated calcium entry elsewhere in the neuron. Here, we describe a ChR2 construct that we localised specifically to the AIS by adding the ankyrinG-binding loop of voltage-gated sodium channels (Na(vII-III to its intracellular terminus. Expression of ChR2-YFP-Na(vII-III did not significantly affect the passive or active electrical properties of cultured rat hippocampal neurons. However, the tiny ChR2 currents and small membrane depolarisations resulting from AIS targeting meant that optogenetic control of action potential firing with ChR2-YFP-Na(vII-III was unsuccessful in baseline conditions. We did succeed in stimulating action potentials with light in some ChR2-YFP-Na(vII-III-expressing neurons, but only when blocking KCNQ voltage-gated potassium channels. We discuss possible alternative approaches to obtaining precise control of neuronal spiking with AIS-targeted optogenetic constructs and propose potential uses for our ChR2-YFP-Na(vII-III probe where subthreshold modulation of action potential initiation is desirable.

Qualitative and quantitative expression status of the human chromosome 20 genes in cancer tissues and the representative cell lines.

Science.gov (United States)

Wang, Quanhui; Wen, Bo; Yan, Guangrong; Wei, Junying; Xie, Liqi; Xu, Shaohang; Jiang, Dahai; Wang, Tingyou; Lin, Liang; Zi, Jin; Zhang, Ju; Zhou, Ruo; Zhao, Haiyi; Ren, Zhe; Qu, Nengrong; Lou, Xiaomin; Sun, Haidan; Du, Chaoqin; Chen, Chuangbin; Zhang, Shenyan; Tan, Fengji; Xian, Youqi; Gao, Zhibo; He, Minghui; Chen, Longyun; Zhao, Xiaohang; Xu, Ping; Zhu, Yunping; Yin, Xingfeng; Shen, Huali; Zhang, Yang; Jiang, Jing; Zhang, Chengpu; Li, Liwei; Chang, Cheng; Ma, Jie; Yan, Guoquan; Yao, Jun; Lu, Haojie; Ying, Wantao; Zhong, Fan; He, Qing-Yu; Liu, Siqi

2013-01-04

Under the guidance of the Chromosome-centric Human Proteome Project (C-HPP), (1, 2) we conducted a systematic survey of the expression status of genes located at human chromosome 20 (Chr.20) in three cancer tissues, gastric, colon, and liver carcinoma, and their representative cell lines. We have globally profiled proteomes in these samples with combined technology of LC-MS/MS and acquired the corresponding mRNA information upon RNA-seq and RNAchip. In total, 323 unique proteins were identified, covering 60% of the coding genes (323/547) in Chr.20. With regards to qualitative information of proteomics, we overall evaluated the correlation of the identified Chr.20 proteins with target genes of transcription factors or of microRNA, conserved genes and cancer-related genes. As for quantitative information, the expression abundances of Chr.20 genes were found to be almost consistent in both tissues and cell lines of mRNA in all individual chromosome regions, whereas those of Chr.20 proteins in cells are different from tissues, especially in the region of 20q13.33. Furthermore, the abundances of Chr.20 proteins were hierarchically evaluated according to tissue- or cancer-related distribution. The analysis revealed several cancer-related proteins in Chr.20 are tissue- or cell-type dependent. With integration of all the acquired data, for the first time we established a solid database of the Chr.20 proteome.

Evaluating the relationship between cannabis use and IQ in youth and young adults at clinical high risk of psychosis.

Science.gov (United States)

Buchy, Lisa; Seidman, Larry J; Cadenhead, Kristin S; Cannon, Tyrone D; Cornblatt, Barbara A; McGlashan, Thomas H; Perkins, Diana O; Stone, William; Tsuang, Ming T; Walker, Elaine F; Woods, Scott W; Bearden, Carrie E; Mathalon, Daniel H; Addington, Jean

2015-12-30

Among people with psychosis, those with a history of cannabis use show better cognitive performance than those who are cannabis naïve. It is unknown whether this pattern is present in youth at clinical high risk (CHR) of psychosis. We evaluated relationships between IQ and cannabis use while controlling for use of other substances known to impact cognition in 678 CHR and 263 healthy control (HC) participants. IQ was estimated using the Vocabulary and Block Design subtests of the Wechsler Abbreviated Scale of Intelligence. Drug and alcohol use severity and frequency were assessed with the Alcohol and Drug Use Scale, and we inquired participants' age at first use. CHR were further separated into early and late age at onset of cannabis use sub-groups, and low-, moderate- and high-frequency sub-groups. No significant differences in IQ emerged between CHR or HC cannabis users vs. non-users, or between use frequency groups. CHR late-onset users showed significantly higher IQ than CHR early-onset users. Age at onset of cannabis use was significantly and positively correlated with IQ in CHR only. Results suggest that age at onset of cannabis may be a more important factor for IQ than use current use or use frequency in CHR. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

A novel KCNQ1 nonsense variant in the isoform-specific first exon causes both jervell and Lange-Nielsen syndrome 1 and long QT syndrome 1: a case report.

Science.gov (United States)

Nishimura, Motoi; Ueda, Marehiko; Ebata, Ryota; Utsuno, Emi; Ishii, Takuma; Matsushita, Kazuyuki; Ohara, Osamu; Shimojo, Naoki; Kobayashi, Yoshio; Nomura, Fumio

2017-06-08

According to previous KCNQ1 (potassium channel, voltage gated, KQT-like subfamily, member 1) gene screening studies, missense variants, but not nonsense or frame-shift variants, cause the majority of long QT syndrome (LQTS; Romano-Ward syndrome [RWS]) 1 cases. Several missense variants are reported to cause RWS by a dominant-negative mechanism, and some KCNQ1 variants can cause both Jervell and Lange-Nielsen Syndrome (JLNS; in an autosomal recessive manner) and LQTS1 (in an autosomal dominant manner), while other KCNQ1 variants cause only JLNS. The human KCNQ1 gene is known to have two transcript isoforms (kidney isoform and pancreas isoform), and both isoforms can form a functional cardiac potassium channel. Here, we report a novel nonsense KCNQ1 variant causing not only JLNS, but also significant QTc prolongation identical to RWS in an autosomal dominant manner. Our case study supports that haploinsufficiency in the KCNQ1 gene is causative of significant QTc prolongation identical to RWS. Interestingly, the nonsense variant (NM_000218.2:c.115G > T [p.Glu39X]) locates in exon 1a of KCNQ1, which is a kidney-isoform specific exon. The variant is located closer to the N-terminus than previously identified nonsense or frame-shift variants. To the best of our knowledge, this is the first report showing that a nonsense variant in exon 1a of KCNQ1, which is the kidney-isoform specific exon, causes JLNS. Our findings may be informative to the genetic pathogenesis of RWS and JLNS caused by KCNQ1 variants.

Building capacity and capabilty at the front line of care – North Zealand Hospital’s Leadership Program

DEFF Research Database (Denmark)

von Plessen, Christian; Ulriksen, Inge; Nielsen, Lisbeth

24.Ulriksen I, Nielsen L, Plessen von C, . International Forum on Quality and Safety in Health Care, London April 2015......24.Ulriksen I, Nielsen L, Plessen von C, . International Forum on Quality and Safety in Health Care, London April 2015...

Clinical Significance of Reticulocyte Hemoglobin Content in the Diagnosis of Iron Deficiency Anemia

Directory of Open Access Journals (Sweden)

Mustafa Karagülle

2013-06-01

Full Text Available OBJECTIVE: The aim of this study was to evaluate the clinical significance of reticulocyte hemoglobin content (CHr in the diagnosis of iron deficiency anemia (IDA and to compare it with other conventional iron parameters. METHODS: A total of 32 female patients with IDA (serum hemoglobin 120 g/L and serum ferritin <20 ng/mL were enrolled. RESULTS: CHr was 24.95±3.92 pg in female patients with IDA and 29.93±2.96 pg in female patients with iron deficiency. CHr showed a significant positive correlation with hemoglobin, mean corpuscular volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration, serum iron, and transferrin saturation and a significant negative correlation with transferrin and total iron-binding capacity. The cut-off value of CHr for detecting IDA was 29 pg. CONCLUSION: Our data demonstrate that CHr is a useful parameter that can be confidently used in the diagnosis of IDA, and a CHr cut-off value of 29 pg predicts IDA.

12041_2017_864_MOESM1_ESM.docx

Indian Academy of Sciences (India)

sony

6, rs4970834, T/C, chr1:109814880, CELSR2, intronic, TC↓. 7, rs599839, G/A ... 10, rs10127775, T/A, chr1:230295789, GALNT2, intronic, HDL↓. 11, rs780092, G/ ... 18, rs3812316, G/C, chr7:73020337, MLXIPL, coding, TG↑. 19, rs327, G/T ...

Adolescents at clinical-high risk for psychosis: Circadian rhythm disturbances predict worsened prognosis at 1-year follow-up.

Science.gov (United States)

Lunsford-Avery, Jessica R; Gonçalves, Bruno da Silva Brandão; Brietzke, Elisa; Bressan, Rodrigo A; Gadelha, Ary; Auerbach, Randy P; Mittal, Vijay A

2017-11-01

Individuals with psychotic disorders experience disruptions to both the sleep and circadian components of the sleep/wake cycle. Recent evidence has supported a role of sleep disturbances in emerging psychosis. However, less is known about how circadian rhythm disruptions may relate to psychosis symptoms and prognosis for adolescents with clinical high-risk (CHR) syndromes. The present study examines circadian rest/activity rhythms in CHR and healthy control (HC) youth to clarify the relationships among circadian rhythm disturbance, psychosis symptoms, psychosocial functioning, and the longitudinal course of illness. Thirty-four CHR and 32 HC participants were administered a baseline evaluation, which included clinical interviews, 5days of actigraphy, and a sleep/activity diary. CHR (n=29) participants were re-administered clinical interviews at a 1-year follow-up assessment. Relative to HC, CHR youth exhibited more fragmented circadian rhythms and later onset of nocturnal rest. Circadian disturbances (fragmented rhythms, low daily activity) were associated with increased psychotic symptom severity among CHR participants at baseline. Circadian disruptions (lower daily activity, rhythms that were more fragmented and/or desynchronized with the light/dark cycle) also predicted severity of psychosis symptoms and psychosocial impairment at 1-year follow-up among CHR youth. Circadian rhythm disturbances may represent a potential vulnerability marker for emergence of psychosis, and thus, rest/activity rhythm stabilization has promise to inform early-identification and prevention/intervention strategies for CHR youth. Future studies with longer study designs are necessary to further examine circadian rhythms in the prodromal period and rates of conversion to psychosis among CHR teens. Copyright © 2017. Published by Elsevier B.V.

A chimeric receptor of the insulin-like growth factor receptor type 1 (IGFR1) and a single chain antibody specific to myelin oligodendrocyte glycoprotein activates the IGF1R signalling cascade in CG4 oligodendrocyte progenitors.

Science.gov (United States)

Annenkov, Alexander; Rigby, Anne; Amor, Sandra; Zhou, Dun; Yousaf, Nasim; Hemmer, Bernhard; Chernajovsky, Yuti

2011-08-01

In order to generate neural stem cells with increased ability to survive after transplantation in brain parenchyma we developed a chimeric receptor (ChR) that binds to myelin oligodendrocyte glycoprotein (MOG) via its ectodomain and activates the insulin-like growth factor receptor type 1 ‎‎(IGF1R) signalling cascade. Activation of this pro-survival pathway in response to ligand broadly available in the brain might increase neuroregenerative potential of transplanted precursors. The ChR was produced by fusing a MOG-specific single ‎chain antibody with the extracellular boundary of the IGF1R transmembrane segment. The ChR is expressed on the cellular surface, predominantly as a monomer, and is not N-glycosylated. To show MOG-dependent functionality of the ChR, neuroblastoma cells B104 expressing this ChR were stimulated with monolayers of cells expressing recombinant MOG. The ChR undergoes MOG-dependent tyrosine phosphorylation and homodimerisation. It promotes insulin and IGF-independent growth of the oligodendrocyte progenitor cell line CG4. The proposed mode of the ChR activation is by MOG-induced dimerisation which promotes kinase domain transphosphorylation, by-passing the requirement of conformation changes known to be important for IGF1R activation. Another ChR, which contains a segment of the β-chain ectodomain, was produced in an attempt to recapitulate some of these conformational changes, but proved non-functional. 2011 Elsevier B.V. All rights reserved.

Knowledge sharing through social media: Investigating trends and technologies in a global marketing and advertising research company

Directory of Open Access Journals (Sweden)

Dina Adamovic

2012-02-01

Full Text Available Background: The purpose of this study was to investigate social media technology trends in Nielsen – a global information and measurement company – and to establish how these technologies can help the company to create a knowledge-sharing culture.Objective: The objective of this study was to investigate trends in knowledge-sharing technologies in Nielsen.Method: The researchers distributed semi-structured questionnaires to a sample of employees in Nielsen’s Television Audience Measurement Department. They also conducted interviews with specific employees in this department to gain a better understanding of employees’ attitudes toward, and perceptions of, the use of social media tools for creating a knowledgesharing culture at Nielsen. The researchers validated the data to see whether it could support the research and used triangulation to create a holistic view of the data they received from the questionnaires.Results: The findings of the study revealed that respondents had a positive attitude to sharing knowledge with one another through using social media tools. However, some respondents thought that technology, in general, was ‘the tree of good and evil’. The survey findings showed that Nielsen did have social media tools. However, not all employees were aware of these tools or were willing to use the tools to share knowledge. This study highlighted the possible advantages of the social media for sharing knowledge and how Nielsen could use the tools more widely.Conclusion: In order for a knowledge sharing culture to thrive at Nielsen, its employees need to engage more with social media tools in their business practices. 

Recent developments in quantum field theory

International Nuclear Information System (INIS)

Ambjoern, J.; Petersen, J.L.; Durhuus, B.J.

1985-01-01

This is the second volume in a set of three containing the proceedings of 3 conferences held in Copenhagen, to mark the centennial of Niels Bohr. The purpose of this symposium was to bring together theoretical particle physicists to discuss the present status and, in particular, the latest developments in quantum field theory, in their broadest aspects. This volume contains the main 19 lectures and reflects the contemporary status of a line of development, one of whose initiators was Niels Bohr. (orig.)

Mapping of murine radiation-induced acute myeloid leukaemia susceptibility loci

International Nuclear Information System (INIS)

Darakhshan, F.

2001-01-01

Studies on radiation-induced AML have shown characteristic phenotypic variation in susceptibility amongst inbred mouse strains, suggesting the involvement of genetic factors in determining the development of AML post-irradiation exposure. The main objective of the present study therefore was to identify and map markers in linkage disequilibrium with gene variants associated with influencing susceptibility to radiation induced AML in mice. Given Chr 2 abnormalities are characteristic of AML in mice, this feature was exploited in an effort to overcome the long latency for AML development. Analysis of Chr 2 aberrations at 24 and 48 h following irradiation established a positive correlation between Chr 2 radiosensitivity and radiation-AML susceptibility thus validating the choice of substitute assay. The analysis also resulted in the identification of a further trait, additional to Chr 2 radiosensitivity, termed overall chromosome radiosensitivity. Genetic mapping of Chr 2 radiosensitivity using public domain microsatellite database information resulted in the definition of cluster regions on 7 different chromosomes. Further genotyping reduced the candidate regions to 3 specific regions of interest. A test of allelic association could not ascertain a conclusive link between markers at these regions and the Chr 2 radiosensitivity/radiation-AML susceptibility phenotype. However, a region on Chr 4 around D4Mit221 appears to be most strongly associated. Similar studies identified three chromosomal regions of interest (on Chrs 4, 8 and 16) associated with overall chromosome radiosensitivity trait. An independent mapping strategy using F3 RCS confirmed the likely involvement of two of the candidate Chr 2 radiosensitivity regions identified by the inbred analysis including that on Chr 4 and also highlighted phenotypic heterogeneity amongst resistant RC strains, suggesting the influence of multiple alleles in specific phenotypes. RFLP analysis of candidate genes, localised on

Discontinuous groups of isometries in the hyperbolic plane

CERN Document Server

Nielsen, Jakob; Schmidt, Asmus L

2002-01-01

Fuchsian groups play a central role in various important fields of mathematics. The current book is based on what became known as the famous Fenchel-Nielsen manuscript. Jakob Nielsen (1890-1959) started this project well before World War II, Werner Fenchel (1905-1988) joined later and overtook the much of the preparation of the manuscript. Professor Asmus Schmidt (University of Copenhagen) is the editor of this first publication in book form of the Fenchel-Nielsen notes. It is on his initiative that the long and difficult way of getting the original notes into the proper shape ready for public

The Colliderscope: a real-time show

CERN Multimedia

Francesco Poppi

2010-01-01

Ninety-six LED lights distributed over the facade of the Niels Bohr Institute (NBI) in Blegdamsvej (Denmark) reproduce the actual signals coming from the Transition Radiation Detector (TRT) in ATLAS. Thanks to the Colliderscope, when a collision occurs below the ground in Geneva, people passing by in Blegdamsvej will be aware of it almost in real-time.   Niels Bohr Institute facade lit up to reflect the latest data from ATLAS-TRT . The pattern, intensity and duration of the Colliderscope’s flashes of light depend on the physical parameters of particles crossing the ATLAS TRT detector. “At the Colliderscope very little happens randomly”, explains Troels Petersen, a physicist at NBI and one of the people who conceived it. “Particularly interesting events, such as electrons, are shown by a bright light that remains on the facade for several seconds”. The Niels Bohr Institute has participated in the development of the TRT detector, and this is why t...

Niels Bohr and the Atomic Structure

Indian Academy of Sciences (India)

IAS Admin

principle with the restriction that no more than two electrons occupy a given ... displacement laws. Early in his ... The only difference between them is their atomic weight. F Soddy ... validity, Bohr took his theory to Rutherford. Unfortunately,.

Genetic analysis of autoimmune sialadenitis in nonobese diabetic mice: a major susceptibility region on chromosome 1.

Science.gov (United States)

Boulard, Olivier; Fluteau, Guy; Eloy, Laure; Damotte, Diane; Bedossa, Pierre; Garchon, Henri-Jean

2002-04-15

The nonobese diabetic (NOD) mouse strain provides a good study model for Sjögren's syndrome (SS). The genetic control of SS was investigated in this model using different matings, including a (NOD x C57BL/6 (B6))F(2) cross, a (NOD x NZW)F(2) cross, and ((NOD x B6) x NOD) backcross. Multiple and different loci were detected depending on parent strain combination and sex. Despite significant complexity, two main features were prominent. First, the middle region of chromosome 1 (chr.1) was detected in all crosses. Its effect was most visible in the (NOD x B6)F(2) cross and dominated over that of other loci, including those mapping on chr.8, 9, 10, and 16; the effect of these minor loci was observed only in the absence of the NOD haplotype on chr.1. Most critically, the chr.1 region was sufficient to trigger an SS-like inflammatory infiltrate of salivary glands as shown by the study of a new C57BL/6 congenic strain carrying a restricted segment derived from NOD chr.1. Second, several chromosomal regions were previously associated with NOD autoimmune phenotypes, including Iddm (chr.1, 2, 3, 9, and 17, corresponding to Idd5, Idd13, Idd3, Idd2, and Idd1, respectively), accounting for the strong linkage previously reported between insulitis and sialitis, and autoantibody production (chr.10 and 16, corresponding to Bana2 and Bah2, respectively). Interestingly, only two loci were detected in the (NOD x NZW)F(2) cross, on chr.1 in females and on chr.7 in males, probably because of the latent autoimmune predisposition of the NZW strain. Altogether these findings reflect the complexity and heterogeneity of human SS.

Development of Joint Climate and Discharge Projections for the International Rhine River Basin - the CHR RheinBlick2050 Project

Science.gov (United States)

Görgen, K.; Pfister, L.

2008-12-01

The anticipated climate change will lead to modified hydro-meteorological regimes that influence discharge behaviour and hydraulics of rivers. This has variable impacts on managed (anthropogenic) and unmanaged (natural) systems, depending on their sensitivity and vulnerability (ecology, economy, infrastructure, transport, energy production, water management, etc.). Decision makers in these contexts need adequate adaptation strategies to minimize adverse effects of climate change, i.e. an improved knowledge on the potential impacts including uncertainties means an extension of the informed options open to users. The goal of the highly applied study presented here is the development of joint, consistent climate and discharge projections for the international Rhine River catchments (Switzerland, France, Germany, Netherlands) in order to assess future changes of hydro-meteorological regimes in the meso- and macroscale Rhine River catchments and to derive and improve the understanding of such impacts on hydrologic and hydraulic processes. The RheinBlick2050 project is an international effort initiated by the International Commission for the Hydrology of the Rhine Basin (CHR) in close cooperation with the International Commission for the Protection of the Rhine. The core experiment design foresees a data-synthesis, multi-model approach where (transient) (bias- corrected) regional climate change projections are used as forcing data for existing calibrated hydrological (and hydraulic) models at a daily temporal resolution over mesoscale catchments of the Rhine River. Mainly for validation purposes, hydro-meteorological observations from national weather services are compiled into a new consistent 5 km x 5 km reference dataset from 1961 to 2005. RCM data are mainly used from the ENSEMBLES project and other existing dynamical downscaling model runs to derive probabilistic ensembles and thereby also access uncertainties on a regional scale. A benchmarking is helping to

Bedste bog om Balkans beskidte krig

DEFF Research Database (Denmark)

Lund, Joachim

2018-01-01

Anmeldelse af: "Vi troede ikke, det kunne ske her. Jugoslaviens sammenbrud 1991-1999" af Christian Axboe Nielsen. Kristeligt Dagblads Forlag, 2018. 410 sider......Anmeldelse af: "Vi troede ikke, det kunne ske her. Jugoslaviens sammenbrud 1991-1999" af Christian Axboe Nielsen. Kristeligt Dagblads Forlag, 2018. 410 sider...

Hjemkomst til Homer

DEFF Research Database (Denmark)

Skyum-Nielsen, Erik

2015-01-01

Erik Skyum-Nielsen beskriver i sin artikel hvordan tre moderne danske forfattere, Bjørnvig, Nordbrandt og Rifbjerg, har henvist til og genbrugt de homeriske digte eller motiver herfra i deres digtning. Med udgangspunkt i Gérard Genettes overbegreb transtekstualitet viser Skyum-Nielsen os først...

Differential relations of locus of control to perceived social stress among help-seeking adolescents at low vs. high clinical risk of psychosis.

Science.gov (United States)

Millman, Zachary B; Weintraub, Marc J; Bentley, Eryn; DeVylder, Jordan E; Mittal, Vijay A; Pitts, Steven C; Thompson, Elizabeth; Demro, Caroline; Reeves, Gloria M; Schiffman, Jason

2017-06-01

Research suggests that perceived social stress influences illness presentation and course among youth in the clinical high-risk (CHR) phase of psychosis. Little is known, however, about the social cognitive factors associated with social stress perception in this population, particularly relative to youth with non-CHR psychopathology. Individuals with psychosis tend to endorse an external locus of control (LOC), which is associated with the stress response in healthy individuals. LOC may therefore be related to perceived social stress in youth at CHR. We examined the differential relations of self-reported LOC and perceived social stress, as measured by the Behavior Assessment System for Children, Second Edition, across 45 CHR and 65 help-seeking control (HSC) participants. Youth at CHR reported more social stress (F[1, 107]=6.28, p=0.01) and a more external LOC (F[1, 107]=4.98, p=0.03) than HSCs. Further, external LOC was more strongly associated with feelings of social stress in the CHR group relative to the HSC group (interaction: b=0.35, t[105]=2.32, psocial stress, however, were nonsignificant at internal levels of LOC (b=-2.0, t[105]=-0.72, p=0.48; f 2 =0.00). Results suggest that perceptions of uncontrollability over one's social environment may more often induce or exacerbate feelings of stress and tension in CHR youth relative to HSCs. A better understanding of the social cognition-stress relation may improve understanding of CHR phenomenology, etiology, and treatment. Copyright © 2016 Elsevier B.V. All rights reserved.

Learning to trust: social feedback normalizes trust behavior in first-episode psychosis and clinical high risk.

Science.gov (United States)

Lemmers-Jansen, Imke L J; Fett, Anne-Kathrin J; Hanssen, Esther; Veltman, Dick J; Krabbendam, Lydia

2018-06-13

Psychosis is characterized by problems in social functioning that exist well before illness onset, and in individuals at clinical high risk (CHR) for psychosis. Trust is an essential element for social interactions that is impaired in psychosis. In the trust game, chronic patients showed reduced baseline trust, impaired response to positive social feedback, and attenuated brain activation in reward and mentalizing areas. We investigated whether first-episode psychosis patients (FEP) and CHR show similar abnormalities in the neural and behavioral mechanisms underlying trust. Twenty-two FEP, 17 CHR, and 43 healthy controls performed two trust games, with a cooperative and an unfair partner in the fMRI scanner. Region of interest analyses were performed on mentalizing and reward processing areas, during the investment and outcome phases of the games. Compared with healthy controls, FEP and CHR showed reduced baseline trust, but like controls, learned to trust in response to cooperative and unfair feedback. Symptom severity was not associated with baseline trust, however in FEP associated with reduced response to feedback. The only group differences in brain activation were that CHR recruited the temporo-parietal junction (TPJ) more than FEP and controls during investment in the unfair condition. This hyper-activation in CHR was associated with greater symptom severity. Reduced baseline trust may be associated with risk for psychotic illness, or generally with poor mental health. Feedback learning is still intact in CHR and FEP, as opposed to chronic patients. CHR however show distinct neural activation patterns of hyper-activation of the TPJ.

The Role of Trauma and Stressful Life Events among Individuals at Clinical High Risk for Psychosis: A Review

Directory of Open Access Journals (Sweden)

Danessa Mayo

2017-04-01

Full Text Available The experience of childhood trauma (CT and stressful life events (SLEs is associated with subsequent development of a variety of mental health conditions, including psychotic illness. Recent research identifying adolescents and young adults at clinical high risk (CHR for psychosis allows for prospective evaluation of the impact of trauma and adverse life events on psychosis onset and other outcomes, addressing etiological questions that cannot be answered in studies of fully psychotic or non-clinical populations. This article provides a comprehensive review of the current emerging literature on trauma and adverse life events in the CHR population. Up to 80% of CHR youth endorse a lifetime history of childhood traumatic events and victimization (e.g., bullying. Several studies have shown that the experience of CT predicts psychosis onset among CHR individuals, while the literature on the influence of recent SLEs (e.g., death of a loved one remains inconclusive. Multiple models have been proposed to explain the link between trauma and psychosis, including the stress-vulnerability and stress-sensitivity hypotheses, with emphases on both cognitive processes and neurobiological mechanisms (e.g., the hypothalamic–pituitary–adrenal axis. Despite the preponderance of CHR individuals who endorse either CT or SLEs, no clinical trials have been conducted evaluating interventions for trauma in CHR youth to date. Furthermore, the current process of formal identification and assessment of trauma, SLEs, and their impact on CHR youth is inconsistent in research and clinical practice. Recommendations for improving trauma assessment, treatment, and future research directions in the CHR field are provided.

Padre Pio - stigmatiseret præst

DEFF Research Database (Denmark)

Hvidt, Niels Christian

2010-01-01

Verden er fuld af spændende beretninger om mænd og kvinder, der menes at have særlig kontakt til det guddommelige. Teolog Niels Christian Hvidt beretter om helgendyrkelsen af en af disse, den navnkundige italienske munk: Padre Pio.......Verden er fuld af spændende beretninger om mænd og kvinder, der menes at have særlig kontakt til det guddommelige. Teolog Niels Christian Hvidt beretter om helgendyrkelsen af en af disse, den navnkundige italienske munk: Padre Pio....

Religion

DEFF Research Database (Denmark)

Jensen, Niels Rosendal

2017-01-01

Anmeldelse af Niels Reehs "Secularization Revisited. Teaching of Religion and the State of Denmark" med afsæt i de nutidige kampe om kristendom og islam og med fremhævelse af Reehs forståelse af staten/religionen som en 'survival unit'.......Anmeldelse af Niels Reehs "Secularization Revisited. Teaching of Religion and the State of Denmark" med afsæt i de nutidige kampe om kristendom og islam og med fremhævelse af Reehs forståelse af staten/religionen som en 'survival unit'....

Constraint-based Word Segmentation for Chinese

DEFF Research Database (Denmark)

Christiansen, Henning; Bo, Li

2014-01-01

-hoc and statistically based methods. In this paper, we show experiments of implementing different approaches to CWSP in the framework of CHR Grammars [Christiansen, 2005] that provides a constraint solving approach to language analysis. CHR Grammars are based upon Constraint Handling Rules, CHR [Frühwirth, 1998, 2009......], which is a declarative, high-level programming language for specification and implementation of constraint solvers....

At være eller ikke at være

DEFF Research Database (Denmark)

Haarder, Jon Helt

2010-01-01

ERLEND LOE OG PETTER AMUNDSEN: EKSPEDITION SHAKESPEARE (Oversat fra norsk af Michael Lambæk Nielsen) 420 sider, 299 kr.Gyldendal Er udkommet To stjerner......ERLEND LOE OG PETTER AMUNDSEN: EKSPEDITION SHAKESPEARE (Oversat fra norsk af Michael Lambæk Nielsen) 420 sider, 299 kr.Gyldendal Er udkommet To stjerner...

Professor om kystsikring: Ingen universelle løsninger

DEFF Research Database (Denmark)

Arnbjerg-Nielsen, Karsten

2017-01-01

DEBAT: Der findes ikke universalløsninger mod stigende risiko for stormfloder, men løsninger skal findes, skriver Karsten Arnbjerg-Nielsen, professor ved DTU.......DEBAT: Der findes ikke universalløsninger mod stigende risiko for stormfloder, men løsninger skal findes, skriver Karsten Arnbjerg-Nielsen, professor ved DTU....

Knowledge sharing through social media: Investigating trends and technologies in a global marketing and advertising research company

Directory of Open Access Journals (Sweden)

Dina Adamovic

2012-07-01

Objective: The objective of this study was to investigate trends in knowledge-sharing technologies in Nielsen. Method: The researchers distributed semi-structured questionnaires to a sample of employees in Nielsen’s Television Audience Measurement Department. They also conducted interviews with specific employees in this department to gain a better understanding of employees’ attitudes toward, and perceptions of, the use of social media tools for creating a knowledgesharing culture at Nielsen. The researchers validated the data to see whether it could support the research and used triangulation to create a holistic view of the data they received from the questionnaires. Results: The findings of the study revealed that respondents had a positive attitude to sharing knowledge with one another through using social media tools. However, some respondents thought that technology, in general, was ‘the tree of good and evil’. The survey findings showed that Nielsen did have social media tools. However, not all employees were aware of these tools or were willing to use the tools to share knowledge. This study highlighted the possible advantages of the social media for sharing knowledge and how Nielsen could use the tools more widely. Conclusion: In order for a knowledge sharing culture to thrive at Nielsen, its employees need to engage more with social media tools in their business practices.

Regulatory cross-talk links Vibrio cholerae chromosome II replication and segregation.

Directory of Open Access Journals (Sweden)

Yoshiharu Yamaichi

2011-07-01

Full Text Available There is little knowledge of factors and mechanisms for coordinating bacterial chromosome replication and segregation. Previous studies have revealed that genes (and their products that surround the origin of replication (oriCII of Vibrio cholerae chromosome II (chrII are critical for controlling the replication and segregation of this chromosome. rctB, which flanks one side of oriCII, encodes a protein that initiates chrII replication; rctA, which flanks the other side of oriCII, inhibits rctB activity. The chrII parAB2 operon, which is essential for chrII partitioning, is located immediately downstream of rctA. Here, we explored how rctA exerts negative control over chrII replication. Our observations suggest that RctB has at least two DNA binding domains--one for binding to oriCII and initiating replication and the other for binding to rctA and thereby inhibiting RctB's ability to initiate replication. Notably, the inhibitory effect of rctA could be alleviated by binding of ParB2 to a centromere-like parS site within rctA. Furthermore, by binding to rctA, ParB2 and RctB inversely regulate expression of the parAB2 genes. Together, our findings suggest that fluctuations in binding of the partitioning protein ParB2 and the chrII initiator RctB to rctA underlie a regulatory network controlling both oriCII firing and the production of the essential chrII partitioning proteins. Thus, by binding both RctB and ParB2, rctA serves as a nexus for regulatory cross-talk coordinating chrII replication and segregation.

Synthesis and electro-optic properties of the chromophore-containing NLO polyarylate polymers

Science.gov (United States)

Ren, Haohui; Peng, Chengcheng; Bo, Shuhui; Fan, Guofang; Xu, Guangming; Zhao, Hui; Zhen, Zhen; Liu, Xinhou

2014-03-01

Base on the same two monomers, diphenolic acid (DPA) and isophthaloyl chloride (IPC), three chromophore-containing nonlinear optical (NLO) polyarylate polymers were prepared. A tricyanofuran (TCF)-acceptor type chromophore group was in main-chain (mPAR-chr1), side-chain (sPAR-chr1) and side-chain with a 1,1-bis(4-hydroxyphenyl)-1-phenyl-2,2,2-trifluoroethane (BPAPF) group (sPAR-F-chr1), respectively. The obtained polymers were characterized and evaluated by UV-Vis, 1H NMR, DSC and TGA. All the polymers exhibited good electro-optic (EO) activity. The relationship between EO coefficients (r33) and the chromophore concentration of the three polymers were also characterized and discussed. There were no obvious differences found in EO activity between mPAR-chr1 and sPAR-chr1 polyarylates with the same chromophore. The fluorinated block polyarylate sPAR-F-chr1 has the largest r33 value in these three polyarylates which is 52 pm/V at the wavelength of 1310 nm (which is almost twice the r33 value of normal polymers contained the same chormophore at the same content), when the concentration of chromophore 1 is 18wt.%. 85% of the r33 value was retained in the sPAR-F-chr1 after being heated at 85°C for 600 hours. The polymer sPAR-F-chr1, with good solubility, high Tg (above 200 °C) and side functional group at the same time, may probably be a practical NLO material. These properties make the new polyarylates have potential applications in EO devices such as EO modulators and switches.

Association Mapping of Ferrous, Zinc, and Aluminum Tolerance at the Seedling Stage in Indica Rice using MAGIC Populations

Directory of Open Access Journals (Sweden)

Lijun Meng

2017-10-01

Full Text Available Excessive amounts of metal are toxic and severely affect plant growth and development. Understanding the genetic control of metal tolerance is crucial to improve rice resistance to Fe, Zn, and Al toxicity. The multi-parent advanced generation inter-cross (MAGIC populations were genotyped using a 55 K rice SNP array and screened at the seedling stage for Fe, Zn, and Al toxicity using a hydroponics system. Association analysis was conducted by implementing a mixed linear model (MLM for each of the five MAGIC populations double cross DC1 (founders were SAGC-08, HHZ5-SAL9-Y3-Y1, BP1976B-2-3-7-TB-1-1, PR33282-B-8-1-1-1-1-1, double cross DC2 (founders of double cross were FFZ1, CT 16658-5-2-2SR-2-3-6MP, IR 68, IR 02A127, eight parents population 8way (founders were SAGC-08, HHZ5-SAL9-Y3-Y1, BP1976B-2-3-7-TB-1-1, PR33282-B-8-1-1-1-1-1, FFZ1, CT 16658-5-2-2SR-2-3-6MP, IR 68, IR 02A127, DC12 (DC1+DC2 and rice multi-parent recombinant inbred line population RMPRIL (DC1+DC2+8way. A total of 21, 30, and 21 QTL were identified for Fe, Zn, and Al toxicity tolerance, respectively. For multi tolerance (MT as Fe, Zn, and Al tolerance-related traits, three genomic regions, MT1.1 (chr.1: 35.4–36.3 Mb, MT1.2 (chr.1: 35.4–36.3 Mb, and MT3.2 (chr.3: 35.4-36.2 Mb harbored QTL. The chromosomal regions MT2.1 (chr.2: 2.4–2.8 Mb, MT2.2 (chr.2: 24.5–25.8 Mb, MT4 (chr.4: 1.2 Mb Mb, MT8.1 (chr.8: 0.7–0.9 Mb, and MT8.2 (chr.8: 2.2–2.4 Mb harbored QTL for Fe and Zn tolerance, while MT2.3 (chr.2: 30.5–31.6 Mb, MT3.1 (chr.3: 12.5–12.8 Mb, and MT6 (chr.6: 2.0–3.0 Mb possessed QTL for Al and Zn tolerance. The chromosomal region MT9.1 (chr.9: 14.2–14.7 Mb possessed QTL for Fe and Al tolerance. A total of 11 QTL were detected across different MAGIC populations and 12 clustered regions were detected under different metal conditions, suggesting that these genomic regions might constitute valuable regions for further marker-assisted selection (MAS in breeding

Health care and social care costs of pneumonia in Denmark: a register-based study of all citizens and patients with COPD in three municipalities

Directory of Open Access Journals (Sweden)

Brogaard SL

2015-10-01

Full Text Available Susanne Lausten Brogaard,1 Maj Britt Dahl Nielsen,1 Lars Ulrik Nielsen,2 Trine Mosegaard Albretsen,3 Morten Bundgaard,4 Niels Anker,1 Maja Appel,1 Kim Gustavsen,1 Rose-Marie Lindkvist,5 Anne Skjoldan,2 Grete Breinhild,3 Peter Bo Poulsen5 1COWI AS, Management - Health, Kongens Lyngby, 2Seniors and Health Department, Gladsaxe Municipality, Welfare Technology, Søborg, 3Elderly and Health Care Department, Lolland Municipality, Maribo, 4Department of Public Health, Holbaek Municipality, Holbaek, 5Pfizer Denmark ApS, Health & Value, Ballerup, Denmark Background: Pneumonia is a frequent lung infection and a serious illness, which is often diagnosed among patients hospitalized with acute exacerbations of COPD. The aim of this study was to estimate the attributable costs due to pneumonia among patients hospitalized with pneumonia compared to a matched general population control group without pneumonia hospitalization.Methods: This study includes citizens older than 18 years from three municipalities (n=142,344. Based on national registers and municipal data, the health and social care costs of pneumonia in the second half of 2013 are estimated and compared with propensity score-matched population controls.Results: The average health care costs of 383 patients hospitalized with pneumonia in the second half of 2013 were US$34,561 per patient. Among pneumonia patients with COPD, the costs were US$35,022. The attributable costs of patients with pneumonia compared to the population control group for the 6-month period were US$24,155 per case. Overall, the attributable costs for the 383 pneumonia cases amounted to US$9.25 million. Subgroup analyses showed that costs increased with age. The attributable costs due to pneumonia were highest among the 18–59-year-old and the 70–79-year-old patients. This difference is likely to reflect an increased risk of mortality among the pneumonia patients. Men have higher costs than women in the pneumonia group

An overexpression of chalcone reductase of Pueraria montana var. lobata alters biosynthesis of anthocyanin and 5'-deoxyflavonoids in transgenic tobacco.

Science.gov (United States)

Joung, Jae-youl; Kasthuri, G Mangai; Park, Ji-young; Kang, Won-jin; Kim, Hyun-soon; Yoon, Bong-sik; Joung, Hyouk; Jeon, Jae-heung

2003-03-28

We isolated the chalcone reductase (pl-chr) gene of Pueraria montana var. lobata by using a PCR strategy from cDNA pools of storage roots. A high level of expression of RNA was found in both stems and roots. The genomic Southern blot result suggests that pl-chr exists as a member of a small gene family. By introducing a pl-chr gene under the control of the 35S CaMV promoter into the pink-flowering Xanthi line of Nicotiana tabacum, the flower color was changed from pink to white-to-pink. The contents of anthocyanin in the flowers of the transgenic lines were dramatically decreased by 40%, but the total UV absorption compounds remained unchanged. The production of liquiritigenin in pl-chr overexpressed transgenic tobacco lines was confirmed by HPLC and MS analysis. The introduction of pl-chr gene provides a method to redirect the flavonoid pathway into 5'-deoxyflavonoid production in non-legume crops, in order to manipulate the phenylpropanoid pathway for isoflavonoid production.

A Trail of Roses

DEFF Research Database (Denmark)

Ørum, Tania

2015-01-01

Heissenbüttel and Max Bense. The Danish poet and critic Hans-Jørgen Nielsen Nielsen used Gertrude Stein as a prominent example in his campaign to widen the conception of literary texts in the conservative Danish context. In one of his essays he used Stein’s sentence: a rose is a rose is a rose is a rose...

Empathy in individuals clinically at risk for psychosis

DEFF Research Database (Denmark)

Derntl, B.; Michel, T. M.; Prempeh, P.

2015-01-01

no significant deficit in the CHR group. Functional data analysis revealed hyperactivation in a frontotemporoparietal network including the amygdala in the CHR group compared with the other two groups. Conclusions Despite normal behavioural performance, the CHR group activated the neural empathy network...... differently and specifically showed hyperactivation in regions critical for emotion processing. This could suggest a compensatory mechanism reflecting emotional hypersensitivity or dysfunctional emotion regulation. Further investigations should clarify the role of these neural alterations for development...... high risk for psychosis. Method Using functional magnetic resonance imaging, we measured 15 individuals at clinical high risk of psychosis (CHR group) and compared their empathy performance with 15 healthy volunteers and 15 patients with schizophrenia. Results Behavioural data analysis indicated...

Tumor-specific chromosome mis-segregation controls cancer plasticity by maintaining tumor heterogeneity.

Directory of Open Access Journals (Sweden)

Yuanjie Hu

Full Text Available Aneuploidy with chromosome instability is a cancer hallmark. We studied chromosome 7 (Chr7 copy number variation (CNV in gliomas and in primary cultures derived from them. We found tumor heterogeneity with cells having Chr7-CNV commonly occurs in gliomas, with a higher percentage of cells in high-grade gliomas carrying more than 2 copies of Chr7, as compared to low-grade gliomas. Interestingly, all Chr7-aneuploid cell types in the parental culture of established glioma cell lines reappeared in single-cell-derived subcultures. We then characterized the biology of three syngeneic glioma cultures dominated by different Chr7-aneuploid cell types. We found phenotypic divergence for cells following Chr7 mis-segregation, which benefited overall tumor growth in vitro and in vivo. Mathematical modeling suggested the involvement of chromosome instability and interactions among cell subpopulations in restoring the optimal equilibrium of tumor cell types. Both our experimental data and mathematical modeling demonstrated that the complexity of tumor heterogeneity could be enhanced by the existence of chromosomes with structural abnormality, in addition to their mis-segregations. Overall, our findings show, for the first time, the involvement of chromosome instability in maintaining tumor heterogeneity, which underlies the enhanced growth, persistence and treatment resistance of cancers.

Perceived social stress and symptom severity among help-seeking adolescents with versus without clinical high-risk for psychosis.

Science.gov (United States)

Millman, Zachary B; Pitts, Steven C; Thompson, Elizabeth; Kline, Emily R; Demro, Caroline; Weintraub, Marc J; DeVylder, Jordan E; Mittal, Vijay A; Reeves, Gloria M; Schiffman, Jason

2018-02-01

Research suggests that social stress exposure influences illness presentation and course among youth at clinical high-risk (CHR) for psychosis, though less is known about the extent to which self-reported perceptions of social stress relate to the severity of positive symptoms. Importantly, despite the notion that youth at CHR are especially susceptible to elevations in positive symptoms under conditions of stress, no study has examined this presumption relative to other psychiatric groups. Extending previous work demonstrating that perceived social stress was higher in a CHR group than in a clinical group of non-CHR, help-seeking controls, the current study aimed to: (1) examine whether perceived social stress is related to the severity of attenuated positive symptoms in the full sample (N=110); and (2) determine whether CHR status moderates the stress-symptom relation. Exploratory analyses examined relations of perceived social stress to negative, disorganized, and general symptoms. Greater perceptions of social stress were associated with more severe positive symptoms in the entire sample; however, although positive symptoms and perceived social stress were higher in the CHR group, the strength of this relation was statistically indistinguishable across groups. No differential effect of perceived social stress was observed for any symptom domain. Results provide some support for the diathesis-stress model of psychosis, while also suggesting that social stress and symptomatology are related independent of clinical vulnerability to psychosis. Future research would benefit from longitudinal studies of stress-symptom relations across CHR and help-seeking control groups. Copyright © 2017 Elsevier B.V. All rights reserved.

CHR AL IDRISSI OF KENITRA

African Journals Online (AJOL)

lanez

31 déc. 2014 ... prescription médicale, dans un objectif de diagnostic, dépistage, ... L'activité de cet emploi/métier s'exerce au sein de laboratoires (analyses médicales, recherche, ... Techniques de prélèvement biologique. Réaliser ... albicans, Pseudomonas, Syphilis, Les virus d'hépatite et le VIH) dans des prélèvements.

Identifying functional network changing patterns in individuals at clinical high-risk for psychosis and patients with early illness schizophrenia: A group ICA study

Directory of Open Access Journals (Sweden)

Yuhui Du

2018-01-01

Full Text Available Although individuals at clinical high risk (CHR for psychosis exhibit a psychosis-risk syndrome involving attenuated forms of the positive symptoms typical of schizophrenia (SZ, it remains unclear whether their resting-state brain intrinsic functional networks (INs show attenuated or qualitatively distinct patterns of functional dysconnectivity relative to SZ patients. Based on resting-state functional magnetic imaging data from 70 healthy controls (HCs, 53 CHR individuals (among which 41 subjects were antipsychotic medication-naive, and 58 early illness SZ (ESZ patients (among which 53 patients took antipsychotic medication within five years of illness onset, we estimated subject-specific INs using a novel group information guided independent component analysis (GIG-ICA and investigated group differences in INs. We found that when compared to HCs, both CHR and ESZ groups showed significant differences, primarily in default mode, salience, auditory-related, visuospatial, sensory-motor, and parietal INs. Our findings suggest that widespread INs were diversely impacted. More than 25% of voxels in the identified significant discriminative regions (obtained using all 19 possible changing patterns excepting the no-difference pattern from six of the 15 interrogated INs exhibited monotonically decreasing Z-scores (in INs from the HC to CHR to ESZ, and the related regions included the left lingual gyrus of two vision-related networks, the right postcentral cortex of the visuospatial network, the left thalamus region of the salience network, the left calcarine region of the fronto-occipital network and fronto-parieto-occipital network. Compared to HCs and CHR individuals, ESZ patients showed both increasing and decreasing connectivity, mainly hypo-connectivity involving 15% of the altered voxels from four INs. The left supplementary motor area from the sensory-motor network and the right inferior occipital gyrus in the vision-related network showed a

Characterization of genomic instability in Saccharomyces cerevisiae and engaging teaching strategies described in two curricula

Science.gov (United States)

Keller, Alexandra P.

Cancer arises through an accumulation of mutations in the genome. In cancer cells, mutations are frequently caused by DNA rearrangements, which include chromosomal breakages, deletions, insertions, and translocations. Such events contribute to genomic instability, a known hallmark of cancer. To study cycles of chromosomal instability, we are using baker's yeast as a model organism. In yeast, a ChrVII system was previously developed (Admire et al., 2006), in which a disomic yeast strain was used to identify regions of instability on ChrVII. Using this system, a fragile site on the left arm of ChrVII (Admire et al., 2006) was identified and characterized. This study led to insight into mechanisms involved in chromosomal rearrangements and mutations that arise from them as well as to an understanding of mechanisms involved in genomic instability. To further our understanding of genomic instability, I devised a strategy to study instability on a different chromosome (ChrV) (Figure 3), so that we could determine whether lessons learned from the ChrVII system are applicable to other chromosomes, and/or whether other mechanisms of instability could be identified. A suitable strain was generated and analyzed, and our findings suggest that frequencies of instability on the right arm of ChrV are similar to those found in ChrVII. The results from the work in ChrV described in this paper support the idea that the instability found on ChrVII is not an isolated occurrence. My research was supported by an NSF GK-12 grant. The aim of this grant is to improve science education in middle schools, and as part of my participation in this program, I studied and practiced effective science communication methodologies. In attempts to explain my research to middle school students, I collaborated with others to develop methods for explaining genetics and the most important techniques I used in my research. While developing these methods, I learned more about what motivates people to learn

Change of CD20 Expression in Diffuse Large B-Cell Lymphoma Treated with Rituximab, an Anti-CD20 Monoclonal Antibody: A Study of the Osaka Lymphoma Study Group

Directory of Open Access Journals (Sweden)

Naoki Wada

2009-10-01

Full Text Available Change of CD20 expression was examined in cases of diffuse large B-cell lymphoma (DLBCL. CD20 expression after treatment with anti-CD20 antibody (rituximab, Rx for DLBCL was examined in 23 cases who received serial biopsy by immunohistochemistry (IHC and flow cytometry (FCM. CD20– by IHC and/or FCM was defined as CD20–. Four cases were CD20– at initial biopsy but became CD20+ after chemotherapy with Rx (CH-R (group A. Recurrent tumors in three group A cases became resistant to CH-R. Initial and recurrent tumors were CD20+ before and after CH-R in 17 cases (group B. Tumors before CH-R were CD20– in two cases (group C and continued to be CD20– in one and turned CD20+ in the other with survival time after the relapse of 8 and 23 months, respectively. Evaluation of CD20 expression with immunohistochemical and flow cytometric methods is used for the prediction of responsiveness of relapsed DLBCL for CH-R.

Monitoring light-induced structural changes of Channelrhodopsin-2 by UV-visible and Fourier transform infrared spectroscopy.

Science.gov (United States)

Ritter, Eglof; Stehfest, Katja; Berndt, Andre; Hegemann, Peter; Bartl, Franz J

2008-12-12

Channelrhodopsin-2 (ChR2) is a microbial type rhodopsin and a light-gated cation channel that controls phototaxis in Chlamydomonas. We expressed ChR2 in COS-cells, purified it, and subsequently investigated this unusual photoreceptor by flash photolysis and UV-visible and Fourier transform infrared difference spectroscopy. Several transient photoproducts of the wild type ChR2 were identified, and their kinetics and molecular properties were compared with those of the ChR2 mutant E90Q. Based on the spectroscopic data we developed a model of the photocycle comprising six distinguishable intermediates. This photocycle shows similarities to the photocycle of the ChR2-related Channelrhodopsin of Volvox but also displays significant differences. We show that molecular changes include retinal isomerization, changes in hydrogen bonding of carboxylic acids, and large alterations of the protein backbone structure. These alterations are stronger than those observed in the photocycle of other microbial rhodopsins like bacteriorhodopsin and are related to those occurring in animal rhodopsins. UV-visible and Fourier transform infrared difference spectroscopy revealed two late intermediates with different time constants of tau = 6 and 40 s that exist during the recovery of the dark state. The carboxylic side chain of Glu(90) is involved in the slow transition. The molecular changes during the ChR2 photocycle are discussed with respect to other members of the rhodopsin family.

Systemic Therapy for Youth at Clinical High Risk for Psychosis: A Pilot Study

Directory of Open Access Journals (Sweden)

Jingyu Shi

2017-10-01

Full Text Available Psychosocial intervention trials for youth at clinical high risk (CHR for psychosis have shown promising effects on treating psychotic symptoms but have not focused on psychosocial functional outcomes, and those studies have been conducted among help-seeking patients; there is a lack of research on non-clinical young CHR individuals. Systemic therapy (ST is grounded in systemic-constructivist and psychosocial resilience theories. It has a number of advantages that makes it attractive for use with CHR individuals in non-clinical context. The present study evaluated the effect of ST for students at CHR on reducing symptoms and enhancing psychosocial function. This was a single-blind randomized controlled trial for CHR young people comparing ST to supportive therapy with a 6-month treatment. Psychotic and depressive symptoms (DS as well as self-esteem and social support (SS were assessed at pre- and posttreatment. 26 CHR individuals were randomly divided into intervention group (n = 13 and control group (n = 13. There were no significant differences in severity of symptoms, level of SS and self-esteem at baseline between the two groups (P > 0.05. At posttreatment, significant improvements in positive and DS as well as SS and self-esteem were observed in the ST group (P < 0.05; in the control group, these improvements were not significant (P > 0.05. The findings indicated that systemic intervention for university students at CHR for psychosis may have a positive effect on symptoms and self-esteem as well as SS in short term. More long-term research is needed to further evaluate this intervention.

Arrays of microLEDs and astrocytes: biological amplifiers to optogenetically modulate neuronal networks reducing light requirement.

Directory of Open Access Journals (Sweden)

Rolando Berlinguer-Palmini

Full Text Available In the modern view of synaptic transmission, astrocytes are no longer confined to the role of merely supportive cells. Although they do not generate action potentials, they nonetheless exhibit electrical activity and can influence surrounding neurons through gliotransmitter release. In this work, we explored whether optogenetic activation of glial cells could act as an amplification mechanism to optical neural stimulation via gliotransmission to the neural network. We studied the modulation of gliotransmission by selective photo-activation of channelrhodopsin-2 (ChR2 and by means of a matrix of individually addressable super-bright microLEDs (μLEDs with an excitation peak at 470 nm. We combined Ca2+ imaging techniques and concurrent patch-clamp electrophysiology to obtain subsequent glia/neural activity. First, we tested the μLEDs efficacy in stimulating ChR2-transfected astrocyte. ChR2-induced astrocytic current did not desensitize overtime, and was linearly increased and prolonged by increasing μLED irradiance in terms of intensity and surface illumination. Subsequently, ChR2 astrocytic stimulation by broad-field LED illumination with the same spectral profile, increased both glial cells and neuronal calcium transient frequency and sEPSCs suggesting that few ChR2-transfected astrocytes were able to excite surrounding not-ChR2-transfected astrocytes and neurons. Finally, by using the μLEDs array to selectively light stimulate ChR2 positive astrocytes we were able to increase the synaptic activity of single neurons surrounding it. In conclusion, ChR2-transfected astrocytes and μLEDs system were shown to be an amplifier of synaptic activity in mixed corticalneuronal and glial cells culture.

Arrays of microLEDs and astrocytes: biological amplifiers to optogenetically modulate neuronal networks reducing light requirement.

Science.gov (United States)

Berlinguer-Palmini, Rolando; Narducci, Roberto; Merhan, Kamyar; Dilaghi, Arianna; Moroni, Flavio; Masi, Alessio; Scartabelli, Tania; Landucci, Elisa; Sili, Maria; Schettini, Antonio; McGovern, Brian; Maskaant, Pleun; Degenaar, Patrick; Mannaioni, Guido

2014-01-01

In the modern view of synaptic transmission, astrocytes are no longer confined to the role of merely supportive cells. Although they do not generate action potentials, they nonetheless exhibit electrical activity and can influence surrounding neurons through gliotransmitter release. In this work, we explored whether optogenetic activation of glial cells could act as an amplification mechanism to optical neural stimulation via gliotransmission to the neural network. We studied the modulation of gliotransmission by selective photo-activation of channelrhodopsin-2 (ChR2) and by means of a matrix of individually addressable super-bright microLEDs (μLEDs) with an excitation peak at 470 nm. We combined Ca2+ imaging techniques and concurrent patch-clamp electrophysiology to obtain subsequent glia/neural activity. First, we tested the μLEDs efficacy in stimulating ChR2-transfected astrocyte. ChR2-induced astrocytic current did not desensitize overtime, and was linearly increased and prolonged by increasing μLED irradiance in terms of intensity and surface illumination. Subsequently, ChR2 astrocytic stimulation by broad-field LED illumination with the same spectral profile, increased both glial cells and neuronal calcium transient frequency and sEPSCs suggesting that few ChR2-transfected astrocytes were able to excite surrounding not-ChR2-transfected astrocytes and neurons. Finally, by using the μLEDs array to selectively light stimulate ChR2 positive astrocytes we were able to increase the synaptic activity of single neurons surrounding it. In conclusion, ChR2-transfected astrocytes and μLEDs system were shown to be an amplifier of synaptic activity in mixed corticalneuronal and glial cells culture.

Clinical high risk for psychosis

DEFF Research Database (Denmark)

van der Steen, Y; Gimpel-Drees, J; Lataster, T

2017-01-01

OBJECTIVE: The aim of this study was to assess associations between momentary stress and both affective and psychotic symptoms in everyday life of individuals at clinical high risk (CHR), compared to chronic psychotic patients and healthy controls, in search for evidence of early stress...... and 26 healthy controls. RESULTS: Multilevel models showed significantly larger associations between negative affect (NA) and activity-related stress for CHR patients than for psychotic patients (P = 0.008) and for CHR compared to controls (P

Preliminary psychometric properties of the brief Negative Symptom Scale in youth at Clinical High-Risk for psychosis.

Science.gov (United States)

Strauss, Gregory P; Chapman, Hannah C

2018-03-01

Preliminary psychometric properties of an adapted version of the Brief Negative Symptom Scale (BNSS) are reported in youth at Clinical High-Risk for psychosis (CHR). Participants included 29 CHR youth who met criteria for a prodromal syndrome on the Structured Interview for Prodromal Syndromes (SIPS). The adapted BNSS demonstrated excellent internal consistency, convergent validity, and discriminant validity, suggesting that the BNSS has utility for assessing negative symptoms in a CHR population. Copyright © 2017 Elsevier B.V. All rights reserved.

Computational optogenetics: empirically-derived voltage- and light-sensitive channelrhodopsin-2 model.

Directory of Open Access Journals (Sweden)

John C Williams

Full Text Available Channelrhodospin-2 (ChR2, a light-sensitive ion channel, and its variants have emerged as new excitatory optogenetic tools not only in neuroscience, but also in other areas, including cardiac electrophysiology. An accurate quantitative model of ChR2 is necessary for in silico prediction of the response to optical stimulation in realistic tissue/organ settings. Such a model can guide the rational design of new ion channel functionality tailored to different cell types/tissues. Focusing on one of the most widely used ChR2 mutants (H134R with enhanced current, we collected a comprehensive experimental data set of the response of this ion channel to different irradiances and voltages, and used these data to develop a model of ChR2 with empirically-derived voltage- and irradiance- dependence, where parameters were fine-tuned via simulated annealing optimization. This ChR2 model offers: 1 accurate inward rectification in the current-voltage response across irradiances; 2 empirically-derived voltage- and light-dependent kinetics (activation, deactivation and recovery from inactivation; and 3 accurate amplitude and morphology of the response across voltage and irradiance settings. Temperature-scaling factors (Q10 were derived and model kinetics was adjusted to physiological temperatures. Using optical action potential clamp, we experimentally validated model-predicted ChR2 behavior in guinea pig ventricular myocytes. The model was then incorporated in a variety of cardiac myocytes, including human ventricular, atrial and Purkinje cell models. We demonstrate the ability of ChR2 to trigger action potentials in human cardiomyocytes at relatively low light levels, as well as the differential response of these cells to light, with the Purkinje cells being most easily excitable and ventricular cells requiring the highest irradiance at all pulse durations. This new experimentally-validated ChR2 model will facilitate virtual experimentation in neural and

Community-acquired lower respiratory tract infections in HIV-infected patients on antiretroviral therapy: predictors in a contemporary cohort study.

Science.gov (United States)

Lamas, Cristiane C; Coelho, Lara E; Grinsztejn, Beatriz J; Veloso, Valdilea G

2017-12-01

Community-acquired pneumonia represents the most frequent bacterial infection in patients with HIV/AIDS. We aimed to assess variables associated with lower respiratory tract infection (LRTI) among HIV-infected adults using ART. A cohort study of HIV-infected patients aged ≥18 years, enrolled from 2000 to 2015, on ART for at least 60 days, with primary outcome as the 1st episode of LRTI during follow-up. The independent variables included were sex at birth, age, race/skin color, educational level, tobacco smoking, alcohol use, cocaine use, diabetes mellitus, CD4 count, HIV viral load, influenza and pneumococcal vaccination. Extended Cox proportional hazards models accounting for time-updated variables were fitted to assess LRTI predictors. 2669 patients were included; median follow-up was 3.9 years per patient. LRTI was diagnosed in 384 patients; incidence rate was 30.7/1000 PY. In the unadjusted Cox extended models, non-white race [crude hazard ratio (cHR) 1.28, p = 0.020], cocaine use (cHR 2.01, p < 0.001), tobacco smoking (cHR 1.34, p value 0.007), and HIV viral load ≥400 copies/mL (cHR 3.40, p < 0.001) increased the risk of LRTI. Lower risk of LRTI was seen with higher educational level (cHR 0.61, p < 0.001), rise in CD4 counts (cHR 0.81, p < 0.001, per 100 cells/mm 3 increase), influenza (cHR 0.60, p = 0.002) and pneumococcal vaccination (cHR 0.57, p < 0.001). In the adjusted model, aHR for CD4 count was 0.86, for cocaine use 1.47 and for viral load ≥400 copies 2.20. LRTI has a high incidence in HIV-infected adults using ART. Higher CD4 counts and undetectable viral loads were protective, as were pneumococcal and influenza vaccines.

National culture and business model change: a framework for successful expansions

DEFF Research Database (Denmark)

Dalby, J.; Nielsen, L.S.; Lueg, Rainer

2014-01-01

Dalby, J., Nielsen, Lueg, R., L. S., Pedersen, L., Tomoni, A. C. 2014. National culture and business model change: a framework for successful expansions. Journal of Enterprising Culture, 22(4): 379-498.......Dalby, J., Nielsen, Lueg, R., L. S., Pedersen, L., Tomoni, A. C. 2014. National culture and business model change: a framework for successful expansions. Journal of Enterprising Culture, 22(4): 379-498....

Die Asta and the Avant-Garde

DEFF Research Database (Denmark)

Thomsen, Bodil Marie Stavning

2013-01-01

The Danish film actress, Asta Nielsen, who became the first world famous film star after her success with The Abyss (1910), had a remarcable influence on what became the European avant-garde.......The Danish film actress, Asta Nielsen, who became the first world famous film star after her success with The Abyss (1910), had a remarcable influence on what became the European avant-garde....

Automated brightfield dual-color in situ hybridization for detection of mouse double minute 2 gene amplification in sarcomas.

Science.gov (United States)

Zhang, Wenjun; McElhinny, Abigail; Nielsen, Alma; Wang, Maria; Miller, Melanie; Singh, Shalini; Rueger, Ruediger; Rubin, Brian P; Wang, Zhen; Tubbs, Raymond R; Nagle, Raymond B; Roche, Pat; Wu, Ping; Pestic-Dragovich, Lidija

2011-01-01

The human homolog of the mouse double minute 2 (MDM2) oncogene is amplified in about 20% of sarcomas. The measurement of the MDM2 amplification can aid in classification and may provide a predictive value for recently formulated therapies targeting MDM2. We have developed and validated an automated bright field dual-color in situ hybridization application to detect MDM2 gene amplification. A repeat-depleted MDM2 probe was constructed to target the MDM2 gene region at 12q15. A chromosome 12-specific probe (CHR12) was generated from a pα12H8 plasmid. The in situ hybridization assay was developed by using a dinitrophenyl-labeled MDM2 probe and a digoxigenin-labeled CHR12 probe on the Ventana Medical Systems' automated slide-staining platforms. The specificity of the MDM2 and CHR12 probes was shown on metaphase spreads and further validated against controls, including normal human tonsil and known MDM2-amplified samples. The assay performance was evaluated on a cohort of 100 formalin-fixed, paraffin-embedded specimens by using a conventional bright field microscope. Simultaneous hybridization and signal detection for MDM2 and CHR12 showed that both DNA targets were present in the same cells. One hundred soft tissue specimens were stained for MDM2 and CHR12. Although 26 of 29 lipomas were nonamplified and eusomic, MDM2 amplification was noted in 78% of atypical lipomatous tumors or well-differentiated liposarcomas. Five of 6 dedifferentiated liposarcoma cases were amplified for MDM2. MDM2 amplification was observed in 1 of 8 osteosarcomas; 3 showed CHR12 aneusomy. MDM2 amplification was present in 1 of 4 chondrosarcomas. Nine of 10 synovial sarcomas displayed no evidence of MDM2 amplification in most tumor cells. In pleomorphic sarcoma, not otherwise specified (pleomorphic malignant fibrous histiocytoma), MDM2 was amplified in 38% of cases, whereas 92% were aneusomic for CHR12. One alveolar rhabdomyosarcoma and 2 embryonal rhabdomyosarcomas displayed low-level aneusomy

Deficient Suppression of Default Mode Regions during Working Memory in Individuals with Early Psychosis and at Clinical High-Risk for Psychosis.

Science.gov (United States)

Fryer, Susanna L; Woods, Scott W; Kiehl, Kent A; Calhoun, Vince D; Pearlson, Godfrey D; Roach, Brian J; Ford, Judith M; Srihari, Vinod H; McGlashan, Thomas H; Mathalon, Daniel H

2013-01-01

The default mode network (DMN) is a set of brain regions typically activated at rest and suppressed during extrinsic cognition. Schizophrenia has been associated with deficient DMN suppression, though the extent to which DMN dysfunction predates psychosis onset is unclear. This study examined DMN suppression during working memory (WM) performance in youth at clinical high-risk (CHR) for psychosis, early schizophrenia (ESZ) patients, and healthy controls (HC). We hypothesized that the DMN would show load-dependent suppression during WM retrieval in HC but not in ESZ, with CHR participants showing an intermediate pattern. fMRI data were collected from CHR (n = 32), ESZ (n = 22), and HC (n = 54) participants, ages 12-30. DMN regions were defined via seed-based connectivity analysis of resting-state fMRI data from an independent HC sample. Load-dependent deactivations of these DMN regions in response to WM probes were interrogated. Healthy controls showed linear load-dependent increases in DMN deactivation. Significant Group-by-Load interactions were observed in DMN regions including medial prefrontal and lateral posterior parietal cortices. Group-by-Load effects in posterior DMN nodes resulted from less suppression at higher WM loads in ESZ relative to HC, with CHR differing from neither group. In medial prefrontal cortex, suppression of activity at higher WM loads was significantly diminished in both CHR and ESZ groups, relative to HC. In addition, investigation of dorsolateral prefrontal cortex (DLPFC) activations revealed that ESZ activated right DLPFC significantly more than HC, with CHR differing from neither group. While HC showed WM load-dependent modulation of DMN suppression, CHR individuals had deficient higher-load DMN suppression that was similar to, but less pronounced than, the distributed suppression deficits evident in ESZ patients. These results suggest that DMN dysregulation associated with schizophrenia predates psychosis onset.

Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

Science.gov (United States)

Flachs, Petr; Bhattacharyya, Tanmoy; Mihola, Ondřej; Piálek, Jaroslav; Forejt, Jiří; Trachtulec, Zdenek

2014-01-01

PR-domain 9 (Prdm9) is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain) and the Hstx2 region of chromosome (Chr) X from M. m. musculus (Mmm; the PWD strain) participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6)F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6)F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6)F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6)F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

Directory of Open Access Journals (Sweden)

Petr Flachs

Full Text Available PR-domain 9 (Prdm9 is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain and the Hstx2 region of chromosome (Chr X from M. m. musculus (Mmm; the PWD strain participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

Neuroanatomical and Symptomatic Sex Differences in Individuals at Clinical High Risk for Psychosis

Directory of Open Access Journals (Sweden)

Elisa Guma

2017-12-01

Full Text Available Sex differences have been widely observed in clinical presentation, functional outcome and neuroanatomy in individuals with a first-episode of psychosis, and chronic patients suffering from schizophrenia. However, little is known about sex differences in the high-risk stages for psychosis. The present study investigated sex differences in cortical and subcortical neuroanatomy in individuals at clinical high risk (CHR for psychosis and healthy controls (CTL, and the relationship between anatomy and clinical symptoms in males at CHR. Magnetic resonance images were collected in 26 individuals at CHR (13 men and 29 CTLs (15 men to determine total and regional brain volumes and morphology, cortical thickness, and surface area (SA. Clinical symptoms were assessed with the brief psychiatric rating scale. Significant sex-by-diagnosis interactions were observed with opposite directions of effect in male and female CHR subjects relative to their same-sex controls in multiple cortical and subcortical areas. The right postcentral, left superior parietal, inferior parietal supramarginal, and angular gyri [<5% false discovery rate (FDR] were thicker in male and thinner in female CHR subjects compared with their same-sex CTLs. The same pattern was observed in the right superior parietal gyrus SA at the regional and vertex level. Using a recently developed surface-based morphology pipeline, we observed sex-specific shape differences in the left hippocampus (<5% FDR and amygdala (<10% FDR. Negative symptom burden was significantly higher in male compared with female CHR subjects (p = 0.04 and was positively associated with areal expansion of the left amygdala in males (<5% FDR. Some limitations of the study include the sample size, and data acquisition at 1.5 T. This study demonstrates neuroanatomical sex differences in CHR subjects, which may be associated with variations in symptomatology in men and women with psychotic symptoms.

Luminance and chromatic contributions to a hyperacuity task: isolation by contrast polarity and target separation.

Science.gov (United States)

Sun, Hao; Cooper, Bonnie; Lee, Barry B

2012-03-01

Vernier thresholds are known to be elevated when a target pair has opposite contrast polarity. Polarity reversal is used to assess the role of luminance and chromatic pathways in hyperacuity performance. Psychophysical hyperacuity thresholds were measured for pairs of gratings of various combinations of luminance (Lum) and chromatic (Chr) contrast polarities, at different ratios of luminance to chromatic contrast. With two red-green gratings of matched luminance and chromatic polarity (+Lum+Chr), there was an elevation of threshold at isoluminance. When both luminance and chromatic polarity were mismatched (-Lum-Chr), thresholds were substantially elevated under all conditions. With the same luminance contrast polarity and opposite chromatic polarity (+Lum-Chr) thresholds were only elevated close to isoluminance; in the reverse condition (-Lum+Chr), thresholds were elevated as in the -Lum-Chr condition except close to equiluminance. Similar data were obtained for gratings isolating the short-wavelength cone mechanism. Further psychophysical measurements assessed the role of target separation with matched or mismatched contrast polarity; similar results were found for luminance and chromatic gratings. Comparison physiological data were collected from parafoveal ganglion cells of the macaque retina. Positional precision of ganglion cell signals was assessed under conditions related to the psychophysical measurements. On the basis of these combined observations, it is argued that both magnocellular, parvocellular, and koniocellular pathways have access to cortical positional mechanisms associated with vernier acuity. Copyright © 2012 Elsevier Ltd. All rights reserved.

Identification of quantitative trait loci underlying seed protein content of soybean including main, epistatic, and QTL × environment effects in different regions of Northeast China.

Science.gov (United States)

Teng, Weili; Li, Wen; Zhang, Qi; Wu, Depeng; Zhao, Xue; Li, Haiyan; Han, Yingpeng; Li, Wenbin

2017-08-01

The objective here was to identify QTL underlying soybean protein content (PC), and to evaluate the additive and epistatic effects of the QTLs. A mapping population, consisting of 129 recombinant inbred lines (RILs), was created by crossing 'Dongnong 46' and 'L-100'. Phenotypic data of the parents and RILs were collected for 4 years in three locations of Heilongjiang Province of China. A total of 213 SSR markers were used to construct a genetic linkage map. Eight QTLs, located on seven chromosomes (Chr), were identified to be associated with PC among the 10 tested environments. Of the seven QTLs, five QTLs, qPR-2 (Satt710, on Chr9), qPR-3 (Sat_122, on Chr12), qPR-5 (Satt543, on Chr17), qPR-7 (Satt163, on Chr18), and qPR-8 (Satt614, on Chr20), were detected in six, seven, seven, six, and seven environments, respectively, implying relatively stable QTLs. qPR-3 could explain 3.33%-11.26% of the phenotypic variation across eight tested environments. qPR-5 and qPR-8 explained 3.64%-10.1% and 11.86%-18.40% of the phenotypic variation, respectively, across seven tested environments. Eight QTLs associated with PC exhibited additive and (or) additive × environment interaction effects. The results showed that environment-independent QTLs often had higher additive effects. Moreover, five epistatic pairwise QTLs were identified in the 10 environments.

GenBank blastx search result: AK059350 [KOME

Lifescience Database Archive (English)

Full Text Available r SLU7; DNA segment, Chr 11, ERATO Doi 730, expressed; DNA segment, Chr 3, Brigham & Womens Genetics 0878 expressed, mRNA (cDNA clone IMAGE:6890616), partial cds.|ROD ROD 1e-103 +3 ...

AcEST: DK956057 [AcEST

Lifescience Database Archive (English)

Full Text Available FIHLYISNCISTCEQIKDKYMQN 228 >tr|B0BNA9|B0BNA9_RAT Similar to DNA segment, Chr 1, Brigham & Women...s Genetics 0212 expressed (Similar to DNA segment, Chr 1, Brigham & Womens Genetics 0212 expr

Domain Modeling: NP_001103132.1 [SAHG[Archive

Lifescience Database Archive (English)

Full Text Available NP_001103132.1 chr12 CRYSTAL STRUCTURE OF THE SECA PROTEIN TRANSLOCATION ATPASE FROM MYCOBACTERIUM TUBERCULO...SIS COMPLEX WITH ADPBS d1nkta_ chr12/NP_001103132.1/NP_001103132.1_holo_1997-2946.p

Executable specifications for hypothesis-based reasoning with Prolog and Constraint Handling Rules

DEFF Research Database (Denmark)

Christiansen, Henning

2009-01-01

Constraint Handling Rules (CHR) is an extension to Prolog which opens up a  spectrum of hypotheses-based reasoning in logic programs without additional interpretation overhead. Abduction with integrity constraints is one example of hypotheses-based reasoning which can be implemented directly...... in Prolog and CHR with a straightforward use of available and efficiently implemented facilities The present paper clarifies the semantic foundations for this way of doing abduction in CHR and Prolog as well as other examples  of hypotheses-based reasoning that is possible, including assumptive logic...

Heuristics to Evaluate Interactive Systems for Children with Autism Spectrum Disorder (ASD).

Science.gov (United States)

Khowaja, Kamran; Salim, Siti Salwah; Asemi, Adeleh

2015-01-01

In this paper, we adapted and expanded a set of guidelines, also known as heuristics, to evaluate the usability of software to now be appropriate for software aimed at children with autism spectrum disorder (ASD). We started from the heuristics developed by Nielsen in 1990 and developed a modified set of 15 heuristics. The first 5 heuristics of this set are the same as those of the original Nielsen set, the next 5 heuristics are improved versions of Nielsen's, whereas the last 5 heuristics are new. We present two evaluation studies of our new heuristics. In the first, two groups compared Nielsen's set with the modified set of heuristics, with each group evaluating two interactive systems. The Nielsen's heuristics were assigned to the control group while the experimental group was given the modified set of heuristics, and a statistical analysis was conducted to determine the effectiveness of the modified set, the contribution of 5 new heuristics and the impact of 5 improved heuristics. The results show that the modified set is significantly more effective than the original, and we found a significant difference between the five improved heuristics and their corresponding heuristics in the original set. The five new heuristics are effective in problem identification using the modified set. The second study was conducted using a system which was developed to ascertain if the modified set was effective at identifying usability problems that could be fixed before the release of software. The post-study analysis revealed that the majority of the usability problems identified by the experts were fixed in the updated version of the system.

Heuristics to Evaluate Interactive Systems for Children with Autism Spectrum Disorder (ASD.

Directory of Open Access Journals (Sweden)

Kamran Khowaja

Full Text Available In this paper, we adapted and expanded a set of guidelines, also known as heuristics, to evaluate the usability of software to now be appropriate for software aimed at children with autism spectrum disorder (ASD. We started from the heuristics developed by Nielsen in 1990 and developed a modified set of 15 heuristics. The first 5 heuristics of this set are the same as those of the original Nielsen set, the next 5 heuristics are improved versions of Nielsen's, whereas the last 5 heuristics are new. We present two evaluation studies of our new heuristics. In the first, two groups compared Nielsen's set with the modified set of heuristics, with each group evaluating two interactive systems. The Nielsen's heuristics were assigned to the control group while the experimental group was given the modified set of heuristics, and a statistical analysis was conducted to determine the effectiveness of the modified set, the contribution of 5 new heuristics and the impact of 5 improved heuristics. The results show that the modified set is significantly more effective than the original, and we found a significant difference between the five improved heuristics and their corresponding heuristics in the original set. The five new heuristics are effective in problem identification using the modified set. The second study was conducted using a system which was developed to ascertain if the modified set was effective at identifying usability problems that could be fixed before the release of software. The post-study analysis revealed that the majority of the usability problems identified by the experts were fixed in the updated version of the system.

Global changes in Staphylococcus aureus gene expression during human prosthetic joint infection

DEFF Research Database (Denmark)

Xu, Yijuan; Nielsen, Per Halkjær; Nielsen, Jeppe Lund

2016-01-01

and Environmental Engineering, Aalborg University, Denmark 2: Danish Technological Institute, Aarhus, Denmark Aim: ”The aim of this study was to gain insight into the in vivo expression of virulence and metabolic genes of Staphylococcus aureus in a prosthetic joint infection in a human subject” Method: ”Deep RNA......Global changes in Staphylococcus aureus gene expression during human prosthetic joint infection Xu, Yijuan1; Nielsen, Per H.1; Nielsen, Jeppe L.1; Thomsen, Trine R. 1,2; Nielsen, Kåre L.1 and the PRIS study group 1: Center for Microbial Communities, Department of Biotechnology, Chemistry...... involved overexpression of various enzymes related to cell-wall synthesis and multidrug efflux pumps. Interestingly, these efflux pumps are only known to be related to fluoroquinolone resistance. Many of the genes encoding virulence factors were upregulated, including toxins and superantigen-like proteins...

Thermopower of dilute alloys of indium

International Nuclear Information System (INIS)

Dudenhoeffer, A.W.

1974-01-01

An experimental investigation of a new theory of electron-diffusion thermopower is discussed. A figure of merit for this ''Nielsen--Taylor'' theory in various metals is established, and it indicates that the effect should be largest in lead, indium, thallium, and aluminum, in that order. Previous investigations have been carried out for lead and aluminum. The thermopower of indium (or any metal) changes when impurity scattering centers are introduced into it. This change in the thermopower as a function of temperature is analyzed in terms of the Nielsen--Taylor theory and in terms of the competing process known as ''phonon drag.'' Definite conclusions as to the validity of the new theory are hampered by the complex nature of this phonon drag, but the experimental data is consistent with the Nielsen--Taylor theory. (Diss. Abstr. Int., B)

Tenofovir treatment in an unselected cohort of highly antiretroviral experienced HIV positive patients

DEFF Research Database (Denmark)

Lerbaek, A; Kristiansen, Thomas Birk; Katzenstein, TL

2004-01-01

Tenofovir treatment in an unselected cohort of highly antiretroviral experienced HIV positive patients.Lerbaek A, Kristiansen TB, Katzenstein TL, Mathiesen L, Gerstoft J, Nielsen C, Larsen K, Nielsen JO, Obel N, Laursen AL, Nielsen SD. Department of Infectious Diseases, Hvidovre Hospital......, HIV-RNA levels and genotypic resistance were determined at baseline and after 3 and 6 months. After initiation of tenofovir treatment, a mean decrease in HIV-RNA for all 34 patients was observed (-0.43 log1o copies/ml (+/- 1.22) and -0.49 log10 copies/ml (+/- 1.36) after 3 and 6 months, respectively......, respectively). After initiation of tenofovir treatment, no significant increases in CD4 count were observed. All new NRTI-associated mutations could be explained by the background treatment. In conclusion, we observed a significant decrease in HIV-RNA only when tenofovir was prescribed, in conjunction...

Poetiske livtag med kristendommen

DEFF Research Database (Denmark)

Larsen, Peter Stein

2015-01-01

Færøerne har to betydelige nulevende digtere, der adskillige gange er blevet oversat til dansk og flere gange Fer blevet nomineret til Nordisk Råds Pris, nemlig Jóannes Nielsen og Tóroddur Poulsen.......Færøerne har to betydelige nulevende digtere, der adskillige gange er blevet oversat til dansk og flere gange Fer blevet nomineret til Nordisk Råds Pris, nemlig Jóannes Nielsen og Tóroddur Poulsen....

Kinetic evaluation of photosensitivity in bi-stable variants of chimeric channelrhodopsins.

Directory of Open Access Journals (Sweden)

Shoko Hososhima

Full Text Available Channelrhodopsin-1 and 2 (ChR1 and ChR2 form cation channels that are gated by light through an unknown mechanism. We tested the DC-gate hypothesis that C167 and D195 are involved in the stabilization of the cation-permeable state of ChRWR/C1C2 which consists of TM1-5 of ChR1 and TM6-7 of ChR2 and ChRFR which consists of TM1-2 of ChR1 and TM3-7 of ChR2. The cation permeable state of each ChRWR and ChRFR was markedly prolonged in the order of several tens of seconds when either C167 or D195 position was mutated to alanine (A. Therefore, the DC-gate function was conserved among these chimeric ChRs. We next investigated the kinetic properties of the ON/OFF response of these bi-stable ChR mutants as they are important in designing the photostimulation protocols for the optogenetic manipulation of neuronal activities. The turning-on rate constant of each photocurrent followed a linear relationship to 0-0.12 mW mm(-2 of blue LED light or to 0-0.33 mW mm(-2 of cyan LED light. Each photocurrent of bi-stable ChR was shut off to the non-conducting state by yellow or orange LED light in a manner dependent on the irradiance. As the magnitude of the photocurrent was mostly determined by the turning-on rate constant and the irradiation time, the minimal irradiance that effectively evoked an action potential (threshold irradiance was decreased with time only if the neuron, which expresses bi-stable ChRs, has a certain large membrane time constant (eg. τm > 20 ms. On the other hand, in another group of neurons, the threshold irradiance was not dependent on the irradiation time. Based on these quantitative data, we would propose that these bi-stable ChRs would be most suitable for enhancing the intrinsic activity of excitatory pyramidal neurons at a minimal magnitude of irradiance.

Measurements on irradiated L1 sensor prototypes for the D0 Run IIb silicon detector project

International Nuclear Information System (INIS)

Ahsan, M.; Bolton, T.; Carnes, K.; Demarteau, M.; Demina, R.; Gray, T.; Korjenevski, S.; Lehner, F.; Lipton, R.; Mao, H.S.; McCarthy, R.

2010-01-01

We report on irradiation studies of Hamamatsu prototype silicon microstrip detectors for layer 1 of the D0 upgrade project for Run IIb. The irradiation was carried out with 10 MeV protons up to proton fluence of 10 14 p/cm 2 at the J.R. Macdonald Laboratory, Manhatten, KS. The flux calibration was carefully checked using different dose normalization techniques. The results based on the obtained sensor leakage currents after irradiation show that the NIEL scaling hypothesis for low energy protons has to be applied with great care. We observe 30-40% less radiation damage in silicon for 10 MeV proton exposure than is expected from the predicted NIEL scaling.

Survey of the Use of Steganography over the Internet

Directory of Open Access Journals (Sweden)

Lavinia Mihaela DINCA

2011-01-01

Full Text Available This paper addressesthe use of Steganography over the Internet by terrorists. There were ru-mors in the newspapers that Steganography is being used to covert communication between terrorists, without presenting any scientific proof. Niels Provos and Peter Honeyman conducted an extensive Internet search where they analyzed over 2 million images and didn’t find a single hidden image. After this study the scientific community was divided: some believed that Niels Provos and Peter Honeyman was conclusive enough other did not. This paper describes what Steganography is and what can be used for, various Steganography techniques and also presents the studies made regarding the use of Steganography on the Internet.

Measurements on irradiated L1 sensor prototypes for the D0 Run IIb silicon detector project

Energy Technology Data Exchange (ETDEWEB)

Ahsan, M.; Bolton, T.; Carnes, K.; /Kansas State U.; Demarteau, M.; /Fermilab; Demina, R.; /Rochester U.; Gray, T.; /Kansas State U.; Korjenevski, S.; /Rochester U.; Lehner, F.; /Zurich U.; Lipton, R.; Mao, H.S.; /Fermilab; McCarthy, R.; /SUNY, Stony Brook /Kansas State U. /Fermilab

2010-01-01

We report on irradiation studies of Hamamatsu prototype silicon microstrip detectors for layer 1 of the D0 upgrade project for Run IIb. The irradiation was carried out with 10 MeV protons up to proton fluence of 10{sup 14} p/cm{sup 2} at the J.R. Macdonald Laboratory, Manhatten, KS. The flux calibration was carefully checked using different dose normalization techniques. The results based on the obtained sensor leakage currents after irradiation show that the NIEL scaling hypothesis for low energy protons has to be applied with great care. We observe 30-40% less radiation damage in silicon for 10 MeV proton exposure than is expected from the predicted NIEL scaling.

Characterization and prognostic implication of 17 chromosome abnormalities in myelodysplastic syndrome.

Science.gov (United States)

Sánchez-Castro, Judit; Marco-Betés, Víctor; Gómez-Arbonés, Xavier; Arenillas, Leonor; Valcarcel, David; Vallespí, Teresa; Costa, Dolors; Nomdedeu, Benet; Jimenez, María José; Granada, Isabel; Grau, Javier; Ardanaz, María T; de la Serna, Javier; Carbonell, Félix; Cervera, José; Sierra, Adriana; Luño, Elisa; Cervero, Carlos J; Falantes, José; Calasanz, María J; González-Porrás, José R; Bailén, Alicia; Amigo, M Luz; Sanz, Guillermo; Solé, Francesc

2013-07-01

The prognosis of chromosome 17 (chr17) abnormalities in patients with primary myelodysplastic syndrome (MDS) remains unclear. The revised International Prognostic Scoring System (IPSS-R) includes these abnormalities within the intermediate cytogenetic risk group. This study assessed the impact on overall survival (OS) and risk of acute myeloid leukemia transformation (AMLt) of chr17 abnormalities in 88 patients with primary MDS. We have compared this group with 1346 patients with primary MDS and abnormal karyotype without chr17 involved. The alterations of chr17 should be considered within group of poor prognosis. The different types of alterations of chromosome 17 behave different prognosis. The study confirms the intermediate prognostic impact of the i(17q), as stated in IPSS-R. The results of the study, however, provide valuable new information on the prognostic impact of alterations of chromosome 17 in complex karyotypes. Copyright © 2013 Elsevier Ltd. All rights reserved.

Social cognition over time in individuals at clinical high risk for psychosis: Findings from the NAPLS-2 cohort.

Science.gov (United States)

Piskulic, Danijela; Liu, Lu; Cadenhead, Kristin S; Cannon, Tyrone D; Cornblatt, Barbara A; McGlashan, Thomas H; Perkins, Diana O; Seidman, Larry J; Tsuang, Ming T; Walker, Elaine F; Woods, Scott W; Bearden, Carrie E; Mathalon, Daniel H; Addington, Jean

2016-03-01

Deficits in social cognition are well established in schizophrenia and have been observed prior to the illness onset. Compared to healthy controls (HCs), individuals at clinical high risk of psychosis (CHR) are said to show deficits in social cognition similar to those observed in patients experiencing a first episode of psychosis. These deficits have been observed in several domains of social cognition, such as theory of mind (ToM), emotion perception and social perception. In the current study, the stability of three domains of social cognition (ToM, social perception and facial emotion perception) was assessed over time along and their association with both clinical symptoms and the later development of psychosis. Six hundred and seventy-five CHR individuals and 264 HC participants completed four tests of social cognition at baseline. Of those, 160 CHR and 155 HC participants completed assessments at all three time points (baseline, 1year and 2years) as part of their participation in the North American Prodrome Longitudinal Study. The CHR group performed poorer on all tests of social cognition across all time points compared to HCs. Social cognition was not associated with attenuated positive symptoms at any time point in the study. CHR individuals who developed a psychotic disorder during the course of the study did not differ in social cognition compared to those who did not develop psychosis. This longitudinal study demonstrated mild to moderate, but persistent ToM and social perception impairments in those at CHR for psychosis compared to HCs. Copyright © 2016 Elsevier B.V. All rights reserved.

From lumping to splitting and back again: Atypical social and language development in individuals with clinical-high-risk for psychosis, first episode schizophrenia, and autism spectrum disorders

Science.gov (United States)

Solomon, Marjorie; Olsen, Emily; Niendam, Tara; Ragland, J. Daniel; Yoon, Jong; Minzenberg, Michael; Carter, Cameron S.

2011-01-01

Objective Individuals with autism and schizophrenia exhibit atypical language and social symptoms. The extent to which these symptoms are evident during development and in current functioning is unclear. Method Three groups of patients aged 11–20 diagnosed as clinical-high-risk for psychosis (CHR; n = 15), first episode psychosis (FEP; n = 16), and autism spectrum disorders (ASD; n = 20), plus typically developing individuals (TYP; n = 20) were compared on common autism parent-report questionnaires assessing social and language development and current functioning including the Social Communication Questionnaire, the Children’s Communication Checklist, and the Social Reciprocity Scale. Results All clinical groups demonstrated atypical social and language development, with social impairment highest in ASD. Twenty percent of participants with CHR and FEP met diagnostic criteria for ASD as assessed by parent-report. ASD exhibited greater current syntactic, and pragmatic language symptoms including delayed echolalia, pedantic speech, and deficits in appreciating irony and sarcasm. All clinical groups exhibited current deficits in social functioning. CHR and FE had similar and intermediate levels of functioning relative to ASD and TYP, with CHR generally scoring closer to TYP, providing construct validity for the CHR diagnostic label. Conclusions The results of this study suggest that ASDs, CHR, and FEP share common features of atypical neurodevelopment of language and social function. Evidence of impaired social reciprocity across both disorders and distinct language symptoms in ASDs provides important information for differential diagnosis and psychosis prevention, as well as leads for future investigations of comparative genetics and pathophysiology. PMID:21458242

Reasons for cannabis use among youths at ultra high risk for psychosis.

Science.gov (United States)

Gill, Kelly E; Poe, Lucy; Azimov, Neyra; Ben-David, Shelly; Vadhan, Nehal P; Girgis, Ragy; Moore, Holly; Cressman, Victoria; Corcoran, Cheryl M

2015-06-01

Cannabis use is prevalent in schizophrenia and its risk states, despite its association with anxiety and positive symptoms. While schizophrenia patients report using cannabis for mood enhancement and social motives, it is not known what motivates clinical high risk (CHR) patients to use cannabis. Among 102 CHR patients, 24 (23%) endorsed cannabis use, and were queried as to reasons for use, using a scale previously administered in schizophrenia patients. We hypothesized a primary motivation for mood enhancement related to anhedonia. We evaluated the 'self-medication' hypothesis by examining if motivation for symptom relief was associated with concurrent severity of symptoms. The rank order of reasons for use in CHR patients was similar to that previously reported by schizophrenia patients, with mood enhancement and social motives as primary reasons for use, and the motivation to use cannabis for symptom relief comparatively less common. Motivation for mood enhancement had a trend association with anhedonia. Motivation for symptom relief was entirely unrelated to concurrent severity of positive and anxiety symptoms. As in schizophrenia, CHR patients primarily use cannabis for mood enhancement, especially in the context of decreased motivation to seek pleasure otherwise. Negative symptoms may drive cannabis use in schizophrenia and its risk states, which may exacerbate positive symptoms. By contrast, CHR patients do not report using cannabis to 'self-medicate' emergent positive symptoms. The understanding of motives for cannabis use among CHR patients may be informative for treatments aimed at reducing use, such as motivational interviewing. © 2013 Wiley Publishing Asia Pty Ltd.

Chronic Depressive Symptomatology in Mild Cognitive Impairment Is Associated with Frontal Atrophy Rate which Hastens Conversion to Alzheimer Dementia.

Science.gov (United States)

Sacuiu, Simona; Insel, Philip S; Mueller, Susanne; Tosun, Duygu; Mattsson, Niklas; Jack, Clifford R; DeCarli, Charles; Petersen, Ronald; Aisen, Paul S; Weiner, Michael W; Mackin, R Scott

2016-02-01

Investigate the association of chronic depressive symptomatology (chrDS) with cortical atrophy rates and conversion to Alzheimer dementia (AD) over 3 years in mild cognitive impairment (MCI). In a multicenter, clinic-based study, MCI elderly participants were selected from the Alzheimer's Disease Neuroimaging Initiative repository, based on availability of both serial structural magnetic resonance imaging and chrDS endorsed on three depression-related items from the Neuropsychiatric Inventory Questionnaire (chrDS N = 32 or no depressive symptoms N = 62) throughout follow-up. Clinical and laboratory investigations were performed every 6 months during the first 2 years and yearly thereafter (median follow-up: 3 years; interquartile range: 1.5-4.0 years). Cortical atrophy rates in 16 predefined frontotemporoparietal regions affected in major depression and AD and the rate of incident AD at follow-up. ChrDS in a single domain amnestic MCI sample were associated with accelerated cortical atrophy in the frontal lobe and anterior cingulate but not with atrophy rates in temporomedial or other AD-affected regions. During follow-up, 38 participants (42.7%) developed AD. Participants with chrDS had 60% shorter conversion time to AD than those without depressive symptoms. This association remained significant in survival models adjusted for temporomedial atrophy rates and showed the same trend in models adjusted for frontal cortical atrophy rate, which all increased the risk of AD. Our results suggest that chrDS associated with progressive atrophy of frontal regions may represent an additional risk factor for conversion to dementia in MCI as opposite to representing typical prodromal AD symptomatology. Published by Elsevier Inc.

Clinical high risk for psychosis in children and adolescents: a systematic review.

Science.gov (United States)

Tor, Jordina; Dolz, Montserrat; Sintes, Anna; Muñoz, Daniel; Pardo, Marta; de la Serna, Elena; Puig, Olga; Sugranyes, Gisela; Baeza, Inmaculada

2017-09-15

The concept of being at risk for psychosis has been introduced both for adults and children and adolescents, but fewer studies have been conducted in the latter population. The aim of this study is to systematically review the articles associated with clinical description, interventions, outcome and other areas in children and adolescents at risk for psychosis. We searched in MEDLINE/PubMed and PsycINFO databases for articles published up to 30/06/16. Reviewed articles were prospective studies; written in English; original articles with Clinical High Risk (CHR) for psychosis samples; and mean age of samples younger than 18 years. From 103 studies initially selected, 48 met inclusion criteria and were systematically reviewed. Studies show that CHR children and adolescents present several clinical characteristics at baseline, with most attenuated positive-symptom inclusion criteria observed, reporting mostly perceptual abnormalities and suspiciousness, and presenting comorbid conditions such as depressive and anxiety disorders. CHR children and adolescents show lower general intelligence and no structural brain changes compared with controls. Original articles reviewed show rates of conversion to psychosis between 17 and 20% at 1 year follow-up and between 7 and 21% at 2 years. While 36% of patients recovered from their CHR status at 6-year follow-up, 40% still met CHR criteria. Studies in children and adolescents with CHR were conducted with different methodologies, assessments tools and small samples. It is important to conduct studies on psychopharmacological and psychological treatment, as well as replication of the few studies found.

Ad agency overview / koost. Ingrid Nielsen

Index Scriptorium Estoniae

2004-01-01

Ülevaade Baltimaade reklaamifirmade assotsiatsioonidesse kuuluvatest reklaamifirmadest. Ettevõtete üldandmed, juhid, teenused, konkurentsieelised, olulisemad kliendid, autasud reklaamikonkurssidelt

Uus teater tuleb Aasiast / Katrin Nielsen

Index Scriptorium Estoniae

Nielsen, Katrin

2007-01-01

Soulius toimunud Aasia lasteteatrite festivalist "AssiFE 2007". Mõningatest lavastustest: Tõkyõ teater Kakashiza "Saabastega kass", Sadari teatri "Kui ta kell seisma jäi", Tuida teatri "Haruki lugu", Souli Joyful Theatre'i vendade Grimmide lugu konn-printsist, Shiny Shoes Theatre'i "Maagiline hõljuv laud", Ulgul Gwa Ulgul "Laul lameda näoga Kong-List"

The Strauss and Carpenter Prognostic Scale in subjects clinically at high risk of psychosis

NARCIS (Netherlands)

Nieman, D. H.; Velthorst, E.; Becker, H. E.; de Haan, L.; Dingemans, P. M.; Linszen, D. H.; Birchwood, M.; Patterson, P.; Salokangas, R. K. R.; Heinimaa, M.; Heinz, A.; Juckel, G.; von Reventlow, H. G.; Morrison, A.; Schultze-Lutter, F.; Klosterkötter, J.; Ruhrmann, S.; McGorry, Patrick D.; McGlashan, Thomas H.; Knapp, Martin; van de Fliert, Reinaud; Klaassen, Rianne; Picker, Heinz; Neumann, Meike; Brockhaus-Dumke, Anke; Pukrop, Ralf; Svirskis, Tanja; Huttunen, Jukka; Laine, Tiina; Ilonen, Tuula; Ristkari, Terja; Hietala, Jarmo; Skeate, Amanda; Gudlowski, Yehonala; Ozgürdal, Seza; French, Paul; Stevens, Helen

2013-01-01

To investigate the predictive value of the Strauss and Carpenter Prognostic Scale (SCPS) for transition to a first psychotic episode in subjects clinically at high risk (CHR) of psychosis. Two hundred and forty-four CHR subjects participating in the European Prediction of Psychosis Study were

Charabias et magiciens dans le théâtre des xiie-xiiie siècles

OpenAIRE

Revol, Thierry

2014-01-01

S’intéressant à l’imaginaire médiéval, Jacques Le Goff a mis en valeur trois domaines dans lesquels se manifeste le merveilleux. Le mirabilis correspond au merveilleux pré-chrétien, le magicus au surnaturel maléfique et satanique, et enfin le miraculosus au surnaturel chrétien. Dans la logique chrétienne, le dernier tend à repousser les deux autres dans le domaine de la superstition, ce qui, paradoxalement, légitime leur existence, puisque celle-ci n’est pas niée. Miraculosus et magicus appar...

On proving confluence modulo equivalence for Constraint Handling Rules

DEFF Research Database (Denmark)

Christiansen, Henning; Kirkeby, Maja Hanne

2017-01-01

-logical built-in predicates such as var/1 and incomplete ones such as is/2, that are ignored in previous work on confluence. To this end, a new operational semantics for CHR is developed which includes such predicates. In addition, this semantics differs from earlier approaches by its simplicity without loss......Previous results on proving confluence for Constraint Handling Rules are extended in two ways in order to allow a larger and more realistic class of CHR programs to be considered confluent. Firstly, we introduce the relaxed notion of confluence modulo equivalence into the context of CHR: while...

Predicting the onset of psychosis in patients at clinical high risk: practical guide to probabilistic prognostic reasoning.

Science.gov (United States)

Fusar-Poli, P; Schultze-Lutter, F

2016-02-01

Prediction of psychosis in patients at clinical high risk (CHR) has become a mainstream focus of clinical and research interest worldwide. When using CHR instruments for clinical purposes, the predicted outcome is but only a probability; and, consequently, any therapeutic action following the assessment is based on probabilistic prognostic reasoning. Yet, probabilistic reasoning makes considerable demands on the clinicians. We provide here a scholarly practical guide summarising the key concepts to support clinicians with probabilistic prognostic reasoning in the CHR state. We review risk or cumulative incidence of psychosis in, person-time rate of psychosis, Kaplan-Meier estimates of psychosis risk, measures of prognostic accuracy, sensitivity and specificity in receiver operator characteristic curves, positive and negative predictive values, Bayes' theorem, likelihood ratios, potentials and limits of real-life applications of prognostic probabilistic reasoning in the CHR state. Understanding basic measures used for prognostic probabilistic reasoning is a prerequisite for successfully implementing the early detection and prevention of psychosis in clinical practice. Future refinement of these measures for CHR patients may actually influence risk management, especially as regards initiating or withholding treatment. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

Negative schemata about the self and others and paranoid ideation in at-risk states and those with persisting positive symptoms.

Science.gov (United States)

Müller, Hendrik; de Millas, Walter; Gaebel, Wolfgang; Herrlich, Jutta; Hasan, Alkomiet; Janssen, Birgit; Juckel, Georg; Karow, Anne; Kircher, Tilo; Kiszkenow-Bäker, Stefanie; Klingberg, Stefan; Klosterkötter, Joachim; Krüger-Özgürdal, Seza; Lambert, Martin; Lautenschlager, Marion; Maier, Wolfgang; Michel, Tanja Maria; Mehl, Stefanie; Müller, Bernhard W; Pützfeld, Verena; Rausch, Franziska; Riedel, Michael; Sartory, Gudrun; Schneider, Frank; Wagner, Michael; Wiedemann, Georg; Wittorf, Andreas; Wobrock, Thomas; Wölwer, Wolfgang; Zink, Mathias; Bechdolf, Andreas

2017-05-19

The objective of this study is to test the conflicting theories concerning the association of negative self and other schemata and paranoid ideation. A risk-based approach, including risk stratification, is used to gain insight into the association of the negative self and other schemata that may be shared by individuals or differentiate between individuals at clinical high risk (CHR) for a first-episode psychosis and those with full-blown psychosis. The dataset includes a sample of individuals at CHR (n = 137) and a sample of individuals with persisting positive symptoms (PPS, n = 211). The CHR sample was subdivided according to a prognostic index yielding 4 CHR sub-classes with increasing risk for transition to psychosis. Negative beliefs about the self were associated with paranoid ideation in CHR and a lower risk state. In the highest risk state and full-blown psychosis, there is an association with negative beliefs about others. These findings are in line with theories suggesting a switch from a predominantly activated negative self-schema to a malevolent others-schema in association with paranoid ideation along the risk-continuum. However, due to methodological limitations these results should be replicated by future studies. © 2017 John Wiley & Sons Australia, Ltd.

Gene divergence of homeologous regions associated with a major seed protein content QTL in soybean

Directory of Open Access Journals (Sweden)

Puji eLestari

2013-06-01

Full Text Available Understanding several modes of duplication contributing on the present genome structure is getting an attention because it could be related to numerous agronomically important traits. Since soybean serves as a rich protein source for animal feeds and human consumption, breeding efforts in soybean have been directed toward enhancing seed protein content. The publicly available soybean sequences and its genomically featured elements facilitate comprehending of quantitative trait loci (QTL for seed protein content in concordance with homeologous regions in soybean genome. Although parts of chromosome (Chr 20 and Chr 10 showed synteny, QTLs for seed protein content present only on Chr 20. Using comparative analysis of gene contents in recently duplicated genomic regions harboring QTL for protein/oil content on Chrs 20 and 10, a total of 27 genes are present in duplicated regions of both chromosomes. Notably, 4 tandem duplicates of the putative homeobox protein 22 (HB22 are present only on Chr 20 and this Medicago truncatula homolog expressed in endosperm at seed filling stage. These tandem duplicates could contribute on the protein/oil QTL of Chr 20. Our study suggests that non-shared gene contents within the duplicated genomic regions might lead to absence/presence of QTL related to protein/oil content.

Binding of radiolabeled asbestos fibers to guinea pig (gp) alveolar macrophages (AM)

International Nuclear Information System (INIS)

Giannotti, M.A.; Tewson, T.J.; Francsechini, M.P.; Scheule, R.K.; Holian, A.

1990-01-01

The mechanism by which fibrogenic particulates cause pulmonary fibrosis in humans is not understood, but is likely to involve the AM. Using two fibrogenic particulates, namely, chrysotile (CHR) and crocidolite (CRO) asbestos and gpAM as components of an in vitro model system, the authors have shown that CHR stimulates the gpAM to release superoxide anion, but CRO does not. To examine whether this difference in stimulatory abilities is a result of differences in cell-asbestos binding they have developed an efficient procedure that radiolabels asbestos fibers while retaining their bioactivity. The fibers are labeled with 68 Ge. The 68 Ge decays into 68 Ga, which then can be detected by its characteristic position emission. Both CHR and CRO asbestos were radiolabled successfully. Mild reaction conditions and short reaction times were found under which >90% of the added 68 Ge and 68 Ga bound to the fibers. The radiolabel was retained even after washing the fibers extensively with physiologic buffers. A density gradient procedure was developed to quantitate the binding of asbestos to gpAM in suspension. The binding of both fibers increased with time over one hr. Thus, these results indicate that although both CHR and CRO interact with the gpAM, only CHR interacts productively to stimulate superoxide anion release

Overview of Organic Marketing Initiatives in Europe

DEFF Research Database (Denmark)

Nielsen, Thorkild; Kristensen, Niels Heine; Hansen, Mette Weinreich

2004-01-01

Nielsen T, Kristensen NH, Hansen MW (2004): Overview of Organic Marketing Initiatives in Europe. Chapter in: Organic Marketing Initiatives and Rural Development. Volume 7, from the OMIaRD project. University of Wales, Aberystwyth, UK. ISBN: 0-9543279-7-1......Nielsen T, Kristensen NH, Hansen MW (2004): Overview of Organic Marketing Initiatives in Europe. Chapter in: Organic Marketing Initiatives and Rural Development. Volume 7, from the OMIaRD project. University of Wales, Aberystwyth, UK. ISBN: 0-9543279-7-1...

The Organic Food Market and Marketing Initiatives in Europe: a Preliminary Analysis

DEFF Research Database (Denmark)

Kristensen, Niels Heine; Nielsen, Thorkild; Bruselius-Jensen, Maria Louisa

2003-01-01

Kristensen NH, Nielsen T, Bruselius-Jensen M, Scheperlen-Bøgh P, Beckie M, Foster C, Midmore P, Padel S (2002): The Organic Food Market and Marketing Initiatives in Europe: a Preliminary Analysis. Final Report to the EU Commission......Kristensen NH, Nielsen T, Bruselius-Jensen M, Scheperlen-Bøgh P, Beckie M, Foster C, Midmore P, Padel S (2002): The Organic Food Market and Marketing Initiatives in Europe: a Preliminary Analysis. Final Report to the EU Commission...

Chardonnay grape seed flour ameliorates hepatic steatosis and insulin resistance via altered hepatic gene expression for oxidative stress, inflammation, and lipid and ceramide synthesis in diet-induced obese mice

Science.gov (United States)

Diet-induced obese (DIO) mice were fed high-fat (HF) diets containing either partially defatted flavonoid-rich Chardonnay grape seed flour (ChrSd) or microcrystalline cellulose (MCC, control) for 5 weeks in order to determine whether ChrSd improved insulin resistance and the pathogenesis of hepatic ...

Domain Modeling: NP_001034750.1 [SAHG[Archive

Lifescience Database Archive (English)

Full Text Available NP_001034750.1 chr11 Solution NMR structure of human myeloid differentiation primary response (MyD88). North...east Structural Genomics target HR2869A p2js7a_ chr11/NP_001034750.1/NP_001034750.1_apo_70-218.pdb psi-blast 0 ...

Domain Modeling: NP_064572.2 [SAHG[Archive

Lifescience Database Archive (English)

Full Text Available theast Structural Genomics Consortium Target BoR24. c2bdva_ chr3/NP_064572.2/NP_064572.2_apo_2-265.pdb psi-blast 0 ... ...NP_064572.2 chr3 X-Ray Crystal Structure of Phage-related Protein BB2244 from Bordetella bronchiseptica. Nor

Exploring neural dysfunction in 'clinical high risk' for psychosis: a quantitative review of fMRI studies.

Science.gov (United States)

Dutt, Anirban; Tseng, Huai-Hsuan; Fonville, Leon; Drakesmith, Mark; Su, Liang; Evans, John; Zammit, Stanley; Jones, Derek; Lewis, Glyn; David, Anthony S

2015-02-01

Individuals at clinical high risk (CHR) of developing psychosis present with widespread functional abnormalities in the brain. Cognitive deficits, including working memory (WM) problems, as commonly elicited by n-back tasks, are observed in CHR individuals. However, functional MRI (fMRI) studies, comprising a heterogeneous cluster of general and social cognition paradigms, have not necessarily demonstrated consistent and conclusive results in this population. Hence, a comprehensive review of fMRI studies, spanning almost one decade, was carried out to observe for general trends with respect to brain regions and cognitive systems most likely to be dysfunctional in CHR individuals. 32 studies were included for this review, out of which 22 met the criteria for quantitative analysis using activation likelihood estimation (ALE). Task related contrast activations were firstly analysed by comparing CHR and healthy control participants in the total pooled sample, followed by a comparison of general cognitive function studies (excluding social cognition paradigms), and finally by only looking at n-back working memory task based studies. Findings from the ALE implicated four key dysfunctional and distinct neural regions in the CHR group, namely the right inferior parietal lobule (rIPL), the left medial frontal gyrus (lmFG), the left superior temporal gyrus (lSTG) and the right fronto-polar cortex (rFPC) of the superior frontal gyrus (SFG). Narrowing down to relatively few significant dysfunctional neural regions is a step forward in reducing the apparent ambiguity of overall findings, which would help to target specific neural regions and pathways of interest for future research in CHR populations. Copyright © 2014. Published by Elsevier Ltd.

Genetic Dissection of Trabecular Bone Structure with Mouse Intersubspecific Consomic Strains

Directory of Open Access Journals (Sweden)

Taro Kataoka

2017-10-01

Full Text Available Trabecular bone structure has an important influence on bone strength, but little is known about its genetic regulation. To elucidate the genetic factor(s regulating trabecular bone structure, we compared the trabecular bone structures of two genetically remote mouse strains, C57BL/6J and Japanese wild mouse-derived MSM/Ms. Phenotyping by X-ray micro-CT revealed that MSM/Ms has structurally more fragile trabecular bone than C57BL/6J. Toward identification of genetic determinants for the difference in fragility of trabecular bone between the two mouse strains, we employed phenotype screening of consomic mouse strains in which each C57BL/6J chromosome is substituted by its counterpart from MSM/Ms. The results showed that many chromosomes affect trabecular bone structure, and that the consomic strain B6-Chr15MSM, carrying MSM/Ms-derived chromosome 15 (Chr15, has the lowest values for the parameters BV/TV, Tb.N, and Conn.D, and the highest values for the parameters Tb.Sp and SMI. Subsequent phenotyping of subconsomic strains for Chr15 mapped four novel trabecular bone structure-related QTL (Tbsq1-4 on mouse Chr15. These results collectively indicate that genetic regulation of trabecular bone structure is highly complex, and that even in the single Chr15, the combined action of the four Tbsqs controls the fragility of trabecular bone. Given that Tbsq4 is syntenic to human Chr 12q12-13.3, where several bone-related SNPs are assigned, further study of Tbsq4 should facilitate our understanding of the genetic regulation of bone formation in humans.

Substructural Logical Specifications

Science.gov (United States)

2012-11-14

and independently in the context of CLF by Schack-Nielsen [SN07] and by Cruz and Hou [CH12]; Schack-Nielsen proves the equivalence of the two specifi...cations, whereas Cruz and Hou used the connection informally. The contribution of this section is to describe a general transformation (of which...Functional Programming (LFP’86), pages 13–27. ACM, 1986. 5.1 [CDE+11] Manuel Clavel, Francisco Durán, Steven Eker, Patrick Lincoln, Narciso Martı́- 290 Oliet

Ground Wars

DEFF Research Database (Denmark)

Nielsen, Rasmus Kleis

infrastructures that utilize large databases with detailed individual-level information for targeting voters, and armies of dedicated volunteers and paid part-timers. Nielsen challenges the notion that political communication in America must be tightly scripted, controlled, and conducted by a select coterie...... reveals how personalized political communication is profoundly influencing electoral outcomes and transforming American democracy. Rasmus Kleis Nielsen is research fellow at the Reuters Institute for the Study of Journalism at the University of Oxford and assistant professor at Roskilde University...

Desempenho diagnóstico e associações clínicas dos anticorpos contra componentes da cromatina no lúpus eritematoso sistêmico juvenil Diagnostic performance and clinical associations of antibodies to the chromatin antigenic system in juvenile systemic lupus erythematosus

Directory of Open Access Journals (Sweden)

Silene Peres Keusseyan

2012-10-01

Full Text Available OBJETIVOS: Determinar a frequência de anticorpos contra componentes da cromatina no lúpus eritematoso sistêmico juvenil (LESJ e correlacionar a presença desses autoanticorpos com manifestações clínicas e atividade da doença. MÉTODOS: Os anticorpos anticromatina (anti-CHR, antinucleossomo (anti-NCS e anti-dsDNA foram medidos em 175 indivíduos, incluindo 37 pacientes com LESJ ativo e 41 com doença inativa, 47 com doenças autoimunes não lúpicas, e 50 crianças saudáveis. Um teste ELISA in house foi desenvolvido com nucleossomos purificados a partir de timo de bezerro para determinar os anticorpos IgG e IgG3 anti-NCS. Anti-CHR e anti-dsDNA foram detectados por kits comerciais de ELISA (INOVA. RESULTADOS: Anticorpos anti-NCS e anti-CHR exibiram não só uma alta especificidade para LESJ, mas também uma frequência semelhante em LESJ ativo e inativo. Os níveis séricos de anti-CHR e IgG/IgG3 anti-NCS não diferiram entre LESJ ativo e inativo. Houve correlação entre o SLEDAI e os anticorpos anti-dsDNA, mas não com os anticorpos contra outros componentes da cromatina. Houve associação de anticorpos anti-dsDNA, anti-CHR e IgG/IgG3 anti-NCS com proteinúria e baixos níveis séricos de C4. Foram observados anticorpos anti-NCS em 14% dos pacientes com LESJ na ausência de anticorpos anti-dsDNA. CONCLUSÕES: Nossos dados indicam que os anticorpos anti-NCS e anti-CHR são marcadores diagnósticos relevantes para LESJ e parecem estar correlacionados com a atividade da nefrite lúpica no LESJ. O anticorpo IgG3 anti-NCS não parece ser mais relevante como marcador de atividade da doença ou nefrite ativa no LESJ em comparação ao anticorpo IgG anti-NCS.OBJECTIVES: To determine the frequency of antibodies to chromatin components in juvenile systemic lupus erythematosus (JSLE, and to correlate the presence of these autoantibodies with clinical manifestations and disease activity. METHODS: Anti-chromatin (anti-CHR, anti-nucleosome core

weblog: http://www.kommunikationsforum.dk/Niels-Ole-Finnemann

DEFF Research Database (Denmark)

Finnemann, Niels Ole

2007-01-01

...men det er også et område, som mange mennesker ikke rigtig tør forholde sig til og nærmest fortrænger, både fordi de ligger under for IT profeternes demagogi, og fordi de selv føler sig fremmedgjorte overfor ny teknologi og nye medier. ...og IT-fremmedgørelsen Fremmedgørelsen over teknologi og...

[Chromogranin A derived peptide CGA47-66 inhibits hyper-permeability of blood brain barrier in mice with sepsis].

Science.gov (United States)

Zeng, Yan; Zhang, Dan; Jiang, Liping; Wei, Fu; Xu, Shan

2016-02-01

To explore the effect of chromofungin (CHR), a chromogranin A (CGA) derived peptide CGA47-66, on hyper-permeability of blood brain barrier in septic mice. 120 healthy male C57BL/6 mice were randomly divided into groups, with 12 mice in each group. Seventy-two mice were used for dynamic observation of the contents of water and Evan blue (EB) in brain tissue after being treated with lipopolysaccharide (LPS). Another 48 mice were divided into normal saline control group (NS group), LPS induced sepsis model group (LPS group), low-dose CHR pretreatment group (CL+LPS group), and high-dose CHR pretreatment group (CH+LPS group). The septic model was reproduced by intraperitoneal injection of 10 mg/kg LPS 0.1 mL, and the mice in NS group was given equal volume of normal saline. The mice in CL+LPS group and CH+LPS group were intraperitoneally injected with 15.5 μg/kg and 77.5 μg/kg CHR 10 minutes before LPS injection. Six hours after LPS injection, 4 mL/kg of 2% EB was injected via caudal vein, the contents of water and EB in brain tissue were determined, and EB immune fluorescence in brain tissue was determined to assess the changes in permeability of blood brain barrier. Brain pathology was observed with hematoxylin and eosin (HE) staining. With the extension of time after LPS injection, the contents of water and EB in brain tissue were gradually increased, and the time of difference with statistical significance appeared earlier when compared with that of control group in the contents of water than that in EB contents (3 hours and 6 hours, respectively). The contents of water and EB in brain tissue in LPS group were significantly increased as compared with NS group [water content: (79.77±0.62)% vs. (78.28±0.44)%, P water and EB contents in brain tissue induced by LPS, and the effect was more significant in CH+LPS group [water content: (78.15±0.73)% vs. (79.77±0.62)%, EB (μg/g): 7.09±2.59 vs. 13.87±4.50, both P leakage in LPS group was more marked than that of NS

Book review

CERN Multimedia

1967-01-01

Niels Bohr. His life and work as seen by his friends and colleagues, edited by S. Rozentai. Translated from the Danish edition published in 1964. (Amsterdam, North- Holland Publishing Company, 1967, 58 s.)

to view fulltext PDF

Indian Academy of Sciences (India)

, USA bass@phy.duke.edu. Basu Madhumita, Physics Department, Bangabasi College, Kolkata 700 009. Bearden Ian, Niels Bohr Institute, Blegdamsvej 17, 2100 Kobenhavn, Denmark bearden@nbi.dk. Bhalerao Rajeev, Tata Institute of ...

Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins

Directory of Open Access Journals (Sweden)

Kahlem Pascal

2006-06-01

Full Text Available Abstract Background Trisomy of human chromosome 21 (Chr21 results in Down's syndrome, a complex developmental and neurodegenerative disease. Molecular analysis of Down's syndrome, however, poses a particular challenge, because the aneuploid region of Chr21 contains many genes of unknown function. Subcellular localization of human Chr21 proteins may contribute to further understanding of the functions and regulatory mechanisms of the genes that code for these proteins. Following this idea, we used a transfected-cell array technique to perform a rapid and cost-effective analysis of the intracellular distribution of Chr 21 proteins. Results We chose 89 genes that were distributed over the majority of 21q, ranging from RBM11 (14.5 Mb to MCM3AP (46.6 Mb, with part of them expressed aberrantly in the Down's syndrome mouse model. Open reading frames of these genes were cloned into a mammalian expression vector with an amino-terminal His6 tag. All of the constructs were arrayed on glass slides and reverse transfected into HEK293T cells for protein expression. Co-localization detection using a set of organelle markers was carried out for each Chr21 protein. Here, we report the subcellular localization properties of 52 proteins. For 34 of these proteins, their localization is described for the first time. Furthermore, the alteration in cell morphology and growth as a result of protein over-expression for claudin-8 and claudin-14 genes has been characterized. Conclusion The cell array-based protein expression and detection approach is a cost-effective platform for large-scale functional analyses, including protein subcellular localization and cell phenotype screening. The results from this study reveal novel functional features of human Chr21 proteins, which should contribute to further understanding of the molecular pathology of Down's syndrome.

Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

Directory of Open Access Journals (Sweden)

Maria Balcova

2016-04-01

Full Text Available Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm and Mus m. domesticus (Mmd, it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2 genomic locus on Chromosome X (Chr X by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s responsible for variation in the global recombination rate between closely related mouse subspecies.

PINP: a new method of tagging neuronal populations for identification during in vivo electrophysiological recording.

Directory of Open Access Journals (Sweden)

Susana Q Lima

Full Text Available Neural circuits are exquisitely organized, consisting of many different neuronal subpopulations. However, it is difficult to assess the functional roles of these subpopulations using conventional extracellular recording techniques because these techniques do not easily distinguish spikes from different neuronal populations. To overcome this limitation, we have developed PINP (Photostimulation-assisted Identification of Neuronal Populations, a method of tagging neuronal populations for identification during in vivo electrophysiological recording. The method is based on expressing the light-activated channel channelrhodopsin-2 (ChR2 to restricted neuronal subpopulations. ChR2-tagged neurons can be detected electrophysiologically in vivo since illumination of these neurons with a brief flash of blue light triggers a short latency reliable action potential. We demonstrate the feasibility of this technique by expressing ChR2 in distinct populations of cortical neurons using two different strategies. First, we labeled a subpopulation of cortical neurons-mainly fast-spiking interneurons-by using adeno-associated virus (AAV to deliver ChR2 in a transgenic mouse line in which the expression of Cre recombinase was driven by the parvalbumin promoter. Second, we labeled subpopulations of excitatory neurons in the rat auditory cortex with ChR2 based on projection target by using herpes simplex virus 1 (HSV1, which is efficiently taken up by axons and transported retrogradely; we find that this latter population responds to acoustic stimulation differently from unlabeled neurons. Tagging neurons is a novel application of ChR2, used in this case to monitor activity instead of manipulating it. PINP can be readily extended to other populations of genetically identifiable neurons, and will provide a useful method for probing the functional role of different neuronal populations in vivo.

Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

Science.gov (United States)

Balcova, Maria; Faltusova, Barbora; Gergelits, Vaclav; Bhattacharyya, Tanmoy; Mihola, Ondrej; Trachtulec, Zdenek; Knopf, Corinna; Fotopulosova, Vladana; Chvatalova, Irena; Gregorova, Sona; Forejt, Jiri

2016-04-01

Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm) and Mus m. domesticus (Mmd), it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2) genomic locus on Chromosome X (Chr X) by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s) responsible for variation in the global recombination rate between closely related mouse subspecies.

Chromosome X-wide association study identifies Loci for fasting insulin and height and evidence for incomplete dosage compensation.

Directory of Open Access Journals (Sweden)

Taru Tukiainen

2014-02-01

Full Text Available The X chromosome (chrX represents one potential source for the "missing heritability" for complex phenotypes, which thus far has remained underanalyzed in genome-wide association studies (GWAS. Here we demonstrate the benefits of including chrX in GWAS by assessing the contribution of 404,862 chrX SNPs to levels of twelve commonly studied cardiometabolic and anthropometric traits in 19,697 Finnish and Swedish individuals with replication data on 5,032 additional Finns. By using a linear mixed model, we estimate that on average 2.6% of the additive genetic variance in these twelve traits is attributable to chrX, this being in proportion to the number of SNPs in the chromosome. In a chrX-wide association analysis, we identify three novel loci: two for height (rs182838724 near FGF16/ATRX/MAGT1, joint P-value = 2.71×10(-9, and rs1751138 near ITM2A, P-value = 3.03×10(-10 and one for fasting insulin (rs139163435 in Xq23, P-value = 5.18×10(-9. Further, we find that effect sizes for variants near ITM2A, a gene implicated in cartilage development, show evidence for a lack of dosage compensation. This observation is further supported by a sex-difference in ITM2A expression in whole blood (P-value = 0.00251, and is also in agreement with a previous report showing ITM2A escapes from X chromosome inactivation (XCI in the majority of women. Hence, our results show one of the first links between phenotypic variation in a population sample and an XCI-escaping locus and pinpoint ITM2A as a potential contributor to the sexual dimorphism in height. In conclusion, our study provides a clear motivation for including chrX in large-scale genetic studies of complex diseases and traits.

Chromosome X-wide association study identifies Loci for fasting insulin and height and evidence for incomplete dosage compensation.

Science.gov (United States)

Tukiainen, Taru; Pirinen, Matti; Sarin, Antti-Pekka; Ladenvall, Claes; Kettunen, Johannes; Lehtimäki, Terho; Lokki, Marja-Liisa; Perola, Markus; Sinisalo, Juha; Vlachopoulou, Efthymia; Eriksson, Johan G; Groop, Leif; Jula, Antti; Järvelin, Marjo-Riitta; Raitakari, Olli T; Salomaa, Veikko; Ripatti, Samuli

2014-02-01

The X chromosome (chrX) represents one potential source for the "missing heritability" for complex phenotypes, which thus far has remained underanalyzed in genome-wide association studies (GWAS). Here we demonstrate the benefits of including chrX in GWAS by assessing the contribution of 404,862 chrX SNPs to levels of twelve commonly studied cardiometabolic and anthropometric traits in 19,697 Finnish and Swedish individuals with replication data on 5,032 additional Finns. By using a linear mixed model, we estimate that on average 2.6% of the additive genetic variance in these twelve traits is attributable to chrX, this being in proportion to the number of SNPs in the chromosome. In a chrX-wide association analysis, we identify three novel loci: two for height (rs182838724 near FGF16/ATRX/MAGT1, joint P-value = 2.71×10(-9), and rs1751138 near ITM2A, P-value = 3.03×10(-10)) and one for fasting insulin (rs139163435 in Xq23, P-value = 5.18×10(-9)). Further, we find that effect sizes for variants near ITM2A, a gene implicated in cartilage development, show evidence for a lack of dosage compensation. This observation is further supported by a sex-difference in ITM2A expression in whole blood (P-value = 0.00251), and is also in agreement with a previous report showing ITM2A escapes from X chromosome inactivation (XCI) in the majority of women. Hence, our results show one of the first links between phenotypic variation in a population sample and an XCI-escaping locus and pinpoint ITM2A as a potential contributor to the sexual dimorphism in height. In conclusion, our study provides a clear motivation for including chrX in large-scale genetic studies of complex diseases and traits.

Structural characterization of the fusion core in syncytin, envelope protein of human endogenous retrovirus family W

International Nuclear Information System (INIS)

Gong Rui; Peng Xiaoxue; Kang Shuli; Feng Huixing; Huang Jianying; Zhang Wentao; Lin Donghai; Tien Po; Xiao Gengfu

2005-01-01

Syncytin is a captive retroviral envelope protein, possibly involved in the formation of the placental syncytiotrophoblast layer generated by trophoblast cell fusion at the maternal-fetal interface. We found that syncytin and type I viral envelope proteins shared similar structural profiling, especially in the regions of N- and C-terminal heptad repeats (NHR and CHR). We expressed the predicted regions of NHR (41 aa) and CHR (34 aa) in syncytin as a native single chain (named 2-helix protein) to characterize it. 2-helix protein exists as a trimer and is highly α-helix, thermo-stable, and denatured by low pH. NHR and CHR could form a protease-resistant complex. The complex structure built by the molecular docking demonstrated that NHR and CHR associated in an antiparallel manner. Overall, the 2-helix protein could form a thermo-stable coiled coil trimer. The fusion core structure of syncytin was first demonstrated in endogenous retrovirus. These results support the explanation how syncytin mediates cytotrophoblast cell fusion involved in placental morphogenesis

Features in Microfluidic Paper-Based Devices Made by Laser Cutting: How Small Can They Be?

Directory of Open Access Journals (Sweden)

Md. Almostasim Mahmud

2018-05-01

Full Text Available In this paper, we determine the smallest feature size that enables fluid flow in microfluidic paper-based analytical devices (µPADs fabricated by laser cutting. The smallest feature sizes fabricated from five commercially available paper types: Whatman filter paper grade 50 (FP-50, Whatman 3MM Chr chromatography paper (3MM Chr, Whatman 1 Chr chromatography paper (1 Chr, Whatman regenerated cellulose membrane 55 (RC-55 and Amershan Protran 0.45 nitrocellulose membrane (NC, were 139 ± 8 µm, 130 ± 11 µm, 103 ± 12 µm, 45 ± 6 µm, and 24 ± 3 µm, respectively, as determined experimentally by successful fluid flow. We found that the fiber width of the paper correlates with the smallest feature size that has the capacity for fluid flow. We also investigated the flow speed of Allura red dye solution through small-scale channels fabricated from different paper types. We found that the flow speed is significantly slower through microscale features and confirmed the similar trends that were reported previously for millimeter-scale channels, namely that wider channels enable quicker flow speed.

Gclust Server: 39396 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 39396 TET_110.m00120 Cluster Sequences Related Sequences(590) 150 hypothetical protein chr_0_825439...1_110; no annotation 2 1.00e-10 0.0 11.11 0.0 0.0 0.0 0.0 Show 39396 Cluster ID 39396 Sequen...(590) Sequence length 150 Representative annotation hypothetical protein chr_0_825439

Refinement of genotype-phenotype correlation in 18 patients carrying a 1q24q25 deletion

DEFF Research Database (Denmark)

Chatron, Nicolas; Haddad, Véronique; Andrieux, Joris

2015-01-01

of different sizes (490 kb to 20.95 Mb) localized within chromosome bands 1q23.3-q31.2 (chr1:160797550-192912120, hg19). The 490 kb deletion is the smallest deletion reported to date associated with this phenotype. We delineated three regions that may contribute to the phenotype: a proximal one (chr1...

Udvidelsen af relationsfeltets didaktik – med religionsundervisningen som eksempel

DEFF Research Database (Denmark)

Skovmand, Keld

beskrive denne dobbeltbevægelse som en almen fagdidaktik (Nielsen 1998 [1994]) eller – med inspiration fra Klafki – en relationsfeltets didaktik (Nielsen 2012). Dobbeltblikket på didaktikken som et relationsfelt kan kvalificeres ved hjælp af de fire kriterier for indholdsvalg, som er udformet af Frede V...... specificere indhold (DuFour & Marzano 2011). Referencer DuFour, Richard & Marzano, Robert J. 2011: Leaders of learning. How district, school, and classroom leaders improve student achievement. Bloomington, IN: Solution Tree Press. Hattie, John 2009: Visible learning. A synthesis of over 800 meta...

Proceedings of the 5th Danish Human-Computer Interaction Research Symposium

DEFF Research Database (Denmark)

Clemmensen, Torkil; Nielsen, Lene

2005-01-01

Lene Nielsen DEALING WITH REALITY - IN THEORY Gitte Skou PetersenA NEW IFIP WORKING GROUP - HUMAN WORK INTERACTION DESIGN Rikke Ørngreen, Torkil Clemmensen & Annelise Mark-Pejtersen CLASSIFICATION OF DESCRIPTIONS USED IN SOFTWARE AND INTERACTION DESIGN Georg Strøm OBSTACLES TO DESIGN IN VOLUNTEER BASED...... for the symposium, of which 14 were presented orally in four panel sessions. Previously the symposium has been held at University of Aarhus 2001, University of Copenhagen 2002, Roskilde University Center 2003, Aalborg University 2004. Torkil Clemmensen & Lene Nielsen Copenhagen, November 2005 CONTENT INTRODUCTION...

CCR 20th Anniversary Commentary: The Development of Breast Cancer Molecular Subtyping.

Science.gov (United States)

Nielsen, Torsten O; Perou, Charles M

2015-04-15

In the August 15, 2004, issue of Clinical Cancer Research, Nielsen and colleagues demonstrated how a cancer subtype identified by gene expression profiling could be validated using a widely accessible technology (immunohistochemistry). This opened the door to large-scale studies of archival cohorts and clinical trials, which allowed detailed clinical understanding of a new genomic discovery. Clin Cancer Res; 21(8); 1779-81. ©2015 AACR. See related article by Nielsen et al., Clin Cancer Res 2004;10(16) Aug 15, 2004;5367-74. ©2015 American Association for Cancer Research.

Estimation of the Reliability of Plastic Slabs

DEFF Research Database (Denmark)

Pirzada, G. B. : Ph.D.

In this thesis, work related to fundamental conditions has been extended to non-fundamental or the general case of probabilistic analysis. Finally, using the ss-unzipping technique a door has been opened to system reliability analysis of plastic slabs. An attempt has been made in this thesis...... to give a probabilistic treatment of plastic slabs which is parallel to the deterministic and systematic treatment of plastic slabs by Nielsen (3). The fundamental reason is that in Nielsen (3) the treatment is based on a deterministic modelling of the basic material properties for the reinforced...

VENEZUELANS´ APPROPRIATION OF SOCIAL MEDIA FOR E-GOVERNMENT

Directory of Open Access Journals (Sweden)

María Isabel Neuman

2015-04-01

Full Text Available In this paper we analyze actual figures of the use of twitter which are contrasted with the theory of virtual communities of Nielsen (2006, with emphasis on the analysis of the account @chavezcandanga of former president Hugo Chavez. The data was obtained from the analytical social networking platforms that processes the Twitter API and international research centers. We conclude that in the case of the virtual community of the @chavezcandanga account the characteristics of social networks are harnessed as an innovative practice in e-government and Nielsen formulations are met.

Spatiotemporal Control of GPR37 Signaling and Its Behavioral Effects by Optogenetics

Directory of Open Access Journals (Sweden)

Wu Zheng

2018-03-01

Full Text Available Despite the progress in deorphanization of G Protein-Coupled Receptors (GPCRs, ≈100 GPCRs are still classified as orphan receptors without identified endogenous ligands and with unknown physiological functions. The lack of endogenous ligands triggering GPCR signaling has hampered the study of orphan GPCR functions. Using GPR37 as an example, we provide here the first demonstration of the channelrhodopsin 2 (ChR2-GPCR approach to bypass the endogenous ligand and selectively activate the orphan GPCR signal by optogenetics. Inspired by the opto-XR approach, we designed the ChR2-GPR37 chimera, in which the corresponding parts of GPR37 replaced the intracellular portions of ChR2. We showed that optogenetic activation of ChR2/opto-GPR37 elicited specific GPR37 signaling, as evidenced by reduced cAMP level, enhanced ERK phosphorylation and increased motor activity, confirming the specificity of opto-GPR37 signaling. Besides, optogenetic activation of opto-GPR37 uncovered novel aspects of GPR37 signaling (such as IP-3 signaling and anxiety-related behavior. Optogenetic activation of opto-GPR37 permits the causal analysis of GPR37 activity in the defined cells and behavioral responses of freely moving animals. Importantly, given the evolutionarily conserved seven-helix transmembrane structures of ChR2 and orphan GPCRs, we propose that opto-GPR37 approach can be readily applied to other orphan GPCRs for their deorphanization in freely moving animals.

Identification of genetic modifiers of behavioral phenotypes in serotonin transporter knockout rats

Directory of Open Access Journals (Sweden)

Nijman Isaäc J

2010-05-01

Full Text Available Abstract Background Genetic variation in the regulatory region of the human serotonin transporter gene (SLC6A4 has been shown to affect brain functionality and personality. However, large heterogeneity in its biological effects is observed, which is at least partially due to genetic modifiers. To gain insight into serotonin transporter (SERT-specific genetic modifiers, we studied an intercross between the Wistar SERT-/- rat and the behaviorally and genetically divergent Brown Norway rat, and performed a QTL analysis. Results In a cohort of >150 intercross SERT-/- and control (SERT+/+ rats we characterized 12 traits that were previously associated with SERT deficiency, including activity, exploratory pattern, cocaine-induced locomotor activity, and abdominal and subcutaneous fat. Using 325 genetic markers, 10 SERT-/--specific quantitative trait loci (QTLs for parameters related to activity and exploratory pattern (Chr.1,9,11,14, and cocaine-induced anxiety and locomotor activity (Chr.5,8 were identified. No significant QTLs were found for fat parameters. Using in silico approaches we explored potential causal genes within modifier QTL regions and found interesting candidates, amongst others, the 5-HT1D receptor (Chr. 5, dopamine D2 receptor (Chr. 8, cannabinoid receptor 2 (Chr. 5, and genes involved in fetal development and plasticity (across chromosomes. Conclusions We anticipate that the SERT-/--specific QTLs may lead to the identification of new modulators of serotonergic signaling, which may be targets for pharmacogenetic and therapeutic approaches.

High-risk diagnosis, social stress, and parent-child relationships: A moderation model.

Science.gov (United States)

Bentley, Eryn; Millman, Zachary B; Thompson, Elizabeth; Demro, Caroline; Kline, Emily; Pitts, Steven C; DeVylder, Jordan E; Smith, Melissa Edmondson; Reeves, Gloria; Schiffman, Jason

2016-07-01

Stress is related to symptom severity among youth at clinical high-risk (CHR) for psychosis, although this relation may be influenced by protective factors. We explored whether the association of CHR diagnosis with social stress is moderated by the quality of parent-child relationships in a sample of 96 (36 CHR; 60 help-seeking controls) adolescents and young adults receiving mental health services. We examined self-reported social stress and parent-child relationships as measured by the Behavior Assessment System for Children, Second Edition (BASC-2), and determined CHR status from the clinician-administered Structured Interview for Psychosis-Risk Syndrome (SIPS). The social stress subscale, part of the clinical domain of the BASC-2, assesses feelings of stress and tension in personal relationships and the relations with parents subscale, part of the adaptive domain of the BASC-2, assesses perceptions of importance in family and quality of parent-child relationship. There was a modest direct relation between risk diagnosis and social stress. Among those at CHR, however, there was a significant relation between parent-child relationships and social stress (b=-0.73, t[92]=-3.77, psocial stress for those at risk for psychosis. Findings provide additional evidence to suggest that interventions that simultaneously target both social stress and parent-child relationships might be relevant for adolescents and young adults at clinical high-risk for psychosis. Copyright © 2016 Elsevier B.V. All rights reserved.

Chronotherapeutic drug delivery systems: an approach to circadian rhythms diseases.

Science.gov (United States)

Sunil, S A; Srikanth, M V; Rao, N Sreenivasa; Uhumwangho, M U; Latha, K; Murthy, K V Ramana

2011-11-01

The purpose of writing this review on chronotherapeutic drug delivery systems (ChrDDs) is to review the literatures with special focus on ChrDDs and the various dosage forms, techniques that are used to target the circadian rhythms (CR) of various diseases. Many functions of the human body vary considerably in a day. ChrDDs refers to a treatment method in which in vivo drug availability is timed to match circadian rhythms of disease in order to optimize therapeutic outcomes and minimize side effects. Several techniques have been developed but not many dosage forms for all the diseases are available in the market. ChrDDs are gaining importance in the field of pharmaceutical technology as these systems reduce dosing frequency, toxicity and deliver the drug that matches the CR of that particular disease when the symptoms are maximum to worse. Finally, the ultimate benefit goes to the patient due the compliance and convenience of the dosage form. Some diseases that follow circadian rhythms include cardiovascular diseases, asthma, arthritis, ulcers, diabetes etc. ChrDDs in the market were also discussed and the current technologies used to formulate were also stated. These technologies include Contin® , Chronotopic®, Pulsincaps®, Ceform®, Timerx®, Oros®, Codas®, Diffucaps®, Egalet®, Tablet in capsule device, Core-in-cup tablet technology. A coated drug-core tablet matrix, A bi-layered tablet, Multiparticulate-based chronotherapeutic drug delivery systems, Chronoset and Controlled release microchips.

Can We Predict Psychosis Outside the Clinical High-Risk State? A Systematic Review of Non-Psychotic Risk Syndromes for Mental Disorders

Science.gov (United States)

Lee, Tae Young; Lee, Junhee; Kim, Minah; Choe, Eugenie

2018-01-01

Abstract Recent evidence has suggested that psychosis could develop not only in people at clinical high risk for psychosis (CHR-P) but also in those with clinical risk syndromes for emergent nonpsychotic mental disorders. The proportion of people with these clinical risk syndromes who will develop psychosis rather than to other nonpsychotic mental disorders is undetermined. Electronic databases were searched for studies reporting on clinical risk syndromes for the development of emergent nonpsychotic mental disorders. Incidence of emerging psychotic and nonpsychotic mental disorders defined on the ICD or DSM. Of a total of 9 studies relating to 3006 nonpsychotic at-risk individuals were included. Within prospective studies (n = 4, sample = 1051), the pooled incidence of new psychotic disorders across these clinical risk syndromes was of 12.9 per 1000 person-years (95% CI: 4.3 to 38.6) and that of nonpsychotic disorders (n = 3, sample = 538) was of 43.5 per 1000 person-years (95% CI: 30.9 to 61.3). Psychotic disorders may emerge outside the CHR-P paradigm, from clinical risk syndromes for incident nonpsychotic disorders, albeit at lower rates than in the CHR-P group. The clinical risk syndromes for emerging nonpsychotic disorders may exhibit a pluripotential risk of developing several types of mental disorders compared with CHR-P. If substantiated by future research, the current findings suggest that it may be useful to move beyond the current strategy of identifying individuals meeting CHR-P criteria only. PMID:29438561

Genome-wide association mapping for seed protein and oil contents using a large panel of soybean accessions.

Science.gov (United States)

Li, Dongmei; Zhao, Xue; Han, Yingpeng; Li, Wenbin; Xie, Futi

2018-01-08

Soybean is globally cultivated primarily for its protein and oil. The protein and oil contents of the seeds are quantitatively inherited traits determined by the interaction of numerous genes. In order to gain a better understanding of the molecular foundation of soybean protein and oil content for the marker-assisted selection (MAS) of high quality traits, a population of 185 soybean germplasms was evaluated to identify the quantitative trait loci (QTLs) associated with the seed protein and oil contents. Using specific length amplified fragment sequencing (SLAF-seq) technology, a total of 12,072 single nucleotide polymorphisms (SNPs) with a minor allele frequency (MAF) ≥ 0.05 were detected across the 20 chromosomes (Chr), with a marker density of 78.7 kbp. A total of 31 SNPs located on 12 of the 20 soybean chromosomes were correlated with seed protein and oil content. Of the 31 SNPs that were associated with the two target traits, 31 beneficial alleles were identified. Two SNP markers, namely rs15774585 and rs15783346 on Chr 07, were determined to be related to seed oil content both in 2015 and 2016. Three SNP markers, rs53140888 on Chr 01, rs19485676 on Chr 13, and rs24787338 on Chr 20 were correlated with seed protein content both in 2015 and 2016. These beneficial alleles may potentially contribute towards the MAS of favorable soybean protein and oil characteristics. Copyright © 2018. Published by Elsevier Inc.

Edukus jättis eurost ilma / Sirje Rank

Index Scriptorium Estoniae

Rank, Sirje, 1966-

2006-01-01

Euroopa Komisjon lükkas Eesti ja Leedu taotlused eurotsooniga liitumiseks tagasi. Küsimustele vastab Taani majandusprofessor Niels Thygesen. Diagramm: EL-i riikide majanduskasv. Vt. samas: Eurotsooni praeguste liikmete jaoks on reegleid ümber kirjutatud

Inauguration of Proton Synchrotron

CERN Multimedia

1960-01-01

On 5 February 1960, the Proton Synchrotron (PS) was formally inaugurated. The great Danish physicist, Niels Bohr, releases a bottle of champagne against a shielding block to launch the PS on its voyage in physics.

At WA7

CERN Multimedia

1977-01-01

The CERN-Genoa-Annecy(LAPP)- Niels Bohr Institute, Copenhagen-Oslo-University College,London Collaboration set-up the experiment WA7 to study two-body reactions at large transverse momentum. Here, Michel Yvert, Alberto Santronico, Per Carlson

Unigene BLAST: CBRC-DMEL-03-0012 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0012 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 0.64 34% ...

Unigene BLAST: CBRC-DMEL-01-0039 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0039 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-11 25% ...

Unigene BLAST: CBRC-DMEL-04-0014 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0014 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-37 49% ...

Unigene BLAST: CBRC-DMEL-01-0065 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0065 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-11 29% ...

Unigene BLAST: CBRC-DMEL-03-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0057 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 6e-13 25% ...

Unigene BLAST: CBRC-DMEL-01-0038 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0038 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 4e-84 95% ...

Unigene BLAST: CBRC-DMEL-03-0039 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0039 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-31 40% ...

Unigene BLAST: CBRC-DMEL-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0074 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-09 28% ...

Unigene BLAST: CBRC-DMEL-01-0066 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0066 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 3e-14 34% ...

Unigene BLAST: CBRC-DMEL-02-0056 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0056 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-11 26% ...

Unigene BLAST: CBRC-DMEL-06-0041 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-06-0041 gnl|UG|Dm#S40592667 DMG1A.1_1.E02.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.6.106.a, mRNA sequence /clone=DMG1-chr2L.6.106.a /gb=EW712706 /gi=156141512 /ug=Dm.26303 /len=1270 0.17 28% ...

Unigene BLAST: CBRC-DMEL-08-0015 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-08-0015 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 35% ...

Unigene BLAST: CBRC-DMEL-03-0045 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0045 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 1e-23 38% ...

Unigene BLAST: CBRC-DMEL-02-0034 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0034 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 8e-12 25% ...

Unigene BLAST: CBRC-DMEL-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0013 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 7e-29 43% ...

Unigene BLAST: CBRC-DMEL-08-0038 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-08-0038 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 6e-10 32% ...

Unigene BLAST: CBRC-DMEL-08-0039 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-08-0039 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 4e-07 39% ...

Unigene BLAST: CBRC-DMEL-04-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-04 26% ...

Unigene BLAST: CBRC-DMEL-04-0005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0005 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-06 20% ...

Unigene BLAST: CBRC-DMEL-03-0071 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0071 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 3e-07 47% ...

Unigene BLAST: CBRC-DMEL-02-0008 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0008 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 3e-12 22% ...

Unigene BLAST: CBRC-DMEL-08-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-08-0057 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 2e-06 22% ...

Unigene BLAST: CBRC-DMEL-02-0075 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0075 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 4e-66 93% ...

Unigene BLAST: CBRC-DMEL-02-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0037 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-12 26% ...

Unigene BLAST: CBRC-DMEL-04-0058 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0058 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-26 32% ...

Unigene BLAST: CBRC-DMEL-02-0018 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0018 gnl|UG|Dm#S40592688 DMG1A.1_1.C09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.19.066.a, mRNA sequence /clone=DMG1-chr3L.19.066.a /gb=EW712727 /gi=156141533 /ug=Dm.35847 /len=1518 1.4 35% ...

Unigene BLAST: CBRC-DMEL-04-0021 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0021 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 2e-16 32% ...

Unigene BLAST: CBRC-DMEL-01-0040 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0040 gnl|UG|Dm#S40593079 DMG1C.3_1.F09.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2L.8.057.a, mRNA sequence /clone=DMG1-chr2L.8.057.a /gb=EW713118 /gi=156142072 /ug=Dm.26354 /len=1535 2e-05 30% ...

Unigene BLAST: CBRC-DMEL-04-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0006 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 0.048 17% ...

Unigene BLAST: CBRC-DMEL-01-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-01-0067 gnl|UG|Dm#S40593085 DMG1C.2_1.C03.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr2R.19.116.a, mRNA sequence /clone=DMG1-chr2R.19.116.a /gb=EW713124 /gi=156142078 /ug=Dm.26350 /len=1473 2e-10 31% ...

Unigene BLAST: CBRC-DMEL-04-0010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0010 gnl|UG|Dm#S40593089 DMG1C.2_1.B05.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3L.17.035.a, mRNA sequence /clone=DMG1-chr3L.17.035.a /gb=EW713128 /gi=156142082 /ug=Dm.15247 /len=1404 1.8 29% ...

Unigene BLAST: CBRC-DMEL-04-0015 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0015 gnl|UG|Dm#S40593060 DMG1C.3_1.C08.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.5.051.a, mRNA sequence /clone=DMG1-chr3R.5.051.a /gb=EW713099 /gi=156142053 /ug=Dm.27239 /len=1584 9e-82 98% ...

Post Traumatic Stress Disorder and psychological functioning in children of parents with acquired brain injury

DEFF Research Database (Denmark)

Kieffer, Rikke; Teasdale, Thomas William; Blinkenberg, Niels

2011-01-01

RIKKE KIEFFER-KRISTENSEN1, THOMAS W. TEASDALE1, & NIELS BILENBERG2 1Department of Psychology, University of Copenhagen, Copenhagen, Denmark and 2Department of Child and Department of Adolescence Psychiatry, University of Southern Denmark, Odense, Denmark (Received...

What hope is there for South Africa? A public theological reflection ...

African Journals Online (AJOL)

2015-04-29

Apr 29, 2015 ... As the Danish physicist, Niels Bohr, rightly said: 'Prediction is very difficult, especially if it ..... sanitation, electricity and refuse removal have also increased in ..... Real final consumption expenditure (FCE) per capita labour force ...

Miscasting, TV adaptation inhibit 'Copenhagen' drama

CERN Multimedia

Winn, S

2002-01-01

Review of a television adaptation of the play 'Copenhagen', produced by Howard Davies for PBS, USA . The play speculates on the real reason that Werner Heisenberg came to see Niels Bohr in Copenhagen in 1941 (1 page).

Optogenetic long-term manipulation of behavior and animal development.

Directory of Open Access Journals (Sweden)

Christian Schultheis

Full Text Available Channelrhodopsin-2 (ChR2 is widely used for rapid photodepolarization of neurons, yet, as it requires high-intensity blue light for activation, it is not suited for long-term in vivo applications, e.g. for manipulations of behavior, or photoactivation of neurons during development. We used "slow" ChR2 variants with mutations in the C128 residue, that exhibit delayed off-kinetics and increased light sensitivity in Caenorhabditis elegans. Following a 1 s light pulse, we could photodepolarize neurons and muscles for minutes (and with repeated brief stimulation, up to days with low-intensity light. Photoactivation of ChR2(C128S in command interneurons elicited long-lasting alterations in locomotion. Finally, we could optically induce profound changes in animal development: Long-term photoactivation of ASJ neurons, which regulate larval growth, bypassed the constitutive entry into the "dauer" larval state in daf-11 mutants. These lack a guanylyl cyclase, which possibly renders ASJ neurons hyperpolarized. Furthermore, photostimulated ASJ neurons could acutely trigger dauer-exit. Thus, slow ChR2s can be employed to long-term photoactivate behavior and to trigger alternative animal development.

and Epigenetic Dysregulation in Diabetes-prone Bicongenic B6.NODC11bxC1tb Mice

Directory of Open Access Journals (Sweden)

Erin Garrigan

2015-01-01

Full Text Available In Type 1 diabetic (T1D human monocytes, STAT5 aberrantly binds to epigenetic regulatory sites of two proinflammatory genes, CSF2 (encoding granulocyte–macrophage colony-stimulating factor and PTGS2 (encoding prostaglandin synthase 2/cyclooxygenase 2. Bicongenic B6.NOD C11bxC1tb mice re-create this phenotype of T1D monocytes with only two nonobese diabetic (NOD Idd subloci (130.8 Mb–149.7 Mb, of Idd5 on Chr 1 and 32.08–53.85 Mb of Idd4.3 on Chr11 on C57BL/6 genetic background. These two Idd loci interact through STAT5 binding at upstream regulatory regions affecting Csf2 ( Chr 11 and Ptgs2 ( Chr 1 expression. B6.NODC11bxC1tb mice exhibited hyperglycemia and immune destruction of pancreatic islets between 8 and 30 weeks of age, with 12%–22% penetrance. Thus, B6.NODC11bxC1tb mice embody NOD epigenetic dysregulation of gene expression in myeloid cells, and this defect appears to be sufficient to impart genetic susceptibility to diabetes in an otherwise genetically nonautoimmune mouse.

Direct projections from hypothalamic orexin neurons to brainstem cardiac vagal neurons.

Science.gov (United States)

Dergacheva, Olga; Yamanaka, Akihiro; Schwartz, Alan R; Polotsky, Vsevolod Y; Mendelowitz, David

2016-12-17

Orexin neurons are known to augment the sympathetic control of cardiovascular function, however the role of orexin neurons in parasympathetic cardiac regulation remains unclear. To test the hypothesis that orexin neurons contribute to parasympathetic control we selectively expressed channelrhodopsin-2 (ChR2) in orexin neurons in orexin-Cre transgenic rats and examined postsynaptic currents in cardiac vagal neurons (CVNs) in the dorsal motor nucleus of the vagus (DMV). Simultaneous photostimulation and recording in ChR2-expressing orexin neurons in the lateral hypothalamus resulted in reliable action potential firing as well as large whole-cell currents suggesting a strong expression of ChR2 and reliable optogenetic excitation. Photostimulation of ChR2-expressing fibers in the DMV elicited short-latency (ranging from 3.2ms to 8.5ms) postsynaptic currents in 16 out of 44 CVNs tested. These responses were heterogeneous and included excitatory glutamatergic (63%) and inhibitory GABAergic (37%) postsynaptic currents. The results from this study suggest different sub-population of orexin neurons may exert diverse influences on brainstem CVNs and therefore may play distinct functional roles in parasympathetic control of the heart. Copyright © 2016 IBRO. Published by Elsevier Ltd. All rights reserved.

Cosmopolitanism | Nielsen | South African Journal of Philosophy

African Journals Online (AJOL)

This essay explicates and defends a version of moral cosmopolitanism. It builds on the work of Martha Nussbaum and Kwame Anthony Appiah, who in turn build on Cicero and Kant. It is an update in a contemporary idiom of a classical cosmopolitanism. In a time when Enlightenment ideas are widely discounted, it gives ...

Claus Beck-Nielsen som spøgelse

DEFF Research Database (Denmark)

Larsen, Peter Stein

2012-01-01

Med Brian Grahams artikel “Sympathy for the Spectres: The Double Nature of Blake’s Spectral Figures in Jerusalem” forbliver vi inden for den litterære tradition, men bevæger os en smule længere frem i tiden. Graham retter blikket mod William Blakes forfatterskab og påpeger, at Blakes univers er...... feministisk synsvinkel – er spøgelserne dobbelte: de spiller en rolle i kristendommens historie, samtidig med at de spiller en kontrasterende sympatisk rolle i den universelle strid mellem Blakes ”male and female powers”, denne evige strid mellem disse to poler ses af Blake som grundlaget for al skabelse og...

Alternative Neo-Rimannian Approaches to Carl Nielsen

DEFF Research Database (Denmark)

Nielsen, Svend Hvidtfelt

2012-01-01

their respective groundbreaking works. Even though Jersild’s and Maegaard’s theories are developed independent of these writers, their content communicates with the content of these writer’s theories. And even though a theory of foreground harmonic progressions like Jersild’s is seemingly as opposed as possible...... to a Schenkerian middleground based harmonic approach they actually in some regards do have something in common, just as they in other regards supplement each other perfectly. I try through the analyses of Nielsen’s music – plus a few other examples (Schumann, Liszt and Wolf) – to show how the theories...

Theory of Mind Impairments in Youth at Clinical High Risk of Psychosis.

Science.gov (United States)

Zhang, TianHong; Tang, YingYing; Cui, HuiRu; Lu, Xi; Xu, LiHua; Liu, XiaoHua; Li, HuiJun; Chow, Annabelle; Du, YaSong; Li, ChunBo; Jiang, KaiDa; Xiao, ZePing; Wang, JiJun

2016-01-01

The normal maturational processes of theory of mind (ToM) capacity are ongoing during adolescence and even early adulthood. However, research has shown that ToM ability also declines among adults suffering from prodromal psychotic experiences. The goal of this study was to investigate the characteristics of ToM performance in youth with clinical high risk (CHR) of psychosis. The Reading Mind in Eyes Task (RMET), including own-race and other-race eyes, was administered to 40 CHR youth; 42 age-, gender-, and education-matched healthy controls (HCs); and 62 adult patients with schizophrenia (SZ). Nine-month follow-up data were collected from 31 CHR subjects, of whom 7 (22.6%) had made the transition to psychosis. CHR youth showed significant impairment in RMET performance compared to HC youth but performed better than did SZ patients. Moreover, they were significantly slower than were HC youth in responding to the RMET, with a response time similar to that of SZ patients. In particular, they had significantly poorer accuracy in interpreting positive and neutral eye expressions compared to the HC group, but not in interpreting negative eye expressions. Preliminary follow-up data showed a trend toward significance (p = 0.079) for RMET performance between those who transitioned to psychosis and those who did not. Our findings illustrate that deficits in ToM capacity, specifically the ability to interpret people's mental state from eye expressions, occur early on in prodromal psychosis in youth. Early interventions for CHR youth focusing on ToM enhancement may halt progress toward psychosis.

Intensive Auditory Cognitive Training Improves Verbal Memory in Adolescents and Young Adults at Clinical High Risk for Psychosis.

Science.gov (United States)

Loewy, Rachel; Fisher, Melissa; Schlosser, Danielle A; Biagianti, Bruno; Stuart, Barbara; Mathalon, Daniel H; Vinogradov, Sophia

2016-07-01

Individuals at clinical high risk (CHR) for psychosis demonstrate cognitive impairments that predict later psychotic transition and real-world functioning. Cognitive training has shown benefits in schizophrenia, but has not yet been adequately tested in the CHR population. In this double-blind randomized controlled trial, CHR individuals (N = 83) were given laptop computers and trained at home on 40 hours of auditory processing-based exercises designed to target verbal learning and memory operations, or on computer games (CG). Participants were assessed with neurocognitive tests based on the Measurement and Treatment Research to Improve Cognition in Schizophrenia initiative (MATRICS) battery and rated on symptoms and functioning. Groups were compared before and after training using a mixed-effects model with restricted maximum likelihood estimation, given the high study attrition rate (42%). Participants in the targeted cognitive training group showed a significant improvement in Verbal Memory compared to CG participants (effect size = 0.61). Positive and Total symptoms improved in both groups over time. CHR individuals showed patterns of training-induced cognitive improvement in verbal memory consistent with prior observations in schizophrenia. This is a particularly vulnerable domain in individuals at-risk for psychosis that predicts later functioning and psychotic transition. Ongoing follow-up of this cohort will assess the durability of training effects in CHR individuals, as well as the potential impact on symptoms and functioning over time. Clinical Trials Number: NCT00655239. URL: https://clinicaltrials.gov/ct2/show/NCT00655239?term=vinogradov&rank=5. Published by Oxford University Press on behalf of the Maryland Psychiatric Research Center 2016.

Review of Middle Eastern Cities 1900-1950. Public Places and Public Spheres in Transformation

DEFF Research Database (Denmark)

Vacher, Helene

2004-01-01

Hans Chr. Korsholm and Jacob Skovgaard Petersen (Ed.)Middle Eastern Cities 1900-1950. Public Places and Public Spheres in Transformation.Proceedings of the Danish Institute in Damascus I. Aarhus, Aarhus University Press, 2001......Hans Chr. Korsholm and Jacob Skovgaard Petersen (Ed.)Middle Eastern Cities 1900-1950. Public Places and Public Spheres in Transformation.Proceedings of the Danish Institute in Damascus I. Aarhus, Aarhus University Press, 2001...

Back to the Future

CERN Multimedia

Collins, Graham

2004-01-01

"Predictions are hard to make, especially about the future" said Nobel physicist Niels Bohr, many years ago. But two months ago, 150 leading physicists gathered at the University of California to engage in just that daunting task (1 page)

Genome-wide association study identifies genetic loci associated with iron deficiency.

Directory of Open Access Journals (Sweden)

Christine E McLaren

2011-03-01

Full Text Available The existence of multiple inherited disorders of iron metabolism in man, rodents and other vertebrates suggests genetic contributions to iron deficiency. To identify new genomic locations associated with iron deficiency, a genome-wide association study (GWAS was performed using DNA collected from white men aged≥25 y and women≥50 y in the Hemochromatosis and Iron Overload Screening (HEIRS Study with serum ferritin (SF≤12 µg/L (cases and iron replete controls (SF>100 µg/L in men, SF>50 µg/L in women. Regression analysis was used to examine the association between case-control status (336 cases, 343 controls and quantitative serum iron measures and 331,060 single nucleotide polymorphism (SNP genotypes, with replication analyses performed in a sample of 71 cases and 161 controls from a population of white male and female veterans screened at a US Veterans Affairs (VA medical center. Five SNPs identified in the GWAS met genome-wide statistical significance for association with at least one iron measure, rs2698530 on chr. 2p14; rs3811647 on chr. 3q22, a known SNP in the transferrin (TF gene region; rs1800562 on chr. 6p22, the C282Y mutation in the HFE gene; rs7787204 on chr. 7p21; and rs987710 on chr. 22q11 (GWAS observed P<1.51×10(-7 for all. An association between total iron binding capacity and SNP rs3811647 in the TF gene (GWAS observed P=7.0×10(-9, corrected P=0.012 was replicated within the VA samples (observed P=0.012. Associations with the C282Y mutation in the HFE gene also were replicated. The joint analysis of the HEIRS and VA samples revealed strong associations between rs2698530 on chr. 2p14 and iron status outcomes. These results confirm a previously-described TF polymorphism and implicate one potential new locus as a target for gene identification.

Copy Number Variation in the Horse Genome

Science.gov (United States)

Ghosh, Sharmila; Qu, Zhipeng; Das, Pranab J.; Fang, Erica; Juras, Rytis; Cothran, E. Gus; McDonell, Sue; Kenney, Daniel G.; Lear, Teri L.; Adelson, David L.; Chowdhary, Bhanu P.; Raudsepp, Terje

2014-01-01

We constructed a 400K WG tiling oligoarray for the horse and applied it for the discovery of copy number variations (CNVs) in 38 normal horses of 16 diverse breeds, and the Przewalski horse. Probes on the array represented 18,763 autosomal and X-linked genes, and intergenic, sub-telomeric and chrY sequences. We identified 258 CNV regions (CNVRs) across all autosomes, chrX and chrUn, but not in chrY. CNVs comprised 1.3% of the horse genome with chr12 being most enriched. American Miniature horses had the highest and American Quarter Horses the lowest number of CNVs in relation to Thoroughbred reference. The Przewalski horse was similar to native ponies and draft breeds. The majority of CNVRs involved genes, while 20% were located in intergenic regions. Similar to previous studies in horses and other mammals, molecular functions of CNV-associated genes were predominantly in sensory perception, immunity and reproduction. The findings were integrated with previous studies to generate a composite genome-wide dataset of 1476 CNVRs. Of these, 301 CNVRs were shared between studies, while 1174 were novel and require further validation. Integrated data revealed that to date, 41 out of over 400 breeds of the domestic horse have been analyzed for CNVs, of which 11 new breeds were added in this study. Finally, the composite CNV dataset was applied in a pilot study for the discovery of CNVs in 6 horses with XY disorders of sexual development. A homozygous deletion involving AKR1C gene cluster in chr29 in two affected horses was considered possibly causative because of the known role of AKR1C genes in testicular androgen synthesis and sexual development. While the findings improve and integrate the knowledge of CNVs in horses, they also show that for effective discovery of variants of biomedical importance, more breeds and individuals need to be analyzed using comparable methodological approaches. PMID:25340504

Copy number variation in the horse genome.

Directory of Open Access Journals (Sweden)

Sharmila Ghosh

2014-10-01

Full Text Available We constructed a 400K WG tiling oligoarray for the horse and applied it for the discovery of copy number variations (CNVs in 38 normal horses of 16 diverse breeds, and the Przewalski horse. Probes on the array represented 18,763 autosomal and X-linked genes, and intergenic, sub-telomeric and chrY sequences. We identified 258 CNV regions (CNVRs across all autosomes, chrX and chrUn, but not in chrY. CNVs comprised 1.3% of the horse genome with chr12 being most enriched. American Miniature horses had the highest and American Quarter Horses the lowest number of CNVs in relation to Thoroughbred reference. The Przewalski horse was similar to native ponies and draft breeds. The majority of CNVRs involved genes, while 20% were located in intergenic regions. Similar to previous studies in horses and other mammals, molecular functions of CNV-associated genes were predominantly in sensory perception, immunity and reproduction. The findings were integrated with previous studies to generate a composite genome-wide dataset of 1476 CNVRs. Of these, 301 CNVRs were shared between studies, while 1174 were novel and require further validation. Integrated data revealed that to date, 41 out of over 400 breeds of the domestic horse have been analyzed for CNVs, of which 11 new breeds were added in this study. Finally, the composite CNV dataset was applied in a pilot study for the discovery of CNVs in 6 horses with XY disorders of sexual development. A homozygous deletion involving AKR1C gene cluster in chr29 in two affected horses was considered possibly causative because of the known role of AKR1C genes in testicular androgen synthesis and sexual development. While the findings improve and integrate the knowledge of CNVs in horses, they also show that for effective discovery of variants of biomedical importance, more breeds and individuals need to be analyzed using comparable methodological approaches.

EPA guidance on the early intervention in clinical high risk states of psychoses

DEFF Research Database (Denmark)

Schmidt, S J; Schultze-Lutter, F; Schimmelmann, B G

2015-01-01

-analysis of current empirical evidence on the efficacy of psychological and pharmacological interventions in CHR samples. Eligible studies had to investigate conversion rate and/or functioning as a treatment outcome in CHR patients defined by the ultra-high risk and/or basic symptom criteria. Besides analyses...... on treatment effects on conversion rate and functional outcome, age and type of intervention were examined as potential moderators. Based on data from 15 studies (n=1394), early intervention generally produced significantly reduced conversion rates at 6- to 48-month follow-up compared to control conditions...... on conversion rates, but not on functional outcome relative to the control conditions. Early intervention in youth samples was generally less effective than in predominantly adult samples. Seven evidence-based recommendations for early intervention in CHR samples could have been formulated, although more...

Euroopa abiraha igatseb taotlejaid / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2008-01-01

Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

Nuclear structure 1985

International Nuclear Information System (INIS)

Broglia, R.; Hagemann, G.; Herskind, B.

1985-01-01

These proceedings of the Niels Bohr Centennial Conference contains 40 lectures in nuclear physics ranging over the following subjects: single particle motion; collective motion at low excitation energy; collective motion at high angular momentum; giant resonances and nuclear forces. (G.J.P.)

Modeling of Aircraft Deicing Fluid Induced Biochemical Oxygen Demand in Subsurface-Flow Constructed Treatment Wetlands

Science.gov (United States)

2009-03-01

Jukka A. Rintala, Christof Holliger, and Alla N. Nozhevnikova. “Evaluation of Kinetic Coefficients Using Intergrated Monod and Haldane Models for...Rousseau, Diederik P. L., Peter A Vanrolleghem, and Niels De Pauw. “Model-Based Design of Horizontal Subsurface Flow constructed Treatment

Kunstens Mirakler

DEFF Research Database (Denmark)

Hvidt, Niels Christian; Assing Hvidt, Elisabeth

Evangeliernes mirakelberetninger har spillet en væsentlig rolle i europæisk kultur og malerkunst. Religionshistorikeren Elisabeth Assing Hvidt og teologen Niels Christian Hvidt sammenstiller malerier af Rembrandt, El Greco m.fl., som skildrer nogle af disse beretninger (bl.a. Bebudelsen og...

The Marian Feasts Across the Lutheran Reformation in Denmark

DEFF Research Database (Denmark)

Petersen, Nils Holger

2015-01-01

A discussion of continuities and changes in conceptions and celebrations of Marian feasts across the Danish Lutheran reformation, based in particular on discussions of Hans Tausen's sermons at Marian feasts from his published sermon collection (1536) and the liturgical documentation in Niels...

19 November 2014 - C. Staur Ambassador Permanent Representative of Denmark to the United Nations Office and other international organisations in Geneva

CERN Multimedia

Brice, Maximilien

2014-01-01

signing the Guest book with CERN Director-General R. Heuer and visiting the ATLAS cavern with ATLAS Collaboration, Former Spokesperson P. Jenni, ATLAS Collaboration, University of Copenhagen M. Dam and Niels Bohr Institute, University of Copenhagen, senior ATLAS Denmark member P. Hansen.

CMS Centre at CERN

CERN Multimedia

2007-01-01

A new "CMS Centre" is being established on the CERN Meyrin site by the CMS collaboration. It will be a focal point for communications, where physicists will work together on data quality monitoring, detector calibration, offline analysis of physics events, and CMS computing operations. Construction of the CMS Centre begins in the historic Proton Synchrotron (PS) control room. The historic Proton Synchrotron (PS) control room, Opened by Niels Bohr in 1960, will be reused by CMS to built its control centre. TThe LHC@FNAL Centre, in operation at Fermilab in the US, will work very closely with the CMS Centre, as well as the CERN Control Centre. (Photo Fermilab)The historic Proton Synchrotron (PS) control room is about to start a new life. Opened by Niels Bohr in 1960, the room will be reused by CMS to built its control centre. When finished, it will resemble the CERN Contro...

Poetikkens kunstformer

DEFF Research Database (Denmark)

Schweppenhäuser, Jakob

2009-01-01

Art Forms in Poetics: On the Relationship between Poetry and Poetics in Niels Lyngsø’s MORFEUS In Denmark, the genre of poetics has to a high degree developed into poets’ own reflections on their literary work and working process. This turn has resulted in a textual hybridity, restlessly oscillat......Art Forms in Poetics: On the Relationship between Poetry and Poetics in Niels Lyngsø’s MORFEUS In Denmark, the genre of poetics has to a high degree developed into poets’ own reflections on their literary work and working process. This turn has resulted in a textual hybridity, restlessly......, complex and ambitious bastard piece MORFEUS from 2004 – a blend of visual poetry, sonnets, associative lists, essays on literature and the arts and many other forms. Inserted in a slipcase, the large quadratic, unpaged sheets, fastened with metal rings, seem extremely tactile; the reader becomes...

Oxygen Evolution on Model Well-Characterised Mass-Selected Nanoparticles of RuOx

DEFF Research Database (Denmark)

Paoli, Elisa Antares; Masini, Federico; Frydendal, Rasmus

2014-01-01

. [6] M. Vukovic, J. Chem. Soc. Faraday Trans., vol. 86, no. 22, pp. 3743–3746, 1990. [7] R. Forgie, G. Bugosh, K. C. Neyerlin, Z. Liu, and P. Strasser, Electrochem. Solid-State Lett., vol. 13, no. 4, p. B36, 2010. [8] Y. Lee, J. Suntivich, K. J. May, E. E. Perry, and Y. Shao-horn, J. Phys. Chem C Lett......, and P. Strasser, ChemCatChem, vol. 2, no. 7, pp. 724–761, Jun. 2010. [2] A. Marshall, B. Børresen, G. Hagen, M. Tsypkin, and R. Tunold, Energy, vol. 32, no. 4, pp. 431–436, Apr. 2007. [3] P. C. K. Vesborg and T. F. Jaramillo, RSC Adv., vol. 2, no. 21, p. 7933, 2012. [4] F. J. Perez-Alonso, D. N. Mc......Carthy, A. Nierhoff, P. Hernandez-Fernandez, C. Strebel, I. E. L. Stephens, J. H. Nielsen, and I. Chorkendorff, Angew. Chem. Int. Ed. Engl., vol. 51, no. 19, pp. 4641–3, May 2012. [5] S. Murphy, R. M. Nielsen, C. Strebel, M. Johansson, and J. H. Nielsen, Carbon N. Y., vol. 49, no. 2, pp. 376–385, Feb. 2011...

Secrets Pages in DR’s Playbook

DEFF Research Database (Denmark)

Nielsen, Jakob Isak

According to former Head of Drama at DR, Ingolf Gabold, one of the “great” and “strange” secrets subtending the success of DR’s TV series is the extremely deliberate work with audiovisual style (Gabold in Nielsen 2012). Here - as elsewhere - Gabold highlights the so-called “paramount-meeting” and......According to former Head of Drama at DR, Ingolf Gabold, one of the “great” and “strange” secrets subtending the success of DR’s TV series is the extremely deliberate work with audiovisual style (Gabold in Nielsen 2012). Here - as elsewhere - Gabold highlights the so-called “paramount...... shifts already took place with Een gang strømer (1987) (Refn in Nielsen 2006). Combining various methods (audiovisual analysis, media systemic analysis [see Hallin & Mancini, Vestergaard 2007] and interview-driven production studies [see Frandsen 2007, Caldwell 2008] that hone in on this particular...... aspect of DR’s productions by interviewing both management and creative personnel) this paper will discuss the causal mechanisms that subtend the development of audiovisual style in DR series from Gøngehøvdingen to 1864 and will conclude with reflections on the role of DR-series’ style in the age...

[Comparison of methods for the identification of the most common yeasts in the clinical microbiology laboratory].

Science.gov (United States)

Guelfand, L; Grisolía, P; Bozzano, C; Kaufman, S

2003-01-01

We evaluated different methods for the routine identification of medically important yeasts. A total of 150 clinical isolates: 25 C. albicans, 25 C. tropicalis, 25 C. glabrata, 25 C. parapsilosis, 8 C. guilliermondii, 11 C. krusei and 31 Cryptococcus neoformans were tested by Yeast Biochemical Card bioMerieux Vitek (YBC), CHROMagar Candida (CHR). The addition of yeast morphology in Corn Meal agar-Tween 80 (AM) to YBC and CHR was also evaluated. The reference methods used were: API 20C, germ tube formation, AM, Christensen urea and Birdseed agar. YBC identified 135 yeasts with an overall accuracy of 90%. Sensitivity (S) and specificity (E) were: 92-98% for C. albicans and C. tropicalis; 84-99% for C. papapsilosis; 100-99% for C. glabrata; 91-100% for C. krusei; 63-98% for C. guilliermondii and 90-99% for Cryptococcus neoformans, respectively. CHR identified correctly 100% for C. albicans, 92% for C. tropicalis and 91% for C. krusei. Both methods combined with AM provided 100% S and E. We found that YBC system was appropriate for identification of yeasts isolated from human sources. CHR was effective and easy to use for identification of C. albicans, C. tropicalis and C. krusei. The routine use of AM with both methods is recommended.

Fine Mapping and Cloning of Leafy Head Mutant Gene pla1-5 in Rice

Directory of Open Access Journals (Sweden)

Gong-neng FENG

2013-09-01

Full Text Available We identified a leafy head mutant pla1-5 (plastochron 1-5 from the progeny of japonica rice cultivar Taipei 309 treated with 60Co-γ ray irradiation. The pla1-5 mutant has a dwarf phenotype and small leaves. Compared with its wild type, pla1-5 has more leaves and fewer tillers, and it fails to produce normal panicles at the maturity stage. Genetic analysis showed that the pla1-5 phenotype is controlled by a single recessive nuclear gene. Using the map-based cloning strategy, we narrowed down the location of the target gene to a 58-kb region between simple sequence repeat markers CHR1027 and CHR1030 on the long arm of chromosome 10. The target gene cosegregated with molecular markers CHR1028 and CHR1029. There were five predicted genes in the mapped region. The results from sequencing analysis revealed that there was one base deletion in the first exon of LOC_Os10g26340 encoding cytochrome P450 CYP78A11 in the pla1-5 mutant, which might result in a downstream frame shift and premature termination. These results suggest that the P450 CYP78A11 gene is the candidate gene of PLA1-5.

Das Problem der Ethnogenese im antiken Griechenland

Directory of Open Access Journals (Sweden)

Welwei Karl-Wilhelm

2011-01-01

Full Text Available Sprachwissenschaftliche Untersuchungen lassen darauf schließen, dass die historischen Dialekte der alten Hellenen erst auf griechischem Boden um und nach 1000 v. Chr. entstanden sind. Bei den frühen Zuwanderern kann es sich nur um kleinere Verbände gehandelt haben, so daß zweifelllos keine großen „Stämme“ nach Griechenland vorgedrungen sind, wie man in der älteren Forschung angenommen hat. In Griechenland haben die Zuwanderer die Suffixe -ss und -nth oder -nd nicht erst kennengelernt, sondern zumindest zum Teil schon mitgebracht und vermutlich im 3. Jahrtausend v. Chr. die allmähliche Entwicklung des späteren Griechischen eingeleitet. Impulse für die Entwicklung der materiellen Kultur gingen um 1700 v. Chr. von Kreta aus und beeinflussten in starkem Maße die mykenische Zeit mit ihren Palastsystemen, deren Zusammenbruch um 1200 v. Chr. aber nicht schon zum Ende der mykenischen Kultur führte, wenn auch die Linear B-Schrift nicht mehr benutzt wurde und die Infrastrukturen der Machtzentren zusammenbrachen. Dies war zugleich die Voraussetzung für die Bildung kleinerer Siedlungen mit neuen Führungssystemen und Sozialstrukturen sowie mit einem jeweils eigenen Identitätsbewußtsein.

Molecular characterization of two prunus necrotic ringspot virus isolates from Canada.

Science.gov (United States)

Cui, Hongguang; Hong, Ni; Wang, Guoping; Wang, Aiming

2012-05-01

We determined the entire RNA1, 2 and 3 sequences of two prunus necrotic ringspot virus (PNRSV) isolates, Chr3 from cherry and Pch12 from peach, obtained from an orchard in the Niagara Fruit Belt, Canada. The RNA1, 2 and 3 of the two isolates share nucleotide sequence identities of 98.6%, 98.4% and 94.5%, respectively. Their RNA1- and 2-encoded amino acid sequences are about 98% identical to the corresponding sequences of a cherry isolate, CH57, the only other PNRSV isolate with complete RNA1 and 2 sequences available. Phylogenetic analysis of the coat protein and movement protein encoded by RNA3 of Pch12 and Chr3 and published PNRSV isolates indicated that Chr3 belongs to the PV96 group and Pch12 belongs to the PV32 group.

EPA guidance on the early detection of clinical high risk states of psychoses

DEFF Research Database (Denmark)

Schultze-Lutter, F; Michel, C; Schmidt, S J

2015-01-01

The aim of this guidance paper of the European Psychiatric Association is to provide evidence-based recommendations on the early detection of a clinical high risk (CHR) for psychosis in patients with mental problems. To this aim, we conducted a meta-analysis of studies reporting on conversion rates...... to psychosis in non-overlapping samples meeting any at least any one of the main CHR criteria: ultra-high risk (UHR) and/or basic symptoms criteria. Further, effects of potential moderators (different UHR criteria definitions, single UHR criteria and age) on conversion rates were examined. Conversion rates...... in the identified 42 samples with altogether more than 4000 CHR patients who had mainly been identified by UHR criteria and/or the basic symptom criterion 'cognitive disturbances' (COGDIS) showed considerable heterogeneity. While UHR criteria and COGDIS were related to similar conversion rates until 2-year follow...

Gauge invariance and the effective potential: the Abelian Higgs model

International Nuclear Information System (INIS)

Ramaswamy, S.

1995-01-01

The gauge invariance of the effective potential in the Abelian Higgs model is examined. The Nielsen identities, which ensure gauge independence of the effective potential and other physical quantities, are shown to hold at finite temperature and in the presence of the chemical potential. It is also shown that, as a consequence of the Nielsen identities, the standard order parameter for symmetry breaking, namely the scalar field vacuum expectation value, has a non-zero parametric dependence on the gauge choice employed. These are then verified to one loop at finite temperature. High-temperature symmetry breaking is considered. In the leading high-temperature limit, the potential agrees with the previous calculations. (orig.)

Measurement of Forward-Backward Charged Particle Correlations with ALICE

DEFF Research Database (Denmark)

Søgaard, Carsten

Part I of the defence covers experimental development carried out in the ALICE experiment at the Large Hadron Collider at the European Organisation for Nuclear Research - CERN. For the Time Projection Chamber a sophisticated laser calibration system has been developed by the Niels Bohr Institute...

The "Special" World: Stalin's Power Apparatus and the Soviet System's Secret Structures of Communication"

DEFF Research Database (Denmark)

Villaume, Poul

2009-01-01

Bogomtale - aspekter af Niels Erik Rosenfeldts store disputats om Stalin-tidens hemmelige magt- og kommunikationsapparat diskuteres. Bogen fokuserer på systemets struktur, anatomi, procedurer og beslutningsprocesser, men sociologisk bureaukrati-teori kunne med fordel være anvendt. Værket vil være...

Gymnastics and politics

DEFF Research Database (Denmark)

Bonde, Hans

The first international biography of Niels Bukh (1880-1950), the charismatic founder of the special Danish school of modern gymnastics. His team of young elite gymnasts travelled around the world demonstrating his gymnastics, making Bukh reputably the most internationally well-known Dane during t...

Optogenetic Central Amygdala Stimulation Intensifies and Narrows Motivation for Cocaine.

Science.gov (United States)

Warlow, Shelley M; Robinson, Mike J F; Berridge, Kent C

2017-08-30

Addiction is often characterized by intense motivation for a drug, which may be narrowly focused at the expense of other rewards. Here, we examined the role of amygdala-related circuitry in the amplification and narrowing of motivation focus for intravenous cocaine. We paired optogenetic channelrhodopsin (ChR2) stimulation in either central nucleus of amygdala (CeA) or basolateral amygdala (BLA) of female rats with one particular nose-poke porthole option for earning cocaine infusions (0.3 mg/kg, i.v.). A second alternative porthole earned identical cocaine but without ChR2 stimulation. Consequently, CeA rats quickly came to pursue their CeA ChR2-paired cocaine option intensely and exclusively, elevating cocaine intake while ignoring their alternative cocaine alone option. By comparison, BLA ChR2 pairing failed to enhance cocaine motivation. CeA rats also emitted consummatory bites toward their laser-paired porthole, suggesting that higher incentive salience made that cue more attractive. A separate progressive ratio test of incentive motivation confirmed that CeA ChR2 amplified rats' motivation, raising their breakpoint effort price for cocaine by 10-fold. However, CeA ChR2 laser on its own lacked any reinforcement value: laser by itself was never self-stimulated, not even by the same rats in which it amplified motivation for cocaine. Conversely, CeA inhibition by muscimol/baclofen microinjections prevented acquisition of cocaine self-administration and laser preference, whereas CeA inhibition by optogenetic halorhodopsin suppressed cocaine intake, indicating that CeA circuitry is needed for ordinary cocaine motivation. We conclude that CeA ChR2 excitation paired with a cocaine option specifically focuses and amplifies motivation to produce intense pursuit and consumption focused on that single target. SIGNIFICANCE STATEMENT In addiction, intense incentive motivation often becomes narrowly focused on a particular drug of abuse. Here we show that pairing central

Inherent X-Linked Genetic Variability and Cellular Mosaicism Unique to Females Contribute to Sex-Related Differences in the Innate Immune Response

Directory of Open Access Journals (Sweden)

Zoltan Spolarics

2017-11-01

Full Text Available Females have a longer lifespan and better general health than males. Considerable number of studies also demonstrated that, after trauma and sepsis, females present better outcomes as compared to males indicating sex-related differences in the innate immune response. The current notion is that differences in the immuno-modulatory effects of sex hormones are the underlying causative mechanism. However, the field remains controversial and the exclusive role of sex hormones has been challenged. Here, we propose that polymorphic X-linked immune competent genes, which are abundant in the population are important players in sex-based immuno-modulation and play a key role in causing sex-related outcome differences following trauma or sepsis. We describe the differences in X chromosome (ChrX regulation between males and females and its consequences in the context of common X-linked polymorphisms at the individual as well as population level. We also discuss the potential pathophysiological and immune-modulatory aspects of ChrX cellular mosaicism, which is unique to females and how this may contribute to sex-biased immune-modulation. The potential confounding effects of ChrX skewing of cell progenitors at the bone marrow is also presented together with aspects of acute trauma-induced de novo ChrX skewing at the periphery. In support of the hypothesis, novel observations indicating ChrX skewing in a female trauma cohort as well as case studies depicting the temporal relationship between trauma-induced cellular skewing and the clinical course are also described. Finally, we list and discuss a selected set of polymorphic X-linked genes, which are frequent in the population and have key regulatory or metabolic functions in the innate immune response and, therefore, are primary candidates for mediating sex-biased immune responses. We conclude that sex-related differences in a variety of disease processes including the innate inflammatory response to injury

Cyberbullying in those at clinical high risk for psychosis.

Science.gov (United States)

Magaud, Emilie; Nyman, Karissa; Addington, Jean

2013-11-01

Several studies suggest an association between experiences of childhood trauma including bullying and the development of psychotic symptoms. The use of communications technology has created a new media for bullying called 'cyberbullying'. Research has demonstrated associations between traditional bullying and cyberbullying. Negative effects of cyberbullying appear similar in nature and severity to the reported effects of traditional bullying. Our aim was to examine the prevalence and correlates of cyberbullying in those at clinical high risk (CHR) for psychosis. Fifty young people at CHR for psychosis were administered the Childhood Trauma Questionnaire with added questions about cyberbullying. Cyberbullying was reported in 38% of the sample. Those who experienced cyberbullying also reported experiencing previous trauma. It is possible that cyberbullying may be a problem for those at CHR of psychosis, and due to the vulnerable nature of these young people may have longitudinal implications. © 2013 Wiley Publishing Asia Pty Ltd.

Linkage of familial Alzheimer disease to chromosome 14 in two large early-onset pedigrees: effects of marker allele frequencies on lod scores.

Science.gov (United States)

Nechiporuk, A; Fain, P; Kort, E; Nee, L E; Frommelt, E; Polinsky, R J; Korenberg, J R; Pulst, S M

1993-05-01

Alzheimer disease (AD) is a devastating neurodegenerative disease leading to global dementia. In addition to sporadic forms of AD, familial forms (FAD) have been recognized. Mutations in the amyloid precursor protein (APP) gene on chromosome (CHR) 21 have been shown to cause early-onset AD in a small number of pedigrees. Recently, linkage to markers on CHR 14 has been established in several early-onset FAD pedigrees. We now report lod scores for CHR 14 markers in two large early-onset FAD pedigrees. Pairwise linkage analysis suggested that in these pedigrees the mutation is tightly linked to the loci D14S43 and D14S53. However, assumptions regarding marker allele frequencies had a major and often unpredictable effect on calculated lod scores. Therefore, caution needs to be exercised when single pedigrees are analyzed with marker allele frequencies determined from the literature or from a pool of spouses.

Jevropeiskii standart / Aleksei Zhigulin

Index Scriptorium Estoniae

Zhigulin, Aleksei

2005-01-01

Rahvusvahelise konsultatsioonifirma Carl Bro Intelligent Solution peaspetsialist Paul Nielsen külastas firma Christiansen Consulting Tallinna kontorit, et tutvuda Baltimaade konsultatsiooniteenuste turu eripäraga

Serum hepcidin-25 may replace the ferritin index in the Thomas plot in assessing iron status in anemic patients.

Science.gov (United States)

Thomas, C; Kobold, U; Balan, S; Roeddiger, R; Thomas, L

2011-04-01

Biochemical markers of iron deficiency do not distinguish iron-deficient anemia (IDA) from the anemia of chronic disease (ACD) and the combined state of ACD/IDA. Serum hepcidin-25 might be a marker resolving this problem. We investigated the extent to which serum hepcidin-25 enables the differentiation of the states above in comparison with the ferritin index plot, the so-called Thomas plot [soluble transferrin receptor (sTfR)/log ferritin and the reticulocyte hemoglobin content (CHr)]. Serum hepcidin-25 was determined in 155 anemic patients who were classified as having latent iron deficiency (latent ID), IDA, ACD, or ACD/IDA using the ferritin index plot (Thomas plot). Hepcidin-25 was determined using an isotope-dilution micro-HPLC-tandem mass spectrometry method. The ability to discriminate among these states based on serum hepcidin-25 alone or in combination with the CHr was evaluated in a receiver operating characteristic curve analysis and a comparison with the recently established ferritin index plot. Serum hepcidin-25 correlated with ferritin and the ferritin index. Use of a hepcidin-25 cutoff level of ≤4 nmol/l allowed the differentiation of IDA from ACD and ACD/IDA. Furthermore, the discrimination of ACD/IDA from ACD required combination with CHr in a new plot (hepcidin-25 and the CHr). The hepcidin-25 plot and the ferritin index plot showed a good correspondence in the differentiation of iron states in patients with anemia. Patients with IDA can be differentiated from ACD and ACD/IDA but not ACD from ACD/IDA based on hepcidin-25 alone. The combination of hepcidin-25 with CHr in the hepcidin-25 plot was useful for the differentiation of the states above. © 2010 Blackwell Publishing Ltd.

Positional cloning of "Lisch-Like", a candidate modifier of susceptibility to type 2 diabetes in mice.

Directory of Open Access Journals (Sweden)

Marija Dokmanovic-Chouinard

2008-07-01

Full Text Available In 404 Lep(ob/ob F2 progeny of a C57BL/6J (B6 x DBA/2J (DBA intercross, we mapped a DBA-related quantitative trait locus (QTL to distal Chr1 at 169.6 Mb, centered about D1Mit110, for diabetes-related phenotypes that included blood glucose, HbA1c, and pancreatic islet histology. The interval was refined to 1.8 Mb in a series of B6.DBA congenic/subcongenic lines also segregating for Lep(ob. The phenotypes of B6.DBA congenic mice include reduced beta-cell replication rates accompanied by reduced beta-cell mass, reduced insulin/glucose ratio in blood, reduced glucose tolerance, and persistent mild hypoinsulinemic hyperglycemia. Nucleotide sequence and expression analysis of 14 genes in this interval identified a predicted gene that we have designated "Lisch-like" (Ll as the most likely candidate. The gene spans 62.7 kb on Chr1qH2.3, encoding a 10-exon, 646-amino acid polypeptide, homologous to Lsr on Chr7qB1 and to Ildr1 on Chr16qB3. The largest isoform of Ll is predicted to be a transmembrane molecule with an immunoglobulin-like extracellular domain and a serine/threonine-rich intracellular domain that contains a 14-3-3 binding domain. Morpholino knockdown of the zebrafish paralog of Ll resulted in a generalized delay in endodermal development in the gut region and dispersion of insulin-positive cells. Mice segregating for an ENU-induced null allele of Ll have phenotypes comparable to the B.D congenic lines. The human ortholog, C1orf32, is in the middle of a 30-Mb region of Chr1q23-25 that has been repeatedly associated with type 2 diabetes.

A role of aryl hydrocarbon receptor in the antiandrogenic effects of polycyclic aromatic hydrocarbons in LNCaP human prostate carcinoma cells

Energy Technology Data Exchange (ETDEWEB)

Kizu, Ryoichi; Okamura, Kazumasa; Toriba, Akira; Hayakawa, Kazuichi [Graduate School of Natural Science and Technology, Kanazawa University, 13-1 Takara-machi, Kanazawa 920-0934 (Japan); Kakishima, Hiroshi [Research Planning Department, Eiken Chemical Co. Ltd., 5-26-20 Oji, Kita-ku, Tokyo 114-0002 (Japan); Mizokami, Atsushi [School of Medicine, Kanazawa University, 13-1 Takara-machi, Kanazawa 920-8641 (Japan); Burnstein, Kerry L. [Department of Molecular and Cellular Pharmacology, University of Miami School of Medicine, FL 33101, Miami (United States)

2003-06-01

The role of aryl hydrocarbon receptor (AhR) on the antiandrogenic effects of polycyclic aromatic hydrocarbons (PAHs) was studied in LNCaP cells. The PAHs used in this study were chrysene (Chr), benzo[k]fluoranthene (BkF), benzo[a]pyrene (BaP), anthracene (Ant) and pyrene (Pyr). Chr, BkF and BaP acted as AhR agonists in LNCaP cells, while Ant and Pyr did not. The antiandrogenic effects of the PAHs were evaluated on the basis of regulation of prostate-specific antigen (PSA) mRNA and protein levels by 5{alpha}-dihydrotestosterone (DHT). Chr, BkF and BaP exhibited an antiandrogenic effect, but Ant and Pyr did not. {alpha}-Naphthoflavone ({alpha}-NF), an AhR antagonist, reversed the antiandrogen action of Chr, BkF and BaP, suggesting a requirement for activated AhR. The antiandrogenic PAHs did not significantly decrease androgen receptor (AR) levels or cellular DHT concentrations. Gel mobility shift assays revealed that Chr, BkF and BaP inhibited the binding of AR in nuclear extracts to oligonucleotide probes containing the AR-responsive element (ARE), whereas Ant and Pyr had no effect. The antiandrogenic PAHs elevated mRNA levels of c-fos and c-jun. Since activator protein-1 (AP-1), a heterodimer of c-jun and c-fos proteins, is known to inhibit binding of AR to ARE by protein-protein interaction with AR, the findings in the present study suggest a possible involvement of AP-1 in the antiandrogenic effects of PAHs acting as AhR agonists. These results suggest that AhR can stimulate AP-1 expression resulting in inhibition of the binding of AR to ARE in the transcription regulatory region of target genes such as PSA. (orig.)

Development, verification and validation of an FPGA-based core heat removal protection system for a PWR

Energy Technology Data Exchange (ETDEWEB)

Wu, Yichun, E-mail: ycwu@xmu.edu.cn [College of Energy, Xiamen University, Xiamen 361102 (China); Shui, Xuanxuan, E-mail: 807001564@qq.com [College of Energy, Xiamen University, Xiamen 361102 (China); Cai, Yuanfeng, E-mail: 1056303902@qq.com [College of Energy, Xiamen University, Xiamen 361102 (China); Zhou, Junyi, E-mail: 1032133755@qq.com [College of Energy, Xiamen University, Xiamen 361102 (China); Wu, Zhiqiang, E-mail: npic_wu@126.com [State Key Laboratory of Reactor System Design Technology, Nuclear Power Institute of China, Chengdu 610041 (China); Zheng, Jianxiang, E-mail: zwu@xmu.edu.cn [College of Energy, Xiamen University, Xiamen 361102 (China)

2016-05-15

Highlights: • An example on life cycle development process and V&V on FPGA-based I&C is presented. • Software standards and guidelines are used in FPGA-based NPP I&C system logic V&V. • Diversified FPGA design and verification languages and tools are utilized. • An NPP operation principle simulator is used to simulate operation scenarios. - Abstract: To reach high confidence and ensure reliability of nuclear FPGA-based safety system, life cycle processes of discipline specification and implementation of design as well as regulations verification and validation (V&V) are needed. A specific example on how to conduct life cycle development process and V&V on FPGA-based core heat removal (CHR) protection system for CPR1000 pressure water reactor (PWR) is presented in this paper. Using the existing standards and guidelines for life cycle development and V&V, a simplified FPGA-based CHR protection system for PWR has been designed, implemented, verified and validated. Diversified verification and simulation languages and tools are used by the independent design team and the V&V team. In the system acceptance testing V&V phase, a CPR1000 NPP operation principle simulator (OPS) model is utilized to simulate normal and abnormal operation scenarios, and provide input data to the under-test FPGA-based CHR protection system and a verified C code CHR function module. The evaluation results are applied to validate the under-test FPGA-based CHR protection system. The OPS model operation outputs also provide reasonable references for the tests. Using an OPS model in the system acceptance testing V&V is cost-effective and high-efficient. A dedicated OPS, as a commercial-off-the-shelf (COTS) item, would contribute as an important tool in the V&V process of NPP I&C systems, including FPGA-based and microprocessor-based systems.

QTL analysis of dietary obesity in C57BL/6byj X 129P3/J F2 mice: diet- and sex-dependent effects.

Science.gov (United States)

Lin, Cailu; Theodorides, Maria L; McDaniel, Amanda H; Tordoff, Michael G; Zhang, Qinmin; Li, Xia; Bosak, Natalia; Bachmanov, Alexander A; Reed, Danielle R

2013-01-01

Obesity is a heritable trait caused by complex interactions between genes and environment, including diet. Gene-by-diet interactions are difficult to study in humans because the human diet is hard to control. Here, we used mice to study dietary obesity genes, by four methods. First, we bred 213 F2 mice from strains that are susceptible [C57BL/6ByJ (B6)] or resistant [129P3/J (129)] to dietary obesity. Percent body fat was assessed after mice ate low-energy diet and again after the same mice ate high-energy diet for 8 weeks. Linkage analyses identified QTLs associated with dietary obesity. Three methods were used to filter candidate genes within the QTL regions: (a) association mapping was conducted using >40 strains; (b) differential gene expression and (c) comparison of genomic DNA sequence, using two strains closely related to the progenitor strains from Experiment 1. The QTL effects depended on whether the mice were male or female or which diet they were recently fed. After feeding a low-energy diet, percent body fat was linked to chr 7 (LOD=3.42). After feeding a high-energy diet, percent body fat was linked to chr 9 (Obq5; LOD=3.88), chr 12 (Obq34; LOD=3.88), and chr 17 (LOD=4.56). The Chr 7 and 12 QTLs were sex dependent and all QTL were diet-dependent. The combination of filtering methods highlighted seven candidate genes within the QTL locus boundaries: Crx, Dmpk, Ahr, Mrpl28, Glo1, Tubb5, and Mut. However, these filtering methods have limitations so gene identification will require alternative strategies, such as the construction of congenics with very small donor regions.

Mean expression of the X chromosome is associated with neuronal density

Directory of Open Access Journals (Sweden)

James Thomas Swingland

2012-11-01

Full Text Available Neurodegenerative diseases are characterised by neuronal loss. Neuronal loss causes a varying density of neurons across samples which confounds results from gene expression studies. Chromosome X is known to be specifically important in brain. We hypothesised the existence of a chromosomal signature of gene expression associated with the X-chromosome for neurological conditions not normally associated with that chromosome. The hypothesis was investigated using microarray datasets from studies on Parkinson's disease, Alzheimer's disease and Huntington's disease. Data were analysed using Chromowave, an analytical tool for detecting spatially extended expression changes across chromosomes. To examine associations with neuronal density, expressions from a set of neuron specific genes were extracted. The association between these genes and the expression patterns extracted by Chromowave was then analyzed. We observed an extended pattern of low expression of ChrX consistent in all the neurodegenerative disease brain datasets. There was a strong correlation between mean ChrX expression and the pattern extracted from the autosomal neuronal specific genes, but no correlation with mean autosomal expression. No chromosomal patterns associated with the neuron specific genes were found on other chromosomes. The chromosomal expression pattern was not present in datasets from blood cells. The ChrX:Autosome expression ratio was also higher in neuronal cells than in tissues with a mix of cell types.The results suggest that a loss of neurons manifests in gene expression experiments primarily as a reduction in mean expression of genes along ChrX. The most likely explanation for this finding relates to the documented general up-regulation of ChrX in brain tissue which, this work suggests, occurs primarily in neurons. The purpose and mechanisms behind this cell specific higher expression warrant further research, which may also help elucidate connectio

PÖFFi eelsoojendus on tehtud / Margit Adorf

Index Scriptorium Estoniae

Adorf, Margit, 1974-

2006-01-01

PÖFFi laste- ja noortefilmide festivali "Just Film" filmides: "Me saame sellest üle" (rezh. Niels Arden Oplev, Taani 2006), "Tommy põrgu" (rezh. Ove Raymond Gyldenas, Norra), "Pilv" (rezh. Gregor Schnitzler, Saksamaa 2006) ja dokumemtaalfilmist "Kurikuulus". Lisatud nimekiri "Just Film'il" linastunud filmidest põhiprogrammis

Proceedings of the Twenty Second Nordic Seminar on Computational Mechanics

DEFF Research Database (Denmark)

This book contains the proceedings of the Twenty Second Nordic Seminar on Computational Mechanics (NSCM22), taking event 22-23 October 2009 at Aalborg University, Denmark. The papers presented at the Optimization Seminar in Honour of Niels Olhoff, held 21 October 2009 at Aalborg University, Denmark...

Pædagogisk forskning for alle og enhver

DEFF Research Database (Denmark)

Larsen, Steen Nepper

2018-01-01

Tredobbelt anmeldelse i avisens tillæg Moderne tider af: Hans Vejleskov og Thyge Winther-Jensen: De pædagogiske fags grundlag og anvendelse. Aarhus Universitetsforlag Kjeld Kjertmann: Indkulturering – en ny læsestart i takt med tiden. Syddansk Universitetsforlag. Niels Jakob Pasgaard: FAQ – om...

African Journal of Drug & Alcohol Studies, 12(2), 2013 Copyright ...

African Journals Online (AJOL)

corresponding author: Derrick Ssewanyana, M.Sc., Public Health, University of Southern Denmark, Esbjerg, Niels ... Of significant public health im- .... fears among the general public and policy ... integration of harm reduction in services .... sion of HIV to PWIDs' sexual partners and ... sensitivity to cultural, racial, ethnic and.

Three-Dimensional Model Test Study of Modified Caisson Breakwater at Port of Castellon, Spain

DEFF Research Database (Denmark)

Nørgaard, Jørgen Harck; Andersen, Thomas Lykke

caisson breakwater at Port of Castellon, Spain, tested earlier (Nørgaard & Lykke Andersen, 2013). Associate Prof. Thomas Lykke Andersen and M.Sc. Jørgen Quvang Harck Nørgaard were in charge of the model tests. Engineer assistant Niels Drustrup assisted in the laboratory with the construction...

Word - Gift - Being

DEFF Research Database (Denmark)

Bogen diskuterer retfærdiggørelsens forhold til gave-økonomi og ontologi i nutidig luthersk teologi. Især diskussionen og gave-givningens og gensidighedens rolle åbner nye perspektiver for reformatorisk teologi. Bidragydere: Oswald Bayer, Ingolf U. Dalferth, Niels Henrik Gregersen, Bo Kristian Ho...

Bedre trafikuheldsdata: Danske erfaringer med brug af forskellige typer trafikuheldsdata

DEFF Research Database (Denmark)

Møller, Mette; Clemmensen, Mikkel Bøg; Janstrup, Kira Hyldekær

bidraget til kvalitetssikring af projektets forskellige dele, og seniorforsker Mette Møller har været overordnet projektansvarlig. Stud. BEng Lars Finn Jensen og stud. BEng Niels Klindt Andersen har varetaget dataindsamling i forbindelse med rundspørgen blandt kommunerne. Vi vil gerne udtrykke en stor tak...

UNESCO accolade for former DG

CERN Multimedia

2006-01-01

Former CERN Director General, Herwig Schopper, has been awarded the UNESCO Niels Bohr Gold Medal award. He shares this year's distinction with two other recipients: Sir Martin Rees, Britain's astronomer royal, and Professor Peter Zoller, a central figure in the field of quantum information. Herwig Schopper (left) receiving the 2005 Niels Bohr Gold Medal from Helge Sander, Denmark's Minister of Science, Technology and Innovation. The awards, which took place at the Danish Royal Academy of Science and Letters on 15 November, recognise scientific excellence, concern for the impact of science, and efforts to promote the free exchange of ideas on a broad international scale. Herwig Schopper was Director-General of CERN from 1981 to 1988. Today, he is President of the SESAME Council, the International Centre for Synchrotron Light for Experimental Science and Applications in the Middle East (see Bulletin No. 26/2003). In his opening address at the ceremony, Jens Jørgen Gaardhøje, from the Danish National Commi...

Nuclear magnetic ordering in silver

International Nuclear Information System (INIS)

Lefmann, K.

1995-12-01

Nuclear antiferromagnetic ordering has been observed by neutron diffraction in a single crystal of 109 Ag. The critical temperature is found to 700 pK, and the critical field is 100 μT. From the paramagnetic phase a second order phase transition leads into a type-I 1-k structure with long range order. The experiments have taken place at the Hahn-Meitner Institut in Berlin in collaboration with the low Temperature Laboratory in Helsinki, the Niels Bohr Institute in Copenhagen, and Risoe National Laboratory, Roskilde. The present report is a Ph.D. thesis which has been successfully defended at the Niels Bohr Institute. Besides the results of the nuclear ordering experiments the thesis contains a description of the theoretical background for nuclear magnetism and a review of earlier nuclear ordering experiments as well as theoretical work. The principles for studying polarized nuclei with use of polarized and unpolarized neutrons are presented, as well as the results of such experiments. (au) 11 tabs., 59 ills., 143 refs

Trying to explain Copenhagen

CERN Document Server

2003-01-01

The documentary "The Copenhagen Fallout" recounts the friendship and "falling out" of Niels Bohr and Werner Heisenberg, two of the greatest contemporary physicists - friends whom war turned into enemies. It will be shown at CERN on 1st December. During a lecture in Germany towards the end of 1922, a 20-year-old physicist dared to interrupt Physics Nobel-Prize winner Niels Bohr with the words "There is a mathematical error in what you have said." The young scientist in question was none other than Werner Heisenberg. From this audacious beginning a fruitful collaboration and great friendship grew. But World War II threw up a wall of incomprehension between the two scientists, as one worked for the Nazi regime and the other opened his Copenhagen institute to German Jewish scientists. Then came their famous meeting in September 1941, dramatised by the no less famous play "Copenhagen", currently being performed in association with CERN at th...

Genomic segments RNA1 and RNA2 of Prunus necrotic ringspot virus codetermine viral pathogenicity to adapt to alternating natural Prunus hosts.

Science.gov (United States)

Cui, Hongguang; Hong, Ni; Wang, Guoping; Wang, Aiming

2013-05-01

Prunus necrotic ringspot virus (PNRSV) affects Prunus fruit production worldwide. To date, numerous PNRSV isolates with diverse pathological properties have been documented. To study the pathogenicity of PNRSV, which directly or indirectly determines the economic losses of infected fruit trees, we have recently sequenced the complete genome of peach isolate Pch12 and cherry isolate Chr3, belonging to the pathogenically aggressive PV32 group and mild PV96 group, respectively. Here, we constructed the Chr3- and Pch12-derived full-length cDNA clones that were infectious in the experimental host cucumber and their respective natural Prunus hosts. Pch12-derived clones induced much more severe symptoms than Chr3 in cucumber, and the pathogenicity discrepancy between Chr3 and Pch12 was associated with virus accumulation. By reassortment of genomic segments, swapping of partial genomic segments, and site-directed mutagenesis, we identified the 3' terminal nucleotide sequence (1C region) in RNA1 and amino acid K at residue 279 in RNA2-encoded P2 as the severe virulence determinants in Pch12. Gain-of-function experiments demonstrated that both the 1C region and K279 of Pch12 were required for severe virulence and high levels of viral accumulation. Our results suggest that PNRSV RNA1 and RNA2 codetermine viral pathogenicity to adapt to alternating natural Prunus hosts, likely through mediating viral accumulation.

Genome-Wide Identification of Chalcone Reductase Gene Family in Soybean: Insight into Root-Specific GmCHRs and Phytophthora sojae Resistance

Directory of Open Access Journals (Sweden)

Caroline J. Sepiol

2017-12-01

Full Text Available Soybean (Glycine max [L.] Merr is one of the main grain legumes worldwide. Soybean farmers lose billions of dollars’ worth of yield annually due to root and stem rot disease caused by the oomycete Phytophthora sojae. Many strategies have been developed to combat the disease, however, these methods have proven ineffective in the long term. A more cost effective and durable approach is to select a trait naturally found in soybean that can increase resistance. One such trait is the increased production of phytoalexin glyceollins in soybean. Glyceollins are isoflavonoids, synthesized via the legume-specific branch of general phenylpropanoid pathway. The first key enzyme exclusively involved in glyceollin synthesis is chalcone reductase (CHR which coacts with chalcone synthase for the production of isoliquiritigenin, the precursor for glyceollin biosynthesis. Here we report the identification of 14 putative CHR genes in soybean where 11 of them are predicted to be functional. Our results show that GmCHRs display tissue-specific gene expression, and that only root-specific GmCHRs are induced upon P. sojae infection. Among 4 root-specific GmCHRs, GmCHR2A is located near a QTL that is linked to P. sojae resistance suggesting GmCHR2A as a novel locus for partial resistance that can be utilized for resistance breeding.

New Targets for Prevention of Schizophrenia

DEFF Research Database (Denmark)

Seidman, Larry J; Nordentoft, Merete

2015-01-01

A number of influences have converged that make this Special Theme Issue timely: "A New Direction: Considering Developmentally Sensitive Targets for Very Early Intervention in Schizophrenia". These factors include: 1. the substantial knowledge about premorbid developmental vulnerabilities...... to psychosis, especially regarding schizophrenia; 2. the promising results emerging from interventions during the clinical high-risk (CHR) phase of psychosis and; 3. the recognition that the CHR period is a relatively late phase of developmental derailment. These factors have together led to a perspective...

The Question of Sharīʿa in Denmark

DEFF Research Database (Denmark)

Vinding, Niels Valdemar

2016-01-01

Denmark contributor Niels V. Vinding comments on recent discussions of sharīʿa in Denmark that have arisen on the basis of uninformed media reporting, which has had the consequence of sparking legislation that may have discriminatory effects on Muslims. These developments come in the wake of the ...

Framing the Life-Rhythm

DEFF Research Database (Denmark)

Munch, Anders V.

2011-01-01

Tracing of the notion 'rhytm' among the neo classicist architect in Denmark around 1920 that tried to vitalize the pure forms of architecture. Several of the project contributed to the artistic competions being part of the Olympic Games in that period.Both the gymnastic programme of Niels Bukh...

Cern collisions light up Copenhagen

CERN Multimedia

Banks, Michael

2010-01-01

"Anyone passing by the Niels Bohr Institute in Copenhagen, Denmark, might be startled by some strange moving lights on the facade of the institute's main building. In fact, the dancing beams show, almost in real time, collisions form the Atlas experiment at Cern's Large Hadron Collider (LHC)" (1 paragraph)

Nicholas Steno and Renè Descartes

DEFF Research Database (Denmark)

Olden-Jørgensen, Sebastian

2009-01-01

Den danske videnskabsmand Niels Steensen (1638-86) læste allerede som ung student Renè Descartes og blev grebet af hans metode, som han forblev tro i hele sit videnskabelige virke. Cartesianismen kan beskrives som Steensens videnskabelige paradigme (Kuhn), men det var også et paradigme, han testede...

Des monastères aux funérailles. La construction d’une relation ethnographique avec des chrétiennes de Damas (Syrie

Directory of Open Access Journals (Sweden)

Anna Poujeau

2009-03-01

Full Text Available Des monastères aux funérailles. La construction d’une relation ethnographique avec des chrétiennes de Damas (Syrie. En juillet 2004, j’ai assisté aux funérailles d’un jeune homme de la famille au sein de laquelle je vivais à Damas. À l’époque, l’intense émotion suscitée par cet événement empêcha que je m’y intéresse de plus près. Ce n’est que deux ans plus tard, en juillet 2006, que j’ai décidé d’enquêter sur l’un des aspects majeurs de la cérémonie : les lamentations funèbres féminines. Lors de ce dernier terrain, les femmes de la famille que j’interrogeais, que j’accompagnais aux funérailles et dont j’enregistrais les chants m’assignèrent alors une place tout à fait particulière. Puisque, moi aussi, « je m’habillais en noir et je venais aux funérailles », je ne pouvais plus être considérée comme une étrangère. Dès lors, elles firent de moi la fille d’une de leur sœur émigrée à Paris et mariée avec un Français. Ce statut me fut par ailleurs confirmé lorsqu’elles m’attribuèrent une place dans leurs plaisanteries entre sœurs, tantes et neveux matrilatéraux.Dans cet article, je souhaite engager une double réflexion : sur la position et l’implication de l’ethnologue sur un terrain où l’émotion est au premier plan, ainsi que sur la façon dont être assignée à une place dans la parenté de ses informateurs donne enfin toute liberté d’action à l’ethnologue sur son terrain.From monasteries to funerals. The construction of ethnographical relations with the Christians of Damascus (Syria. In July 2004, I attended the funeral of a young man from the family with whom I was staying in Damascus. At the time, the intense emotion provoked by that event prevented me from immediately examining it more closely. It was only two years later, in July 2006, that I decided to study one of the main features of the ceremony: the women’s lamentations. During this

12000 rotation periods of Kepler stars (Nielsen+, 2013)

DEFF Research Database (Denmark)

Nielsen, M. B.; Gizon, L.; Schunker, H.

2013-01-01

Rotation periods of 12253 stars in the Kepler field. The periods are determined by the brightness variations, from star spots or active regions, in the light curves of the white light photometry obtained by the Kepler spacecraft. The median absolute deviation from the median (MAD) of the periods...... shows the scatter of periods for each star, over 6 or more (out of 8 analyzed) Kepler quarters. The g-r color index, E(B-V), radius, surface gravity, and effective temperature are from the Kepler Input Catalog (KIC). Column 9 (TF) indicates whether or not the msMAP data for a given star satisfies...... the selection criteria described in section 2. Of these, there are 86 stars with periods from the msMAP data that differ from the period derived from the PDCMAP data by more than one frequency resolution element (1/90d-1). For these stars the msMAP periods are therefore given in column 10 as a none-zero value...

Saared meis ja meie ümber / Katrin Nielsen

Index Scriptorium Estoniae

Nielsen, Katrin

1998-01-01

Chaplini kunstikeskuses 17. detsembrini avatud fotonäitusest 'Põhjala saared', kus oma töid eksponeerisid: Absalon Hansen - Fääri saartest, Göte Ask - Gotlandist, Andy Horner - Ahvenamaalt, ning Tartu kunstikooli fotoeriala tudengid oma pilte Naissaarest, Piirissaarest, Abrukast, Manijast, Vormsist ja Vilsandist.

Use of a ring chromosome and pulsed-field gels to study interhomolog recombination, double-strand DNA breaks and sister-chromatid exchange in yeast

International Nuclear Information System (INIS)

Game, J.C.; Sitney, K.C.; Cook, V.E.; Mortimer, R.K.

1989-01-01

The authors describe a system that uses pulsed-field gels for the physical detection of recombinant DNA molecules, double-strand DNA breaks (DSB) and sister-chromatid exchange in the yeast Saccharomyces cerevisiae. The system makes use of a circular variant of chromosome II (Chr. III). Meiotic recombination between this ring chromosome and a linear homolog produces new molecules of sizes distinguishable on gels from either parental molecule. They demonstrate that these recombinant molecules are not present either in strains with two linear Chr. III molecules or in rad50 mutants, which are defective in meiotic recombination. In conjunction with the molecular endpoints. They present data on the timing of commitment to meiotic recombination scored genetically. They have used x-rays to linearize circular Chr. III, both to develop a sensitive method for measuring frequency of DSB and as a means of detecting double-size circles originating in part from sister-chromatid exchange, which they find to be frequent during meiosis

The competition of charge remote and charge directed fragmentation mechanisms in quaternary ammonium salt derivatized peptides--an isotopic exchange study.

Science.gov (United States)

Cydzik, Marzena; Rudowska, Magdalena; Stefanowicz, Piotr; Szewczuk, Zbigniew

2011-12-01

Derivatization of peptides as quaternary ammonium salts (QAS) is a promising method for sensitive detection by electrospray ionization tandem mass spectrometry (Cydzik et al. J. Pept. Sci. 2011, 17, 445-453). The peptides derivatized by QAS at their N-termini undergo fragmentation according to the two competing mechanisms - charge remote (ChR) and charge directed (ChD). The absence of mobile proton in the quaternary salt ion results in ChR dissociation of a peptide bond. However, Hofmann elimination of quaternary salt creates an ion with one mobile proton leading to the ChD fragmentation. The experiments on the quaternary ammonium salts with deuterated N-alkyl groups or amide NH bonds revealed that QAS derivatized peptides dissociate according to the mixed ChR-ChD mechanism. The isotopic labeling allows differentiation of fragments formed according to ChR and ChD mechanisms. © The Author(s) 2011. This article is published with open access at Springerlink.com

Multifidelity Robust Aeroelastic Design, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — Nielsen Engineering & Research (NEAR) proposes a new method to generate mathematical models of wind-tunnel models and flight vehicles for robust aeroelastic...

Genomic locus modulating corneal thickness in the mouse identifies POU6F2 as a potential risk of developing glaucoma.

Directory of Open Access Journals (Sweden)

Rebecca King

2018-01-01

Full Text Available Central corneal thickness (CCT is one of the most heritable ocular traits and it is also a phenotypic risk factor for primary open angle glaucoma (POAG. The present study uses the BXD Recombinant Inbred (RI strains to identify novel quantitative trait loci (QTLs modulating CCT in the mouse with the potential of identifying a molecular link between CCT and risk of developing POAG. The BXD RI strain set was used to define mammalian genomic loci modulating CCT, with a total of 818 corneas measured from 61 BXD RI strains (between 60-100 days of age. The mice were anesthetized and the eyes were positioned in front of the lens of the Phoenix Micron IV Image-Guided OCT system or the Bioptigen OCT system. CCT data for each strain was averaged and used to QTLs modulating this phenotype using the bioinformatics tools on GeneNetwork (www.genenetwork.org. The candidate genes and genomic loci identified in the mouse were then directly compared with the summary data from a human POAG genome wide association study (NEIGHBORHOOD to determine if any genomic elements modulating mouse CCT are also risk factors for POAG.This analysis revealed one significant QTL on Chr 13 and a suggestive QTL on Chr 7. The significant locus on Chr 13 (13 to 19 Mb was examined further to define candidate genes modulating this eye phenotype. For the Chr 13 QTL in the mouse, only one gene in the region (Pou6f2 contained nonsynonymous SNPs. Of these five nonsynonymous SNPs in Pou6f2, two resulted in changes in the amino acid proline which could result in altered secondary structure affecting protein function. The 7 Mb region under the mouse Chr 13 peak distributes over 2 chromosomes in the human: Chr 1 and Chr 7. These genomic loci were examined in the NEIGHBORHOOD database to determine if they are potential risk factors for human glaucoma identified using meta-data from human GWAS. The top 50 hits all resided within one gene (POU6F2, with the highest significance level of p = 10-6 for

Kvantemekanik

DEFF Research Database (Denmark)

Mølmer, Klaus

enorm succes, men fortolkningen af den splittede samtidig tidens største videnskabsmænd, særligt Niels Bohr og Albert Einstein. Denne bog gennemgår kvantemekanikkens og fysikkens udvikling i det 20. århundrede - og giver indblik i de nyeste opdagelser af, hvordan den atomare verden fungerer...

Tumor suppressor genes that escape from X-inactivation contribute to cancer sex bias

OpenAIRE

Dunford, Andrew; Weinstock, David M.; Savova, Virginia; Schumacher, Steven E.; Cleary, John P.; Yoda, Akinori; Sullivan, Timothy J.; Hess, Julian M.; Gimelbrant, Alexander A.; Beroukhim, Rameen; Lawrence, Michael S.; Getz, Gad; Lane, Andrew A.

2016-01-01

There is a striking and unexplained male predominance across many cancer types. A subset of X chromosome (chrX) genes can escape X-inactivation, which would protect females from complete functional loss by a single mutation. To identify putative “Escape from X-Inactivation Tumor Suppressor” (EXITS) genes, we compared somatic alterations from >4100 cancers across 21 tumor types for sex bias. Six of 783 non-pseudoautosomal region (PAR) chrX genes (ATRX, CNKSR2, DDX3X, KDM5C, KDM6A, and MAGEC3) ...

Epiretinal membrane surgery for combined hamartoma of the retina and retinal pigment epithelium: role of multimodal analysis

Directory of Open Access Journals (Sweden)

Bruè C

2013-01-01

Full Text Available Claudia Bruè, Andrea Saitta, Michele Nicolai, Cesare Mariotti, Alfonso GiovanniniOphthalmology, Department of Neuroscience, Marche Polytechnic University, Ancona, ItalyBackground: The purpose of this study was to evaluate the role of spectral domain optical coherence tomography (SD-OCT, MP-1 microperimetry, and fundus autofluorescence imaging for planning surgical procedures in combined hamartomas of the retina and retinal pigment epithelium (CHR-RPE and following epiretinal membrane removal.Methods: In an interventional retrospective case series, six consecutive subjects with CHR-RPE underwent vitrectomy and epiretinal membrane peeling, with 4 years of follow-up. Each underwent complete ophthalmic examination, including best corrected visual acuity, fundus examination, fundus fluorescein angiography, SD-OCT, MP-1, and fundus autofluorescence at one, 6, 12, and 48 months.Results: Six eyes from six subjects with CHR-RPE were studied (mean age 31 ± 14 years. All patients were phakic and five were male (83.3%. Lesions were unilateral, ie, three macular, two juxtapapillary and macular, and one pericentral. Preoperative best corrected visual acuity was 0.3 ± 0.08 Snellen, with significant improvement to 0.9 ± 0.17 Snellen (P = 0.001 at 4 years of follow-up. Mean retinal sensitivity within the central 20° field improved from 16.6 ± 1.84 dB to 18.8 ± 0.96 dB (P = 0.07. There was also a statistically significant reduction in the visual defect (P = 0.04. SD-OCT demonstrated that the epiretinal membranes were completely removed in all but one patient, with significantly decreased macular edema on follow-up at one, 6, 12, and 48 months (P = 0.001. A positive correlation was shown between preoperative macular sensitivity and postoperative best corrected visual acuity. Fundus autofluorescence demonstrated a block in background autofluorescence at the site of the lesion, and hyperautofluorescsence at the edematous retina overlain by the epiretinal

Modellen

DEFF Research Database (Denmark)

Om genopførelsen af Palle Nielsens (f. 1942) værk Modellen fra 1968: en kæmpe legeplads til børn i museet, hvor de kan boltre sig frit: klatre i tove, kravle i trækonstruktioner, arbejde med værktøjer, kaste sig ud i skumgummipuder, male med fingermaling og klæde sig ud i kostumer......Om genopførelsen af Palle Nielsens (f. 1942) værk Modellen fra 1968: en kæmpe legeplads til børn i museet, hvor de kan boltre sig frit: klatre i tove, kravle i trækonstruktioner, arbejde med værktøjer, kaste sig ud i skumgummipuder, male med fingermaling og klæde sig ud i kostumer...

Dicty_cDB: CHR861 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available no Acid sequence ---ETTELXNKXIKFXSXXAXGEIXSISTWXXXFVXNXPAYXHDSXVNDEIXXDYFQRCL XISXGTXYDXSIQGDKXDYYC*ixyfxlfxxxxxixxxxx...ame A: ---*nxrig**xy*ixfkxsxwxnxixfxlxxxicxkxsxlxs*fxxk**nsx*lfstlf xyfkxxxl**xxsrr*x*llllnixfxpipxlxxxlxxxs...XGEIXSISTWXXXFVXNXPAYXHDSXVNDEIXXDYFQRCL XISXGTXYDXSIQGDKXDYYC*ixyfxlfxxxxxixxxxxfxinfkniiiikq*x*xkkk kvkngk...*iksqyknnnqiknkknkknktfi Frame C: ---kxpnwxixilnsfqxxxxxkxnxfxlgqxnlxkxixptimipx*mmkfxxiifnvvx ifqxxpfmixxfkaixmiiivkyxixsysxtxxxfxxx

Dicty_cDB: CHR553 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available wftfi lq*nsc***iitnlfhkfsgsst***r*rnyqrvyq*sksistikffrgrrndg*fiefn s*w*fqriekdess...VSGEKAVLIQKEIEDLKKQKKRDQDKLAEKDKLLTKLAKRMRKMEEA I--- ---kv***iynv*kgfgn*kih*r*inskke*kgekrngd*kieigndsfeiken

Dicty_cDB: CHR636 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode

Dicty_cDB: CHR522 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available gene, mitochondrial gene encoding mitochondrial protein, partial cds. 46 0.86 1 AJ505593 |AJ505593.1 Alcis repanda...ial), isolate 00372. 46 0.86 1 AJ438725 |AJ438725.1 Alcis repandata mitochondrion nd1 gene (partial), 16S rR...rum 3D7 chromosome 11 section 3 of 8 of the complete sequence. 46 0.86 1 AJ416938 |AJ416938.1 Alcis repand

Dicty_cDB: CHR619 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available rslfikmptkt*mxx**sw*kmlckdslx*sl*fr lw*rf*m*nxt*wfxmlcpfrkttpttt*xm**xmpxrpxm*s*stxkrmxrccp*tttk mxfkmxxkt*m*sxplx*rmlcxxxxrxmfxqmsx...rpxm*s*stwkrmxxccp*ttxkmi ixmsxkt*m*nqsxw*rmxc Frame B: s...vqlhivxxvxhcsmxkdvatcpchqqlveqvyqepssstagv ssclttlmsxwhicvkdsnggklgpngxxxfrr*fixkyir--- ---mnv*lixxvknvgxdpx

Dicty_cDB: CHR818 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available nce. 52 5e-09 4 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltior...rhiza cDNA 5', mRNA sequence. 54 7e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.

Dicty_cDB: CHR684 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available tiiihvllilamt*lvvailqsmlmiiihvpsmpvlnqqvllipqsm*miitn vqlihvpkkvv*lilqsilmitmpvplipahhqlvfpipq*tvmiiinvl*ihv...qtqlvv *ilqltvtivihvp*thaliqlvv*tlqsmlmiiihvpsmpvpnqqvllipqsm*mittn vqlmhvpkkvv*liphsilmitm

Dicty_cDB: CHR211 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 'HPRT insertion targeting and chromosome engineering clone MHPN350f07. 50 0.13 1 ...BX965467 |BX965467.1 Forward strand read from insert in 5'HPRT insertion targeting and chromosome engineering

Dicty_cDB: CHR769 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available r cysteine) proteinase inhibitor clade B (ovalbumin) family member. 32 0.51 2 CX072513 |CX072513.1 UCRCS08_28E10_g Parent...is cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 0.97 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent

Dicty_cDB: CHR866 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 52.2 Felis catus clone RP86-222L20, WORKING DRAFT SEQUENCE, 2 ordered pieces. 38 0.57 3 CX072513 |CX072513.1 UCRCS08_28E10_g Parent...CS08-28E10-J20-1-4.g, mRNA sequence. 46 0.77 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent Washington Navel

Dicty_cDB: CHR728 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP142o16. 5... targeting and chromosome engineering clone MHPP421e10. 50 0.14 1 CR044130 |CR044130.1 Forward strand read f...rom insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.14 1 CR017539 |CR...017539.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...nsertion targeting and chromosome engineering clone MHPP47e19. 50 0.14 1 dna update 2005.11.21 Homology vs P

Dicty_cDB: CHR667 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available strand read from insert in 5'HPRT insertion targeting and chromosome engineering clone MHPN347m23. 46 0.19 ...2 CR052856 |CR052856.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering

Dicty_cDB: CHR419 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 10.25 Translated Amino Acid sequence iklklkfnykqqiknsikk*ncylfyylff*yfqywynlkqpilv*kpmvtimilfs...lkfkl*e*n*ithd*i*sn*ILKYLIIKFI --- ---IKLKLKFNYKQQIKNSIKK*ncylfyylff*yfqywynlkqpilv*kpmvtimilfs n*qipkkfkwpe...ylff*yfqywynlkqpilv*kpmvtimilfsn*q ipkkfkwpeifclerkamkfm*wvelkrdlkaiiqsfplfltqiqshflpwllkfvmlql fm*kitlmrpvv...lssqvasgahglqn*qeklkfkl*e*n*ithd*i*sn*ILKYLIIKFI --- ---IKLKLKFNYKQQIKNSIKK*ncylfyylff*yfqywynlkqpilv*kpmvtimilfs

The Niels Bohr Archive is Placing Collections on its Website

DEFF Research Database (Denmark)

Aaserud, Finn

2010-01-01

this supplement, the documents of which we hope to make available on our website by 2013, the centennial for Bohr's model of the nuclear atom. We have found the task of digitizing our collections generally complex, sometimes frustrating, and in the end satisfying. At this stage it is particularly important...

Viikingite rünnakud algasid Eestist / Niels-Peter Granzow Busch

Index Scriptorium Estoniae

Granzow Busch, Niels-Peter

2014-01-01

Saaremaalt Salmelt kaevati välja kaks viikingilaeva koos 41 sõdalase skeletiga. Leidude kohta jagavad selgitusi antropoloog Raili Allmäe ja arheoloog Jüri Peets Tallinna Ülikooli Ajaloo Instituudist

Fulltext PDF

Indian Academy of Sciences (India)

1932, he attended the opening address by Niels Bohr at the 'International Congress on Light Therapy' on the topic ... understanding of the molecular processes taking place in the cell in term of atomic physics, might be ... Delbriick recalls in a few well-chosen words the paradoxes that gave rise to the quantum mechanical.

Epistemology and Probability

CERN Document Server

Plotnitsky, Arkady

2010-01-01

Offers an exploration of the relationships between epistemology and probability in the work of Niels Bohr, Werner Heisenberg, and Erwin Schrodinger; in quantum mechanics; and in modern physics. This book considers the implications of these relationships and of quantum theory for our understanding of the nature of thinking and knowledge in general

In Situ Flash Pyrolysis of Straw

DEFF Research Database (Denmark)

Bech, Niels

In-Situ Flash Pyrolysis of Straw Ph.D. dissertation by Niels Bech Submitted: April 2007. Supervisors: Professor Kim Dam-Johansen, Associate Professor Peter Arendt Jensen Erfaringerne med forbrænding af halm opnået gennem et årti har vist, at en proces der kan koncentrere energien på marken, fjerne...

Er gulvet grim og skummel, så ring til Hummel

DEFF Research Database (Denmark)

Brügger, Niels

for at komme med et bud på. Bogen bygger på over 300 slogans, som forfatteren har indsamlet gennem flere år. Niels Brügger er lektor i medievidenskab ved Institut for Informations- og Medievidenskab, Aarhus Universitet. Til daglig forsker han i internettets historie — de sjove slogans er en hobby....

Põltsamaa loss / Christian Gottlieb Welté, Stavenhagen Wilhelm Siegfried, Johann Michael Graff

Index Scriptorium Estoniae

Welté, Christian Gottlieb, 1748/49-1792

1996-01-01

Lk. 58 (17. saj. pärinevad figuraalsed ahjukahlid), värv., lk. 59 (fragment 1815. a. alevi kaardist), värv., lk. 221 (sisevaated 1770. aastatest, rokokoodekoor J. M. Graff, reprod TÜ kunstikabineti kogust), lk. 222 (lossiansambel, G. Chr. Velté õlimaal 18. saj. lõpust), värv., lk. 223 (loss ja kirik, G. Chr. Velté õlimaal 18. saj. lõpust), värv., lk. 224 (ampiirstiilis ahi härrastemaja saalis), värv., lk. 225 (loss ja alev, W. S. Stavenhageni gravüür 1867)

Functional analyses of AtCHR12 and AtCHR23 : plant growth responses upon over-expression of chromatin remodeling ATPase genes

NARCIS (Netherlands)

Folta, A.

2015-01-01

Living organisms have to deal with changing environmental conditions during their whole life cycle. In contrast to animals, plants are sessile organisms. Therefore they have evolved multiple regulatory mechanisms that help them to cope with changing conditions. One of the first responses to

Les femmes aux travaux d’aiguille: un topos littéraire?

Directory of Open Access Journals (Sweden)

Viviane Cunha

2011-11-01

Full Text Available Resumo: O artigo apresenta um estudo do topos da tecedeira/fiandeira no universo das artes visuais e na literatura abordando sobretudo o da literatura grega e o do lirismo medieval. O corpus de análise é constituído da Odisséia no que concerne ao universo clássico, do romance Philomena (Chrétien de Troyes e da epopéia Berte as grans piés (Adenet le Roi no que concerne aos textos medievais. Procura-se assim apresentar essas figuras emblemáticas através da história e numa perspectiva interdisciplinar.Palavras-chave: Literatura comparada; literatura grega; Homero; Odisséia; literatura francesa; Chrétien de Troyes; Philomena; Adenet le Roi; Berte as grans piés; mulher; tecedeira; fiandeira.Résumé: L’article présente une étude du topos de la tisseuse/fileuse dans l’univers des arts visuels et dans la littérature en approchant surtout celui de la poésie grecque et celui du lyrisme medieval. Le corpus d’analyse se constitue de l’Odyssée en ce qui concerne l’univers classique, du roman Philomena (Chrétien de Troyes et de l’épopée Berte as grans piés (Adenet Le Roi en ce qui concerne les textes médiévaux. On cherche ainsi à présenter ces figures emblématiques à travers l’histoire et dans une perspective interdisciplinaire.Mots-clés: Littérature comparée; littérature grecque; Homère; Odyssée; littérature française; Chrétien de Troyes; Philomena; Adenet le Roi; Berte as grans piés; femme; tisseuse; fileuse.Keywords: Comparative literature; Greek literatura; Homer; Odyssey; French literature; Chrétien de Troyes; Philomena; Adenet le Roi; Berte as grans piés; women; weaver; spinner.

Cyclin A regulates a cell-cycle-dependent expression of CKAP2 through phosphorylation of Sp1

International Nuclear Information System (INIS)

Kang, Du-Seock; Hong, Kyeong-Man; Park, Joobae; Bae, Chang-Dae

2012-01-01

Highlights: ► We identified a GC box and a CHR element in human CKAP2 minimal promoter. ► The CHR element repressed the CKAP2 minimal promoter activity at the G1/S phase. ► The GC box was essential for the basic promoter activity of human CKAP2. ► The GC box was also essential for the cyclic expression of human CKAP2. ► The phosphorylation of Sp1, mediated by Cyclin A, underlies the cyclic expression. -- Abstract: CKAP2 plays crucial roles in proper chromosome segregation and maintaining genomic stability. CKAP2 protein showed cell-cycle-dependent expression, which reached a maximum level at the G2/M phase and disappeared at the onset of G1 phase. To elucidate the mechanisms underlying cell cycle-dependent expression of CKAP2, we cloned and analyzed the human CKAP2 promoter. The upstream 115-bp region from the transcription start site was sufficient for minimal CKAP2 promoter activity. We identified 2 regulatory sequences; a CHR (−110 to −104 bp) and a GC box (−41 to −32 bp). We confirmed Sp1 bound to the GC box using a supershift assay and a ChIP assay. Mutation in the GC box resulted in a near complete loss of CKAP2 promoter activity while mutation in the CHR decreased the promoter activity by 50%. The CHR mutation showed enhanced activity at the G1/S phase, but still retained cyclic activity. The Chromatin IP revealed that the amount of Sp1 bound to the GC box gradually increased and reached a maximum level at the G2/M phase. The amount of Sp1 bound to the GC box was greatly reduced when Cyclin A was depleted, which was restored by adding Cyclin A/Cdk2 complex back into the nuclear extracts. Together, we concluded that the GC box was responsible for the cyclic activity of human CKAP2 promoter through the phosphorylation of Sp1, possibly by Cyclin A/Cdk complex.

RE-SONAN--CEIFeb-ru-aN

Indian Academy of Sciences (India)

discovery of energy quanta"; 1921 - to Albert Einstein "for services to theoretical physics, and especially for his discovery of the law of the photoelectric effect"; 1922 - to Niels Bohr" for his investigations of the structure of atoms, and ofthe radiation emanating from them"; 1929 - to Louis Victor de Broglie "for his discovery of the ...

Spinal pain in Danish school children – how often and how long?

DEFF Research Database (Denmark)

Dissing, Kristina Boe; Hartvigsen, Jan; Wedderkopp, Niels

Title Spinal pain in Danish school children – how often and how long? The CHAMPS Study-DK Authors First author: Kristina Boe Dissing1 Last author: Lise Hestbæk1,2 Co-authors: Jan Hartvigsen1,2, Christopher Williams3,4, Steven Kamper5, Eleanor Boyle1, Niels Wedderkopp6,7 Affiliations 1 Department...

New Releases

Index Scriptorium Estoniae

2005-01-01

Heliplaatidel Grieg "Peer Gynt" dirigeerib Paavo Järvi; Medtner "Pf Concs Nos 1-3. Sonate-Ballade", Rachmaninov "Bells", Various Cpsrs "Estonian Orch Wks" ja Nielsen "Syms Nos 1-6" dirigeerib Neeme Järvi

The new dedicated PIXE set-up at the National Environmental Research Institute, Denmark

International Nuclear Information System (INIS)

Kemp, Ka ring re; Waahlin, Peter

1999-01-01

The Niels Bohr Institute in Copenhagen was in the beginning of the 70'es one of the early places for PIXE. Contributions were made to the theoretical interpretation of the PIXE spectra as well as the practical application. The home-made 4 MV van de Graaff accelerator at the Niels Bohr Institute was an excellent tool for PIXE. The accelerator, which was used for many years, has now found its place on a museum after more than 40 years of active service. A dedicated PIXE set-up has now been established at the National Environmental Research Institute using a new 1.7 MV Tandem Pelletron (5SDH) from NEC. The main application is elemental analysis of outdoor aerosols. The main work is unsophisticated macro analyses, which do not push the equipment to its limits. This enables automated analysis of about 10,000 samples per year using very limited manpower resources. The research focuses on the contribution from various source types to the atmosphere over Europe, the North Atlantic and Greenland. Source compositions and their temporal variations are studied

Copenhagen, an unexplained encounter

CERN Multimedia

2003-01-01

Why did Werner Heisenberg, a participant in the nuclear research programme of the Third Reich, visit his friend and mentor Niels Bohr in occupied Denmark in September 1941? Was it a deliberate attempt to mislead the allies through talking to Bohr? Or was he really pursuing the utopian goal of halting the race to build the atomic bomb? What the historians have never been able to fully explain is explored in the play "Copenhagen", in which the ghosts of the two great scientists try to fathom why they failed to understand each other all those years ago. "Copenhagen", which has filled theatres in London, New York and Paris, is one of the most successful plays of British author Michael Frayn, also famous for his crime thrillers and comedies. A production of the play in French will be staged at the Théâtre de Carouge from 18th November. Werner Heisenberg and Niels Bohr before World War II.Both CERN and the Association pour l'Histoire des Sciences have associated themselves with the production...

Nuclear magnetic ordering in silver

Energy Technology Data Exchange (ETDEWEB)

Lefmann, K

1995-12-01

Nuclear antiferromagnetic ordering has been observed by neutron diffraction in a single crystal of {sup 109}Ag. The critical temperature is found to 700 pK, and the critical field is 100 {mu}T. From the paramagnetic phase a second order phase transition leads into a type-I 1-k structure with long range order. The experiments have taken place at the Hahn-Meitner Institut in Berlin in collaboration with the low Temperature Laboratory in Helsinki, the Niels Bohr Institute in Copenhagen, and Risoe National Laboratory, Roskilde. The present report is a Ph.D. thesis which has been successfully defended at the Niels Bohr Institute. Besides the results of the nuclear ordering experiments the thesis contains a description of the theoretical background for nuclear magnetism and a review of earlier nuclear ordering experiments as well as theoretical work. The principles for studying polarized nuclei with use of polarized and unpolarized neutrons are presented, as well as the results of such experiments. (au) 11 tabs., 59 ills., 143 refs.

Fluorescence in situ hybridization of TP53 for the detection of chromosome 17 abnormalities in myelodysplastic syndromes.

Science.gov (United States)

Sánchez-Castro, Judit; Marco-Betés, Víctor; Gómez-Arbonés, Xavier; García-Cerecedo, Tomás; López, Ricard; Talavera, Elisabeth; Fernández-Ruiz, Sara; Ademà, Vera; Marugan, Isabel; Luño, Elisa; Sanzo, Carmen; Vallespí, Teresa; Arenillas, Leonor; Marco Buades, Josefa; Batlle, Ana; Buño, Ismael; Martín Ramos, María Luisa; Blázquez Rios, Beatriz; Collado Nieto, Rosa; Vargas, Ma Teresa; González Martínez, Teresa; Sanz, Guillermo; Solé, Francesc

2015-01-01

Conventional G-banding cytogenetics (CC) detects chromosome 17 (chr17) abnormalities in 2% of patients with de novo myelodysplastic syndromes (MDS). We used CC and fluorescence in situ hybridization (FISH) (LSI p53/17p13.1) to assess deletion of 17p in 531 patients with de novo MDS from the Spanish Group of Hematological Cytogenetics. FISH detected - 17 or 17p abnormalities in 13 cases (2.6%) in whom no 17p abnormalities were revealed by CC: 0.9% of patients with a normal karyotype, 0% in non-informative cytogenetics, 50% of patients with a chr17 abnormality without loss of 17p and 4.7% of cases with an abnormal karyotype not involving chr17. Our results suggest that applying FISH of 17p13 to identify the number of copies of the TP53 gene could be beneficial in patients with a complex karyotype. We recommend using FISH of 17p13 in young patients with a normal karyotype or non-informative cytogenetics, and always in isolated del(17p).

Molecular hierarchy in neurons differentiated from mouse ES cells containing a single human chromosome 21.

Science.gov (United States)

Wang, Chi Chiu; Kadota, Mitsutaka; Nishigaki, Ryuichi; Kazuki, Yasuhiro; Shirayoshi, Yasuaki; Rogers, Michael Scott; Gojobori, Takashi; Ikeo, Kazuho; Oshimura, Mitsuo

2004-02-06

Defects in neurogenesis and neuronal differentiation in the fetal brain of Down syndrome (DS) patients lead to the apparent neuropathological abnormalities and contribute to the phenotypic characters of mental retardation, and premature development of Alzheimer's disease, those being the most common phenotype in DS. In order to understand the molecular mechanism underlying the cause of phenotypic abnormalities in the DS brain, we have utilized an in vitro model of TT2F mouse embryonic stem cells containing a single human chromosome 21 (hChr21) to study neuron development and neuronal differentiation by microarray containing 15K developmentally expressed cDNAs. Defective neuronal differentiation in the presence of extra hChr21 manifested primarily the post-transcriptional and translational modification, such as Mrpl10, SNAPC3, Srprb, SF3a60 in the early neuronal stem cell stage, and Mrps18a, Eef1g, and Ubce8 in the late differentiated stage. Hierarchical clustering patterned specific expression of hChr21 gene dosage effects on neuron outgrowth, migration, and differentiation, such as Syngr2, Dncic2, Eif3sf, and Peg3.

Mass dependence of spectral and angular distributions of Cherenkov radiation from relativistic isotopes in solid radiators and its possible application as mass selector

Science.gov (United States)

Bogdanov, O. V.; Rozhkova, E. I.; Pivovarov, Yu. L.; Kuzminchuk-Feuerstein, N.

2018-02-01

The first proof of principle experiment with a prototype of a Time-of-Flight (TOF) - Cherenkov detector of relativistic heavy ions (RHI) exploiting a liquid Iodine Naphthalene radiator has been performed at Cave C at GSI (Darmstadt, Germany). A conceptual design for a liquid Cherenkov detector was proposed as a prototype for the future TOF measurements at the Super-FRS by detection of total number of Cherenkov photons. The ionization energy loss of RHI in a liquid radiator decreases only slightly this number, while in a solid radiator changes sufficiently not the total number of ChR photons, but ChR angular and spectral distributions. By means of computer simulations, we showed that these distributions are very sensitive to the isotope mass, due to different stopping powers of isotopes with initial equal relativistic factors. The results of simulations for light (Li, Be) and heavy (Xe) isotopes at 500-1000 MeV/u are presented indicating the possibility to use the isotopic effect in ChR of RHI as the mass selector.

Positioning of chromosomes in human spermatozoa is determined by ordered centromere arrangement.

Directory of Open Access Journals (Sweden)

Olga S Mudrak

Full Text Available The intranuclear positioning of chromosomes (CHRs is a well-documented fact; however, mechanisms directing such ordering remain unclear. Unlike somatic cells, human spermatozoa contain distinct spatial markers and have asymmetric nuclei which make them a unique model for localizing CHR territories and matching peri-centromere domains. In this study, we established statistically preferential longitudinal and lateral positioning for eight CHRs. Both parameters demonstrated a correlation with the CHR gene densities but not with their sizes. Intranuclear non-random positioning of the CHRs was found to be driven by a specific linear order of centromeres physically interconnected in continuous arrays. In diploid spermatozoa, linear order of peri-centromeres was identical in two genome sets and essentially matched the arrangement established for haploid cells. We propose that the non-random longitudinal order of CHRs in human spermatozoa is generated during meiotic stages of spermatogenesis. The specific arrangement of sperm CHRs may serve as an epigenetic basis for differential transcription/replication and direct spatial CHR organization during early embryogenesis.

Ethics in researching teacher professionalism as relational competence

DEFF Research Database (Denmark)

Dahl, Kari Kragh Blume

’s academic achievements, among other (OECD, 2004). This poses ethical questions about researching what ‘good teacher professionalism’ is, since focusing on personal rather than academical or professional skills means shift in focus from subjects, knowledge, pedagogy, motivation and ideologies, which has been......Research findings suggest that teachers’ relational competencies are critical for pupils’ academical engagement and progression, welfare, social behavior and participation in the school’s processes, among other (Nielsen, 2015). Relational competence can be defined as having an eye for children...... thus possibly develop academically and become persons in various ways) according to which teacher, whom s/he is relating with (Nielsen, 2015). Yet findings suggest that there is a link between a teacher’s psychological and social skills, that is, aspects related to the person, and school children...

Symmetry breaking in gauge glasses

International Nuclear Information System (INIS)

Hansen, K.

1988-09-01

In order to explain why nature selects the gauge groups of the Standard Model, Brene and Nielsen have proposed a way to break gauge symmetry which does not rely on the existence of a Higgs field. The observed gauge groups will in this scheme appear as the only surviving ones when this mechanism is applied to a random selection of gauge groups. The essential assumption is a discrete space-time with random couplings. Some working assumptions were made for computational reasons of which the most important is that quantum fluctuations were neclected. This work presents an example which under the same conditions show that a much wider class of groups than predicted by Brene and Nielsen will be broken. In particular no possible Standard Model Group survives unbroken. Numerical calculations support the analytical result. (orig.)

Effects of sertindole on cognition in clozapine-treated schizophrenia patients - a double-blinded, randomized, placebo-controlled trial

DEFF Research Database (Denmark)

Nielsen, R E; Levander, S; Nielsen, Jimmi

Nielsen RE, Levander S, Thode D, Nielsen J. Effects of sertindole on cognition in clozapine-treated schizophrenia patients. Objective:  To assess the cognitive effects of sertindole augmentation in clozapine-treated patients diagnosed with schizophrenia. Cognition is secondary outcome of the trial....... Method:  A 12-week, double-blinded, randomized, placebo-controlled, augmentation study of patients treated with clozapine. Participants were randomized 1:1 to receive 16 mg of sertindole or placebo as adjunctive treatment to clozapine. Results:  Participants displayed substantial cognitive deficits......, ranging from 1.6 standard deviation below norms at baseline to more than three standard deviations on tests of response readiness and focused attention. There were no significant differences between sertindole augmentation and placebo groups at study end. Correlation analysis of Positive and Negative...

Magnus forces and statistics in 2 + 1 dimensions

International Nuclear Information System (INIS)

Davis, R.L.

1990-01-01

Spinning vortex solutions to the abelian Higgs model, not Nielsen-Olesen solutions, are appropriate to a Ginzburg-Landau description of superconductivity. The main physical distinction is that spinning vortices experience the Magnus force while Nielsen-Olesen vortices do not. In 2 + 1 dimensional superconductivity without a Chern-Simons interaction, the effect of the Magnus force is equivalent to that of a background fictitious magnetic field. Moreover, the phase obtained an interchanging two quasi-particles is always path-dependent. When a Chern-Simons term is added there is an additional localized Magnus flux at the vortex. For point-like vortices, the Chern-Simons interaction can be seen as defining their intrinsic statistics, but in realistic cases of vortices with finite size in strong Magnus fields the quasi-particle statistics are not well-defined

Proceedings of the symposium on the foundations of modern physics, 1987

International Nuclear Information System (INIS)

Lahti, P.

1987-01-01

This book discusses the following subjects: The Quantum Postulate and atomic theory; modern mathematics in formulation of basic laws of physics; uncertainty principles, Quantum systems; Niels Bohr's concept of reality; Quantum theory; language and reality in Quantum physics; Wolfgang Pauli's conception of reality; interpretation of Quantum mechanics; varieties of realism; and many-Hilbert-spaces theory of Quantum measurements

Fulltext PDF

Indian Academy of Sciences (India)

The attitude of slightly flippant irreverence for dogma reflected in Ghalib's lines, and indeed in his life, has played an important role in the development of every scientific discipline. The physicist Niels Bohr is said to have once remarked that the opposite of a great truth was usually another great truth. Scientific belief, once it ...

Virkelighed er noget vi leger frem, når vi leger med magten

DEFF Research Database (Denmark)

Holm, Claus

2008-01-01

I ny bog analyserer professor Niels Åkerstrøm Andersen fra CBS, hvordan organisationer forsøger at bruge den ellers uskyldige leg i magtens tjeneste. Men legen er ikke kun en loyal tjener, legen laver sine egne regler og risikerer at tage magten fra magthaverne, når de mægtiggør os gennem legen....

Conversazioni con la sfinge il ruolo dei paradossi nelle rivoluzioni scientifiche

CERN Document Server

Klein, Etienne

1993-01-01

Niels Bohr rifiutava ogni idea troppo conservatrice con il lapidario giudizio "Non è abbastanza folle". La fisica moderna ha dimostrato l'inefficacia del buon senso per costruire teorie o comprendere particolari risultati sperimentali. In rottura con l'esperenzia comune, ha contrapposto l'inaudito all'abitudine, i concetti delicati agli archetipi classici, le ipotesi piu ardite alle apparenze rassicuranti.

Firmaets Største Bedrift

DEFF Research Database (Denmark)

Hansen, Peer Henrik

fortæller, hvordan de tidligere modstandsfolk Arne Sejr og Niels Frommelt få år efter befrielsen etablerede deres såkaldte Firma for med støtte fra ledende danske politikere, Forsvarets Efterretningstjeneste og CIA at organisere en hemmelig krig mod Sovjetunionens danske støtter. Meget tyder på, at både...

På sporet af 5. C

DEFF Research Database (Denmark)

Krøgholt, Ida; Christoffersen, Erik Exe

2016-01-01

Borgerscener er landsdelsscenernes niche. Præmissen for scenerne er at bruge teatermediet til at skildre mennesker i deres autentiske liv, og i Lars Ole 5. C på Aarhus Teater leges der med Niels Malmros’ film fra 1973, som 10 århusianske børn i 12 årsalderen bruger som filter for deres egne...

ФC31 Integrase-Mediated Isolation and Characterization of Novel Safe Harbors for Transgene Expression in the Pig Genome

Science.gov (United States)

Bi, Yanzhen; Hua, Zaidong; Ren, Hongyan; Zhang, Liping; Xiao, Hongwei; Liu, Ximei; Hua, Wenjun; Mei, Shuqi; Molenaar, Adrian; Laible, Götz; Zheng, Xinmin

2018-01-01

Programmable nucleases have allowed the rapid development of gene editing and transgenics, but the technology still suffers from the lack of predefined genetic loci for reliable transgene expression and maintenance. To address this issue, we used ФC31 integrase to navigate the porcine genome and identify the pseudo attP sites suitable as safe harbors for sustained transgene expression. The combined ФC31 integrase mRNA and an enhanced green fluorescence protein (EGFP) reporter donor were microinjected into one-cell zygotes for transgene integration. Among the resulting seven EGFP-positive piglets, two had transgene integrations at pseudo attP sites, located in an intergenic region of chromosome 1 (chr1-attP) and the 6th intron of the TRABD2A gene on chromosome 3 (chr3-attP), respectively. The integration structure was determined by TAIL-PCR and Southern blotting. Primary fibroblast cells were isolated from the two piglets and examined using fluorescence-activated cell sorting (FACS) and enzyme-linked immunosorbent assay (ELISA), which demonstrated that the chr1-attP site was more potent than chr3-attP site in supporting the EGFP expression. Both piglets had green feet under the emission of UV light, and pelleted primary fibroblast cells were green-colored under natural light, corroborating that the two pseudo attP sites are beneficial to transgene expression. The discovery of these two novel safe harbors for robust and durable transgene expression will greatly facilitate the use of transgenic pigs for basic, biomedical and agricultural studies and applications. PMID:29300364

MVisAGe Identifies Concordant and Discordant Genomic Alterations of Driver Genes in Squamous Tumors.

Science.gov (United States)

Walter, Vonn; Du, Ying; Danilova, Ludmila; Hayward, Michele C; Hayes, D Neil

2018-06-15

Integrated analyses of multiple genomic datatypes are now common in cancer profiling studies. Such data present opportunities for numerous computational experiments, yet analytic pipelines are limited. Tools such as the cBioPortal and Regulome Explorer, although useful, are not easy to access programmatically or to implement locally. Here, we introduce the MVisAGe R package, which allows users to quantify gene-level associations between two genomic datatypes to investigate the effect of genomic alterations (e.g., DNA copy number changes on gene expression). Visualizing Pearson/Spearman correlation coefficients according to the genomic positions of the underlying genes provides a powerful yet novel tool for conducting exploratory analyses. We demonstrate its utility by analyzing three publicly available cancer datasets. Our approach highlights canonical oncogenes in chr11q13 that displayed the strongest associations between expression and copy number, including CCND1 and CTTN , genes not identified by copy number analysis in the primary reports. We demonstrate highly concordant usage of shared oncogenes on chr3q, yet strikingly diverse oncogene usage on chr11q as a function of HPV infection status. Regions of chr19 that display remarkable associations between methylation and gene expression were identified, as were previously unreported miRNA-gene expression associations that may contribute to the epithelial-to-mesenchymal transition. Significance: This study presents an important bioinformatics tool that will enable integrated analyses of multiple genomic datatypes. Cancer Res; 78(12); 3375-85. ©2018 AACR . ©2018 American Association for Cancer Research.

The interaction of working memory and emotion in persons clinically at risk for psychosis: an fMRI pilot study.

Science.gov (United States)

Pauly, Katharina; Seiferth, Nina Y; Kellermann, Thilo; Ruhrmann, Stephan; Daumann, Bianca; Backes, Volker; Klosterkötter, Joachim; Shah, N Jon; Schneider, Frank; Kircher, Tilo T; Habel, Ute

2010-07-01

Subtle emotional and cognitive dysfunctions may already be apparent in individuals at risk for psychosis. However, there is a paucity of research on the neural correlates of the interaction of both domains. It remains unclear whether those correlates are already dysfunctional before a transition to psychosis. We used functional magnetic resonance imaging to examine the interaction of working memory and emotion in 12 persons clinically at high risk for psychosis (CHR) and 12 healthy subjects individually matched for age, gender and parental education. Participants performed an n-back task while negative or neutral emotion was induced by olfactory stimulation. Although healthy and psychosis-prone subjects did not differ in their working memory performance or the evaluation of the induced emotion, decreased activations were found in CHR subjects in the superior parietal lobe and the precuneus during working memory and in the insula during emotion induction. Looking at the interaction, CHR subjects, showed decreased activation in the right superior temporal gyrus, which correlated negatively with psychopathological scores. Decreased activation was also found in the thalamus. However, an increase of activation emerged in several cerebellar regions. Dysfunctions in areas associated with controlling whether incoming information is linked to emotional content and in the integration of multimodal information might lead to compensatory activations of cerebellar regions known to be involved in olfactory and working memory processes. Our study underlines that cerebral dysfunctions related to cognitive and emotional processes, as well as their interaction, can emerge in persons with CHR, even in absence of behavioral differences. (c) 2009 Elsevier B.V. All rights reserved.

Theory of Mind, Emotion Recognition and Social Perception in Individuals at Clinical High Risk for Psychosis: findings from the NAPLS-2 cohort.

Science.gov (United States)

Barbato, Mariapaola; Liu, Lu; Cadenhead, Kristin S; Cannon, Tyrone D; Cornblatt, Barbara A; McGlashan, Thomas H; Perkins, Diana O; Seidman, Larry J; Tsuang, Ming T; Walker, Elaine F; Woods, Scott W; Bearden, Carrie E; Mathalon, Daniel H; Heinssen, Robert; Addington, Jean

2015-09-01

Social cognition, the mental operations that underlie social interactions, is a major construct to investigate in schizophrenia. Impairments in social cognition are present before the onset of psychosis, and even in unaffected first-degree relatives, suggesting that social cognition may be a trait marker of the illness. In a large cohort of individuals at clinical high risk for psychosis (CHR) and healthy controls, three domains of social cognition (theory of mind, facial emotion recognition and social perception) were assessed to clarify which domains are impaired in this population. Six-hundred and seventy-five CHR individuals and 264 controls, who were part of the multi-site North American Prodromal Longitudinal Study, completed The Awareness of Social Inference Test , the Penn Emotion Recognition task , the Penn Emotion Differentiation task , and the Relationship Across Domains , measures of theory of mind, facial emotion recognition, and social perception, respectively. Social cognition was not related to positive and negative symptom severity, but was associated with age and IQ. CHR individuals demonstrated poorer performance on all measures of social cognition. However, after controlling for age and IQ, the group differences remained significant for measures of theory of mind and social perception, but not for facial emotion recognition. Theory of mind and social perception are impaired in individuals at CHR for psychosis. Age and IQ seem to play an important role in the arising of deficits in facial affect recognition. Future studies should examine the stability of social cognition deficits over time and their role, if any, in the development of psychosis.

Reticulocyte Hemoglobin Content Helps Avoid Iron Overload in Hemodialysis Patients: A Retrospective Observational Study.

Science.gov (United States)

Capone, Domenico; Cataldi, Mauro; Vinciguerra, Mauro; Mosca, Teresa; Barretta, Salvatore; Ragosta, Annalisa; Sorrentino, Aniello; Vecchione, Alessandra; Barretta, Luca; Tarantino, Giovanni

2017-01-01

Anemia in patients suffering from end-stage renal failure is currently treated with Erythropoiesis-Stimulating Agents (ESA). This treatment needs sufficient iron supplementation to avoid an inadequate dosage of ESA. Nowadays modern analytical instruments allow to accurately calculate the content of Hemoglobin (Hb) in reticulocytes (CHr), that can be used as a guide for prescribing patients with the appropriate amount of iron. Patients, undergoing hemodialysis, were retrospectively selected from the database and were divided in two groups: group A received intravenous (IV) iron and subcutaneously ESA, and their dosages were adjusted on the basis of the following parameters: Hb, Mean corpuscular haemoglobin (MCH), CHr with consequent MCH/CHr ratio and reticulocyte count determined by the ADVIA 120 Hematology System of Siemens; group B patients were administered IV iron and ESA monitoring iron storage, Hb and ferritin. The aforementioned parameters and the administered amount of iron and ESA were monitored at baseline, four and eight months from the begining of the study. For ESA supplementation, no difference was observed between the groups at the various observed times. Despite similar Hb levels, the patients of group A needed significant lower doses of IV iron (-57.8%) avoiding risks of organ toxicity and obtaining consequent cost saving of nearly 1 €/patient/month. The use of CHr and its related parameters allows the avoidance of overdosage of IV iron, which can potentially damage organs, and the reduction of health care direct and indirect costs. Copyright© 2017, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

75 FR 65323 - The Tennis Channel, Inc. v. Comcast Cable Communications, LLC; File No. CSR-8258-P

Science.gov (United States)

2010-10-22

... (formerly, Nielsen Media Research). There are 210 DMAs in the United States. In addition to its role as a... Starter tier. 9. In 2005, The Tennis Channel executed an affiliation agreement with Comcast that provided...

On the monodromy group for the super Schwarzian differential equation

International Nuclear Information System (INIS)

Uehara, Shozo; Yasui, Yukinori.

1991-03-01

We calculate the first variation of the monodromy group associated with a super Schwarzian differential equation. The relation between the monodromy period and the Fenchel-Nielsen deformation of a super Riemann surface is presented. (author)

The influence of atomic coherence and dipole–dipole interaction on ...

Indian Academy of Sciences (India)

Entanglement is an essential feature of quantum mechanics. ... entanglement in a system of two identical two-level atoms with one-photon ..... [1] M A Nielsen and I L Chuang, Quantum computation and quantum information (Cambridge.

On the Implementation of Global Abduction

DEFF Research Database (Denmark)

Christiansen, Henning

2007-01-01

needs to give up one plan, it may start a new one, or continue a suspended plan, while its beliefs learned about the world in the failed attempts persist. This paper describes an implementation of GA in the high-level language of Constraint Handling Rules (CHR). It appears to be a first attempt...... to a full implementation of GA, which also confirms CHR as a powerful meta-programming language for advanced reasoning. The construction gives rise to discussing important issues of the semantics and pragmatics of Global Abduction, leading to proposal for a specific procedural semantics and architecture...

Potential epigenetic biomarkers of obesity-related insulin resistance in human whole-blood.

Science.gov (United States)

Day, Samantha E; Coletta, Richard L; Kim, Joon Young; Garcia, Luis A; Campbell, Latoya E; Benjamin, Tonya R; Roust, Lori R; De Filippis, Elena A; Mandarino, Lawrence J; Coletta, Dawn K

2017-04-03

Obesity can increase the risk of complex metabolic diseases, including insulin resistance. Moreover, obesity can be caused by environmental and genetic factors. However, the epigenetic mechanisms of obesity are not well defined. Therefore, the identification of novel epigenetic biomarkers of obesity allows for a more complete understanding of the disease and its underlying insulin resistance. The aim of our study was to identify DNA methylation changes in whole-blood that were strongly associated with obesity and insulin resistance. Whole-blood was obtained from lean (n = 10; BMI = 23.6 ± 0.7 kg/m 2 ) and obese (n = 10; BMI = 34.4 ± 1.3 kg/m 2 ) participants in combination with euglycemic hyperinsulinemic clamps to assess insulin sensitivity. We performed reduced representation bisulfite sequencing on genomic DNA isolated from the blood. We identified 49 differentially methylated cytosines (DMCs; q obese compared with lean participants. We identified 2 sites (Chr.21:46,957,981 and Chr.21:46,957,915) in the 5' untranslated region of solute carrier family 19 member 1 (SLC19A1) with decreased methylation in obese participants (lean 0.73 ± 0.11 vs. obese 0.09 ± 0.05; lean 0.68 ± 0.10 vs. obese 0.09 ± 0.05, respectively). These 2 DMCs identified by obesity were also significantly predicted by insulin sensitivity (r = 0.68, P = 0.003; r = 0.66; P = 0.004). In addition, we performed a differentially methylated region (DMR) analysis and demonstrated a decrease in methylation of Chr.21:46,957,915-46,958,001 in SLC19A1 of -34.9% (70.4% lean vs. 35.5% obese). The decrease in whole-blood SLC19A1 methylation in our obese participants was similar to the change observed in skeletal muscle (Chr.21:46,957,981, lean 0.70 ± 0.09 vs. obese 0.31 ± 0.11 and Chr.21:46,957,915, lean 0.72 ± 0.11 vs. obese 0.31 ± 0.13). Pyrosequencing analysis further demonstrated a decrease in methylation at Chr.21:46,957,915 in both whole-blood (lean 0.71 ± 0.10 vs. obese 0.18 ± 0

The DnaK Chaperone Uses Different Mechanisms To Promote and Inhibit Replication of Vibrio cholerae Chromosome 2

Energy Technology Data Exchange (ETDEWEB)

Jha, Jyoti K.; Li, Mi; Ghirlando, Rodolfo; Miller Jenkins, Lisa M.; Wlodawer, Alexander; Chattoraj, Dhruba; Dunny, Gary M.

2017-04-18

Replication of Vibrio cholerae chromosome 2 (Chr2) depends on molecular chaperone DnaK to facilitate binding of the initiator (RctB) to the replication origin. The binding occurs at two kinds of site, 12-mers and 39-mers, which promote and inhibit replication, respectively. Here we show that DnaK employs different mechanisms to enhance the two kinds of binding. We found that mutations inrctBthat reduce DnaK binding also reduce 12-mer binding and initiation. The initiation defect is suppressed by second-site mutations that increase 12-mer binding only marginally. Instead, they reduce replication inhibitory mechanisms: RctB dimerization and 39-mer binding. One suppressing change was in a dimerization domain which is folded similarly to the initiator of an iteron plasmid—the presumed progenitor of Chr2. In plasmids, DnaK promotes initiation by reducing dimerization. A different mutation was in the 39-mer binding domain of RctB and inactivated it, indicating an alternative suppression mechanism. Paradoxically, although DnaK increases 39-mer binding, the increase was also achieved by inactivating the DnaK binding site of RctB. This result suggests that the site inhibits the 39-mer binding domain (via autoinhibition) when prevented from binding DnaK. Taken together, our results reveal an important feature of the transition from plasmid to chromosome: the Chr2 initiator retains the plasmid-like dimerization domain and its control by chaperones but uses the chaperones in an unprecedented way to control the inhibitory 39-mer binding. IMPORTANCE The capacity of proteins to undergo remodeling provides opportunities to control their function. However, remodeling remains a poorly understood aspect of the structure-function paradigm due to its dynamic nature. Here we have studied remodeling of the initiator of replication ofVibrio choleraeChr2 by the molecular chaperone, DnaK. We show that DnaK binds to a site on the Chr2 initiator (RctB) that

Notes on the fishes collected by the R.V. “TRIDENS” on the North West African shelf, 19-25 January 1969

NARCIS (Netherlands)

Groot, de S.J.; Nijssen, H.

1971-01-01

On the North West African shelf 98 species of fishes were collected of which a classification is given. Three species have hitherto been recorded only farther South. The status of Platophrys podas africanus (Nielsen, 1961) is discussed.

Sarkozy presidendina on Euroopale parim valik / Kristian L. Nielsen

Index Scriptorium Estoniae

Nielsen, Kristian L.

2007-01-01

Autori hinnangul tundub Prantsusmaa presidendiks valitud Nicolas Sarkozy olevat tugeval positsioonil, et tegelda krooniliselt suure töötusega eriti noorte hulgas ja sellest tulenevate sotsiaalprobleemidega, ta on näidanud tahet tegelda tööturu reformi ja avaliku sektori kärpimisega. Autor vaatleb, kuidas N. Sarkozy võib mõjutada Euroopa poliitikat laiemalt, käsitledes tema seisukohti EL-i laienemise, põhiseadusleppe, USA-suhete küsimustes

Klaaspärlimäng peletab klassikahirmu / Katrin Nielsen

Index Scriptorium Estoniae

Nielsen, Katrin

2003-01-01

Eri stiile-ajastuid ühendavast Peeter Vähi kujandatud muusikafestivalist "Klaaspärlimäng" 22. juulist-24. augustini. Kontsertidest Pärnu kontserdimajas: gamelaniansambli Gamelan Son of Lion kontserdist 22. juulil, Vardo Rumesseni kontserdist ja CD esitlusest 28. juulil, tütarlastekoori "Ellerhein" kontserdist 30. juulil

Report of the Army Science Board Summer Study on Installations 2025

Science.gov (United States)

2009-12-01

stresses , beha- vioral health problems, and injuries associated with war. Transform: IMCOM is modernizing installation management processes, policies...well. For example, "Prediction is very difficult, especially about the future" (Niels Bohr). Others stress that the future will be a lot like the...34homogenization" Endangered species Continuous and ubiquitous of society Islanding computing Telecommuting Wireless proliferation across appliances

Neutrons as Party Animals: An Analogy for Understanding Heavy-Element Fissility

Science.gov (United States)

Reed, B. Cameron

2012-01-01

I teach a general education class on the history of nuclear physics and the Manhattan Project. About halfway through the course we come to the discovery of fission and Niels Bohr's insight that it is the rare isotope of uranium, U-235, which fissions under slow-neutron bombardment as opposed to the much more common U-238 isotope. As an…

Gluonic effects in color dielectric model. Pt. 2

International Nuclear Information System (INIS)

Aoki, N.; Hyuga, H.

1990-01-01

We study generalized versions of the Nielsen and Patkos color dielectric model with an effective quark mass m q (χ=m q /χ τ and a dielectric function Κ(χ)=χ β . Gluonic effects are studied in this model with both perturbative and self-consistent calculations. In the case of τ=0.5 and β=2, it is shown that the perturbative gluonic effects are too strong to obtain a reasonable description of N and Δ. The choice of τ=2 and β=4 is shown to give a reasonable agreement of the masses of N and Δ with their observed ones. Taking into account the results in our previous paper, it is therefore suggested that the choice of τ:β=1:2 is superior to that of 1:4, the latter of which corresponds of the Nielsen and Patkos model. (orig.)

Developing Praxis in Conflictual Cooperation

DEFF Research Database (Denmark)

Axel, Erik

. The presentation will discuss and analyse some empirical material from a project on conflictual cooperation in the building business. The analysis opens an opportunity to discuss and expand Lave and Wenger's notion of situated learning. The authors' original intention of understanding learning as an integral......The present and Nielsen's abstracts argue that change and learning are two related aspects of praxis. The present abstract will investigate the relation between developing praxis and its organization, while Nielsen's abstract will investigate the relation between learning and changing praxis...... of the house leaves traces which we must take into account in our ensuing acts. Additionally it will be argued that the professionals may constitute different communities on the building site. This does not mean that the building site is a community of practice, all the same the conflictual cooperation...

Whole-exome sequencing supports genetic heterogeneity in childhood apraxia of speech.

Science.gov (United States)

Worthey, Elizabeth A; Raca, Gordana; Laffin, Jennifer J; Wilk, Brandon M; Harris, Jeremy M; Jakielski, Kathy J; Dimmock, David P; Strand, Edythe A; Shriberg, Lawrence D

2013-10-02

Childhood apraxia of speech (CAS) is a rare, severe, persistent pediatric motor speech disorder with associated deficits in sensorimotor, cognitive, language, learning and affective processes. Among other neurogenetic origins, CAS is the disorder segregating with a mutation in FOXP2 in a widely studied, multigenerational London family. We report the first whole-exome sequencing (WES) findings from a cohort of 10 unrelated participants, ages 3 to 19 years, with well-characterized CAS. As part of a larger study of children and youth with motor speech sound disorders, 32 participants were classified as positive for CAS on the basis of a behavioral classification marker using auditory-perceptual and acoustic methods that quantify the competence, precision and stability of a speaker's speech, prosody and voice. WES of 10 randomly selected participants was completed using the Illumina Genome Analyzer IIx Sequencing System. Image analysis, base calling, demultiplexing, read mapping, and variant calling were performed using Illumina software. Software developed in-house was used for variant annotation, prioritization and interpretation to identify those variants likely to be deleterious to neurodevelopmental substrates of speech-language development. Among potentially deleterious variants, clinically reportable findings of interest occurred on a total of five chromosomes (Chr3, Chr6, Chr7, Chr9 and Chr17), which included six genes either strongly associated with CAS (FOXP1 and CNTNAP2) or associated with disorders with phenotypes overlapping CAS (ATP13A4, CNTNAP1, KIAA0319 and SETX). A total of 8 (80%) of the 10 participants had clinically reportable variants in one or two of the six genes, with variants in ATP13A4, KIAA0319 and CNTNAP2 being the most prevalent. Similar to the results reported in emerging WES studies of other complex neurodevelopmental disorders, our findings from this first WES study of CAS are interpreted as support for heterogeneous genetic origins of

Major Quantitative Trait Loci and Putative Candidate Genes for Powdery Mildew Resistance and Fruit-Related Traits Revealed by an Intraspecific Genetic Map for Watermelon (Citrullus lanatus var. lanatus)

Science.gov (United States)

Kim, Kwang-Hwan; Hwang, Ji-Hyun; Han, Dong-Yeup; Park, Minkyu; Kim, Seungill; Choi, Doil; Kim, Yongjae; Lee, Gung Pyo; Kim, Sun-Tae; Park, Young-Hoon

2015-01-01

An intraspecific genetic map for watermelon was constructed using an F2 population derived from ‘Arka Manik’ × ‘TS34’ and transcript sequence variants and quantitative trait loci (QTL) for resistance to powdery mildew (PMR), seed size (SS), and fruit shape (FS) were analyzed. The map consists of 14 linkage groups (LGs) defined by 174 cleaved amplified polymorphic sequences (CAPS), 2 derived-cleaved amplified polymorphic sequence markers, 20 sequence-characterized amplified regions, and 8 expressed sequence tag-simple sequence repeat markers spanning 1,404.3 cM, with a mean marker interval of 6.9 cM and an average of 14.6 markers per LG. Genetic inheritance and QTL analyses indicated that each of the PMR, SS, and FS traits is controlled by an incompletely dominant effect of major QTLs designated as pmr2.1, ss2.1, and fsi3.1, respectively. The pmr2.1, detected on chromosome 2 (Chr02), explained 80.0% of the phenotypic variation (LOD = 30.76). This QTL was flanked by two CAPS markers, wsb2-24 (4.00 cM) and wsb2-39 (13.97 cM). The ss2.1, located close to pmr2.1 and CAPS marker wsb2-13 (1.00 cM) on Chr02, explained 92.3% of the phenotypic variation (LOD = 68.78). The fsi3.1, detected on Chr03, explained 79.7% of the phenotypic variation (LOD = 31.37) and was flanked by two CAPS, wsb3-24 (1.91 cM) and wsb3-9 (7.00 cM). Candidate gene-based CAPS markers were developed from the disease resistance and fruit shape gene homologs located on Chr.02 and Chr03 and were mapped on the intraspecific map. Colocalization of these markers with the major QTLs indicated that watermelon orthologs of a nucleotide-binding site-leucine-rich repeat class gene containing an RPW8 domain and a member of SUN containing the IQ67 domain are candidate genes for pmr2.1 and fsi3.1, respectively. The results presented herein provide useful information for marker-assisted breeding and gene cloning for PMR and fruit-related traits. PMID:26700647

Major Quantitative Trait Loci and Putative Candidate Genes for Powdery Mildew Resistance and Fruit-Related Traits Revealed by an Intraspecific Genetic Map for Watermelon (Citrullus lanatus var. lanatus).

Science.gov (United States)

Kim, Kwang-Hwan; Hwang, Ji-Hyun; Han, Dong-Yeup; Park, Minkyu; Kim, Seungill; Choi, Doil; Kim, Yongjae; Lee, Gung Pyo; Kim, Sun-Tae; Park, Young-Hoon

2015-01-01

An intraspecific genetic map for watermelon was constructed using an F2 population derived from 'Arka Manik' × 'TS34' and transcript sequence variants and quantitative trait loci (QTL) for resistance to powdery mildew (PMR), seed size (SS), and fruit shape (FS) were analyzed. The map consists of 14 linkage groups (LGs) defined by 174 cleaved amplified polymorphic sequences (CAPS), 2 derived-cleaved amplified polymorphic sequence markers, 20 sequence-characterized amplified regions, and 8 expressed sequence tag-simple sequence repeat markers spanning 1,404.3 cM, with a mean marker interval of 6.9 cM and an average of 14.6 markers per LG. Genetic inheritance and QTL analyses indicated that each of the PMR, SS, and FS traits is controlled by an incompletely dominant effect of major QTLs designated as pmr2.1, ss2.1, and fsi3.1, respectively. The pmr2.1, detected on chromosome 2 (Chr02), explained 80.0% of the phenotypic variation (LOD = 30.76). This QTL was flanked by two CAPS markers, wsb2-24 (4.00 cM) and wsb2-39 (13.97 cM). The ss2.1, located close to pmr2.1 and CAPS marker wsb2-13 (1.00 cM) on Chr02, explained 92.3% of the phenotypic variation (LOD = 68.78). The fsi3.1, detected on Chr03, explained 79.7% of the phenotypic variation (LOD = 31.37) and was flanked by two CAPS, wsb3-24 (1.91 cM) and wsb3-9 (7.00 cM). Candidate gene-based CAPS markers were developed from the disease resistance and fruit shape gene homologs located on Chr.02 and Chr03 and were mapped on the intraspecific map. Colocalization of these markers with the major QTLs indicated that watermelon orthologs of a nucleotide-binding site-leucine-rich repeat class gene containing an RPW8 domain and a member of SUN containing the IQ67 domain are candidate genes for pmr2.1 and fsi3.1, respectively. The results presented herein provide useful information for marker-assisted breeding and gene cloning for PMR and fruit-related traits.

Transdiagnostic Risk Calculator for the Automatic Detection of Individuals at Risk and the Prediction of Psychosis: Second Replication in an Independent National Health Service Trust.

Science.gov (United States)

Fusar-Poli, Paolo; Werbeloff, Nomi; Rutigliano, Grazia; Oliver, Dominic; Davies, Cathy; Stahl, Daniel; McGuire, Philip; Osborn, David

2018-06-12

The benefits of indicated primary prevention among individuals at Clinical High Risk for Psychosis (CHR-P) are limited by the difficulty in detecting these individuals. To overcome this problem, a transdiagnostic, clinically based, individualized risk calculator has recently been developed and subjected to a first external validation in 2 different catchment areas of the South London and Maudsley (SLaM) NHS Trust. Second external validation of real world, real-time electronic clinical register-based cohort study. All individuals who received a first ICD-10 index diagnosis of nonorganic and nonpsychotic mental disorder within the Camden and Islington (C&I) NHS Trust between 2009 and 2016 were included. The model previously validated included age, gender, ethnicity, age by gender, and ICD-10 index diagnosis to predict the development of any ICD-10 nonorganic psychosis. The model's performance was measured using Harrell's C-index. This study included a total of 13702 patients with an average age of 40 (range 16-99), 52% were female, and most were of white ethnicity (64%). There were no CHR-P or child/adolescent services in the C&I Trust. The C&I and SLaM Trust samples also differed significantly in terms of age, gender, ethnicity, and distribution of index diagnosis. Despite these significant differences, the original model retained an acceptable predictive performance (Harrell's C of 0.73), which is comparable to that of CHR-P tools currently recommended for clinical use. This risk calculator may pragmatically support an improved transdiagnostic detection of at-risk individuals and psychosis prediction even in NHS Trusts in the United Kingdom where CHR-P services are not provided.

Oligonucleotide PIK3CA/Chromosome 3 Dual in Situ Hybridization Automated Assay with Improved Signals, One-Hour Hybridization, and No Use of Blocking DNA.

Science.gov (United States)

Zhang, Wenjun; Hubbard, Antony; Baca-Parkinson, Leslie; Stanislaw, Stacey; Vladich, Frank; Robida, Mark D; Grille, James G; Maxwell, Daniel; Tsao, Tsu-Shuen; Carroll, William; Gardner, Tracie; Clements, June; Singh, Shalini; Tang, Lei

2015-09-01

The PIK3CA gene at chromosome 3q26.32 was found to be amplified in up to 45% of patients with squamous cell carcinoma of the lung. The strong correlation between PIK3CA amplification and increased phosphatidylinositol 3-kinase (PI3K) pathway activities suggested that PIK3CA gene copy number is a potential predictive biomarker for PI3K inhibitors. Currently, all microscopic assessments of PIK3CA and chromosome 3 (CHR3) copy numbers use fluorescence in situ hybridization. PIK3CA probes are derived from bacterial artificial chromosomes whereas CHR3 probes are derived mainly from the plasmid pHS05. These manual fluorescence in situ hybridization assays mandate 12- to 18-hour hybridization and use of blocking DNA from human sources. Moreover, fluorescence in situ hybridization studies provide limited morphologic assessment and suffer from signal decay. We developed an oligonucleotide-based bright-field in situ hybridization assay that overcomes these shortcomings. This assay requires only a 1-hour hybridization with no need for blocking DNA followed by indirect chromogenic detection. Oligonucleotide probes produced discrete and uniform CHR3 stains superior to those from the pHS05 plasmid. This assay achieved successful staining in 100% of the 195 lung squamous cell carcinoma resections and in 94% of the 33 fine-needle aspirates. This robust automated bright-field dual in situ hybridization assay for the simultaneous detection of PIK3CA and CHR3 centromere provides a potential clinical diagnostic method to assess PIK3CA gene abnormality in lung tumors. Copyright © 2015 American Society for Investigative Pathology and the Association for Molecular Pathology. Published by Elsevier Inc. All rights reserved.

Reproductive isolation in hybrid mice due to spermatogenesis defects at three meiotic stages.

Science.gov (United States)

Oka, Ayako; Mita, Akihiko; Takada, Yuki; Koseki, Haruhiko; Shiroishi, Toshihiko

2010-09-01

Early in the process of speciation, reproductive failures occur in hybrid animals between genetically diverged populations. The sterile hybrid animals are often males in mammals and they exhibit spermatogenic disruptions, resulting in decreased number and/or malformation of mature sperms. Despite the generality of this phenomenon, comparative study of phenotypes in hybrid males from various crosses has not been done, and therefore the comprehensive genetic basis of the disruption is still elusive. In this study, we characterized the spermatogenic phenotype especially during meiosis in four different cases of reproductive isolation: B6-ChrX(MSM), PGN-ChrX(MSM), (B6 × Mus musculus musculus-NJL/Ms) F(1), and (B6 × Mus spretus) F(1). The first two are consomic strains, both bearing the X chromosome of M. m. molossinus; in B6-ChrX(MSM), the genetic background is the laboratory strain C57BL/6J (predominantly M. m. domesticus), while in PGN-ChrX(MSM) the background is the PGN2/Ms strain purely derived from wild M. m. domesticus. The last two cases are F(1) hybrids between mouse subspecies or species. Each of the hybrid males exhibited cell-cycle arrest and/or apoptosis at either one or two of three distinct meiotic stages: premeiotic stage, zygotene-to-pachytene stage of prophase I, and metaphase I. This study shows that the sterility in hybrid males is caused by spermatogenic disruptions at multiple stages, suggesting that the responsible genes function in different cellular processes. Furthermore, the stages with disruptions are not correlated with the genetic distance between the respective parental strains.

Mediators Linking Childhood Adversities and Trauma to Suicidality in Individuals at Risk for Psychosis

Directory of Open Access Journals (Sweden)

Stefanie J. Schmidt

2017-11-01

Full Text Available Suicidality is highly prevalent in patients at clinical high risk (CHR for psychosis. Childhood adversities and trauma are generally predictive of suicidality. However, the differential effects of adversity/trauma-domains and CHR-criteria, i.e., ultra-high risk and basic symptom criteria, on suicidality remain unclear. Furthermore, the underlying mechanisms and, thus, worthwhile targets for suicide-prevention are still poorly understood. Therefore, structural equation modeling was used to test theory-driven models in 73 CHR-patients. Mediators were psychological variables, i.e., beliefs about one’s own competencies as well as the controllability of events and coping styles. In addition, symptomatic variables (depressiveness, basic symptoms, attenuated psychotic symptoms were hypothesized to mediate the effect of psychological mediators on suicidality as the final outcome variable. Results showed two independent pathways. In the first pathway, emotional and sexual but not physical adversity/trauma was associated with suicidality, which was mediated by dysfunctional competence/control beliefs, a lack of positive coping-strategies and depressiveness. In the second pathway, cognitive basic symptoms but not attenuated psychotic symptoms mediated the relationship between trauma/adversity and suicidality. CHR-patients are, thus, particularly prone to suicidality if adversity/trauma is followed by the development of depressiveness. Regarding the second pathway, this is the first study showing that adversity/trauma led to suicidality through an increased risk for psychosis as indicated by cognitive basic symptoms. As insight is generally associated with suicidality, this may explain why self-experienced basic symptoms increase the risk for it. Consequently, these mediators should be monitored regularly and targeted by integrated interventions as early as possible to enhance resilience against suicidality.

Polymorphism in hybrid male sterility in wild-derived Mus musculus musculus strains on proximal chromosome 17.

Science.gov (United States)

Vyskocilová, Martina; Prazanová, Gabriela; Piálek, Jaroslav

2009-02-01

The hybrid sterility-1 (Hst1) locus at Chr 17 causes male sterility in crosses between the house mouse subspecies Mus musculus domesticus (Mmd) and M. m. musculus (Mmm). This locus has been defined by its polymorphic variants in two laboratory strains (Mmd genome) when mated to PWD/Ph mice (Mmm genome): C57BL/10 (carrying the sterile allele) and C3H (fertile allele). The occurrence of sterile and/or fertile (wild Mmm x C57BL)F1 males is evidence that polymorphism for this trait also exists in natural populations of Mmm; however, the nature of this polymorphism remains unclear. Therefore, we derived two wild-origin Mmm strains, STUS and STUF, that produce sterile and fertile males, respectively, in crosses with C57BL mice. To determine the genetic basis underlying male fertility, the (STUS x STUF)F1 females were mated to C57BL/10 J males. About one-third of resulting hybrid males (33.8%) had a significantly smaller epididymis and testes than parental animals and lacked spermatozoa due to meiotic arrest. A further one-fifth of males (20.3%) also had anomalous reproductive traits but produced some spermatozoa. The remaining fertile males (45.9%) displayed no deviation from values found in parental individuals. QTL analysis of the progeny revealed strong associations of male fitness components with the proximal end of Chr 17, and a significant effect of the central section of Chr X on testes mass. The data suggest that genetic incompatibilities associated with male sterility have evolved independently at the proximal end of Chr 17 and are polymorphic within both Mmd and Mmm genomes.

Partial trisomy 5q resulting from chromosome 7 insertion: An expansion of the phenotype

Energy Technology Data Exchange (ETDEWEB)

Fries, M.H.; Reilly, P.A.; Williams, T.C. [Keesler Medical Center, MS (United States)] [and others

1994-09-01

Partial trisomy 5q has been categorized into three separate phenotypes; however, a distinctive phenotype has not been described for duplications spanning 5q23-q35. We report a case of partial trisomy 5q for this region as a result of a ins(7,5)(q31.3;q23.2q35.1)mat. The liveborn male infant was delivered by emergency cesarean section at 37 weeks after a pregnancy notable for oligohydramnios, with birth weight 1792 g (<3%). Postnatal course was marked by psychomotor delay, failure to thrive, and biopsy demonstrated neonatal giant cell hepatitis with a paucity of intrahepatic bile ducts. His appearance was remarkable for lack of subcutaneous fat, midline displaced hair whorl, bitemporal narrowing with frontal bossing, wide anterior fontanel, widow`s peak, protuberant eyes with periorbital and lid edema, short flat nasal bridge with broad flattened nasal tip, long smooth philtrum, wide mouth with thin lips, wide gingival ridges, micrognathia, posteriorly rotated low-set ears, hepatomegaly, flexion contractions of elbows, and generalized hypertonicity. Urine organic acids, oligosaccharide/mucopolysaccharide screen, and plasma amino acids were negative. GTG-banding on prometaphase chromosomes showed an unbalanced translocation involving chr. 7. This was identified as an insertion of chr. 5 (q23.2q35.1) into distal 7q after FISH using chr. 5 and chr. 7 painting probes. The infant`s mother carries the balanced insertional rearrangement: 46,XX,dir ins(7,5)(q31.3;q23.2q35.1). This phenotype overlaps that of previously described duplications with the addition of giant cell hepatitis, coarsened facial features, gingival thickening, and flexion contractures, suggestive of a yet undiagnosed storage disorder.

Effects of different irrigation regimes and nitrogen levels on yield and ...

African Journals Online (AJOL)

Jane

2011-08-31

Aug 31, 2011 ... levels on yield and quality of melon (Cucumis melo L.) M. Simsek1* and N. ... fertilization have significant adverse effects on water resources ... usage of water to meet the needs of plants (Stewart and. Nielsen, 1990).

Rational Planning and Politicians' Preferences for Spending and Reform

DEFF Research Database (Denmark)

George, Bert; Deschmidt, Sebastian; Nielsen, Poul Aaes

2017-01-01

The rational planning cycle of formulating strategic goals and using performance information to assess goal implementation is assumed to assist decision-making by politicians. Empirical evidence supporting this assumption is scarce. Our study replicates Nielsen and Baekgaard's (2015) experiment...

L’exil de la « religion » chez Camus

Directory of Open Access Journals (Sweden)

Crina Zărnescu

2008-11-01

Full Text Available Cet ouvrage se propose de « restituer » à l’œuvre et au système de pensée de l’existentialiste Camus la dimension chrétienne qu’il a tant niée. Au-delà de son nihilisme acharné et de son attachement aux valeurs concrètes de cette humaine condition (« Mon royaume est de ce monde ! », selon Pindare on pressent une ouverture et une attente. Une ouverture vers les constituantes fondamentales de la pensée chrétienne. Une attente d’une résurrection profondément humaine investie d’un potentiel sacré.

A new species of the Genus Microbrotula (Teleostei: Bythitidae) from Cenderawasih Bay, New Guinea, Indonesia

DEFF Research Database (Denmark)

Schwarzhans, Werner; Nielsen, Jørgen

2012-01-01

Following the recent revision of Microbrotula (Schwarzhans Nielsen, 2011), an additional nine specimens of the viviparous genus Microbrotula (Teleostei: Bythitidae), all caught in the Cenderawasih Bay, Irian Jaya, New Guinea, Indonesia, were made available to us. These specimens represent a new...

Auhindu / Maria-Kristiina Soomre

Index Scriptorium Estoniae

Soomre, Maria-Kristiina, 1978-

2000-01-01

USA kunstikriitikute ühenduse 2000. a. preemiad 1999-2000 hooaja parimatele näitustele. Ameerika Arhitektide Instituudi (AIA) 2000. a. kuldmedal ameeriklasele Michael Gravesile. Rootsi Arhitektide Ühing andis Kasper Salini preemia Hendrik Jais-Nielsen & Mats White Arkitekter AB-le.

Paroodiafilmitööstuse hambad on nüriks kulunud / Laurence Boyce

Index Scriptorium Estoniae

Boyce, Laurence

2010-01-01

Paroodiafilmidest kui filmižanrist, kultusfilmideks tõusnud "Airplane!" (USA 1980), "Airplane II: The Sequel" (USA 1982), "Palja relvaga" ("The Naked Gun" I, II, III, USA 1988-1994), peaosades Leslie Nielsen. Tänapäeva paroodiafilmid on suunatud peamiselt teismelisele kinopublikule

Observing behaviour categorically

DEFF Research Database (Denmark)

Nielsen, Mogens; Cheng, Allan

1995-01-01

In an attempt to understand the relationships and differences between the extensive amount of research within the field of bisimulation equivalences, Joyal, Nielsen, and Winskel recently proposed an abstract category-theoretic definition of bisimulation. They identify spans of morphisms satisfyin...

The importance of values for brand purchase : A managerial contribution

NARCIS (Netherlands)

Voorn, Ronaldus Johannes Jan; van der Veen, Gerrita; van Rompay, Thomas Johannes Lucas; Hegner, Sabrina; Pruyn, Adriaan T.H.

2017-01-01

Consumers currently place increasing importance on the values that companies represent. Modern values such as transparency, benevolence to society, sustainability and fairness are becoming more relevant, as noted by many major consulting firms among which Nielsen (2013), the World Federation of

What is complementarity?: Niels Bohr and the architecture of quantum theory

Science.gov (United States)

Plotnitsky, Arkady

2014-12-01

This article explores Bohr’s argument, advanced under the heading of ‘complementarity,’ concerning quantum phenomena and quantum mechanics, and its physical and philosophical implications. In Bohr, the term complementarity designates both a particular concept and an overall interpretation of quantum phenomena and quantum mechanics, in part grounded in this concept. While the argument of this article is primarily philosophical, it will also address, historically, the development and transformations of Bohr’s thinking, under the impact of the development of quantum theory and Bohr’s confrontation with Einstein, especially their exchange concerning the EPR experiment, proposed by Einstein, Podolsky and Rosen in 1935. Bohr’s interpretation was progressively characterized by a more radical epistemology, in its ultimate form, which was developed in the 1930s and with which I shall be especially concerned here, defined by his new concepts of phenomenon and atomicity. According to this epistemology, quantum objects are seen as indescribable and possibly even as inconceivable, and as manifesting their existence only in the effects of their interactions with measuring instruments upon those instruments, effects that define phenomena in Bohr’s sense. The absence of causality is an automatic consequence of this epistemology. I shall also consider how probability and statistics work under these epistemological conditions.

What is complementarity?: Niels Bohr and the architecture of quantum theory

International Nuclear Information System (INIS)

Plotnitsky, Arkady

2014-01-01

This article explores Bohr’s argument, advanced under the heading of ‘complementarity,’ concerning quantum phenomena and quantum mechanics, and its physical and philosophical implications. In Bohr, the term complementarity designates both a particular concept and an overall interpretation of quantum phenomena and quantum mechanics, in part grounded in this concept. While the argument of this article is primarily philosophical, it will also address, historically, the development and transformations of Bohr’s thinking, under the impact of the development of quantum theory and Bohr’s confrontation with Einstein, especially their exchange concerning the EPR experiment, proposed by Einstein, Podolsky and Rosen in 1935. Bohr’s interpretation was progressively characterized by a more radical epistemology, in its ultimate form, which was developed in the 1930s and with which I shall be especially concerned here, defined by his new concepts of phenomenon and atomicity. According to this epistemology, quantum objects are seen as indescribable and possibly even as inconceivable, and as manifesting their existence only in the effects of their interactions with measuring instruments upon those instruments, effects that define phenomena in Bohr’s sense. The absence of causality is an automatic consequence of this epistemology. I shall also consider how probability and statistics work under these epistemological conditions. (paper)

Niels Bohr, Max Delbruck and the paradox of light and life

International Nuclear Information System (INIS)

Scott, G.P.

1983-01-01

This paper features a concise, interdisciplinary history of philosophical issues which were the basis of Delbruck's scientific career. The paradox in living behavior of freedom-to-adapt versus deterministic atomism required complete reassessment with the advent of quantum mechanics. Apparent contradictions implied, for example, by the wave-particle model led Bohr to a belief in the ''complementarity of nature,'' which in 1932 he applied to biology. His claim was that purely physicochemical explanations of purposeful life functions such as ''self-generation and freedom of the will'' were impossible since mutually exclusive situations were involved. Thus Delbruck was challenged to spend his career investigating these vital functions. Beginning with ''fruit-fly photochemistry'' he established the molecular nature of the gene and then collected a world-wide group for a research effort on phage virus, which culminated in discovery of the DNA double helix by Watson and Crick. The second phase of his career featured a study of the total stimulus-response system of the fungus Phycomuces, which is still in progress. The extreme light-sensitivity observed, approaching one-quantum response, has raised the question of the survival value of amplified quantum noise. In critical comments to the author, Delbruck opposed the ''Compton-switch model'' for mind-body interaction; and in his lecture, ''Mind from Matter?'' he revealed his ''a priori concept of truth,'' which embraces a neutral monism and rejects the language of emergent evolution. His views are contrasted with those expressed in Popper's First Darwin Lecture

Euroopa jääb USAst aina enam maha / Niels Thygesen

Index Scriptorium Estoniae

Thygesen, Niels

2006-01-01

Ilmunud ka: Molodjozh Estonii 28. veebr. lk. 12-13, Delovõje Vedomosti 8. märts lk. 10. Sissetulekute tase eurotsoonis tervikuna ning majandusnäitajate poolest tähtsamates riikides Prantsusmaal, Saksamaal ja Itaalias on ligikaudu 30% madalam kui Ameerika Ühendriikides. Oht, et vahe veelgi suureneb ning selle põhjustest

Great Physicists - The Life and Times of Leading Physicists from Galileo to Hawking

Science.gov (United States)

Cropper, William H.

2004-09-01

Here is a lively history of modern physics, as seen through the lives of thirty men and women from the pantheon of physics. William H. Cropper vividly portrays the life and accomplishments of such giants as Galileo and Isaac Newton, Marie Curie and Ernest Rutherford, Albert Einstein and Niels Bohr, right up to contemporary figures such as Richard Feynman, Murray Gell-Mann, and Stephen Hawking. We meet scientists--all geniuses--who could be gregarious, aloof, unpretentious, friendly, dogged, imperious, generous to colleagues or contentious rivals. As Cropper captures their personalities, he also offers vivid portraits of their great moments of discovery, their bitter feuds, their relations with family and friends, their religious beliefs and education. In addition, Cropper has grouped these biographies by discipline--mechanics, thermodynamics, particle physics, and others--each section beginning with a historical overview. Thus in the section on quantum mechanics, readers can see how the work of Max Planck influenced Niels Bohr, and how Bohr in turn influenced Werner Heisenberg. Our understanding of the physical world has increased dramatically in the last four centuries. With Great Physicists , readers can retrace the footsteps of the men and women who led the way.

The prokaryote-eukaryote dichotomy: meanings and mythology.

Science.gov (United States)

Sapp, Jan

2005-06-01

Drawing on documents both published and archival, this paper explains how the prokaryote-eukaryote dichotomy of the 1960s was constructed, the purposes it served, and what it implied in terms of classification and phylogeny. In doing so, I first show how the concept was attributed to Edouard Chatton and the context in which he introduced the terms. Following, I examine the context in which the terms were reintroduced into biology in 1962 by Roger Stanier and C. B. van Niel. I study the discourse over the subsequent decade to understand how the organizational dichotomy took on the form of a natural classification as the kingdom Monera or superkingdom Procaryotae. Stanier and van Niel admitted that, in regard to constructing a natural classification of bacteria, structural characteristics were no more useful than physiological properties. They repeatedly denied that bacterial phylogenetics was possible. I thus examine the great historical irony that the "prokaryote," in both its organizational and phylogenetic senses, was defined (negatively) on the basis of structure. Finally, we see how phylogenetic research based on 16S rRNA led by Carl Woese and his collaborators confronted the prokaryote concept while moving microbiology to the center of evolutionary biology.

La construction relative dans Chrétien de Troyes

NARCIS (Netherlands)

Fabriek, Pieter

1924-01-01

1. On peut reléguer à la syntaxe figée la construction relative avec la pronom neutre que dans feire que sages, que je sache, (au) plus tost qu'il pot, je n'ai que feire; avec le pronom adjectif qui dans il n'i a celui (nul, un seul) qui, com cil qui; en outre qui vive dans riens (om) qui vive

Details of Nazis' A-Bomb program surface

CERN Multimedia

Glanz, J

2002-01-01

Werner Heisenberg, leader of the Nazi atomic bomb program, revealed the projects existence to Niels Bohr in a meeting in Copenhagen in 1941. But contrary to several historical accounts of the meeting, Heisenberg never expressed moral qualms about building a bomb for Hitler nor hinted that he might be willing to sabotage the project, according to secret documents cited in a London newspaper yesterday (2 pages).

Wave-Particle Dualism in Action

Science.gov (United States)

Schleich, Wolfgang P.

The wave-particle dualism, that is the wave nature of particles and the particle nature of light together with the uncertainty relation of Werner Heisenberg and the principle of complementarity formulated by Niels Bohr represent pillars of quantum theory. We provide an introduction into these fascinating yet strange aspects of the microscopic world and summarize key experiments confirming these concepts so alien to our daily life.

From the Gut of an Insect to the Global Climate: Denitrification and Nitrous Oxide Production inside Lake Chironomidae

DEFF Research Database (Denmark)

Stief, Peter; Nielsen, Lars Peter; Revsbech, Niels Peter

2006-01-01

FROM THE GUT OF AN INSECT TO THE GLOBAL CLIMATE: DENITRIFICATION AND NITROUS OXIDE PRODUCTION INSIDE LAKE CHIRONOMIDAE P. Stief, L.P. Nielsen, N.P. Revsbech, A. Schramm Department of Biological Sciences, Microbiology, University of Aarhus, Denmark Denitrifying bacteria in lake sediments drive...

Bio-Lebensmittel in der öffentlichen Gemeinschaftsverpflegung - Eine Studie auf dem dänischen Markt und in den entsprechenden Aufsichtsbehörden

DEFF Research Database (Denmark)

Nielsen, Thorkild; Kristensen, Niels Heine; Mikkelsen, Bent Egberg

2003-01-01

Nielsen T, Kristensen NH, Mikkelsen BE (2003): Bio-Lebensmittel in der öffentlichen Gemeinschaftsverpflegung - Eine Studie auf dem dänischen Markt und in den entsprechenden Aufsichtsbehörden. Proceedings from "Ökologischer Landbau der Zukunft - Die 7. Wissenschaftstagung zum Ökologischen Landbau...

The Danish hearing in noise test

DEFF Research Database (Denmark)

Nielsen, Jens Bo; Dau, Torsten

2010-01-01

Objective : A Danish version of the hearing in noise test (HINT) has been developed and evaluated in normal-hearing (NH) and hearing-impaired (HI) listeners. The speech material originated from Nielsen & Dau (2009) where a sentence-based intelligibility equalization method was presented. Design...

Predicted Thermal Responses of Military Working Dog (MWD) to Chemical, Biological, Radiological, Nuclear (CBRN) Protective Kennel Enclosure

Science.gov (United States)

2011-08-01

used ( Hemingway , 1961; Crawford, 1962; Schmidt-Nielsen, 1970; Meyer, 1989). The panting frequency depends on individual MWD anthropometrics...of temperature regulation in the unanesthetized dog. J. Appl. Physiol. 213(2):547-556. 12. Hemingway , A. 1961. The panting response of normal un