NIC symposium 2012. 25 years HLRZ/NIC. Proceedings
International Nuclear Information System (INIS)
Binder, Kurt
2012-01-01
Since 25 years the John von Neumann Institute for Computing (NIC), the former ''Hoechstleistungsrechenzentrum'', plays a pioneering role in supporting research in computational science at the fore-front, by giving large grants of computer time to carefully selected research projects. The scope of these projects ranges from fundamental aspects of physics, such as the physics of elementary particles and nuclear physics, astrophysics, statistical physics and physics of condensed matter, computational chemistry and life sciences, to more applied areas of research, such as the modelling of processes in the atmosphere, materials science, fluid dynamics applications in engineering, etc. Use of the supercomputer resources that the Juelich Supercomputing Centre (JSC) provides for these research projects. The present book, which appears in the framework of the biannual NIC Symposia series, continues a tradition started 10 years ago, to present selected highlights of this research to a broader audience. Due to space restrictions, only a small number of the research projects that are carried out at the NIC can be presented in this way. Projects that stand out as particularly excellent are nominated as ''John von Neumann Excellence Project'' by the review board. In 2010 this award was given to A. Muramatsu (Stuttgart) for his project on ''Quantum Monte Carlo studies of strongly correlated systems''. In 2011, two such awards were given to C. Hoelbling (Wuppertal) for his project ''Computing B K with 2+1 flavours at the physical mass point'', and another one to W. Paul (Halle) for ''Long range correlations at polymer-solid interfaces''. The procedures adopted by the NIC to identify the scientifically best projects for the allocation of computer time are of the same character as those used by organisations founded more recently, such as (in Germany) the Gauss Centre for Supercomputing (GCS), an alliance of the three German national supercomputing centres in Juelich, Garching and
NIC symposium 2012. 25 years HLRZ/NIC. Proceedings
Energy Technology Data Exchange (ETDEWEB)
Binder, Kurt [Mainz Univ. (Germany). Inst. fuer Physik; Muenster, Gernot [Muenster Univ. (Germany). Inst. fuer Theoretische Physik 1; Kremer, Manfred [Forschungszentrum Juelich GmbH (DE). Juelich Supercomputing Centre (JSC)
2012-08-07
Since 25 years the John von Neumann Institute for Computing (NIC), the former ''Hoechstleistungsrechenzentrum'', plays a pioneering role in supporting research in computational science at the fore-front, by giving large grants of computer time to carefully selected research projects. The scope of these projects ranges from fundamental aspects of physics, such as the physics of elementary particles and nuclear physics, astrophysics, statistical physics and physics of condensed matter, computational chemistry and life sciences, to more applied areas of research, such as the modelling of processes in the atmosphere, materials science, fluid dynamics applications in engineering, etc. Use of the supercomputer resources that the Juelich Supercomputing Centre (JSC) provides for these research projects. The present book, which appears in the framework of the biannual NIC Symposia series, continues a tradition started 10 years ago, to present selected highlights of this research to a broader audience. Due to space restrictions, only a small number of the research projects that are carried out at the NIC can be presented in this way. Projects that stand out as particularly excellent are nominated as ''John von Neumann Excellence Project'' by the review board. In 2010 this award was given to A. Muramatsu (Stuttgart) for his project on ''Quantum Monte Carlo studies of strongly correlated systems''. In 2011, two such awards were given to C. Hoelbling (Wuppertal) for his project ''Computing B{sub K} with 2+1 flavours at the physical mass point'', and another one to W. Paul (Halle) for ''Long range correlations at polymer-solid interfaces''. The procedures adopted by the NIC to identify the scientifically best projects for the allocation of computer time are of the same character as those used by organisations founded more recently, such as (in Germany) the Gauss Centre for Supercomputing (GCS), an alliance of the three German national supercomputing centres in Juelich, Garching
NIC symposium 2012. 25 years HLRZ/NIC. Proceedings
Energy Technology Data Exchange (ETDEWEB)
Binder, Kurt [Mainz Univ. (Germany). Inst. fuer Physik; Muenster, Gernot [Muenster Univ. (Germany). Inst. fuer Theoretische Physik 1; Kremer, Manfred (eds.) [Forschungszentrum Juelich GmbH (DE). Juelich Supercomputing Centre (JSC)
2012-08-07
Since 25 years the John von Neumann Institute for Computing (NIC), the former ''Hoechstleistungsrechenzentrum'', plays a pioneering role in supporting research in computational science at the fore-front, by giving large grants of computer time to carefully selected research projects. The scope of these projects ranges from fundamental aspects of physics, such as the physics of elementary particles and nuclear physics, astrophysics, statistical physics and physics of condensed matter, computational chemistry and life sciences, to more applied areas of research, such as the modelling of processes in the atmosphere, materials science, fluid dynamics applications in engineering, etc. Use of the supercomputer resources that the Juelich Supercomputing Centre (JSC) provides for these research projects. The present book, which appears in the framework of the biannual NIC Symposia series, continues a tradition started 10 years ago, to present selected highlights of this research to a broader audience. Due to space restrictions, only a small number of the research projects that are carried out at the NIC can be presented in this way. Projects that stand out as particularly excellent are nominated as ''John von Neumann Excellence Project'' by the review board. In 2010 this award was given to A. Muramatsu (Stuttgart) for his project on ''Quantum Monte Carlo studies of strongly correlated systems''. In 2011, two such awards were given to C. Hoelbling (Wuppertal) for his project ''Computing B{sub K} with 2+1 flavours at the physical mass point'', and another one to W. Paul (Halle) for ''Long range correlations at polymer-solid interfaces''. The procedures adopted by the NIC to identify the scientifically best projects for the allocation of computer time are of the same character as those used by organisations founded more recently, such as (in Germany) the Gauss Centre for
NIC symposium 2010. Proceedings
Energy Technology Data Exchange (ETDEWEB)
Muenster, Gernot [Muenster Univ. (Germany). Inst. fuer Theoretische Physik 1; Wolf, Dietrich [Duisburg-Essen Univ., Duisburg (Germany). Fakultaet fuer Physik; Kremer, Manfred (eds.) [Forschungszentrum Juelich GmbH (DE). Juelich Supercomputing Centre (JSC)
2012-06-21
The fifth NIC-Symposium gave an overview of the activities of the John von Neumann Institute for Computing (NIC) and of the results obtained in the last two years by research groups supported by the NIC. The large recent progress in supercomputing is highlighted by the fact that the newly installed Blue Gene/P system in Juelich - with a peak performance of 1 Petaflop/s - currently ranks number four in the TOP500 list. This development opens new dimensions in simulation science for researchers in Germany and Europe. NIC - a joint foundation of Forschungszentrum Juelich, Deutsches Elektronen-Synchrotron (DESY) and Gesellschaft fuer Schwerionenforschung (GSI) - supports with its members' supercomputer facilities about 130 research groups at universities and national labs working on computer simulations in various fields of science. Fifteen invited lectures covered selected topics in the following fields: Astrophysics Biophysics Chemistry Elementary Particle Physics Condensed Matter Materials Science Soft Matter Science Environmental Research Hydrodynamics and turbulence Plasma Physics Computer Science The talks are intended to inform a broad audience of scientists and the interested public about the research activities at NIC. The proceedings of the symposium cover projects that have been supported by the IBM supercomputers JUMP and IBM Blue Gene/P in Juelich and the APE topical computer at DESY-Zeuthen in an even wider range than the lectures.
NIC symposium 2010. Proceedings
Energy Technology Data Exchange (ETDEWEB)
Muenster, Gernot [Muenster Univ. (Germany). Inst. fuer Theoretische Physik 1; Wolf, Dietrich [Duisburg-Essen Univ., Duisburg (Germany). Fakultaet fuer Physik; Kremer, Manfred [Forschungszentrum Juelich GmbH (DE). Juelich Supercomputing Centre (JSC)
2012-06-21
The fifth NIC-Symposium gave an overview of the activities of the John von Neumann Institute for Computing (NIC) and of the results obtained in the last two years by research groups supported by the NIC. The large recent progress in supercomputing is highlighted by the fact that the newly installed Blue Gene/P system in Juelich - with a peak performance of 1 Petaflop/s - currently ranks number four in the TOP500 list. This development opens new dimensions in simulation science for researchers in Germany and Europe. NIC - a joint foundation of Forschungszentrum Juelich, Deutsches Elektronen-Synchrotron (DESY) and Gesellschaft fuer Schwerionenforschung (GSI) - supports with its members' supercomputer facilities about 130 research groups at universities and national labs working on computer simulations in various fields of science. Fifteen invited lectures covered selected topics in the following fields: Astrophysics Biophysics Chemistry Elementary Particle Physics Condensed Matter Materials Science Soft Matter Science Environmental Research Hydrodynamics and turbulence Plasma Physics Computer Science The talks are intended to inform a broad audience of scientists and the interested public about the research activities at NIC. The proceedings of the symposium cover projects that have been supported by the IBM supercomputers JUMP and IBM Blue Gene/P in Juelich and the APE topical computer at DESY-Zeuthen in an even wider range than the lectures.
NIC symposium 2010. Proceedings
International Nuclear Information System (INIS)
Muenster, Gernot
2012-01-01
The fifth NIC-Symposium gave an overview of the activities of the John von Neumann Institute for Computing (NIC) and of the results obtained in the last two years by research groups supported by the NIC. The large recent progress in supercomputing is highlighted by the fact that the newly installed Blue Gene/P system in Juelich - with a peak performance of 1 Petaflop/s - currently ranks number four in the TOP500 list. This development opens new dimensions in simulation science for researchers in Germany and Europe. NIC - a joint foundation of Forschungszentrum Juelich, Deutsches Elektronen-Synchrotron (DESY) and Gesellschaft fuer Schwerionenforschung (GSI) - supports with its members' supercomputer facilities about 130 research groups at universities and national labs working on computer simulations in various fields of science. Fifteen invited lectures covered selected topics in the following fields: Astrophysics Biophysics Chemistry Elementary Particle Physics Condensed Matter Materials Science Soft Matter Science Environmental Research Hydrodynamics and turbulence Plasma Physics Computer Science The talks are intended to inform a broad audience of scientists and the interested public about the research activities at NIC. The proceedings of the symposium cover projects that have been supported by the IBM supercomputers JUMP and IBM Blue Gene/P in Juelich and the APE topical computer at DESY-Zeuthen in an even wider range than the lectures.
Passive Classification of Wireless NICs during Rate Switching
Directory of Open Access Journals (Sweden)
Cherita L. Corbett
2008-02-01
Full Text Available Computer networks have become increasingly ubiquitous. However, with the increase in networked applications, there has also been an increase in difficulty to manage and secure these networks. The proliferation of 802.11 wireless networks has heightened this problem by extending networks beyond physical boundaries. We propose the use of spectral analysis to identify the type of wireless network interface card (NIC. This mechanism can be applied to support the detection of unauthorized systems that use NICs which are different from that of a legitimate system. We focus on rate switching, a vaguely specified mechanism required by the 802.11 standard that is implemented in the hardware and software of the wireless NIC. We show that the implementation of this function influences the transmission patterns of a wireless stream, which are observable through traffic analysis. Our mechanism for NIC identification uses signal processing to analyze the periodicity embedded in the wireless traffic caused by rate switching. A stable spectral profile is created from the periodic components of the traffic and used for the identity of the wireless NIC. We show that we can distinguish between NICs manufactured by different vendors and NICs manufactured by the same vendor using their spectral profiles.
Passive Classification of Wireless NICs during Rate Switching
Directory of Open Access Journals (Sweden)
Beyah RaheemA
2008-01-01
Full Text Available Abstract Computer networks have become increasingly ubiquitous. However, with the increase in networked applications, there has also been an increase in difficulty to manage and secure these networks. The proliferation of 802.11 wireless networks has heightened this problem by extending networks beyond physical boundaries. We propose the use of spectral analysis to identify the type of wireless network interface card (NIC. This mechanism can be applied to support the detection of unauthorized systems that use NICs which are different from that of a legitimate system. We focus on rate switching, a vaguely specified mechanism required by the 802.11 standard that is implemented in the hardware and software of the wireless NIC. We show that the implementation of this function influences the transmission patterns of a wireless stream, which are observable through traffic analysis. Our mechanism for NIC identification uses signal processing to analyze the periodicity embedded in the wireless traffic caused by rate switching. A stable spectral profile is created from the periodic components of the traffic and used for the identity of the wireless NIC. We show that we can distinguish between NICs manufactured by different vendors and NICs manufactured by the same vendor using their spectral profiles.
Department of Housing and Urban Development — The NSP Investment Cluster (NIC) study analyzes how markets treated with a concentration of NSP investment have changed over time compared to similar markets that...
Plant operation data collection and database management using NIC system
International Nuclear Information System (INIS)
Inase, S.
1990-01-01
The Nuclear Information Center (NIC), a division of the Central Research Institute of Electric Power Industry, collects nuclear power plant operation and maintenance information both in Japan and abroad and transmits the information to all domestic utilities so that it can be effectively utilized for safe plant operation and reliability enhancement. The collected information is entered into the database system after being key-worded by NIC. The database system, Nuclear Information database/Communication System (NICS), has been developed by NIC for storage and management of collected information. Objectives of keywords are retrieval and classification by the keyword categories
Investigating Alfvénic wave propagation in coronal open-field regions
Morton, R. J.; Tomczyk, S.; Pinto, R.
2015-01-01
The physical mechanisms behind accelerating solar and stellar winds are a long-standing astrophysical mystery, although recent breakthroughs have come from models invoking the turbulent dissipation of Alfvén waves. The existence of Alfvén waves far from the Sun has been known since the 1970s, and recently the presence of ubiquitous Alfvénic waves throughout the solar atmosphere has been confirmed. However, the presence of atmospheric Alfvénic waves does not, alone, provide sufficient support for wave-based models; the existence of counter-propagating Alfvénic waves is crucial for the development of turbulence. Here, we demonstrate that counter-propagating Alfvénic waves exist in open coronal magnetic fields and reveal key observational insights into the details of their generation, reflection in the upper atmosphere and outward propagation into the solar wind. The results enhance our knowledge of Alfvénic wave propagation in the solar atmosphere, providing support and constraints for some of the recent Alfvén wave turbulence models. PMID:26213234
CacheCard : Caching static and dynamic content on the NIC
Bos, Herbert; Huang, Kaiming
2009-01-01
CacheCard is a NIC-based cache for static and dynamic web content in a way that allows for implementation on simple devices like NICs. It requires neither understanding of the way dynamic data is generated, nor execution of scripts on the cache. By monitoring file system activity and potential
Can Hall effect trigger Kelvin-Helmholtz instability in sub-Alfvénic flows?
Pandey, B. P.
2018-05-01
In the Hall magnetohydrodynamics, the onset condition of the Kelvin-Helmholtz instability is solely determined by the Hall effect and is independent of the nature of shear flows. In addition, the physical mechanism behind the super- and sub-Alfvénic flows becoming unstable is quite different: the high-frequency right circularly polarized whistler becomes unstable in the super-Alfvénic flows whereas low-frequency, left circularly polarized ion-cyclotron wave becomes unstable in the presence of sub-Alfvénic shear flows. The growth rate of the Kelvin-Helmholtz instability in the super-Alfvénic case is higher than the corresponding ideal magnetohydrodynamic rate. In the sub-Alfvénic case, the Hall effect opens up a new, hitherto inaccessible (to the magnetohydrodynamics) channel through which the partially or fully ionized fluid can become Kelvin-Helmholtz unstable. The instability growth rate in this case is smaller than the super-Alfvénic case owing to the smaller free shear energy content of the flow. When the Hall term is somewhat smaller than the advection term in the induction equation, the Hall effect is also responsible for the appearance of a new overstable mode whose growth rate is smaller than the purely growing Kelvin-Helmholtz mode. On the other hand, when the Hall diffusion dominates the advection term, the growth rate of the instability depends only on the Alfvén -Mach number and is independent of the Hall diffusion coefficient. Further, the growth rate in this case linearly increases with the Alfvén frequency with smaller slope for sub-Alfvénic flows.
Extracción de cobre desde soluciones clorhídricas con LIX 860N-IC y LIX 84-IC
Directory of Open Access Journals (Sweden)
Navarro, Carlos María
2001-08-01
Full Text Available In this work, the extraction of copper from chloride solutions with two hydroxyoximes: 5- nonylsalicylaldoxime (LIX 860N-IC and 2-hydroxy-5-nonylacetophenona oxime (LIX 84-IC is discussed. The results showed that an increase in the acidity and an increase in the total concentration of chloride ions in the aqueous phase decreased significantly the extraction of copper as well as the extraction of iron for both extractants. This effect of the chloride ions can be explained by the formation of a series of chloro complexes of Cu(II and Fe(III in the aqueous phase. The effect of initial pH and total chloride concentration on the extraction of chloride by the organic phase suggests that LIX 860N-IC, and to a lesser extent LIX 84-IC, extract small amounts of the cationic complex, CuCl+. An increase in the concentration of chloride ions also produced a small decrease in the rate of copper extraction with both hydroxyoximes.
En este trabajo se discute el estudio de la extracción de cobre desde soluciones clorhídricas con dos hidroxioximas: 5-nonilsalicilaldoxima (LIX 860N-IC, y 2-hidroxi-5 nonilacetofenona oxima (LIX 84-IC. Los resultados indicaron que al aumentar la acidez o aumentar la concentración de cloruro en la fase acuosa se produce una significativa disminución en la extracción de cobre y hierro con ambas hidroxioximas. Este efecto del ion cloruro se explica por la formación de varios clorocomplejos de Cu(II y Fe(III en la solución acuosa. El efecto del pH y la concentración total de cloruro en la extracción de cloruro sugiere que el LIX 860N-IC, y en menor grado el LIX 84-IC extraen pequeñas cantidades del catión monovalente, CuCl+. Se determinó también que un aumento en la concentración de cloruro en la solución acuosa produce una leve disminución en la velocidad de extracción del cobre con ambas hidroxioximas.
Ion, Bogdan; Kazim, Erum; Gauld, James
2014-01-01
Nicotinamidase (Nic) is a key zinc-dependent enzyme in NAD metabolism that catalyzes the hydrolysis of nicotinamide to give nicotinic acid. A multi-scale computational approach has been used to investigate the catalytic mechanism, substrate binding and roles of active site residues of Nic from Streptococcus pneumoniae (SpNic). In particular, density functional theory (DFT), molecular dynamics (MD) and ONIOM quantum mechanics/molecular mechanics (QM/MM) methods have been employed. The o...
All-electron ab initio investigations of the electronic states of the NiC molecule
DEFF Research Database (Denmark)
Shim, Irene; Gingerich, Karl. A.
1999-01-01
The low-lying electronic states of NiC are investigated by all-electron ab initio multi-configuration self-consistent-field (CASSCF) calculations including relativistic corrections. The electronic structure of NiC is interpreted as perturbed antiferromagnetic couplings of the localized angular...
On the distribution of energy versus Alfvénic correlation for polar wind fluctuations
Directory of Open Access Journals (Sweden)
B. Bavassano
2006-11-01
Full Text Available Previous analyses have shown that polar wind fluctuations at MHD scales appear as a mixture of Alfvénic fluctuations and variations with an energy imbalance in favour of the magnetic term. In the present study, by separately examining the behaviour of kinetic and magnetic energies versus the Alfvénic correlation level, we unambiguously confirm that the second population is essentially related to a large increase of the magnetic energy with respect to that of the Alfvénic population. The relevant new result is that this magnetic population, though of secondary importance in terms of occurrence frequency, corresponds to a primary peak in the distribution of total energy. The fact that this holds in the case of polar wind, which is the least structured type of interplanetary plasma flow and with the slowest evolving Alfvénic turbulence, strongly suggests the general conclusion that magnetic structures cannot be neglected when modeling fluctuations for all kinds of wind regime.
A Multi-Scale Computational Study on the Mechanism of Streptococcus pneumoniae Nicotinamidase (SpNic
Directory of Open Access Journals (Sweden)
Bogdan F. Ion
2014-09-01
Full Text Available Nicotinamidase (Nic is a key zinc-dependent enzyme in NAD metabolism that catalyzes the hydrolysis of nicotinamide to give nicotinic acid. A multi-scale computational approach has been used to investigate the catalytic mechanism, substrate binding and roles of active site residues of Nic from Streptococcus pneumoniae (SpNic. In particular, density functional theory (DFT, molecular dynamics (MD and ONIOM quantum mechanics/molecular mechanics (QM/MM methods have been employed. The overall mechanism occurs in two stages: (i formation of a thioester enzyme-intermediate (IC2 and (ii hydrolysis of the thioester bond to give the products. The polar protein environment has a significant effect in stabilizing reaction intermediates and in particular transition states. As a result, both stages effectively occur in one step with Stage 1, formation of IC2, being rate limiting barrier with a cost of 53.5 kJ•mol−1 with respect to the reactant complex, RC. The effects of dispersion interactions on the overall mechanism were also considered but were generally calculated to have less significant effects with the overall mechanism being unchanged. In addition, the active site lysyl (Lys103 is concluded to likely play a role in stabilizing the thiolate of Cys136 during the reaction.
Ion, Bogdan F; Kazim, Erum; Gauld, James W
2014-09-29
Nicotinamidase (Nic) is a key zinc-dependent enzyme in NAD metabolism that catalyzes the hydrolysis of nicotinamide to give nicotinic acid. A multi-scale computational approach has been used to investigate the catalytic mechanism, substrate binding and roles of active site residues of Nic from Streptococcus pneumoniae (SpNic). In particular, density functional theory (DFT), molecular dynamics (MD) and ONIOM quantum mechanics/molecular mechanics (QM/MM) methods have been employed. The overall mechanism occurs in two stages: (i) formation of a thioester enzyme-intermediate (IC2) and (ii) hydrolysis of the thioester bond to give the products. The polar protein environment has a significant effect in stabilizing reaction intermediates and in particular transition states. As a result, both stages effectively occur in one step with Stage 1, formation of IC2, being rate limiting barrier with a cost of 53.5 kJ·mol-1 with respect to the reactant complex, RC. The effects of dispersion interactions on the overall mechanism were also considered but were generally calculated to have less significant effects with the overall mechanism being unchanged. In addition, the active site lysyl (Lys103) is concluded to likely play a role in stabilizing the thiolate of Cys136 during the reaction.
Directory of Open Access Journals (Sweden)
Anamaria Alves Napoleão
2006-08-01
Full Text Available Este estudo objetivou revisar o conhecimento produzido sobre a Classificação das Intervenções de Enfermagem (NIC, disponível na literatura científica, no período de janeiro de 1980 a janeiro de 2004. A NIC é uma taxonomia que inclui atividades realizadas pelos enfermeiros. Foram consultadas as bases de dados Lilacs, Medline e realizado levantamento manual no Centro de Classificação em Enfermagem da Universidade de Iowa - College of Nursing, além da inclusão de uma tese obtida em acervo particular. Os trabalhos analisados referiam-se à aplicação da NIC na prática, comparação de linguagens em sistemas informatizados e uso da NIC nesses sistemas, apresentação, construção e desenvolvimento da taxonomia, validação, entre outros. Concluiu-se que várias são as possibilidades relativas à produção do conhecimento sobre a NIC no Brasil e que são necessários estudos sobre essa taxonomia que levantem questionamentos, gerem novos conhecimentos e que contribuam em mais esse aspecto relativo ao avanço da enfermagem brasileira.El objetivo de este estudio fue revisar el conocimiento producido sobre la Clasificación de Intervenciones de Enfermería (NIC/CIE disponible en la literatura científica entre enero de 1980 y enero de 2004. La NIC/CIE es una taxonomía que incluye actividades realizadas por los enfermeros. Fueron consultadas las bases de datos Lilacs, Medline y realizada una búsqueda manual en el Centro de Clasificación de Enfermería de la Universidad de Iowa - Escuela de Enfermería, y también fue incluida una tesis de un acervo particular. Los trabajos analizados estaban relacionados a la aplicación de la NIC/CIE en la práctica, comparación de lenguajes en sistemas informatizados, uso de la NIC/CIE en esos sistemas, presentación, construcción, desarrollo y validación de la taxonomía, entre otros. Los autores concluyeron que son varias las posibilidades relativas a la producción de conocimiento sobre la NIC
Alfvénic fluctuations in "newborn"' polar solar wind
Directory of Open Access Journals (Sweden)
B. Bavassano
2005-06-01
Full Text Available The 3-D structure of the solar wind is strongly dependent upon the Sun's activity cycle. At low solar activity a bimodal structure is dominant, with a fast and uniform flow at the high latitudes, and slow and variable flows at low latitudes. Around solar maximum, in sharp contrast, variable flows are observed at all latitudes. This last kind of pattern, however, is a relatively short-lived feature, and quite soon after solar maximum the polar wind tends to regain its role. The plasma parameter distributions for these newborn polar flows appear very similar to those typically observed in polar wind at low solar activity. The point addressed here is about polar wind fluctuations. As is well known, the low-solar-activity polar wind is characterized by a strong flow of Alfvénic fluctuations. Does this hold for the new polar flows too? An answer to this question is given here through a comparative statistical analysis on parameters such as total energy, cross helicity, and residual energy, that are of general use to describe the Alfvénic character of fluctuations. Our results indicate that the main features of the Alfvénic fluctuations observed in low-solar-activity polar wind have been quickly recovered in the new polar flows developed shortly after solar maximum. Keywords. Interplanetary physics (MHD waves and turbulence; Sources of the solar wind – Space plasma physics (Turbulence
El deseo del bien o del bien aparente en ética a nicómaco iii.4
Gualdrón, Miguel
2010-01-01
La noción de “fin”, y el deseo de este fin, son cruciales dentro de la teoría aristotélica de la acción, en tanto sustentan no sólo la posibilidad misma de actuar, sino también la evaluación ética de la acción. El deseo de un fin en la acción es identificado en varios lugares de la obra de Aristóteles con el deseo del bien. En el capítulo 4 del libro III de la Ética a Nicómaco, Aristóteles plantea un problema en lo que concierne a este deseo, según el cual el deseo puede ser del bien en sí o ...
Radial Variations of Outward and Inward Alfvénic Fluctuations Based on Ulysses Observations
Yang, L.; Lee, L. C.; Li, J. P.; Luo, Q. Y.; Kuo, C. L.; Shi, J. K.; Wu, D. J.
2017-12-01
Ulysses magnetic and plasma data are used to study hourly scale Alfvénic fluctuations in the solar polar wind. The calculated energy ratio {R}{vA}2(cal) of inward to outward Alfvén waves is obtained from the observed Walén slope through an analytical expression, and the observed {R}{vA}2(obs) is based on a direct decomposition of original Alfvénic fluctuations into outward- and inward-propagating Alfvén waves. The radial variation of {R}{vA}2(cal) shows a monotonically increasing trend with heliocentric distance r, implying the increasing local generation or contribution of inward Alfvén waves. The contribution is also shown by the radial increase in the occurrence of dominant inward fluctuations. We further pointed out a higher occurrence (˜ 83 % of a day in average) of dominant outward Alfvénic fluctuations in the solar wind than previously estimated. Since {R}{vA}2(cal) is more accurate than {R}{vA}2(obs) in the measurement of the energy ratio for dominant outward fluctuations, the values of {R}{vA}2(cal) in our results are likely more realistic in the solar wind than those previously estimated as well as {R}{vA}2(obs) in our results. The duration ratio R T of dominant inward to all Alfvénic fluctuations increases monotonically with r, and is about two or more times that from Voyager 2 observations at r≥slant 4 {au}. These results reveal new qualitative and quantitative features of Alfvénic fluctuations therein compared with previous studies and put constraints on modeling the variation of solar wind fluctuations.
SUNWARD-PROPAGATING ALFVÉNIC FLUCTUATIONS OBSERVED IN THE HELIOSPHERE
Energy Technology Data Exchange (ETDEWEB)
Li, Hui; Wang, Chi [State Key Laboratory of Space Weather, National Space Science Center, CAS, Beijing, 100190 (China); Belcher, John W.; Richardson, John D. [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA (United States); He, Jiansen, E-mail: hli@spaceweather.ac.cn [School of Earth and Space Sciences, Peking University, Beijing, 100871 (China)
2016-06-10
The mixture/interaction of anti-sunward-propagating Alfvénic fluctuations (AFs) and sunward-propagating Alfvénic fluctuations (SAFs) is believed to result in the decrease of the Alfvénicity of solar wind fluctuations with increasing heliocentric distance. However, SAFs are rarely observed at 1 au and solar wind AFs are found to be generally outward. Using the measurements from Voyager 2 and Wind , we perform a statistical survey of SAFs in the heliosphere inside 6 au. We first report two SAF events observed by Voyager 2 . One is in the anti-sunward magnetic sector with a strong positive correlation between the fluctuations of magnetic field and solar wind velocity. The other one is in the sunward magnetic sector with a strong negative magnetic field—velocity correlation. Statistically, the percentage of SAFs increases gradually with heliocentric distance, from about 2.7% at 1.0 au to about 8.7% at 5.5 au. These results provide new clues for understanding the generation mechanism of SAFs.
Mapping the nursing care with the NIC for patients in risk for pressure ulcer
Directory of Open Access Journals (Sweden)
Ana Gabriela Silva Pereira
2014-06-01
Full Text Available Objective:To identify the nursing care prescribed for patients in risk for pressure ulcer (PU and to compare those with the Nursing Interventions Classification (NIC interventions. Method: Cross mapping study conducted in a university hospital. The sample was composed of 219 adult patients hospitalized in clinical and surgical units. The inclusion criteria were: score ≤ 13 in the Braden Scale and one of the nursing diagnoses, Self-Care deficit syndrome, Impaired physical mobility, Impaired tissue integrity, Impaired skin integrity, Risk for impaired skin integrity. The data were collected retrospectively in a nursing prescription system and statistically analyzed by crossed mapping. Result: It was identified 32 different nursing cares to prevent PU, mapped in 17 different NIC interventions, within them: Skin surveillance, Pressure ulcer prevention and Positioning. Conclusion: The cross mapping showed similarities between the prescribed nursing care and the NIC interventions.
Swift heavy ion irradiation effects in Pt/C and Ni/C multilayers
Gupta, Ajay; Pandita, Suneel; Avasthi, D. K.; Lodha, G. S.; Nandedkar, R. V.
1998-12-01
Irradiation effects of 100 MeV Ag ion irradiation on Ni/C and Pt/C multilayers have been studied using X-ray reflectivity measurements. Modifications are observed in both the multilayers at (dE/dx)e values much below the threshold values for Ni and Pt. This effect is attributed to the discontinuous nature of the metal layers. In both the multilayers interfacial roughness increases with irradiation dose. While Ni/C multilayers exhibit large ion-beam induced intermixing, no observable intermixing is observed in the case of Pt/C multilayer. This difference in the behavior of the two systems suggests a significant role for chemically guided defect motion in the mixing process associated with swift heavy ion irradiation.
Strategic management of nuclear technology information through the KNGR NIC experience
International Nuclear Information System (INIS)
Kang, G. D.; Moon, C. G.
2000-01-01
The key to the success of nuclear information management depends on whether nuclear engineers focus their attention on such management or not. This paper focus to strategic management of nuclear technology information through the KNGR NIC experience. The present KEPCO systems on nuclear information are largely divided into four parts, which are Integrated NPP Information System, System by Business Process Reengineering for Construction, KNGR IMS and Document Management Systems of Plant DDCC. In order to accommodate effective system integration, it is not desirable that a system is subordinate to others because each system has its own work flows and practices site by site. Therefore for good NIS, the system should be developed by web-based, local computer system and bottom-up approach. NIC management have to focus on domain control, nuclear portal service and development of search engine
Passive Classification of Wireless NICs during Rate Switching
Beyah RaheemA; Copeland JohnA; Corbett CheritaL
2008-01-01
Abstract Computer networks have become increasingly ubiquitous. However, with the increase in networked applications, there has also been an increase in difficulty to manage and secure these networks. The proliferation of 802.11 wireless networks has heightened this problem by extending networks beyond physical boundaries. We propose the use of spectral analysis to identify the type of wireless network interface card (NIC). This mechanism can be applied to support the detection of unauthorize...
Alfvénic instabilities driven by runaways in fusion plasmas
International Nuclear Information System (INIS)
Fülöp, T.; Newton, S.
2014-01-01
Runaway particles can be produced in plasmas with large electric fields. Here, we address the possibility that such runaway ions and electrons excite Alfvénic instabilities. The magnetic perturbation induced by these modes can enhance the loss of runaways. This may have important implications for the runaway electron beam formation in tokamak disruptions
GUN CONTROL: Potential Effects of Next-Day Destruction of NICS Background Check Records
National Research Council Canada - National Science Library
2002-01-01
.... Under the Brady Handgun Violence Prevention Act, licensed dealers generally are not to transfer firearms to an individual until a NICS search determines that the transfer will not violate applicable...
Directory of Open Access Journals (Sweden)
Alice Capobiango
2009-12-01
Full Text Available Os objetivos deste estudo foram avaliar a frequência de HPV anal em pacientes com neoplasia intraepitelial cervical (NIC, verificar a concordância entre os subtipos encontrados nos dois locais e investigar os fatores que influenciaram a ocorrência de HPV anal em mulheres com NIC sem evidências clínicas de imunodepressão. Foram avaliadas 52 mulheres com idades entre 16 e 72 anos e diagnóstico de neoplasia intraepitelial cervical graus I, II e III. A identificação do DNA (ácido desoxirribonucleico do HPV e de sete subtipos dos vírus foi realizada por meio da reação em cadeia da polimerase (PCR em material colhido no ânus e colo uterino. Foram pesquisados fatores que poderiam contribuir para a infecção anal, como paridade, número de parceiros, tabagismo, manipulação e coito anal e o tipo de doença ginecológica. Das 52 mulheres, foi diagnosticado HPV na região anal em 25 (48%, das quais 23 (44% também apresentavam HPV no colo uterino - resultado significativo para existência do HPV em portadoras de NIC. Em 16 (31% o HPV foi diagnosticado somente no colo uterino e em 11 (21% não foi identificado em colo ou ânus. Houve associação significativa nas variáveis paridade (p=0,02 e número de parceiros (p=0,04. Concluiu-se que: as mulheres com HPV genital têm mais probabilidade de serem acometidas por HPV anal; não há concordância unânime entre os subtipos do HPV do colo do útero e do ânus e a paridade e o número de parceiros contribuem para aumentar a incidência de HPV anal nas mulheres sem imunodeficiência e com HPV cervical.This study aims were to assess the frequency of HPV anal infection in patients with cervical intra-epithelial neoplasia (CIN, to find out the relation between the found subtypes, when present in both regions, and investigate factors that influenced the occurrence of anal HPV in women with CIN. Fifty two women with age between 16 and 72 years and cervical intra-epithelial neoplasia (CIN diagnosis
Energy Technology Data Exchange (ETDEWEB)
Matteini, L.; Horbury, T. S.; Schwartz, S. J. [The Blackett Laboratory, Imperial College London, SW7 2AZ (United Kingdom); Pantellini, F. [LESIA, Observatoire de Paris, CNRS, UPMC, Universit Paris-Diderot, 5 Place Jules Janssen, F-92195 Meudon (France); Velli, M. [Department of Earth, Planetary, and Space Sciences, UCLA, California (United States)
2015-03-20
We investigate the properties of plasma fluid motion in the large-amplitude, low-frequency fluctuations of highly Alfvénic fast solar wind. We show that protons locally conserve total kinetic energy when observed from an effective frame of reference comoving with the fluctuations. For typical properties of the fast wind, this frame can be reasonably identified by alpha particles which, due to their drift with respect to protons at about the Alfvén speed along the magnetic field, do not partake in the fluid low-frequency fluctuations. Using their velocity to transform the proton velocity into the frame of Alfvénic turbulence, we demonstrate that the resulting plasma motion is characterized by a constant absolute value of the velocity, zero electric fields, and aligned velocity and magnetic field vectors as expected for unidirectional Alfvénic fluctuations in equilibrium. We propose that this constraint, via the correlation between velocity and magnetic field in Alfvénic turbulence, is the origin of the observed constancy of the magnetic field; while the constant velocity corresponding to constant energy can only be observed in the frame of the fluctuations, the corresponding constant total magnetic field, invariant for Galilean transformations, remains the observational signature in the spacecraft frame of the constant total energy in the Alfvén turbulence frame.
Directory of Open Access Journals (Sweden)
Mohammad S. Khan
2017-07-01
Full Text Available Transgenic Brassica napus harboring the synthetic chitinase (NiC gene exhibits broad-spectrum antifungal resistance. As the rhizosphere microorganisms play an important role in element cycling and nutrient transformation, therefore, biosafety assessment of NiC containing transgenic plants on soil ecosystem is a regulatory requirement. The current study is designed to evaluate the impact of NiC gene on the rhizosphere enzyme activities and microbial community structure. The transgenic lines with the synthetic chitinase gene (NiC showed resistance to Alternaria brassicicola, a common disease causing fungal pathogen. The rhizosphere enzyme analysis showed no significant difference in the activities of fivesoil enzymes: alkalyine phosphomonoestarase, arylsulphatase, β-glucosidase, urease and sucrase between the transgenic and non-transgenic lines of B. napus varieties, Durr-e-NIFA (DN and Abasyne-95 (AB-95. However, varietal differences were observed based on the analysis of molecular variance. Some individual enzymes were significantly different in the transgenic lines from those of non-transgenic but the results were not reproducible in the second trail and thus were considered as environmental effect. Genotypic diversity of soil microbes through 16S–23S rRNA intergenic spacer region amplification was conducted to evaluate the potential impact of the transgene. No significant diversity (4% for bacteria and 12% for fungal between soil microbes of NiC B. napus and the non-transgenic lines was found. However, significant varietal differences were observed between DN and AB-95 with 79% for bacterial and 54% for fungal diversity. We conclude that the NiC B. napus lines may not affect the microbial enzyme activities and community structure of the rhizosphere soil. Varietal differences might be responsible for minor changes in the tested parameters.
Kinetics of Ni:C Thin Film Composition Formation at Different Temperatures and Fluxes
Directory of Open Access Journals (Sweden)
Gediminas KAIRAITIS
2013-09-01
Full Text Available In this work analysis considering Ni:C thin films growth on thermaly oxidized Si substrate by proposed kinetic model is presented. Model is built considering experimental results where microstructure evolution as a function of the substrate temperature and metal content of Ni:C nanocomposite films grown by hyperthermal ion deposition is investigated. The proposed kinetic model is based on the rate equations and includes processes of adsorption, surface segregation, diffusion, chemical reactions of constituents. The experimental depth profile curves were fitted by using proposed model. The obtained results show a good agreement with experiment taking into account concentration dependent diffusion. It is shown by modeling that with the increase of substrate temperature the process of nickel surface segregation becomes most important. DOI: http://dx.doi.org/10.5755/j01.ms.19.3.5234
Directory of Open Access Journals (Sweden)
Popa Ovidiu Cristian
2015-05-01
Full Text Available This article illustrates the concept of tourism potential, which includes all natural and human tourism resources which generate various forms of tourism. Slănic Moldova town is in a great development, being sustained by the glorious oldtime image: ”Moldova‟s Pearl”. The recent accomplishments, the implementation projects and the short and medium time investment programs aim not only to affirm the resort at a regional level, but to transform it in to an authentic “Romanian tourism pearl”. Developing Slănic Moldova town will aim to develop its natural resources. For the years to come, it is willing to sustain a long-lasting economy especially based on touristic services at a European level, but also on diversifying the local economic activities, in respect for the nature and permanent environment preoccupation. In order to reach certain values the contribution of all factors that can determine the town‟s socio-economic development are needed: the local community and the local‟s support, keeping the environment intact and not the least increasing the number of tourists. Slănic Moldova will be one of the main touristic balneoclimatheric mountain destinations in Romania having a diverse and attractive touristic offer during the entire year, high quality touristic services, in an exceptional, pollution free, natural environment. Slănic Moldova will pass through an essential stage of its development, in which the national and external touristic context will be redefined. Being guided by the reputation of „Moldova‟s Pearl”, Slănic Moldova will develop its mineral waters and great natural environment extraordinary potential, thus becoming the great „pearl of Romanian tourism”.
Lee, Eunjoo; Park, Hyejin; Nam, Mihwa; Whyte, James
2011-01-01
The purpose of the study was to identify Nursing Interventions Classification (NIC) interventions performed by Korean school nurses. The Korean data were then compared to U.S. data from other studies in order to identify differences and similarities between Korean and U.S. school nurse practice. Of the 542 available NIC interventions, 180 were…
Yoon, Heakyung C.; Loftness, Vivian
2002-05-01
Lack of speech privacy has been reported to be the main dissatisfaction among occupants in open workplaces, according to workplace surveys. Two speech privacy measurements, Articulation Index (AI), standardized by the American National Standards Institute in 1969, and Speech Privacy Noise Isolation Class (NIC', Noise Isolation Class Prime), adapted from Noise Isolation Class (NIC) by U. S. General Services Administration (GSA) in 1979, have been claimed as objective tools to measure speech privacy in open offices. To evaluate which of them, normal privacy for AI or satisfied privacy for NIC', is a better tool in terms of speech privacy in a dynamic open office environment, measurements were taken in the field. AIs and NIC's in the different partition heights and workplace configurations have been measured following ASTM E1130 (Standard Test Method for Objective Measurement of Speech Privacy in Open Offices Using Articulation Index) and GSA test PBS-C.1 (Method for the Direct Measurement of Speech-Privacy Potential (SPP) Based on Subjective Judgments) and PBS-C.2 (Public Building Service Standard Method of Test Method for the Sufficient Verification of Speech-Privacy Potential (SPP) Based on Objective Measurements Including Methods for the Rating of Functional Interzone Attenuation and NC-Background), respectively.
Ueki, Shigeharu; Kayaba, Hiroyuki; Tomita, Noriko; Kobayashi, Noriko; Takahashi, Tomoe; Obara, Toshikage; Takeda, Masahide; Moritoki, Yuki; Itoga, Masamichi; Ito, Wataru; Ohsaga, Atsushi; Kondoh, Katsuyuki; Chihara, Junichi
2011-04-01
The active involvement of hospital laboratory in surveillance is crucial to the success of nosocomial infection control. The recent dramatic increase of antimicrobial-resistant organisms and their spread into the community suggest that the infection control strategy of independent medical institutions is insufficient. To share the clinical data and surveillance in our local medical region, we developed a microbiology data warehouse for networking hospital laboratories in Akita prefecture. This system, named Akita-ReNICS, is an easy-to-use information management system designed to compare, track, and report the occurrence of antimicrobial-resistant organisms. Participating laboratories routinely transfer their coded and formatted microbiology data to ReNICS server located at Akita University Hospital from their health care system's clinical computer applications over the internet. We established the system to automate the statistical processes, so that the participants can access the server to monitor graphical data in the manner they prefer, using their own computer's browser. Furthermore, our system also provides the documents server, microbiology and antimicrobiotic database, and space for long-term storage of microbiological samples. Akita-ReNICS could be a next generation network for quality improvement of infection control.
Grañó Martí, Sílvia
2015-01-01
Pregunta clínica: És més efectiu el tractament convencional del dolor crònic lumbar no específic en l'edat adulta si li afegim el tractament amb teràpia craneosacral? Objectiu: Valorar l'efectivitat de la teràpia craneosacral en persones en edat adulta amb dolor crònic lumbar no específic. Metodologia: Es realitzarà un estudi experimental a partir d'un assaig clínic aleatoritzat i amb un simple cec. Es durà a terme durant l'any 2016 i mitjans de 2017 a la població de Lleida. La mostra e...
Controlador electrònic programable per vehicles de maquinària pesada
Gómez Areste, Sergi
2017-01-01
Disseny d'un controlador electrònic per maquinària pesada basat en sistemes de lògica reconfigurable. Diseño de un controlador electrónico para maquinaria pesada basado en sistemas de lógica reconfigurable. Designing an electronic controller for heavy machinery systems based on reconfigurable logic.
La responsabilitat davant la intel·ligència artificial en el comerç electrònic
Martín i Palomas, Elisabet
2015-01-01
Es planteja en aquesta tesi l'efecte produït sobre la responsabilitat derivada de les accions realitzades autònomament per sistemes dotats d'intel·ligència artificial, sense la participació directa de cap ésser humà, en els temes més directament relacionats amb el comerç electrònic. Per a això s'analitzen les activitats realitzades per algunes de les principals empreses internacionals de comerç electrònic, com el grup nord-americà eBay o el grup xinès Alibaba. Després de desenvolupar els prin...
Álvarez Baldó, Andrea
2010-01-01
LINKARE es una plataforma de Telemedicina experimental. La primera fase del proyecto está diseñada y desarrollada. Los trabajos a realizar consisten en la implantación de la plataforma LINKCARE en un entorno real, inicialmente de preproducción y posteriromente de producción, en el Hospital Clínic, por ello el proyecto se desarrollará en esta institución.
NIC (Nuclear Industry in China) exhibition. Press file
International Nuclear Information System (INIS)
1998-01-01
Framatome participated to the NIC exhibition which took place in Beijing (China) on March 1998. This press dossier was distributed to visitors. It presents in a first part the activities of the Framatome group in people's republic of China (new constructions (Daya Bay, Ling Ao project), technological cooperation and contracts in the nuclear domain, technology transfers in the domain of nuclear fuels, activities and daughter companies in the domain of industrial equipments, Framatome Connectors International (FCI) daughter company in the domain of connectors engineering). Then, the general activities of Framatome in the nuclear, industrial equipment, and connectors engineering domains are summarized in the next 3 parts. (J.S.)
International Nuclear Information System (INIS)
Munir, I.; Hussan, W.; Kazi, M.; Mian, A.
2016-01-01
Brassica juncea is an important oil seed crop throughout the world. The demand and cultivation of oil seed crops has gained importance due to rapid increase in world population and industrialization. Fungal diseases pose a great threat to Brassica productivity worldwide. Absence of resistance genes against fungal infection within crossable germplasms of this crop necessitates deployment of genetic engineering approaches to produce transgenic plants with resistance against fungal infections. In the current study, hypocotyls and cotyledons of Brassica juncea, used as explants, were transformed with Agrobacterium tumefacien strain EHA101 harboring binary vector pEKB/NIC containing synthetic chitinase gene (NIC), an antifungal gene under the control of cauliflower mosaic virus promoter (CaMV35S). Bar genes and nptII gene were used as selectable markers. Presence of chitinase gene in trangenic lines was confirmed by PCR and southern blotting analysis. Effect of the extracted proteins from non-transgenic and transgenic lines was observed on the growth of Alternaria brassicicola, a common disease causing pathogen in brassica crop. In comparison to non-transgenic control lines, the leaf tissue extracts of the transgenic lines showed considerable resistance and antifungal activity against A. brassicicola. The antifungal activity in transgenic lines was observed as corresponding to the transgene copy number. (author)
Liu, Song; An, Cuihua; Zang, Lei; Chang, Xiaoya; Guo, Huinan; Jiao, Lifang; Wang, Yijing
2018-04-16
A 3D flower-like mesoporous Ni@C composite material has been synthesized by using a facile and economical one-pot hydrothermal method. This unique 3D flower-like Ni@C composite, which exhibited a high surface area (522.4 m 2 g -1 ), consisted of highly dispersed Ni nanoparticles on mesoporous carbon flakes. The effect of calcination temperature on the electrochemical performance of the Ni@C composite was systematically investigated. The optimized material (Ni@C 700) displayed high specific capacity (1306 F g -1 at 2 A g -1 ) and excellent cycling performance (96.7 % retention after 5000 cycles). Furthermore, an asymmetric supercapacitor (ASC) that contained Ni@C 700 as cathode and mesoporous carbon (MC) as anode demonstrated high energy density (60.4 W h kg -1 at a power density of 750 W kg -1 ). © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Pawel Rouba Billowicz
2016-04-01
Full Text Available “Combats Escènics” és un treball que tracta sobre la interpretació artística de la violència d’artistes de l’espectacle per tal de divertir el públic i emetre un missatge humanista mitjançant una coreografia ritual. En aquest estudi es presenta una classificació del combat escènic des del doble vessant agonista/antagonista, es realitza un passeig històric de la representació artística del combat a través de les diferents etapes i de les diverses cultures, s’aborda la preparació escènica de l’actor i del coreògraf, i s’entreveuen les perspectives de futur d’aquesta modalitat artística. Estudi realitzat per Pawel Rouba Billewicz (Inowroclaw, Polònia, 1939 - Barcelona, 2007, director, coreògraf, actor, mestre d’armes, mestre del gest i de la pantomima i professor de l’INEF de Catalunya. Aquest article, editorialment inèdit, es publica postmortem per Apunts. Educació Física i Esports com a homenatge i reconeixement de l’autor per la seva extraordinària i polivalent aportació al camp de l’art i l’Activitat Física i l’Esport.
Mapeamento das ações de enfermagem do CIPESC às intervenções de enfermagem da NIC
Directory of Open Access Journals (Sweden)
Tânia Couto Machado Chianca
2003-10-01
Full Text Available Termos utilizados num instrumento do projeto de Classificação Internacional da Prática em Saúde Coletiva (CIPESC no Brasil foram analisados à luz das intervenções de enfermagem estabelecidas na Classificação de Intervenções de Enfermagem (NIC para determinar se elas podiam representar a prática de enfermagem no Brasil. Um processo de três passos foi empregado para fazer a ligação entre os termos e uma análise descritiva foi conduzida. Concluiu-se que a NIC pode ser útil no Brasil.
Sòcrates l'impenetrable i l'amor platònic
Pàmias i Massana, Jordi
2013-01-01
Un investigador de la UAB ha publicat un article en què es reinterpreta un passatge del diàleg El Banquet de Plató per establir que la fortalesa del filòsof Sòcrates radica en la seva capacitat de resistir la seducció. Així, Sòcrates coneix el desig, però només l'exerceix quan es tracta de veritable amor. Aquesta nova interpretació permet apropar-nos al nucli de la doctrina de l'amor platònic.
Abu-Raiya, Hisham
2014-04-01
In this paper, comparisons are made between a newly developed Qura'nic theory of personality and the Freudian and Jungian theories of the mind. Notable similarities were found between the Freudian id, ego, superego and neurosis and the Qura'nic nafs ammarah besoa' (evil-commanding psyche), a'ql (intellect), al-nafs al-lawammah (the reproachful psyche) and al-nafs al-marid'a (the sick psyche), respectively. Noteworthy resemblances were detected also between the Jungian concepts collective unconscious, archetypes, Self and individuation and the Qura'nic constructs roh (spirit), al-asmaa' (the names), qalb (heart), and al-nafs al-mutmainnah (the serene psyche), respectively. These parallels, as well as the departure points, between the models are thoroughly discussed and analyzed. The comparisons performed in this paper open new avenues for dialogue between western models of the psyche and their Muslim counterparts, a dialogue that can enrich both perspectives and advance the field of psychology.
Directory of Open Access Journals (Sweden)
Maria Gabriela L. d'Ottaviano-Morelli
2004-02-01
Full Text Available This study aimed to estimate and analyze the prevalence of cervical intraepithelial neoplasia (CIN and invasive cervical carcinoma based on cytological diagnosis. The study included 120,635 women undergoing cytological exams in public health services in the region of Campinas, São Paulo State, Brazil, between September 1998 and March 1999. Prevalence rates per 100,000 women were: 354 for CIN I; 255 for CIN II; 141 for CIN III; and 24 for invasive carcinoma. As age increased, prevalence rates and prevalence ratios decreased for CIN grades I and II and increased for CIN III until the 50-54 age group, decreasing thereafter The prevalence rate of invasive carcinoma increased with age. The prevalence pattern of CIN II was distinct from that of CIN III, but similar to that of CIN I. This would not have been observed if the Bethesda System had been used for cytological diagnosis. Mean age at time of CIN II diagnosis was about 10 years less than for CIN III diagnosis. Therefore, a high-grade lesion diagnosed in a young woman according to the Bethesda System would probably be a CIN II, whereas in an older woman it would probably be a CIN III.O objetivo deste estudo foi estimar e analisar a prevalência das neoplasias intra-epiteliais cervicais (NIC e do carcinoma invasivo do colo uterino, com base no diagnóstico citológico. Foram incluídas 120.635 mulheres que realizaram o exame citológico, entre setembro de 1998 a março de 1999, nos serviços públicos de saúde da região de Campinas, Brasil. As prevalências por 100 mil mulheres foram: 354 para NIC I; 255 para NIC II; 141 para NIC III e 24 de carcinoma invasivo. À medida que a idade aumentou, as prevalências e razões de prevalência diminuíram para NIC I e NIC II, e aumentaram para NIC III até 50-54 anos, decrescendo após. A prevalência do carcinoma invasivo aumentou com a idade. O padrão da prevalência da NIC II é distinto do padrão da NIC III e semelhante ao da NIC I, o que n
Coburn, Cynthia E.; Penuel, William R.; Geil, Kimberly E.
2015-01-01
The Carnegie Foundation for the Advancement of Teaching is a nonprofit, operating foundation with a long tradition of developing and studying ways to improve teaching practice. For the past three years, the Carnegie Foundation has initiated three different Networked Improvement Communities (NICs). The first, Quantway, is addressing the high…
Venus' night side atmospheric dynamics using near infrared observations from VEx/VIRTIS and TNG/NICS
Mota Machado, Pedro; Peralta, Javier; Luz, David; Gonçalves, Ruben; Widemann, Thomas; Oliveira, Joana
2016-10-01
We present night side Venus' winds based on coordinated observations carried out with Venus Express' VIRTIS instrument and the Near Infrared Camera (NICS) of the Telescopio Nazionale Galileo (TNG). With NICS camera, we acquired images of the continuum K filter at 2.28 μm, which allows to monitor motions at the Venus' lower cloud level, close to 48 km altitude. We will present final results of cloud tracked winds from ground-based TNG observations and from coordinated space-based VEx/VIRTIS observations.The Venus' lower cloud deck is centred at 48 km of altitude, where fundamental dynamical exchanges that help maintain superrotation are thought to occur. The lower Venusian atmosphere is a strong source of thermal radiation, with the gaseous CO2 component allowing radiation to escape in windows at 1.74 and 2.28 μm. At these wavelengths radiation originates below 35 km and unit opacity is reached at the lower cloud level, close to 48 km. Therefore, it is possible to observe the horizontal cloud structure, with thicker clouds seen silhouetted against the bright thermal background from the low atmosphere. By continuous monitoring of the horizontal cloud structure at 2.28 μm (NICS Kcont filter), it is possible to determine wind fields using the technique of cloud tracking. We acquired a series of short exposures of the Venus disk. Cloud displacements in the night side of Venus were computed taking advantage of a phase correlation semi-automated technique. The Venus apparent diameter at observational dates was greater than 32" allowing a high spatial precision. The 0.13" pixel scale of the NICS narrow field camera allowed to resolve ~3-pixel displacements. The absolute spatial resolution on the disk was ~100 km/px at disk center, and the (0.8-1") seeing-limited resolution was ~400 km/px. By co-adding the best images and cross-correlating regions of clouds the effective resolution was significantly better than the seeing-limited resolution. In order to correct for
Montenegro Siguencia, Diana Fernanda
2013-01-01
Important issues such as NICs, the difference between IAS 11 and IAS 2 phases of a construction project, and construction costs are covered. According to the knowledge of the company and the different concepts and use them as a basis for management model for inventory control, which are the main procedures, process control, flow charts and forms to be used as as the activity of building the application of IAS 11. Se abarca temas importantes como las NICs, la diferencia entre la NIC 11 y la...
Alfvénic waves in polar spicules
Tavabi, E.; Koutchmy, S.; Ajabshirizadeh, A.; Ahangarzadeh Maralani, A. R.; Zeighami, S.
2015-01-01
Context. For investigating spicules from the photosphere to coronal heights, the new Hinode/SOT long series of high-resolution observations from space taken in CaII H line emission offers an improved way to look at their remarkable dynamical behavior using images free of seeing effects. They should be put in the context of the huge amount of already accumulated material from ground-based instruments, including high- resolution spectra of off-limb spicules. Aims: Both the origin of the phenomenon and the significance of dynamical spicules for the heating above the top of the photosphere and the fuelling of the chromospheric and the transition region need more investigation, including of the possible role of the associated magnetic waves for the corona higher up. Methods: We analyze in great detail the proper transverse motions of mature and tall polar region spicules for different heights, assuming that there might be Helical-Kink waves or Alfvénic waves propagating inside their multicomponent substructure, by interpreting the quasi-coherent behavior of all visible components presumably confined by a surrounding magnetic envelop. We concentrate the analysis on the taller CaII spicules more relevant for coronal heights and easier to measure. Two-dimensional velocity maps of proper motion were computed for the first time using a correlation tracking technique based on FFTs and cross-correlation function with a 2nd-order-accuracy Taylor expansion. Highly processed images with the popular mad-max algorithm were first prepared to perform this analysis. The locations of the peak of the cross-correlation function were obtained with subpixel accuracy. Results: The surge-like behavior of solar polar region spicules supports the untwisting multicomponent interpretation of spicules exhibiting helical dynamics. Several tall spicules are found with (i) upward and downward flows that are similar at lower and middle levels, the rate of upward motion being slightly higher at high
A novel fluffy nanostructured 3D network of Ni(C7H4O5) for supercapacitors
International Nuclear Information System (INIS)
Chen, Qiulin; Lei, Shuijin; Chen, Lianfu; Deng, Peiqin; Xiao, Yanhe; Cheng, Baochang
2017-01-01
Highlights: • The fluffy 3D network of Ni(C 7 H 4 O 5 ) complex is firstly prepared on Ni foam. • The fluffy 3D network shows high areal capacitance and excellent cycle stability. • The fluffy network has large superior pseudocapacitive performance than the powder. • An asymmetric supercapacitor with high capacitance and energy density is assembled. - Abstract: Supercapacitors have raised considerable research interest in recent years due to their extensive potential application in next-generation energy storage. It is always of great importance to develop new electrode materials for supercapacitors so far. In this research, nickel gallate complex (Ni(C 7 H 4 O 5 )) nanostructures are successfully grown on nickel foam by a facile hydrothermal route, which can be directly used as the electrodes for supercapacitors. X-ray diffraction patterns show that the sample is amorphous. The scanning electron microscopy images reveal that the products consist of novel fluffy 3D network with a mass of fibers. The electrochemical measurements demonstrate that the prepared Ni(C 7 H 4 O 5 ) electrode possesses the specific capacitance of 3.688 F cm −2 (1229.3 F g −1 ) at a current density of 9 mA cm −2 (3 A g −1 ). It presents an excellent cycling stability with a capacitance retention of 87.9% after 5000 cycles even at a very high current density of 40 mA cm −2 . An asymmetric supercapacitor device is assembled using the Ni(C 7 H 4 O 5 ) sample as positive electrode and activated carbon as negative one. A high gravimetric capacitance of 71.4 F g −1 at a current density of 0.5 A g −1 can be achieved. The fabricated device delivers the highest energy density of 23.8 W h kg −1 at a power density of 388.2 W kg −1 with a voltage window of 1.55 V. This strategy should be extended to other organometallic compounds for supercapacitors.
78 FR 23872 - HIPAA Privacy Rule and the National Instant Criminal Background Check System (NICS)
2013-04-23
..., gender, citizenship, race and ethnicity; and ``yes'' or ``no'' answers to questions about the person's... elements of an express permission, we would consider limiting the information to be disclosed to the... information to States on HIPAA Privacy Rule policies as they relate to NICS reporting? Are there central...
Impacto de la NIC 16 en pymes manufactureras: caso Cuenca-Ecuador
Illescas Sigcha, Mayra Jimena
2017-01-01
Se presenta los resultados obtenidos de la investigación a 172 empresas manufactureras de la ciudad de Cuenca de las que tanto solo el 90% de grandes empresas, el 63% de medianas empresas igualmente 39% de pequeñas empresas y el 6% de microempresas aplicaron la NIC 16 propiedad Planta y Equipo, mientras que las empresas que no aplicaron fue por el desconocimiento de la norma y por falta de recursos económicos. This presents the results obtained of research to 172 manufacturing companies of...
NaNet: a configurable NIC bridging the gap between HPC and real-time HEP GPU computing
International Nuclear Information System (INIS)
Lonardo, A.; Ameli, F.; Biagioni, A.; Frezza, O.; Cicero, F. Lo; Martinelli, M.; Paolucci, P.S.; Pastorelli, E.; Simeone, F.; Simula, F.; Tosoratto, L.; Vicini, P.; Ammendola, R.; Ramusino, A. Cotta; Fiorini, M.; Neri, I.; Lamanna, G.; Pontisso, L.; Sozzi, M.; Rossetti, D.
2015-01-01
NaNet is a FPGA-based PCIe Network Interface Card (NIC) design with GPUDirect and Remote Direct Memory Access (RDMA) capabilities featuring a configurable and extensible set of network channels. The design currently supports both standard—Gbe (1000BASE-T) and 10GbE (10Base-R)—and custom—34 Gbps APElink and 2.5 Gbps deterministic latency KM3link—channels, but its modularity allows for straightforward inclusion of other link technologies. The GPUDirect feature combined with a transport layer offload module and a data stream processing stage makes NaNet a low-latency NIC suitable for real-time GPU processing. In this paper we describe the NaNet architecture and its performances, exhibiting two of its use cases: the GPU-based low-level trigger for the RICH detector in the NA62 experiment at CERN and the on-/off-shore data transport system for the KM3NeT-IT underwater neutrino telescope
2012-06-04
..., development of statistical and assessment applications using standard html and java script, asp.net and Excel... the application procedures should be directed to Erika McDuffe, Program Specialist, NIC Jails Division... stay, average daily population); staffing levels, and; corrections activities and programs. It is not...
Preparation of Ni-C Ultrafine Composite from Waste Material
Directory of Open Access Journals (Sweden)
Mahmoud A. Rabah
2017-06-01
Full Text Available This work depicts the preparation of Ni-C ultrafine composite from used engine oil. The used oil was emulsified with detergent loaded with Ni (OH2. The loaded emulsion was sprayed on electric plasma generated between two C electrodes to a DC main 28 V and 70-80 A. The purged Ni-doped carbon fume was trapped on a polymer film moistened with synthetic adhesive to fix the trapped smoke. Characterization of the deposit was made using SEM. XRD examined the crystal morphology. Carbon density in the cloud was calculated. The average size and thickness of the deposited composite is 120-160 nm. Aliphatic hydrocarbons readily decompose to gaseous products. Solid carbon smoke originates from aromatic compounds. Plasma heat blasts the oil in short time to decompose in one step.
Energy Technology Data Exchange (ETDEWEB)
Di Youying [College of Chemistry and Chemical Engineering, Liaocheng University, Liaocheng 252059, Shandong (China)], E-mail: yydi@lcu.edu.cn; Hong Yuanping; Kong Yuxia; Yang Weiwei [College of Chemistry and Chemical Engineering, Liaocheng University, Liaocheng 252059, Shandong (China); Tan Zhicheng [Thermochemistry Laboratory, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China)
2009-01-15
A novel compound, viz. zinc nicotinate monohydrate, was synthesized by the method of room temperature solid phase synthesis. The techniques of FT-IR chemical and elemental analyses and X-ray powder diffraction were applied to characterise the structure and composition of the complex. In accordance with Hess' law, a thermochemical cycle was designed and the enthalpy change of the solid phase reaction of nicotinic acid with hydrated zinc acetate was determined to be {delta}{sub r}H{sub m}{sup 0}=(46.71{+-}0.21)kJ.mol{sup -1} by use of an isoperibol solution-reaction calorimeter. The standard molar enthalpy of formation of the title complex Zn(Nic){sub 2} . H{sub 2}O(s) was calculated as -(1062.3 {+-} 2.0) kJ . mol{sup -1} by use of the enthalpies of dissolution and other auxiliary thermodynamic data.
Cifuentes Garzón, Juan Andrés
2012-01-01
Un problema de interpretar la información financiera es la diversidad de normas contables y poder emitir un criterio que sea entendible, comparable, etc; para otros usuarios de la información y que los resultados obtenidos no pierdan credibilidad. Las IASB (Internacional Accounting Comité Foundation), para poner fin a este y varios problemas más y aumentar la transparencia de la información se comprometen a revisar las NIC (Normas internacionales de Contabilidad). Más delante de acuerdo a ...
Building 1D resonance broadened quasilinear (RBQ) code for fast ions Alfvénic relaxations
Gorelenkov, Nikolai; Duarte, Vinicius; Berk, Herbert
2016-10-01
The performance of the burning plasma is limited by the confinement of superalfvenic fusion products, e.g. alpha particles, which are capable of resonating with the Alfvénic eigenmodes (AEs). The effect of AEs on fast ions is evaluated using a resonance line broadened diffusion coefficient. The interaction of fast ions and AEs is captured for cases where there are either isolated or overlapping modes. A new code RBQ1D is being built which constructs diffusion coefficients based on realistic eigenfunctions that are determined by the ideal MHD code NOVA. The wave particle interaction can be reduced to one-dimensional dynamics where for the Alfvénic modes typically the particle kinetic energy is nearly constant. Hence to a good approximation the Quasi-Linear (QL) diffusion equation only contains derivatives in the angular momentum. The diffusion equation is then one dimensional that is efficiently solved simultaneously for all particles with the equation for the evolution of the wave angular momentum. The evolution of fast ion constants of motion is governed by the QL diffusion equations which are adapted to find the ion distribution function.
100 anys després, el desastre del Titànic troba nous culpables
Marco Soler, Enric
2012-01-01
100 anys després de l'enfonsament del Titànic, l'article revisa, des d'un punt de vista astronòmic, la influència de l'alineació lunisolar de gener de 1912 sobre el desastre marítim. 100 years after the sinking of the Titanic, the article reviews, from an astronomical point of view, the influence of the lunisolar alignment of January 1912 on the maritime disaster.
Suroso, Arif Imam; Siahaan, Rotua
2006-01-01
This study was aimed at finding out the existence of stress in work towards employees' performance, and knowing the indicators of each shaper element of that influencing the employees' performance of plant department of agribusiness industry at PT. NIC. The method of this study is case study involving 155 respondents. Using the Structural Equation Modelling (SEM), it is known that the influence of stress in work towards employees' performance is significantly negative. It means that the advan...
Directory of Open Access Journals (Sweden)
Huda M. Hassan Hilal
2015-06-01
Full Text Available The topic of female leadership has yet to be conclusively and impartially investigated, especially from the Islamic perspective. The current study bridges the gap between the original Qur’ānic teachings and dominant Muslim culture by highlighting the Qur’ānic conceptualisation of female leadership and investigates the myth that only men are the best leaders. It identifies female leadership qualities of Queen Āsiyah, Queen Balqīs and Maryam, the daughter of ‘Imrān and mother of Prophet ‘Īsā, and matches them with male leadership qualities of Prophet Muhammad, Dhū al-Qarnayn, Țālūt, and Prophet Sulaymān as narrated in the Qur’ān. The research documents the traits of a leader’s personality, leader-follower relation, task structure, and crisis management as four principal axes to the study, relying on the dominant theories of leadership. The inference reveals conformity between both male and female patterns of leadership, except for minor differences related to physical strength, and war conducts.
HPT-Deformation of Copper and NicKEXl Single Crystals
International Nuclear Information System (INIS)
Hafok, M.; Vorhauer, A.; Pippan, R.; KEXcKEXs, J.
2005-01-01
Full text: Copper and nicKEXl single crystals of high purity with a crystallographic orientation, (001) and (111) respectively, were deformed by applying high pressure torsion (HPT) at room temperature. Special interest was devoted to the structural evolution of the material, which was characterized by electron backscatter diffraction (EBSD) and x-ray texture analysis as well. In addition back scatter electron investigations were applied to characterize shape and size of the new formed structure. Furthermore the study is focused on the micro structural and micro textural evolution that lead to the increase of misorientation angle with increasing plastic deformation. We observed an increasing fragmentation of the structure with increasing plastic equivalent strain up to a level where the grain size is saturated. The saturation could be traced back to dynamical recovery and recrystallisation during the deformation process that is depending on the purity of the material. (author)
Dawn-dusk asymmetries and sub-Alfvénic flow in the high and low latitude magnetosheath
Directory of Open Access Journals (Sweden)
M. Longmore
2005-11-01
Full Text Available We present the results of a statistical survey of the magnetosheath using four years of Cluster orbital coverage. Moments of the plasma distribution obtained from the electron and ion instruments together with magnetic field data are used to characterise the flow and density in the magnetosheath. We note two important differences between our survey and the gasdynamic model predictions: a deceleration of the flow at higher latitudes close to the magnetopause, resulting in sub-Alfvénic flow near the cusp, and a dawn-dusk asymmetry with higher velocity magnitudes and lower densities measured on the dusk side of the magnetosheath in the Northern Hemisphere. The latter observation is in agreement with studies carried out by Paularena et al. (2001, Němeček et al. (2000, and Šafránková et al. (2004. In equations of hydrodynamics for a single-component additon to this we observe a reverse of this asymmetry for the Southern Hemisphere. High-latitude sub-Alfvénic flow is thought to be a necessary condition for steady state reconnection pole-ward of the cusp.
Celma Vicente, Matilde; Ajuria-Imaz, Eloisa; Lopez-Morales, Manuel; Fernandez-Marín, Pilar; Menor-Castro, Alicia; Cano-Caballero Galvez, Maria Dolores
2015-01-01
This paper shows the utility of a NIC standardized language to assess the extent of nursing student skills at Practicum in surgical units To identify the nursing interventions classification (NIC) that students can learn to perform in surgical units. To determine the level of difficulty in learning interventions, depending on which week of rotation in clinical placement the student is. Qualitative study using Delphi consensus technique, involving nurses with teaching experience who work in hospital surgical units, where students undertake the Practicum. The results were triangulated through a questionnaire to tutors about the degree of conformity. A consensus was reached about the interventions that students can achieve in surgical units and the frequency in which they can be performed. The level of difficulty of each intervention, and the amount of weeks of practice that students need to reach the expected level of competence was also determined. The results should enable us to design better rotations matched to student needs. Knowing the frequency of each intervention that is performed in each unit determines the chances of learning it, as well as the indicators for its assessment. Copyright © 2015 Elsevier España, S.L.U. All rights reserved.
LLNL Contribution to LLE FY09 Annual Report: NIC and HED Results
International Nuclear Information System (INIS)
Heeter, R.F.; Landen, O.L.; Hsing, W.W.; Fournier, K.B.
2009-01-01
In FY09, LLNL led 238 target shots on the OMEGA Laser System. Approximately half of these LLNL-led shots supported the National Ignition Campaign (NIC). The remainder was dedicated to experiments for the high-energy-density stewardship experiments (HEDSE). Objectives of the LLNL led NIC campaigns at OMEGA included: (1) Laser-plasma interaction studies in physical conditions relevant for the NIF ignition targets; (2) Demonstration of Tr = 100 eV foot symmetry tuning using a reemission sphere; (3) X-ray scattering in support of conductivity measurements of solid density Be plasmas; (4) Experiments to study the physical properties (thermal conductivity) of shocked fusion fuels; (5) High-resolution measurements of velocity nonuniformities created by microscopic perturbations in NIF ablator materials; (6) Development of a novel Compton Radiography diagnostic platform for ICF experiments; and (7) Precision validation of the equation of state for quartz. The LLNL HEDSE campaigns included the following experiments: (1) Quasi-isentropic (ICE) drive used to study material properties such as strength, equation of state, phase, and phase-transition kinetics under high pressure; (2) Development of a high-energy backlighter for radiography in support of material strength experiments using Omega EP and the joint OMEGA-OMEGA-EP configuration; (3) Debris characterization from long-duration, point-apertured, point-projection x-ray backlighters for NIF radiation transport experiments; (4) Demonstration of ultrafast temperature and density measurements with x-ray Thomson scattering from short-pulse laser-heated matter; (5) The development of an experimental platform to study nonlocal thermodynamic equilibrium (NLTE) physics using direct-drive implosions; (6) Opacity studies of high-temperature plasmas under LTE conditions; and (7) Characterization of copper (Cu) foams for HEDSE experiments.
REDVET en el Centro de Información de la Red de Agricultura de EE.UU (AgNIC)
REDVET
2010-01-01
ResumenAgNIC http://www.agnic.org/ es el Centro de Información de Red de Agricultura de EE.UU, una alianza de instituciones que trabajan paraofrecer un acceso rápido y fiable a fuentes de información agraria de calidad basada en concepto de "centros de excelencia".
Stellar winds and coronae of low-mass Population II/III stars
Suzuki, Takeru K.
2018-06-01
We investigated stellar winds from zero-/low-metallicity low-mass stars by magnetohydrodynamical simulations for stellar winds driven by Alfvén waves from stars with mass M = (0.6-0.8) M⊙ and metallicity Z = (0-1) Z⊙, where M⊙ and Z⊙ are the solar mass and metallicity, respectively. Alfvénic waves, which are excited by the surface convection, travel upward from the photosphere and heat up the corona by their dissipation. For lower Z, denser gas can be heated up to the coronal temperature because of the inefficient radiation cooling. The coronal density of Population II/III stars with Z ≤ 0.01 Z⊙ is one to two orders of magnitude larger than that of a solar-metallicity star with the same mass, and as a result, the mass loss rate, \\dot{M}, is 4.5-20 times larger. This indicates that metal accretion on low-mass Pop. III stars is negligible. The soft X-ray flux of the Pop. II/III stars is also expected to be ˜1-30 times larger than that of a solar-metallicity counterpart owing to the larger coronal density, even though the radiation cooling efficiency is smaller. A larger fraction of the input Alfvénic wave energy is transmitted to the corona in low-Z stars because they avoid severe reflection owing to the smaller density difference between the photosphere and the corona. Therefore, a larger fraction is converted to the thermal energy of the corona and the kinetic energy of the stellar wind. From this energetics argument, we finally derived a scaling of \\dot{M} as \\dot{M}∝ L R_{\\star }^{11/9} M_{\\star }^{-10/9} T_eff^{11/2}[\\max (Z/Z_{⊙},0.01)]^{-1/5}, where L, R⋆, and Teff are the stellar luminosity, radius, and effective temperature, respectively.
Stellar winds and coronae of low-mass Population II/III stars
Suzuki, Takeru K.
2018-04-01
We investigated stellar winds from zero-/low-metallicity low-mass stars by magnetohydrodynamical simulations for stellar winds driven by Alfvén waves from stars with mass M = (0.6-0.8) M⊙ and metallicity Z = (0-1) Z⊙, where M⊙ and Z⊙ are the solar mass and metallicity, respectively. Alfvénic waves, which are excited by the surface convection, travel upward from the photosphere and heat up the corona by their dissipation. For lower Z, denser gas can be heated up to the coronal temperature because of the inefficient radiation cooling. The coronal density of Population II/III stars with Z ≤ 0.01 Z⊙ is one to two orders of magnitude larger than that of a solar-metallicity star with the same mass, and as a result, the mass loss rate, \\dot{M}, is 4.5-20 times larger. This indicates that metal accretion on low-mass Pop. III stars is negligible. The soft X-ray flux of the Pop. II/III stars is also expected to be ˜1-30 times larger than that of a solar-metallicity counterpart owing to the larger coronal density, even though the radiation cooling efficiency is smaller. A larger fraction of the input Alfvénic wave energy is transmitted to the corona in low-Z stars because they avoid severe reflection owing to the smaller density difference between the photosphere and the corona. Therefore, a larger fraction is converted to the thermal energy of the corona and the kinetic energy of the stellar wind. From this energetics argument, we finally derived a scaling of \\dot{M} as \\dot{M}∝ L R_{\\star }^{11/9} M_{\\star }^{-10/9} T_eff^{11/2}[\\max (Z/Z_{⊙},0.01)]^{-1/5}, where L, R⋆, and Teff are the stellar luminosity, radius, and effective temperature, respectively.
Reliability research on nuclear I and C system at KAIST NIC laboratory
International Nuclear Information System (INIS)
Seong, Poong-Hyun
1996-01-01
As the use of computer systems becomes popular in nuclear industry, reliability assurance of digitized nuclear instrumentation and control systems is becoming one of hot issues. Some issues on this are S/W verification and validation, reliability estimation of digital systems, development strategy of high integrity knowledge base for expert systems, and so on. In order to address these issues, the Nuclear Instrumentation and Control (NIC) laboratory at KAIST is conducting some research projects. This paper describes some highlights of these research activities. The final goal of these research activities is to develop some useful methodologies and tools for development of dependable digital nuclear instrument and control systems. (author)
Measuring the Alfvénic nature of the interstellar medium: Velocity anisotropy revisited
International Nuclear Information System (INIS)
Burkhart, Blakesley; Lazarian, A.; Leão, I. C.; De Medeiros, J. R.; Esquivel, A.
2014-01-01
The dynamics of the interstellar medium (ISM) are strongly affected by turbulence, which shows increased anisotropy in the presence of a magnetic field. We expand upon the Esquivel and Lazarian method to estimate the Alfvén Mach number using the structure function anisotropy in velocity centroid data from Position-Position-Velocity maps. We utilize three-dimensional magnetohydrodynamic simulations of fully developed turbulence, with a large range of sonic and Alfvénic Mach numbers, to produce synthetic observations of velocity centroids with observational characteristics such as thermal broadening, cloud boundaries, noise, and radiative transfer effects of carbon monoxide. In addition, we investigate how the resulting anisotropy-Alfvén Mach number dependency found in Esquivel and Lazarian might change when taking the second moment of the Position-Position-Velocity cube or when using different expressions to calculate the velocity centroids. We find that the degree of anisotropy is related primarily to the magnetic field strength (i.e., Alfvén Mach number) and the line-of-sight orientation, with a secondary effect on sonic Mach number. If the line of sight is parallel to up to ≈45 deg off of the mean field direction, the velocity centroid anisotropy is not prominent enough to distinguish different Alfvénic regimes. The observed anisotropy is not strongly affected by including radiative transfer, although future studies should include additional tests for opacity effects. These results open up the possibility of studying the magnetic nature of the ISM using statistical methods in addition to existing observational techniques.
Energy Technology Data Exchange (ETDEWEB)
Chen, Che-Yu; King, Patrick K.; Li, Zhi-Yun [Department of Astronomy, University of Virginia, Charlottesville, VA 22901 (United States)
2016-10-01
Diffuse striations in molecular clouds are preferentially aligned with local magnetic fields, whereas dense filaments tend to be perpendicular to them. When and why this transition occurs remain uncertain. To explore the physics behind this transition, we compute the histogram of relative orientation (HRO) between the density gradient and the magnetic field in three-dimensional magnetohydrodynamic (MHD) simulations of prestellar core formation in shock-compressed regions within giant molecular clouds. We find that, in the magnetically dominated (sub-Alfvénic) post-shock region, the gas structure is preferentially aligned with the local magnetic field. For overdense sub-regions with super-Alfvénic gas, their elongation becomes preferentially perpendicular to the local magnetic field. The transition occurs when self-gravitating gas gains enough kinetic energy from the gravitational acceleration to overcome the magnetic support against the cross-field contraction, which results in a power-law increase of the field strength with density. Similar results can be drawn from HROs in projected two-dimensional maps with integrated column densities and synthetic polarized dust emission. We quantitatively analyze our simulated polarization properties, and interpret the reduced polarization fraction at high column densities as the result of increased distortion of magnetic field directions in trans- or super-Alfvénic gas. Furthermore, we introduce measures of the inclination and tangledness of the magnetic field along the line of sight as the controlling factors of the polarization fraction. Observations of the polarization fraction and angle dispersion can therefore be utilized in studying local magnetic field morphology in star-forming regions.
El llibre electrònic cientificotècnic en el context espanyol
Directory of Open Access Journals (Sweden)
Romero Otero, Irene Sofía
2015-12-01
Full Text Available Aquest treball descriu alguns dels aspectes del llibre electrònic que més debat generen, especialment el cientificotècnic, a Espanya i per a això el document aborda el tema de l'IVA, els preus proposats per les editorials i la necessitat d'introduir-se a nous mercats de lectors mitjançant diferents models de negocis. A més, esmenta algunes conclusions dels avantatges que posseeix aquest recurs, que, per les seves àmplies possibilitats intrínseques en matèria de servei intangible d'un nou tipus de text, desenvolupa facilitats per a la distribució i difusió mundial. D'aquesta manera, el llibre electrònic ha permès a les editorials adaptar-se a les necessitats reals dels seus clients i als processos actuals d'adquisició de monografies. Per tot l'anterior, aquest article pretén mostrar un panorama general de com s'està comportant el llibre electrònic en el context espanyol.Este trabajo describe algunos de los aspectos más debatibles que está generando el libro electrónico, especialmente el científico-técnico, en España y para ello el documento aborda el tema del IVA, los precios propuestos por las editoriales y la necesidad de ingresar a nuevos mercados de lectores mediante distintos modelos de negocios. Además, menciona algunas conclusiones de las ventajas que posee dicho recurso, que, por sus amplias posibilidades intrínsecas en materia de servicio intangible de un nuevo tipo de texto, desarrolla facilidades para la distribución y difusión mundial. De esta forma el libro electrónico ha permitido a las editoriales adaptarse a las necesidades reales de sus clientes y a los procesos actuales de adquisición de monografías. Por lo anterior, este artículo pretende mostrar un panorama general de cómo se está comportando el libro electrónico en el contexto español.This paper describes some of the most controversial areas of debate on the subject of the scientific and technical e-book market in Spain: VAT regulations
An Offload NIC for NASA, NLR, and Grid Computing
Awrach, James
2013-01-01
This work addresses distributed data management and access dynamically configurable high-speed access to data distributed and shared over wide-area high-speed network environments. An offload engine NIC (network interface card) is proposed that scales at nX10-Gbps increments through 100-Gbps full duplex. The Globus de facto standard was used in projects requiring secure, robust, high-speed bulk data transport. Novel extension mechanisms were derived that will combine these technologies for use by GridFTP, bandwidth management resources, and host CPU (central processing unit) acceleration. The result will be wire-rate encrypted Globus grid data transactions through offload for splintering, encryption, and compression. As the need for greater network bandwidth increases, there is an inherent need for faster CPUs. The best way to accelerate CPUs is through a network acceleration engine. Grid computing data transfers for the Globus tool set did not have wire-rate encryption or compression. Existing technology cannot keep pace with the greater bandwidths of backplane and network connections. Present offload engines with ports to Ethernet are 32 to 40 Gbps f-d at best. The best of ultra-high-speed offload engines use expensive ASICs (application specific integrated circuits) or NPUs (network processing units). The present state of the art also includes bonding and the use of multiple NICs that are also in the planning stages for future portability to ASICs and software to accommodate data rates at 100 Gbps. The remaining industry solutions are for carrier-grade equipment manufacturers, with costly line cards having multiples of 10-Gbps ports, or 100-Gbps ports such as CFP modules that interface to costly ASICs and related circuitry. All of the existing solutions vary in configuration based on requirements of the host, motherboard, or carriergrade equipment. The purpose of the innovation is to eliminate data bottlenecks within cluster, grid, and cloud computing systems
Effects of Alfvénic Drift on Diffusive Shock Acceleration at Weak Cluster Shocks
Kang, Hyesung; Ryu, Dongsu
2018-03-01
Non-detection of γ-ray emission from galaxy clusters has challenged diffusive shock acceleration (DSA) of cosmic-ray (CR) protons at weak collisionless shocks that are expected to form in the intracluster medium. As an effort to address this problem, we here explore possible roles of Alfvén waves self-excited via resonant streaming instability during the CR acceleration at parallel shocks. The mean drift of Alfvén waves may either increase or decrease the scattering center compression ratio, depending on the postshock cross-helicity, leading to either flatter or steeper CR spectra. We first examine such effects at planar shocks, based on the transport of Alfvén waves in the small amplitude limit. For the shock parameters relevant to cluster shocks, Alfvénic drift flattens the CR spectrum slightly, resulting in a small increase of the CR acceleration efficiency, η. We then consider two additional, physically motivated cases: (1) postshock waves are isotropized via MHD and plasma processes across the shock transition, and (2) postshock waves contain only forward waves propagating along with the flow due to a possible gradient of CR pressure behind the shock. In these cases, Alfvénic drift could reduce η by as much as a factor of five for weak cluster shocks. For the canonical parameters adopted here, we suggest η ∼ 10‑4–10‑2 for shocks with sonic Mach number M s ≈ 2–3. The possible reduction of η may help ease the tension between non-detection of γ-rays from galaxy clusters and DSA predictions.
Suttle, L. G.; Hare, J. D.; Lebedev, S. V.; Ciardi, A.; Loureiro, N. F.; Burdiak, G. C.; Chittenden, J. P.; Clayson, T.; Halliday, J. W. D.; Niasse, N.; Russell, D.; Suzuki-Vidal, F.; Tubman, E.; Lane, T.; Ma, J.; Robinson, T.; Smith, R. A.; Stuart, N.
2018-04-01
This work presents a magnetic reconnection experiment in which the kinetic, magnetic, and thermal properties of the plasma each play an important role in the overall energy balance and structure of the generated reconnection layer. Magnetic reconnection occurs during the interaction of continuous and steady flows of super-Alfvénic, magnetized, aluminum plasma, which collide in a geometry with two-dimensional symmetry, producing a stable and long-lasting reconnection layer. Optical Thomson scattering measurements show that when the layer forms, ions inside the layer are more strongly heated than electrons, reaching temperatures of Ti˜Z ¯ Te≳300 eV—much greater than can be expected from strong shock and viscous heating alone. Later in time, as the plasma density in the layer increases, the electron and ion temperatures are found to equilibrate, and a constant plasma temperature is achieved through a balance of the heating mechanisms and radiative losses of the plasma. Measurements from Faraday rotation polarimetry also indicate the presence of significant magnetic field pile-up occurring at the boundary of the reconnection region, which is consistent with the super-Alfvénic velocity of the inflows.
CALCUL DU SPECTRE DE REFLEXION DU MULTICOUCHE Ni/C DANS LE DOMAINE DES RAYONS X
Directory of Open Access Journals (Sweden)
A MEDDOUR
2000-12-01
Full Text Available Le pouvoir réflecteur d’un dioptre quelconque dans le domaine des rayons X est trop faible, mais il est toujours possible de choisir des systèmes pouvant présenter un pic de réflexion d’intensité importante autour d’une incidence caractéristique du matériau. Ce dernier est un multicouche, composé de deux couches déposées en sandwich. Nous avons élaboré un programme qui permet de calculer la réflexion d’un tel matériau en suivant la méthode d’Abelès dans laquelle une couche mince est représentée par une matrice carrée contenant toutes les informations nécessaires pour le calcul de la réflexion. Ce programme tient compte aussi des rugosités aux interfaces du multicouche, vue leur importante influence sur l’intensité du pic apparaissant sur le spectre de réflexion. L’application du programme au multicouche Ni/C a montré l’existence d’un pic centré autour de 31.32°. Son intensité est sensible au nombre de périodes dans le multicouche, aux épaisseurs des couches minces de Ni et de C et à la taille des rugosités des interfaces Ni/C et C/Ni.
Directory of Open Access Journals (Sweden)
Antonio Pedro Flores Auge
2000-10-01
Full Text Available Objetivo: verificar a freqüência de neoplasia intra-epitelial cervical (NIC em mulheres infectadas pelo vírus da imunodeficiência humana (HIV. Métodos: foram estudadas 99 mulheres HIV-soropositivas; o diagnóstico da infeccão pelo HIV foi realizado por meio de dois testes ELISA, complementados por teste Western blot ou de imunofluorescência indireta. Como grupo controle foram analisadas 104 mulheres que não apresentavam positividade no teste ELISA. Em ambos os grupos o rastreamento de NIC foi realizado por meio da associação de colpocitologia oncológica e colposcopia. Nos casos em que a colposcopia revelou existência de zonas de transformação anormal, o diagnóstico de NIC foi realizado mediante biopsia dirigida, complementada ou não por conização. Resultados: em 15 das 99 pacientes do grupo de estudo (15,2% foi encontrada neoplasia intra-epitelial cervical, sendo dez casos de NIC I, um de NIC II e quatro de NIC III. Entre as 104 mulheres do grupo controle, quatro (3,8% eram portadoras de neoplasia intra-epitelial cervical, encontrando-se um caso de NIC I e três de NIC III. Conclusão: a análise comparativa dos resultados evidenciou que a freqüência de neoplasia intra-epitelial cervical foi significantemente mais elevada entre as pacientes infectadas pelo HIV.Purpose: to verify the frequency of cervical intraepithelial neoplasia in human immunodeficiency virus (HIV ¾ infected women. Methods: ninety-nine HIV-seropositive women were studied. The diagnosis of the HIV infection was established through two ELISA tests complemented by Western blot test or indirect immunofluorescence test. As control group, 104 women whose ELISA test was not positive were analyzed. The investigation of cervical intraepithelial neoplasia was achieved by association of Pap smear and colposcopy in both groups. In the cases where colposcopy revealed existence of abnormal transformation zones, NIC diagnosis was obtained through colposcopy-guided biopsy
Charge transfer effects in electrocatalytic Ni-C revealed by x-ray photoelectron spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Haslam, G. E.; Chin, X.-Y.; Burstein, G. T. [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke St., Cambridge CB2 3QZ (United Kingdom); Sato, K.; Mizokawa, T. [Department of Complexity Science and Engineering, University of Tokyo, 5-1-5 Kashiwanoha, Chiba 277-8651 (Japan)
2012-06-04
Binary Ni-C thin-film alloys, which have been shown to be passive against corrosion in hot sulphuric acid solution whilst also being electrocatalytically active, were investigated by XPS to determine the oxidation state of the metal and carbon components. The Ni component produces a Ni 2p spectrum similar to that of metallic nickel (i.e., no oxidation occurs) but with a 0.3 eV shift to higher binding energy (BE) due to electron donation to the carbon matrix. The C 1s peak shows a shift to lower BE by accepting electrons from the Ni nanocrystals. A cluster-model analysis of the observed Ni 2p spectrum is consistent with the electron transfer from the nickel to the carbon.
Directory of Open Access Journals (Sweden)
Arif Imam Suroso
2011-08-01
Full Text Available Normal 0 false false false MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} This study was aimed at finding out the existence of stress in work towards employees’ performance, and knowing the indicators of each shaper element of that influencing the employees’ performance of plant department of agribusiness industry at PT. NIC. The method of this study is case study involving 155 respondents. Using the Structural Equation Modelling (SEM, it is known that the influence of stress in work towards employees’ performance is significantly negative. It means that the advance of stress in work can take the employees’ performance down. The advance of stress in work was stimulated by stressor, in this case are job pressure and lack of support. The relationship between stressor and stress in work is positively significant. Lack of support is the most influence indicator of stressor variable instead of job pressure. This study concludes that stress in work significantly influence the employees’ performance. Generally, stress in work at plant department of PT. NIC is in low category (41.9% and the performance is in high/good category (60.6%. It means that the existence of stress in work at this time have positive characteristics because it has played the role as motivator to work.
Directory of Open Access Journals (Sweden)
Taline Bavaresco
2012-12-01
Full Text Available OBJECTIVE: to validate the Nursing Intervention Classifications (NIC for the diagnosis 'Risk of Impaired Skin Integrity' in patients at risk of pressure ulcers (PU. METHOD: the sample comprised 16 expert nurses. The data was collected with an instrument about the interventions and their definitions were scored on a Likert scale by the experts. The data was analyzed statistically, using the calculation of weighted averages (WA. The study was approved by the Research Ethics Committee (56/2010. RESULTS: nine interventions were validated as 'priority' (WA ≥0.80, among them Prevention of PU (MP=0.92; 22 as 'suggested' (WA >0.50 and OBJETIVO: validar las intervenciones de la clasificación de enfermería NIC para el diagnóstico Riesgo de Integridad de la Piel Perjudicada en pacientes en riesgo de úlcera por presión (UP. MÉTODO: la muestra fue compuesta por 16 enfermeras experts. Los datos colectados en instrumento con las intervenciones, su definición y una escala Likert puntuada por las experts. Los datos analizados estadísticamente, utilizándose cálculo de media ponderada (MP. Estudio aprobado en Comité de Ética e Investigación (56/2010. RESULTADOS: se validaron nueve intervenciones como prioritarias (MP ≥0,80, entre ellas Prevención de UP (MP=0,92; 22 como sugeridas (MP >0,50 OBJETIVO: validar as intervenções da classificação de enfermagem NIC para o diagnóstico Risco de Integridade da Pele Prejudicada, em pacientes em risco de úlcera por pressão (UP. MÉTODO: a amostra foi composta por 16 enfermeiras experts. Os dados foram coletados em instrumento contendo a caracterização das participantes, além de uma tabela com as intervenções e a definição de cada uma delas, bem como uma escala Likert que foi pontuada pelas experts. Os dados foram analisados estatisticamente, utilizando-se cálculo de média ponderada (MP. O estudo foi aprovado em Comitê de Ética e Pesquisa (56/2010. RESULTADOS: validaram-se nove interven
Huertas Guzmán, Vilma Adriana; Ávila Vargas, Yuly Esperanza
2015-01-01
La presente investigación tiene por objetivo principal diseñar un modelo de optimización Financiera para el reconocimiento contable del impuesto diferido en Colombia– norma internacional contable 12 (nic12) y su incidencia en la información financiera a revelar, se parte de hacer un seguimiento bibliográfico desde las diferentes teorías que sean desarrollado a la luz de la temática central, se propone un estudio de caso dentro de la metodología y finalmente una propuesta de utilidad a las nec...
Possible Noise Nature of Elsässer Variable z- in Highly Alfvénic Solar Wind Fluctuations
Wang, X.; Tu, C.-Y.; He, J.-S.; Wang, L.-H.; Yao, S.; Zhang, L.
2018-01-01
It has been a long-standing debate on the nature of Elsässer variable z- observed in the solar wind fluctuations. It is widely believed that z- represents inward propagating Alfvén waves and interacts nonlinearly with z+ (outward propagating Alfvén waves) to generate energy cascade. However, z- variations sometimes show a feature of convective structures. Here we present a new data analysis on autocorrelation functions of z- in order to get some definite information on its nature. We find that there is usually a large drop on the z- autocorrelation function when the solar wind fluctuations are highly Alfvénic. The large drop observed by Helios 2 spacecraft near 0.3 AU appears at the first nonzero time lag τ = 81 s, where the value of the autocorrelation coefficient drops to 25%-65% of that at τ = 0 s. Beyond the first nonzero time lag, the autocorrelation coefficient decreases gradually to zero. The drop of z- correlation function also appears in the Wind observations near 1 AU. These features of the z- correlation function may suggest that z- fluctuations consist of two components: high-frequency white noise and low-frequency pseudo structures, which correspond to flat and steep parts of z- power spectrum, respectively. This explanation is confirmed by doing a simple test on an artificial time series, which is obtained from the superposition of a random data series on its smoothed sequence. Our results suggest that in highly Alfvénic fluctuations, z- may not contribute importantly to the interactions with z+ to produce energy cascade.
Directory of Open Access Journals (Sweden)
Carlos VARGAS VASSEROT
2007-01-01
Full Text Available De la NIC 32 se desprende que las aportaciones de los socios al capital se reconocerán como patrimonio neto sólo si la cooperativa tiene un derecho incondicional a rehusar su reembolso. Lo que ocurre es que nuestro ordenamiento cooperativo, en aras de proteger al máximo al socio, incluso frente al riesgo de amenazar la estabilidad de la cooperativa, históricamente ha reconocido un derecho cuasi absoluto al reembolso de sus aportaciones, que la cooperativa tiene que atender aunque esto signifique tener que reducir el capital estatutario o incluso la disolución de la misma. Esto, tal como está en nuestra legislación cooperativa reconocido el derecho al reembolso de las aportaciones del socio, que aunque es posible someterlo a una serie de limitaciones impuestas temporales e incluso cuantitativa, no se puede impedir su ejercicio, significa que todas las aportaciones al capital social de las cooperativas que hayan hecho o que hagan los socios deberán ser calificados a efectos contables como pasivos exigibles y no como hasta ahora como recursos propios. Por tanto, en el ordenamiento cooperativo español, si se quiere evitar que todas las aportaciones de los socios al capital cooperativo sean consideradas recursos ajenos, es necesario realizar una serie de modificaciones legales en la articulación del derecho de reembolso y en el propio régimen del capital social. En el presente estudio se abordará la proyectada reforma de la Ley 27/1999 de Cooperativas para adaptarse al contenido de la NIC 32 y se estudiarán cuáles son las consecuencias de calificar contablemente las aportaciones sociales de los socios como recursos ajenos y no como neto patrimonial como hasta ahora habíamos hecho. /According the IAS 32 co-operative social shares will no longer be considered as elements of capital. They will be recognised as net worth just if the co-operative has an unconditional right to reject its redemption. However, in order to protect to members
Boström, O; Fredriksson, R; Håland, Y; Jakobsson, L; Krafft, M; Lövsund, P; Muser, M H; Svensson, M Y
2000-03-01
Long-term whiplash associated disorders (WAD) 1-3 sustained in low velocity rear-end impacts is the most common disability injury in Sweden. Therefore, to determine neck injury mechanisms and develop methods to measure neck-injury related parameters are of importance for current crash-safety research. A new neck injury criterion (NIC) has previously been proposed and evaluated by means of dummy, human and mathematical rear-impact simulations. So far, the criterion appears to be sensitive to the major car and collision related risk factors for injuries with long-term consequences. To further evaluate the applicability of NIC, four seats were tested according to a recently proposed sled-test procedure. 'Good' as well as 'bad' seats were chosen on the basis of a recently presented disability risk ranking list. The dummy used in the current tests was the Biofidelic Rear Impact Dummy (BioRID). The results of this study showed that NICmax values were generally related to the real-world risk of long-term WAD 1-3. Furthermore, these results suggested that NICmax calculated from sled tests using the BioRID dummy can be used for evaluating the neck injury risk of different car seats.
PLASMA HEATING INSIDE INTERPLANETARY CORONAL MASS EJECTIONS BY ALFVÉNIC FLUCTUATIONS DISSIPATION
Energy Technology Data Exchange (ETDEWEB)
Li, Hui; Wang, Chi; Zhang, Lingqian [State Key Laboratory of Space Weather, National Space Science Center, CAS, Beijing, 100190 (China); He, Jiansen [School of Earth and Space Sciences, Peking University, Beijing, 100871 (China); Richardson, John D.; Belcher, John W. [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA (United States); Tu, Cui, E-mail: hli@spaceweather.ac.cn [Laboratory of Near Space Environment, National Space Science Center, CAS, Beijing, 100190 (China)
2016-11-10
Nonlinear cascade of low-frequency Alfvénic fluctuations (AFs) is regarded as one of the candidate energy sources that heat plasma during the non-adiabatic expansion of interplanetary coronal mass ejections (ICMEs). However, AFs inside ICMEs were seldom reported in the literature. In this study, we investigate AFs inside ICMEs using observations from Voyager 2 between 1 and 6 au. It has been found that AFs with a high degree of Alfvénicity frequently occurred inside ICMEs for almost all of the identified ICMEs (30 out of 33 ICMEs) and for 12.6% of the ICME time interval. As ICMEs expand and move outward, the percentage of AF duration decays linearly in general. The occurrence rate of AFs inside ICMEs is much less than that in ambient solar wind, especially within 4.75 au. AFs inside ICMEs are more frequently presented in the center and at the boundaries of ICMEs. In addition, the proton temperature inside ICME has a similar “W”-shaped distribution. These findings suggest significant contribution of AFs on local plasma heating inside ICMEs.
Anàlisi de la situació dels residus d’aparells elèctrics i electrònics (RAEE) al Gironès
Terol Torres, Júlia; Ros Badosa, Ester; Barbero Bueno, Verónica
2007-01-01
Estudi de la situació dels residus d’aparells elèctrics i electrònics al Gironès reformulant la seva gestió actual, valorant si caldria fer una nova planta, així com una campanya de sensibilització social i construcció d’una possible planta intermediària de triatge de RAEE per a la comarca del Gironès
Directory of Open Access Journals (Sweden)
Romulus COSTACHE
2013-02-01
Full Text Available This paper aims to analyze, especially in terms of space, the phenomenon of flooding for Cernăteşti locality, dated May 29, 2012. In the context of high intensity torrential rains, in a short period of time, in this period occurred flash-floods of high intensity on Slănic river, producing catastrophic floods in Cernăteşti locality. Thus, for a rigorous analysis of spatial occurrence of these hydrological risk phenomena, were used detailed cartographic materials like 1:5000 topographic plans overlapped to analyzed territory. Also, have been analyzed and synoptic conditions directly responsible for floods extent with disastrous effects on socio-economic component. The results certified that, due to the synergy between torrential rainfall and local morphometry, 60 ha of Slănic water meadow sector was flooded on Cernăteşti locality segment, when more than 20 buildings and almost 500 m of the local accessiblity infrastucture were damaged
Wang, X.; Wu, H.; Tu, C. Y.; Wang, L.; He, J.; Tian, H.
2017-12-01
Sunward-propagating Alfvénic fluctuations with a power-law spectrum (SAFP) have been recently reported to be a significant physical phenomenon in the solar wind. However, some characteristics of these SAFPs are still unknown. Here we develop a new method for identifying SAFPs. In this method, we can identify all SAFPs with any value of θRB (angle between the global magnetic field and the radial direction). We find 508 SAFPs using the WIND spacecraft observation from 1995 to 2014. We also find that SAFP occurs more frequently when θRB equals 90°. The spectral index with an average -1.77 changes continuously from -2.18 for the parallel to -1.71 for the perpendicular. SAFPs occur more at the maximum and tend to be observed in the slow solar wind especially at solar minimum. We also apply the new method to identify anti-sunward-propagating Alfvénic fluctuations with a power-law spectrum (AFP) for comparison. The number of SAFPs is much less than AFPs, and the cases with local bending account for about half of all observed cases. SAFPs have a preference for negative σc and ASFs for positive. The statistical results demonstrate that SAFP has a steeper and weaker power spectrum and present a weaker power anisotropy than that of AFP. These new results may reveal new insight into the physical mechanism of the SAFP generation.
Directory of Open Access Journals (Sweden)
Juan Rodés
Full Text Available La investigación traslacional es una nueva disciplina que incorpora aspectos de ciencia básica e investigación clínica y, por tanto, requiere entrenamiento y recursos que no se suelen encontrar en los laboratorios o en departamentos clínicos. Es por ello que los institutos donde se combinan ambos tipos de investigación como universidades, centros de investigación básica y hospitales de alto nivel asistencial, son las instituciones ideales para realizar este tipo de investigación. En el Hospital Clínic de Barcelona se ha producido un cambio en el transcurso de los últimos 40 años. Este cambio ha venido marcado por varios hechos, a destacar la creación de los servicios clínicos que substituyeron a las antiguas cátedras, la creación de los servicios de medicina, las becas post-residencia, los años sabáticos, la Fundación Clínic para la Investigación Biomédica y finalmente la puesta en marcha del Institut d'Investigacions Biomèdiques August Pi i Sunyer (IDIBAPS. En los últimos años es importante destacar también la reorganización del hospital en institutos y centros. La producción científica en estos últimos años se ha mantenido en alza, tanto en número de publicaciones como del impacto de las revistas en las que se publica. El IDIBAPS ha alcanzado unos resultados similares a los obtenidos por los mejores institutos de investigación del mundo occidental.
NaNet: a low-latency NIC enabling GPU-based, real-time low level trigger systems
International Nuclear Information System (INIS)
Ammendola, Roberto; Biagioni, Andrea; Frezza, Ottorino; Cicero, Francesca Lo; Lonardo, Alessandro; Paolucci, Pier Stanislao; Rossetti, Davide; Simula, Francesco; Tosoratto, Laura; Vicini, Piero; Fantechi, Riccardo; Lamanna, Gianluca; Pantaleo, Felice; Piandani, Roberto; Sozzi, Marco; Pontisso, Luca
2014-01-01
We implemented the NaNet FPGA-based PCIe Gen2 GbE/APElink NIC, featuring GPUDirect RDMA capabilities and UDP protocol management offloading. NaNet is able to receive a UDP input data stream from its GbE interface and redirect it, without any intermediate buffering or CPU intervention, to the memory of a Fermi/Kepler GPU hosted on the same PCIe bus, provided that the two devices share the same upstream root complex. Synthetic benchmarks for latency and bandwidth are presented. We describe how NaNet can be employed in the prototype of the GPU-based RICH low-level trigger processor of the NA62 CERN experiment, to implement the data link between the TEL62 readout boards and the low level trigger processor. Results for the throughput and latency of the integrated system are presented and discussed.
NaNet: a low-latency NIC enabling GPU-based, real-time low level trigger systems
Energy Technology Data Exchange (ETDEWEB)
Ammendola, Roberto [INFN, Rome – Tor Vergata (Italy); Biagioni, Andrea; Frezza, Ottorino; Cicero, Francesca Lo; Lonardo, Alessandro; Paolucci, Pier Stanislao; Rossetti, Davide; Simula, Francesco; Tosoratto, Laura; Vicini, Piero [INFN, Rome – Sapienza (Italy); Fantechi, Riccardo [CERN, Geneve (Switzerland); Lamanna, Gianluca; Pantaleo, Felice; Piandani, Roberto; Sozzi, Marco [INFN, Pisa (Italy); Pontisso, Luca [University, Rome (Italy)
2014-06-11
We implemented the NaNet FPGA-based PCIe Gen2 GbE/APElink NIC, featuring GPUDirect RDMA capabilities and UDP protocol management offloading. NaNet is able to receive a UDP input data stream from its GbE interface and redirect it, without any intermediate buffering or CPU intervention, to the memory of a Fermi/Kepler GPU hosted on the same PCIe bus, provided that the two devices share the same upstream root complex. Synthetic benchmarks for latency and bandwidth are presented. We describe how NaNet can be employed in the prototype of the GPU-based RICH low-level trigger processor of the NA62 CERN experiment, to implement the data link between the TEL62 readout boards and the low level trigger processor. Results for the throughput and latency of the integrated system are presented and discussed.
NaNet:a low-latency NIC enabling GPU-based, real-time low level trigger systems
INSPIRE-00646837; Biagioni, Andrea; Fantechi, Riccardo; Frezza, Ottorino; Lamanna, Gianluca; Lo Cicero, Francesca; Lonardo, Alessandro; Paolucci, Pier Stanislao; Pantaleo, Felice; Piandani, Roberto; Pontisso, Luca; Rossetti, Davide; Simula, Francesco; Sozzi, Marco; Tosoratto, Laura; Vicini, Piero
2014-01-01
We implemented the NaNet FPGA-based PCI2 Gen2 GbE/APElink NIC, featuring GPUDirect RDMA capabilities and UDP protocol management offloading. NaNet is able to receive a UDP input data stream from its GbE interface and redirect it, without any intermediate buffering or CPU intervention, to the memory of a Fermi/Kepler GPU hosted on the same PCIe bus, provided that the two devices share the same upstream root complex. Synthetic benchmarks for latency and bandwidth are presented. We describe how NaNet can be employed in the prototype of the GPU-based RICH low-level trigger processor of the NA62 CERN experiment, to implement the data link between the TEL62 readout boards and the low level trigger processor. Results for the throughput and latency of the integrated system are presented and discussed.
Directory of Open Access Journals (Sweden)
Rosimeire da Silva Vargas
2007-06-01
Full Text Available Trata-se de um estudo de caso, que teve como objetivos descrever a sistematização da assistência de enfermagem a um portador de cirrose hepática e relatar as dificuldades encontradas na implementação dessa assistência. Utilizou-se o modelo conceitual de Horta, aplicando-se os Diagnósticos de Enfermagem da NANDA, Intervenções de Enfermagem da NIC e Resultados de Enfermagem da NOC. O estudo foi desenvolvido em um hospital público do Distrito Federal, em Setembro de 2005, na unidade de Pronto Socorro. Entre os diagnósticos de enfermagem identificados incluíram-se confusão aguda, constipação e conhecimento deficiente. Dentre as dificuldades apontadas destacaram-se o desinteresse da equipe de enfermagem e do paciente, deficiência de conhecimento e despreparo dos profissionais, recursos materiais e humanos insuficientes para dispensar o cuidado.Con el propósito de describir la Sistematización de la asistencia de Enfermería e de apuntar las dificultades de su aplicación, fue realizado en "estudio de caso" de un portador de cirrosis hepática. Para realizar el estudio, se utilizó el modelo conceptual de Horta y se aplicaron lo Diagnósticos de Enfermería de NANDA, las intervenciones de Enfermería de NIC y los resultados de Enfermería de la NOC. El estudio fue realizado durante el año 2005 en la unidad de Pronto socorro de un hospital público del Distrito Federal. Los resultados del estudio permitieron identificar los siguientes diagnósticos de enfermería: confusión aguda, constipación y conocimiento deficiente. Desde el punto de vista de las dificultades enfrentadas durante la realización del estudio, consideramos importante mencionar las siguientes: el desinterés tanto del equipo de enfermería como del propio paciente, la falta de recursos materiales, el déficit de conocimientos y la escasa preparación de los profesionales, en síntesis, la insuficiencia de los recursos materiales y humanos para realizar los cuidados
NaNet: a flexible and configurable low-latency NIC for real-time trigger systems based on GPUs
International Nuclear Information System (INIS)
Ammendola, R; Biagioni, A; Frezza, O; Lonardo, A; Cicero, F Lo; Paolucci, P S; Rossetti, D; Simula, F; Tosoratto, L; Vicini, P; Lamanna, G; Pantaleo, F; Sozzi, M
2014-01-01
NaNet is an FPGA-based PCIe X8 Gen2 NIC supporting 1/10 GbE links and the custom 34 Gbps APElink channel. The design has GPUDirect RDMA capabilities and features a network stack protocol offloading module, making it suitable for building low-latency, real-time GPU-based computing systems. We provide a detailed description of the NaNet hardware modular architecture. Benchmarks for latency and bandwidth for GbE and APElink channels are presented, followed by a performance analysis on the case study of the GPU-based low level trigger for the RICH detector in the NA62 CERN experiment, using either the NaNet GbE and APElink channels. Finally, we give an outline of project future activities
NaNet: a flexible and configurable low-latency NIC for real-time trigger systems based on GPUs
INSPIRE-00646837; Biagioni, A.; Frezza, O.; Lamanna, G.; Lonardo, A.; Lo Cicero, F.; Paolucci, P.S.; Pantaleo, F.; Rossetti, D.; Simula, F.; Sozzi, M.; Tosoratto, L.; Vicini, P.
2014-02-21
NaNet is an FPGA-based PCIe X8 Gen2 NIC supporting 1/10 GbE links and the custom 34~Gbps APElink channel. The design has GPUDirect RDMA capabilities and features a network stack protocol offloading module, making it suitable for building low-latency, real-time GPU-based computing systems. We provide a detailed description of the NaNet hardware modular architecture. Benchmarks for latency and bandwidth for GbE and APElink channels are presented, followed by a performance analysis on the case study of the GPU-based low level trigger for the RICH detector in the NA62 CERN experiment, using either the NaNet GbE and APElink channels. Finally, we give an outline of project future activities.
NaNet: a flexible and configurable low-latency NIC for real-time trigger systems based on GPUs
Energy Technology Data Exchange (ETDEWEB)
Ammendola, R [INFN Sezione di Roma Tor Vergata, Via della Ricerca Scientifica, 1 - 00133 Roma (Italy); Biagioni, A; Frezza, O; Lonardo, A; Cicero, F Lo; Paolucci, P S; Rossetti, D; Simula, F; Tosoratto, L; Vicini, P [INFN Sezione di Roma, P.le Aldo Moro, 2 - 00185 Roma (Italy); Lamanna, G; Pantaleo, F; Sozzi, M [INFN Sezione di Pisa, Via F. Buonarroti 2 - 56127 Pisa (Italy)
2014-02-01
NaNet is an FPGA-based PCIe X8 Gen2 NIC supporting 1/10 GbE links and the custom 34 Gbps APElink channel. The design has GPUDirect RDMA capabilities and features a network stack protocol offloading module, making it suitable for building low-latency, real-time GPU-based computing systems. We provide a detailed description of the NaNet hardware modular architecture. Benchmarks for latency and bandwidth for GbE and APElink channels are presented, followed by a performance analysis on the case study of the GPU-based low level trigger for the RICH detector in the NA62 CERN experiment, using either the NaNet GbE and APElink channels. Finally, we give an outline of project future activities.
Directory of Open Access Journals (Sweden)
Belén Álvarez Pérez
2015-12-01
Full Text Available En el trabajo se presenta un estudio de cómo la nueva configuración del patrimonio neto establecida en las NIIF/NIC y la adaptación de la normativa contable española a las mismas pueden causar modificaciones en la cifra de capital social de las cooperativas y, por tanto, en sus fondos propios, con la incidencia que ello supone en diversas operaciones societarias.
Directory of Open Access Journals (Sweden)
Borges Sonia Cristina Vidigal
2004-01-01
Full Text Available OBJETIVO: avaliar a taxa de detecção do papilomavírus humano (HPV de alto risco oncogênico em pacientes portadoras de neoplasia intra-epitelial cervical (NIC e verificar se existe associação entre a presença do vírus e a carga viral com a gravidade da lesão cervical, assim como qual o melhor ponto de corte para predizer a gravidade desta lesão. MÉTODOS: estudo de corte transversal, no qual foram selecionadas 110 mulheres com citologia e/ou biópsia com diagnóstico de NIC. Todas foram submetidas à coleta de nova citologia oncológica, captura híbrida II (CH II, colposcopia e conização pela cirurgia de alta freqüência com alça. RESULTADOS: a taxa global de detecção do HPV de alto risco oncogênico na população estudada foi de 77,3%. À avaliação histopatológica, 81 (73,7% mulheres apresentavam NIC e, nestas mulheres, a taxa de detecção do DNA-HPV foi de 87,6%, sendo de 85,9% nas mulheres com NIC 2 ou 3. A CH II apresentou sensibilidade de 87,7%, especificidade de 56%, valor preditivo positivo de 86,6% e valor preditivo negativo de 58,3%, com odds ratio (OR de 7,76 (2,47 < OR < 25,15 no diagnóstico de NIC 2 ou 3. Com ponto de corte de carga viral de 20 pg/mL, selecionado a partir da curva ROC, o valor preditivo positivo da CH II no diagnóstico da NIC 2 ou 3, na população estudada, foi de 81,3%. CONCLUSÕES: a taxa de detecção do DNA-HPV nas pacientes portadoras de NIC foi de 77,3% e, em mulheres com NIC 2 e 3, foi de 85,9%. O melhor ponto de corte da carga viral para a predição da lesão cervical de alto grau foi de 20 pg/mL. Acima deste ponto a probabilidade de detecção do HPV de alto risco oncogênico é maior que 80%.
Bimetallic poly- and oligo-nuclear complexes based on a rhodium(III) metalloligand
Vasilchenko, Danila B.; Venediktov, Anatoliy B.; Korenev, Sergey V.; Filatov, Evgeniy Yu.; Baidina, Iraida A.; Nadolinnyi, Vladimir A.
2012-10-01
Interaction of trans-[Rh(i-Nic)4Cl2]3- anions (i-Nic- - isonicotinate anion) with Cuaq2+ and Coaq2+ cations in water has afforded complex salts Co3[Rh(i-Nic)4Cl2]2·17H2O (1) and Cu3[Rh(i-Nic)4Cl2]2·14H2O (2). Oligonuclear character of 1 and 2 has been established. A coordination polymer Cu5[Rh(i-Nic)4Cl2]2(i-Nic)2(OH)2·2H2O (3) has been crystallized by hydrothermal treatment of 2 at 160 °C, and its structure was determined by X-ray structural analysis. EPR data for the complexes has been collected and interpreted. Thermal decomposition of the salts was studied by c-DTA. Bimetallic alloys rhodium-copper and rhodium-cobalt have been obtained as final products of thermal decomposition.
Reig Bolaño, Ramon; Armengol Vila, Xavier; Domènech Mestres, Carles; Serra Espaulella, Jordi
2013-01-01
Aquesta comunicació posa en comú la metodologia de treball de l’assignatura Projecte Integrat II del Grau en Enginyeria Mecatrònica de la UVIC, assignatura del segon semestre del 3r. curs que integra les diferents disciplines del grau: el disseny mecànic, el disseny electrònic, la programació de dispositius, la planificació i execució de projectes mecatrònics i el contacte amb la realitat empresarial. S’ha realitzat una combinació equilibrada de l’esperit i les formes dels concursos de robòti...
Directory of Open Access Journals (Sweden)
Vázquez-Corzo Sara
2003-01-01
Full Text Available OBJETIVO: Determinar si anticuerpos séricos contra E4, E7 y Ras pueden ser utilizados como marcadores de lesiones tempranas del cérvix uterino asociadas al virus del papiloma humano. MATERIAL Y MÉTODOS: Entre marzo de 1999 y abril de 2000 se realizó un estudio sero-epidemiológico de casos y controles en la clínica de displasias del Hospital General Doctor Gea González, en la Ciudad de México, en 116 muestras de suero para evaluar la presencia de anticuerpos anti-E4, E7 y Ras utilizando un ELISA de captura. Se estimaron razones de momios e intervalos de confianza de 95% RESULTADOS: Anticuerpos anti-E7 se asociaron a mujeres con lesiones NIC III, mientras que anticuerpos anti-E4 y anti-Ras fueron más frecuentes en lesiones NIC I-II. Al evaluar el perfil de anticuerpos que presentaron las mujeres, encontramos que a anticuerpos contra dos proteínas predicen la existencia de una lesión NIC I-II, y b la presencia de tres anticuerpos predicen una lesión NIC III. CONCLUSIONES: La detección de anticuerpos séricos contra E4, E7 y Ras en combinación con otras técnicas de diagnóstico, podrían ser de utilidad para detectar oportunamente a mujeres con lesiones tempranas asociadas al Virus del Papiloma Humano y en riesgo de desarrollar cáncer.
Alfvénic Dynamics and Fine Structuring of Discrete Auroral Arcs: Swarm and e-POP Observations
Miles, D.; Mann, I. R.; Pakhotin, I.; Burchill, J. K.; Howarth, A. D.; Knudsen, D. J.; Wallis, D. D.; Yau, A. W.; Lysak, R. L.
2017-12-01
The electrodynamics associated with dual discrete arc aurora with anti-parallel flow along the arcs were observed nearly simultaneously by the enhanced Polar Outflow Probe (e-POP) and the Swarm A and C spacecraft. Auroral imaging from e-POP reveal 1-10 km structuring of the arcs, which move and evolve on second timescales and confound the traditional single-spacecraft field-aligned current algorithms. High-cadence magnetic data from e-POP shows 1-10 Hz, presumably Alfvénic perturbations co-incident with and at the same scale size as the observed dynamic auroral fine structures. High-cadence electric and magnetic field data from Swarm A reveals non-stationary electrodynamics involving reflected and interfering Alfvén waves and signatures of modulation consistent with trapping in the Ionospheric Alfvén Resonator (IAR). Together, these observations suggest a role for Alfven waves, perhaps also the IAR, in discrete arc dynamics on 0.2 - 10s timescales and 1-10 km spatial scales.
Directory of Open Access Journals (Sweden)
Juliana Barroso Zimmermmann
2006-06-01
Full Text Available OBJETIVO: avaliar a associação entre a contagem de linfócitos T CD4+ e a gravidade da neoplasia intra-epitelial cervical em pacientes HIV positivas. MÉTODOS: estudo transversal no qual foram incluídas 87 pacientes infectadas pelo HIV, confirmado por testes sorológicos prévios. Todas eram portadoras do HPV cervical, diagnosticado por meio da reação em cadeia da polimerase. Foram realizados anamnese, exame físico e colposcopia de todas em pacientes. A biópsia do colo uterino foi realizada quando indicada pelo exame colposcópico. Os resultados histopatológicos foram classificados com neoplasia intra-epitelial de baixo grau (NIC I ou de alto grau (NIC II e II. A associação entre a contagem de linfócitos T CD4+ e a gravidade da lesão foi verificada por meio da comparação de médias utilizando a análise da variância (ANOVA. RESULTADOS: entre as 60 pacientes biopsiadas foram encontrados 24 casos (40,0% com NIC I, oito (13,3% NIC II, três (5% NIC III, 14 (23,3% pacientes somente com cervicite crônica e 11 (18,3% apresentando efeito citopático produzido pelo HPV, mas sem perda da polaridade celular. Isso equivale a 35 mulheres com lesão intra-epitelial de baixo grau (NIC I + HPV (58,3% e 11 (18,3% com lesão intra-epitelial de alto grau (NIC II + NIC III. A associação entre a média da contagem de linfócitos T CD4+ e a gravidade da lesão intra-epitelial cervical não foi significativa (p=0,901. CONCLUSÕES: não houve associação entre a contagem de linfócitos T CD4+ e a gravidade da lesão intra-epitelial do colo uterino, diagnosticada pelo exame histopatológico.PURPOSE: to evaluate association between CD4+ cell count and cervical intraepithelial lesion severity in HIV-infected women. METHODS: cross-sectional study of 87 HIV-infected patients which were confirmed by previous serologic examinations. All had cervical HPV diagnosed by polymerase chain reaction (PCR. All patients underwent anamnesis, physical examinations and
Directory of Open Access Journals (Sweden)
K. Kunte
2009-11-01
Full Text Available This paper describes a recent sighting of the Chestnut Palmfly Butterfly, Elymnias obnubila Marshall & de Nicéville, 1883 (Lepidoptera: Nymphalidae: Satyrinae from Ngenpui Wildlife Sanctuary in southern Mizoram. It represents a range extension of the species by 1,500km north of its previously known range in southern Myanmar and Thailand, and an addition to the Indian butterfly fauna.
Orbea Terán, María Elena
2012-01-01
Esta obra tiene como fin explicar al lector el proceso de aplicación de las NIIF en la Propiedad, Planta y Equipo de la empresa de servicios Urbano Express, para lo cual se analiza las NIIF (Normas Internacionales de Información Financiera) y NIC (Normas Internacional de Contabilidad) requeridas, se describe todo el funcionamiento de la organización, y posteriormente se aplican las normas estudiadas para conocer los efectos sobre la información de los Estados Financieros. Las Normas Intern...
Linear growth rates of resistive tearing modes with sub-Alfvénic streaming flow
International Nuclear Information System (INIS)
Wu, L. N.; Ma, Z. W.
2014-01-01
The tearing instability with sub-Alfvénic streaming flow along the external magnetic field is investigated using resistive MHD simulation. It is found that the growth rate of the tearing mode instability is larger than that without the streaming flow. With the streaming flow, there exist two Alfvén resonance layers near the central current sheet. The larger perturbation of the magnetic field in two closer Alfvén resonance layers could lead to formation of the observed cone structure and can largely enhance the development of the tearing mode for a narrower streaming flow. For a broader streaming flow, a larger separation of Alfvén resonance layers reduces the magnetic reconnection. The linear growth rate decreases with increase of the streaming flow thickness. The growth rate of the tearing instability also depends on the plasma beta (β). When the streaming flow is embedded in the current sheet, the growth rate increases with β if β s , but decreases if β > β s . The existence of the specific value β s can be attributed to competition between the suppressing effect of β and the enhancing effect of the streaming flow on the magnetic reconnection. The critical value β s increases with increase of the streaming flow strength
Prestes, Alan; Klausner, Virginia; Ojeda-González, Arian
2017-11-01
The interaction between a fast-speed and a low-speed stream causes large-amplitude Alfvénic fluctuations; consequently, the intermittency and the brief intervals of southward magnetic field associated with Alfvén waves may cause high levels of AE activity, the so-called high-intensity, long-duration, continuous AE activity (HILDCAA). In this article, the 4 h windowed Pearson cross-correlation (4WPCC) between the solar wind velocity and the interplanetary magnetic field (IMF) components is performed in order to confirm that the less strict HILDCAA (HILDCAAs*) events include a larger number of Alfvén waves than the HILDCAA events, once HILDCAAs disregard part of the phenomenon. Actually, a HILDCAA event is entirely contained within a HILDCAA* event. However, the opposite is not necessarily true. This article provides a new insight, since the increase of Alfvén waves results in an increase of auroral electrojet activity; consequently, it can cause HILDCAAs* events. Another important aspect of this article is that the superposed epoch analysis (SEA) results reaffirm that the HILDCAAs* are associated with high-speed solar streams (HSSs), and also the HILDCAAs* present the same physical characteristics of the traditional HILDCAA events.
Alfvénic turbulence in solar wind originating near coronal hole boundaries: heavy-ion effects?
Directory of Open Access Journals (Sweden)
B. Bavassano
2006-03-01
Full Text Available The mid-latitude phases of the Ulysses mission offer an excellent opportunity to investigate the solar wind originating near the coronal hole boundaries. Here we report on Alfvénic turbulence features, revealing a relevant presence of in-situ generated fluctuations, observed during the wind rarefaction phase that charaterizes the transition from fast to slow wind. Heavy-ion composition and magnetic field measurements indicate a strict time correspondence of the locally generated fluctuations with 1 the crossing of the interface between fast and slow wind and 2 the presence of strongly underwound magnetic field lines (with respect to the Parker spiral. Recent studies suggest that such underwound magnetic configurations correspond to fast wind magnetic lines that, due to footpoint motions at the Sun, have their inner leg transferred to slow wind and are stretched out by the velocity gradient. If this is a valid scenario, the existence of a magnetic connection across the fast-slow wind interface is a condition that, given the different state of the two kinds of wind, may favour the development of processes acting as local sources of turbulence. We suggest that heavy-ion effects could be responsible of the observed turbulence features.
Directory of Open Access Journals (Sweden)
Oda Gómez
2011-01-01
Full Text Available Esta investigación de tipo documental y empírica tiene el propósito de analizar la armonización contable material de las Normas Internacionales de Contabilidad (nic y las Normas Internacionales de Información Financiera (niif de los entes emisores no financieros; para ello, se abordó inicialmente el proceso de aplicación de las mismas en el nivel mundial, así como el proceso correspondiente en Venezuela. Se consultó el anuario estadístico de 2007 emitido por la Bolsa de Valores de Caracas; de un total de 49 empresas que aparecen en él, veinte corresponden al sector financiero y de seguros, y veintinueve al sector no financiero; de estas últimas se obtuvieron los estados financieros auditados comparativos de los años 2007-2006 de veinticinco empresas, que fue la muestra que se analiza. El análisis de los resultados indica que para la mayoría de las unidades estudiadas, en más del 70% las prácticas de contabilidad utilizadas por las empresas objeto de estudio coinciden con las disposiciones establecidas por las nic-niif. Sin embargo, se puede observar que de los 221 atributos examinados, 48% no aplica a las empresas objeto de estudio o no aparece la información en los elementos de los estados financieros; al aplicar el índice de Jaccard son excluidos de la base de datos para determinar la similitud.
Energy Technology Data Exchange (ETDEWEB)
Kilkenny, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bell, P. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bradley, D. K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bleuel, D. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Caggiano, J. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Dewald, E. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hsing, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kalantar, H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kauffman, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Moody, J. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Schneider, M. B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Shaughnessy, D. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Shelton, R. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Yeamans, C. B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Batha, S. H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Grim, G. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Herrmann, H. W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Merrill, F. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Leeper, R. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sangster, T. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Edgell, D. H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Glebov, V. Y. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Regan, S. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Frenje, J. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gatu-Johnson, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Petrasso, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rindernecht, H. G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Zylstra, A. B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cooper, G. W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ruiz, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-01-05
At the completion of the National Ignition Campaign NIF had about 36 different types of diagnostics. These were based on several decades of development on Nova and OMEGA and involved the whole US ICF community. A plan for a limited of NIF Diagnostics was documented by the Joint Central Diagnostic Team in the NIF Conceptual Design Report in 1994. These diagnostics and many more were installed diagnostics by two decades later. We give a short description of each of the 36 different types of NIC diagnostics grouped by the function of the diagnostics, namely target drive, target response and target assembly, stagnation and burn. A comparison of NIF diagnostics with the Nova diagnostics shows that the NIF diagnostic capability is broadly equivalent to that of Nova’s in 1999. NIF diagnostics have a much greater degree of automation and rigor than Nova’s and the NIF diagnostic suite incorporates some scientific innovation compared to Nova and OMEGA namely one much higher speed x-ray imager. Directions for future NIF diagnostics are discussed.
One electron oxidation of Ni(II)-iminodiacetate by carbonate radical
International Nuclear Information System (INIS)
Mandal, P.C.; Bardhan, D.K.; Bhattacharyya, S.N.
1995-01-01
Reactions of carbonate radical (CO 3 - ), generated by photolysis or by radiolysis of a carbonate solution with nickel(II)-iminodiacetate (Ni(II)IDA) were studied at pH 10.5 and ionic strength (I)=0.2 mol x dm -3 . The stable product arising from the ligand degradation in the complex is mainly glyoxalic acid. Time-resolved spectroscopy and transient kinetics were studied using flash photolysis. From the kinetic data it was suggested that the carbonate radical initially reacts with Ni(III)IDA with a rate constant (2.4.±0.4) x 10 6 dm 3 x mol -1 x s -1 to form a Ni(II)IDA species which, however, undergoes a first-order transformation (k=2.7 x 10 2 x s -1 ) to give a radical intermediate of the type Ni(II)RNHCHCO - 2 ) which rapidly forms an adduct containing a Ni-C bond. This adduct decays very slowly to give rise to glyoxalic acid. From a consideration of equilibrium between Ni(II)IDA and Ni(III)IDA, the one electron reduction potential for the Ni(III)IDA/Ni(II)IDA couple was determined to be 1.467 V. (author) 30 refs.; 5 figs
Disruption of Alfvénic turbulence by magnetic reconnection in a collisionless plasma
Mallet, Alfred; Schekochihin, Alexander A.; Chandran, Benjamin D. G.
2017-12-01
We calculate the disruption scale \\text{D}$ at which sheet-like structures in dynamically aligned Alfvénic turbulence are destroyed by the onset of magnetic reconnection in a low- collisionless plasma. The scaling of \\text{D}$ depends on the order of the statistics being considered, with more intense structures being disrupted at larger scales. The disruption scale for the structures that dominate the energy spectrum is \\text{D}\\sim L\\bot 1/9(de\\unicode[STIX]{x1D70C}s)4/9$ , where e$ is the electron inertial scale, s$ is the ion sound scale and \\bot $ is the outer scale of the turbulence. When e$ and s/L\\bot $ are sufficiently small, the scale \\text{D}$ is larger than s$ and there is a break in the energy spectrum at \\text{D}$ , rather than at s$ . We propose that the fluctuations produced by the disruption are circularised flux ropes, which may have already been observed in the solar wind. We predict the relationship between the amplitude and radius of these structures and quantify the importance of the disruption process to the cascade in terms of the filling fraction of undisrupted structures and the fractional reduction of the energy contained in them at the ion sound scale s$ . Both of these fractions depend strongly on e$ , with the disrupted structures becoming more important at lower e$ . Finally, we predict that the energy spectrum between \\text{D}$ and s$ is steeper than \\bot -3$ , when this range exists. Such a steep `transition range' is sometimes observed in short intervals of solar-wind turbulence. The onset of collisionless magnetic reconnection may therefore significantly affect the nature of plasma turbulence around the ion gyroscale.
Directory of Open Access Journals (Sweden)
IULIA FONTANINE
2013-08-01
Full Text Available The Subcarpathian area between Buzău and Slănic rivers, located in the south-eastern part of Romania, is one of the most affected areas by the torrential related phenomena. This occurs due to physical-geographical and economical-geographical factors, such as: slope, curvature profile, lithology, soil texture and land use. In order to calculate and spatially model the surface runoff potential index, these factors were integrated and worked in GIS enviroment. Each characteristic of the factors was given a bonitation score, according to the way that it influences surface runoff. By applying the methodology mainly taken after Smith (2003 [1], the Flash-Flood Potential Index was obtained, with values between 19.4 - 44.5. The highest values of the index correspond to deforestated slopes, which exceed 15º, located in Bălăneasa and Sărățel river basins.
Crause, Lisa A.; Carter, Dave; Daniels, Alroy; Evans, Geoff; Fourie, Piet; Gilbank, David; Hendricks, Malcolm; Koorts, Willie; Lategan, Deon; Loubser, Egan; Mouries, Sharon; O'Connor, James E.; O'Donoghue, Darragh E.; Potter, Stephen; Sass, Craig; Sickafoose, Amanda A.; Stoffels, John; Swanevelder, Pieter; Titus, Keegan; van Gend, Carel; Visser, Martin; Worters, Hannah L.
2016-08-01
SpUpNIC (Spectrograph Upgrade: Newly Improved Cassegrain) is the extensively upgraded Cassegrain Spectrograph on the South African Astronomical Observatory's 74-inch (1.9-m) telescope. The inverse-Cassegrain collimator mirrors and woefully inefficient Maksutov-Cassegrain camera optics have been replaced, along with the CCD and SDSU controller. All moving mechanisms are now governed by a programmable logic controller, allowing remote configuration of the instrument via an intuitive new graphical user interface. The new collimator produces a larger beam to match the optically faster Folded-Schmidt camera design and nine surface-relief diffraction gratings offer various wavelength ranges and resolutions across the optical domain. The new camera optics (a fused silica Schmidt plate, a slotted fold flat and a spherically figured primary mirror, both Zerodur, and a fused silica field-flattener lens forming the cryostat window) reduce the camera's central obscuration to increase the instrument throughput. The physically larger and more sensitive CCD extends the available wavelength range; weak arc lines are now detectable down to 325 nm and the red end extends beyond one micron. A rear-of-slit viewing camera has streamlined the observing process by enabling accurate target placement on the slit and facilitating telescope focus optimisation. An interactive quick-look data reduction tool further enhances the user-friendliness of SpUpNI
A Hydrodynamic Model of Alfvénic Wave Heating in a Coronal Loop and Its Chromospheric Footpoints
Reep, Jeffrey W.; Russell, Alexander J. B.; Tarr, Lucas A.; Leake, James E.
2018-02-01
Alfvénic waves have been proposed as an important energy transport mechanism in coronal loops, capable of delivering energy to both the corona and chromosphere and giving rise to many observed features of flaring and quiescent regions. In previous work, we established that resistive dissipation of waves (ambipolar diffusion) can drive strong chromospheric heating and evaporation, capable of producing flaring signatures. However, that model was based on a simplified assumption that the waves propagate instantly to the chromosphere, an assumption that the current work removes. Via a ray-tracing method, we have implemented traveling waves in a field-aligned hydrodynamic simulation that dissipate locally as they propagate along the field line. We compare this method to and validate against the magnetohydrodynamics code Lare3D. We then examine the importance of travel times to the dynamics of the loop evolution, finding that (1) the ionization level of the plasma plays a critical role in determining the location and rate at which waves dissipate; (2) long duration waves effectively bore a hole into the chromosphere, allowing subsequent waves to penetrate deeper than previously expected, unlike an electron beam whose energy deposition rises in height as evaporation reduces the mean-free paths of the electrons; and (3) the dissipation of these waves drives a pressure front that propagates to deeper depths, unlike energy deposition by an electron beam.
Keilbach, D.; Berger, L.; Drews, C.; Marsch, E.; Wimmer-Schweingruber, R. F.
2017-12-01
Recent studies, that determined the inflow longitude of the local interstellar medium from the anisotropy of interstellar pickup ion (PUI) radial velocity, have once again raised the question, how transport effects and especially wave activity in the solar wind modifies the velocity distribution function of PUIs.This study investigates the modification of an oxygen PUI torus distribution by alfvénic waves qualitatively with a numerical approach. The focus of this study is to understand this modification kinetically, which means, that instead of describing the PUI transport through diffusion approaches, we trace the trajectories of test particles in pitch angle space with a time resolution of at least 100 time steps per gyro orbit in order to find first principles of wave particle interactions on the most basic scale.Therefore we have implemented a Leapfrog solver of the Lorentz-Newton equations of motion for a charged test particle in a electro-magnetic field. The alfvénic waves were represented through a continuous circularly polarized wave superimposed to a constant 5 nT background magnetic field. In addition an electric field arising from induction has been added to the simulation's boundary conditions. The simulation code computes the particles' trajectories in the solar wind bulk system.Upon interaction with mono frequent single-frequency waves, the particles are found to perform stationary trajectories in pitch angle space, so that the pitch angle distribution of a conglomerate of test particles does not experience a systematic broadening over time. Also the particles do not react most strongly with waves at resonant frequencies, since the pitch angle modification by the waves sweeps their parallel velocity out of resonance quickly. However, within frequencies close to first order resonance, strong interactions between waves and particles are observed.Altogether the framework of our simulation is readily expandable to simulate additional effects, which may
Directory of Open Access Journals (Sweden)
Sara Vázquez-Corzo
2003-10-01
Full Text Available OBJETIVO: Determinar si anticuerpos séricos contra E4, E7 y Ras pueden ser utilizados como marcadores de lesiones tempranas del cérvix uterino asociadas al virus del papiloma humano. MATERIAL Y MÉTODOS: Entre marzo de 1999 y abril de 2000 se realizó un estudio sero-epidemiológico de casos y controles en la clínica de displasias del Hospital General Doctor Gea González, en la Ciudad de México, en 116 muestras de suero para evaluar la presencia de anticuerpos anti-E4, E7 y Ras utilizando un ELISA de captura. Se estimaron razones de momios e intervalos de confianza de 95% RESULTADOS: Anticuerpos anti-E7 se asociaron a mujeres con lesiones NIC III, mientras que anticuerpos anti-E4 y anti-Ras fueron más frecuentes en lesiones NIC I-II. Al evaluar el perfil de anticuerpos que presentaron las mujeres, encontramos que a anticuerpos contra dos proteínas predicen la existencia de una lesión NIC I-II, y b la presencia de tres anticuerpos predicen una lesión NIC III. CONCLUSIONES: La detección de anticuerpos séricos contra E4, E7 y Ras en combinación con otras técnicas de diagnóstico, podrían ser de utilidad para detectar oportunamente a mujeres con lesiones tempranas asociadas al Virus del Papiloma Humano y en riesgo de desarrollar cáncer.OBJECTIVE: To evaluate whether serum antibodies anti-E4, E7 and Ras could be used as markers for early cervical lesions associated with HPV (human papillomavirus. MATERIAL AND METHODS: A seroepidemiological case-control study was conducted between March 1999 and April 2000 at the dysplasia clinic of Hospital General Doctor Gea Gonzalez, in Mexico City, to evaluate the presence of antibodies anti-E4, E7, and Ras through a sandwich ELISA. Analysis was done using odds ratios and 95% confidence intervals. RESULTS: Anti-E7 antibodies were associated to women with CIN III lesions, while anti-E4 and Ras antibodies were strongly associated with CIN I-II lesions. The antibody profile of women with different
Haldane-gap excitations in the low-Hc one-dimensional quantum antiferromagnet Ni(C5D14N2)2N3(PF6)
International Nuclear Information System (INIS)
Zheludev, A.; Chen, Y.; Broholm, C. L.; Honda, Z.; Katsumata, K.
2001-01-01
Inelastic neutron scattering on deuterated single-crystal samples is used to study Haldane-gap excitations in the new S=1 one-dimensional quantum antiferromagnet Ni(C 5 D 14 N 2 ) 2 N 3 (PF 6 ), that was recently recognized as an ideal model system for high-field studies. The Haldane gap energies Δ x =0.42(3) meV, Δ y =0.52(6) meV, and Δ z =1.9(1) meV, for excitations polarized along the a, b, and c crystallographic axes, respectively, are measured. The dispersion relation is studied for momentum transfers both along and perpendicular to the chains' direction. The in-chain exchange constant J=2.8 meV is found to be much larger than interchain coupling, J y =1.8(4)x10 -3 meV and J x =4(3)x10 -4 meV, along the b and a axes, respectively. The results are discussed in the context of future experiments in high magnetic fields
Directory of Open Access Journals (Sweden)
COSTACHE R.
2015-03-01
Full Text Available The present study aims to provide an example of the assessment of economical loss caused by floods and flash-floods, by integrating GIS techniques of hydraulic and hydrological modelling. The case study was performed in Lopătari village, which is located in the upper area of Slănic River, one of the most affected areas by floods and flash-floods. The flood event produced on 29.V.2012 was considered in order to perform this study. Thus, a flood hydrograph was simulated by using software HEC-HMS 3.5, based on hourly precipitation data from Bisoca meteorological station from 29.V.2012. The peak discharge resulting from the hydrological modelling software was used in HEC-RAS 4.1 hydraulic modelling software in order to determine the extent of flooding band, the number of the affected elements and the local economical loss. Finally, 21 flooded buildings were identified and 550 m of affected road, the estimated economical damage being about 800,000 RON.
Directory of Open Access Journals (Sweden)
Mirosław Mrozkowiak
2015-11-01
Mirosław Mrozkowiak Uniwersytet Kazimierza Wielkiego Bydgoszcz e-mail: magmar54@interia.pl strona: http://wadypostawy.republika.pl Słowa kluczowe: powierzchnia podeszwowa stopy, obciążenie masą ciała. Streszczenie Wstęp. Stopa spełnia węzłową rolę w lokomocji i motoryczności człowieka. Jej konstrukcja w postaci uformowanego sklepienia podłużnego i poprzecznego zapewnia odpowiednie amortyzowanie wszelkich obciążeń, nacisków i wstrząsów, utrzymuje ciało w pozycji spionizowanej, umożliwia poruszanie się, skakanie i bieganie. Cel. Określenie różnic powierzchni plantokonturogramów stóp w warunkach obciążenia masą własną, populacji żeńskiej w wieku od 4 do 18 lat w ujęciu odsetkowym. Materiał i metodyka. Badaniami objęto populację 9804 kobiet w wieku od 4 do 18 lat, z wybranych losowo przedszkoli i szkół regionu Warmińsko – Mazurskiego. Metodyka badań obejmowała pomiar powierzchni plantokonturogramu stóp (Gamma. Do oceny wykorzystano stanowisko do komputerowej oceny postawy ciała, techniką mory projekcyjnej – Posturometr M. Wyniki. Wyniki badań opracowano graficznie, przedstawiając przebieg zmian odsetka różnic powierzchni plantokonturogramu lewej i prawej stopy dla płci żeńskiej i obojga płci. Wnioski. 1. U dziewcząt o większej powierzchni plantokonturogramu lewej stopy odsetki różnic są większe niż u dziewcząt o większej powierzchni plantokonturogramu prawej stopy. 2. Wielkość odsetka różnic powierzchni stóp dziewcząt jest zbliżony do wielkości uzyskanych przez osobników obojga płci do 17 r.ż., dalej następuje gwałtowny wzrost wielkości różnic u osobników obojga płaci, posiadających większą powierzchnię plantokonturogramu lewej stopy. Keywords: plantar surface of the foot, the load weight. Abstract Admission. The rate meets the nodal role in human locomotion and motor skills. Its structure
International Nuclear Information System (INIS)
Wang Lianying; Wu Guoqing; Evans, David G.
2007-01-01
The nickel(II) citrate complex anion ([Ni(C 6 H 4 O 7 )] 2- ) may be intercalated into the interlayer galleries of a layered double hydroxide (LDH) host by a process involving ion-exchange with an Mg 2 Al-NO 3 LDH precursor. The powder X-ray diffraction (XRD) pattern confirms that the layered structure is maintained. The thermal decomposition process of the complex anion-intercalated material has been characterized by in situ high temperature powder XRD, thermogravimetry-differential thermal analysis (TG-DTA) and coupled with mass spectrometry (MS). The thermal stability of the nickel(II) citrate complex anion intercalated in LDHs in air is lower than that in the sodium salt. Calcination generates a high degree of nickel(II) oxide dispersion in a matrix of magnesium and aluminium oxide phases which should be an advantage if the materials are used as catalyst precursors. Based on the observed data, a structural model for the [Ni(C 6 H 4 O 7 )] 2- anion intercalated in the galleries of the LDH is proposed
Guarnieri, Fernando L.; Tsurutani, Bruce T.; Vieira, Luis E. A.; Hajra, Rajkumar; Echer, Ezequiel; Mannucci, Anthony J.; Gonzalez, Walter D.
2018-01-01
The purpose of this study is to present a wavelet interactive filtering and reconstruction technique and apply this to the solar wind magnetic field components detected at the L1 Lagrange point ˜ 0.01 AU upstream of the Earth. These filtered interplanetary magnetic field (IMF) data are fed into a model to calculate a time series which we call AE∗. This model was adjusted assuming that magnetic reconnection associated with southward-directed IMF Bz is the main mechanism transferring energy into the magnetosphere. The calculated AE∗ was compared to the observed AE (auroral electrojet) index using cross-correlation analysis. The results show correlations as high as 0.90. Empirical removal of the high-frequency, short-wavelength Alfvénic component in the IMF by wavelet decomposition is shown to dramatically improve the correlation between AE∗ and the observed AE index. It is envisioned that this AE∗ can be used as the main input for a model to forecast relativistic electrons in the Earth's outer radiation belts, which are delayed by ˜ 1 to 2 days from intense AE events.
El concepto de persona y construcción de persona prudente, a la luz de la Ética a Nicómaco
Directory of Open Access Journals (Sweden)
Matilde Maria Gonçalves de Sá
2014-03-01
Full Text Available El objetivo de este trabajo consiste en presentar el concepto de ‘persona’, discurrir brevemente sobre éste y su origen, relacionándolo con las dimensiones (irracional y racional del alma, demostrando, así, la posibilidad de la construcción de la prudencia en forma humana expresada por Aristóteles en la Ética a Nicómaco. Se pretende hacer penetrar una síntesis de la prudencia, postulando un ser humano, persona, mejor, en una contribución para que los profesionales del mundo jurídico: estén más abiertos a la investigación losó ca, aunándola a su día a día, con el n de que a ne sus criterios, que intervenga en sus decisiones, que les brinde más éxito y provoque más dinamismo en su trabajo, cosa que resultará en una persona más humano, más responsable, prudente y más justa y más feliz.
Directory of Open Access Journals (Sweden)
Yonghong Lu
2010-10-01
Full Text Available The asymmetric unit of the title compound, [Ni(C16H32N4]Br2·2H2O, consists of one half [Ni(C16H32N4]2+ cation, one Br− anion and one water molecule of crystallization. The NiII ion lies on an inversion centre in a square-planar environment formed by the four macrocyclic ligand N atoms. In the crystal structure, the cations, anions and water molecules are linked via intermolecular N—H...Br and O—H...Br hydrogen bonds, forming discrete chains with set-graph motif D(2D22(7D21(3D32(8. The water molecules and Br− ions are linked with set-graph motif R42(8.
Deehan, Gerald A; Hauser, Sheketha R; Waeiss, R Aaron; Knight, Christopher P; Toalston, Jamie E; Truitt, William A; McBride, William J; Rodd, Zachary A
2015-12-01
The co-abuse of ethanol (EtOH) and nicotine (NIC) increases the likelihood that an individual will relapse to drug use while attempting to maintain abstinence. There is limited research examining the consequences of long-term EtOH and NIC co-abuse. The current experiments determined the enduring effects of chronic EtOH, NIC, or EtOH + NIC intake on the reinforcing properties of NIC and glutamate (GLU) activity within the mesocorticolimbic (MCL) system. Alcohol-preferring (P) rats self-administered EtOH, Sacc + NIC, or EtOH + NIC combined for 10 weeks. The reinforcing properties of 0.1-3.0 μM NIC within the nucleus accumbens shell (AcbSh) were assessed following a 2-3-week drug-free period using intracranial self-administration (ICSA) procedures. The effects of EtOH, Sacc, Sacc + NIC, or EtOH + NIC intake on extracellular levels and clearance of glutamate (GLU) in the medial prefrontal cortex (mPFC) were also determined. Binge intake of EtOH (96-100 mg%) and NIC (21-27 mg/mL) were attained. All groups of P rats self-infused 3.0 μM NIC directly into the AcbSh, whereas only animals in the EtOH + NIC co-abuse group self-infused the 0.3 and 1.0 μM NIC concentrations. Additionally, self-administration of EtOH + NIC, but not EtOH, Sacc or Sacc + NIC, resulted in enduring increases in basal extracellular GLU levels in the mPFC. Overall, the co-abuse of EtOH + NIC produced enduring neuronal alterations within the MCL which enhanced the rewarding properties of NIC in the AcbSh and elevated extracellular GLU levels within the mPFC.
Controle interno da qualidade em citopatologia ginecológica: um estudo de 48.355 casos
Directory of Open Access Journals (Sweden)
Arcuri Roberto Alfonso
2002-01-01
Full Text Available Todos os sistemas de avaliação de desempenho em laboratórios de citopatologia exigem um programa de controle interno da qualidade estabelecido e executado. O presente estudo tem por objetivo identificar os resultados do programa e o desempenho dos citotécnicos. Para tanto foram revistos os laudos, emitidos pelos citotécnicos e pelos citopatologistas, de 48.355 exames citopatológicos ginecológicos realizados durante 21 meses. Foram identificados 2.299 casos anômalos encaminhados ao citopatologista, e confirmados 1.132; 2.973 casos de alto risco foram detectados e 998 anômalos identificados. A revisão de 10% dos negativos representou 3.180 casos, com identificação de 77 anômalos. Os anômalos totais detectados foram: 1.176 Ascus, 60 Agus, 819 Nic I/HPV, 85 Nic II, 33 Nic III, 11 carcinomas escamosos, 17 adenocarcinomas, cinco Vain I e um Vain III. Os Ascus/Agus foram 56%, e as outras lesões representaram 44%. Os 4,56% de anômalos detectados concordam com os valores propostos por Cardin (3% a 5%, pelo sistema Bethesda (4% a 6% e por Kurman et al. (5% (4, 6, 7. O citopatologista revisou 17,48% dos casos (n = 8.452. Dos 77 (0,16% do total anômalos identificados no reescrutínio, 59 (0,12% foram Ascus, seis (0,01% Agus e 12 (0,02% Nic I. O presente estudo mostra resultados do controle interno da qualidade desenvolvido em laboratório particular e fornece dados relevantes para o planejamento de um programa de prevenção do câncer uterocervical.
Directory of Open Access Journals (Sweden)
F. L. Guarnieri
2018-01-01
Full Text Available The purpose of this study is to present a wavelet interactive filtering and reconstruction technique and apply this to the solar wind magnetic field components detected at the L1 Lagrange point ∼ 0.01 AU upstream of the Earth. These filtered interplanetary magnetic field (IMF data are fed into a model to calculate a time series which we call AE∗. This model was adjusted assuming that magnetic reconnection associated with southward-directed IMF Bz is the main mechanism transferring energy into the magnetosphere. The calculated AE∗ was compared to the observed AE (auroral electrojet index using cross-correlation analysis. The results show correlations as high as 0.90. Empirical removal of the high-frequency, short-wavelength Alfvénic component in the IMF by wavelet decomposition is shown to dramatically improve the correlation between AE∗ and the observed AE index. It is envisioned that this AE∗ can be used as the main input for a model to forecast relativistic electrons in the Earth's outer radiation belts, which are delayed by ∼ 1 to 2 days from intense AE events.
Quantitative Determination of Engine Water Ingestion.
1986-12-01
4II- lIII.s;I.I. iN [ I I.S( NIC ID) LINIA.) 4 5v1fil I [:,SS(I~r. III.G’I.141 ) lS;; NE141I))=NI IF" (i’* IIw JI)).I.’".N2) ESINE [LI)-1NZ %t...Tulsa, OK 74150 Be. hMr. Ronald Cam Allied Pilot Association BASF Wyandotte CorporationEquipment Evaluation Comm.":" .O.Box 5241609 Biddle Avenue P.O
United States of America Ocean Dumping Report for Calendar Year 1981. Dredged Material.
1982-06-01
ocean dumping rules and regulations, F.R. Vol 42 No. 7, 11 Jan 1977 (2) Metals: () esame as above(3) Orga& nics : same as above 1). Other :iiLvs.is: (I...results: (1) Nutrients: Meets chemical - biological testing criteria II (2) Metals: * B 1 t U S(3) Orga! nics : b. Other analyses: (1) Metals: (2...description of dredged material, dredging, and transportation made: a. Description: Silty sand to silty clay noncohesive Hydrogen Sulfide smell. BIDDLE b
Directory of Open Access Journals (Sweden)
Juan Palomares Laguna
2009-06-01
Full Text Available Nuestro trabajo tiene como objetivo contrastar si la decisión de la SEC en base a la cual se permite no reconciliar el Patrimonio Neto (PN y el Resultado neto (RN, a las normas americanas, exclusivamente a las sociedades que utilizan las NIC/NIIF en sus estados primarios, está justificada o no. Nuestro estudio está referido al sector de las telecomunicaciones por lo que otros trabajos deberán en su caso contrastar si los resultados aquí obtenidos son extrapolables a otros sectores. Utilizando una muestra de sociedades pertenecientes al sector de las telecomunicaciones, analizaremos si las distancias con los US GAAP se reducen o no, una vez que éstas han migrado a las NIC/NIIF y si éstas diferencias son significativas. Podemos afirmar, de forma general, en base a los resultados obtenidos, que la migración a la normativa internacional ha supuesto un acercamiento con los US GAAP y que las diferencias no son significativas, aunque sí existen tipos de ajustes, como las combinaciones de negocios, que de por si solos introducen impactos significativos. Sin embargo, de forma transitoria, las sociedades recién migradas muestran una menor homogeneidad en el RN con los US GAAP.Por todo ello, consideramos acertada la decisión de la SEC, aunque futuras investigaciones deberán confirmar que las diferencias tienden a reducirse una vez que los efectos de la NIIF 1 se difuminan y que los avances previstos en la armonización de iure se trasladan a la armonización de facto.The aim of this paper is to test whether, the SEC’s decision to allow only companies using IFRS not to reconcile their Equity (E and Net Profit (NP to US GAAP is justified. Ourresearch is restricted to the telecommunications sector, and therefore, further research is needed to test whether our result are similar for other sectors. Using a sample of companies belonging to the telecommunications sector, we investigate whether the differences to US GAAP have been reduced after
Las virtudes intelectuales (Ética a Nicómaco , VI en tres obras de divulgación aristotélica
Directory of Open Access Journals (Sweden)
Mélanie Jecker
2014-06-01
Full Text Available Me propongo observar en este trabajo cómo la doctrina aristotélica de las virtudes intelectuales expuesta en el libro VI de la Ética a Nicómaco llegó a formularse en un corpus de tres compendios de la Ética y dos florilegios de filosofía moral que circularon en la Castilla de los siglos XIII-XV. Estos textos pertenecen a la polifacética literatura medieval de divulgación que pretendía ofrecer al estudiante de la Facultad de Artes o al círculo más amplio de la nobleza ansiosa de erudición el acceso a las doctrinas de los autores de la Antigüedad clásica, especialmente las de Aristóteles, «el Filósofo», primera auctoritas filosófica estudiada en las universidades medievales. El objeto que me propongo analizar aquí valdrá por lo tanto como ilustración para entender un fenómeno más amplio: la transmisión de contenidos doctrinales aristotélicos mediante obras de divulgación, la cual constituye una de las modalidades más interesantes de la recepción del corpus aristotelicum en Europa a partir del siglo XIII.
International Nuclear Information System (INIS)
Jiao, Yong-Kun; Li, Xiu-Ping; Zhao, Cui; Wang, Hai-Chao; Xue, Min; Zhao, Jiong-Peng; Liu, Fu-Chen
2013-01-01
A novel heterometallic complex, [Ni 2 Mn(N 3 ) 2 (nic) 4 ·(H 2 O) 2 ] n (1) (nic=nicotinate), was obtained by assembling MnCl 2 ·4H 2 O, Ni(NO 3 ) 2 ·6H 2 O, NaN 3 and nicotinic acid with a “one step” synthetic strategy—hydrothermal reaction. The 3D structure of the complex can be described as end-on (EO) azido and syn,syn carboxylates mixed bridged by alternate Ni–Mn–Ni trimers linked by the nicotinate. Dominant ferromagnetic interactions were observed between the Ni II and Mn II ions in the trimer. - Graphical abstract: A novel heterometallic 3D complex [Ni 2 Mn(N 3 ) 2 (nic) 4 ·(H 2 O) 2 ] n (1) (nic=nicotinate) was synthesized by hydrothermal reaction. This complex exhibits interesting structural and magnetic properties. - Highlights: • It is difficult to construct simple coordination complexes with azide as “ligands” to obtain heterometallic metal–azido compounds. • A “one-step” method—hydrothermal reaction— was introduced to avoid the disadvantages of azide mentioned above. • The magnetic property is different with the isostructural homometal–azido complex due to the changed metal center
catena-Poly[nickel(II-bis(μ-2-aminoethanesulfonato-κ3N,O:O′;κ3O:N,O′
Directory of Open Access Journals (Sweden)
Feng Yang
2010-07-01
Full Text Available In the title polymeric complex, [Ni(C2H6NO3S2]n, the NiII ion occupies a special position on an inversion centre and displays a slightly distorted octahedral coordination geometry, being linked to four sulfonate O atoms and to two N atoms of the taurine ligands. The sulfonate groups doubly bridge symmetry-related NiII centers, forming polymeric chains along the a axis.
Tris(propane-1,2-diamine-κ2N,N′nickel(II tetracyanidonickelate(II
Directory of Open Access Journals (Sweden)
Juraj Černák
2008-02-01
Full Text Available The title compound, [Ni(C3H10N23][Ni(CN4], is built up of [Ni(pn3]2+ cations (pn is 1,2-diaminopropane and [Ni(CN4]2− anions. Both NiII atoms in the cation and the anion lie on a mirror plane. The respective ions interact through Coulombic forces and through a complex network of hydrogen bonds. Extended disorder associated with the cation has been resolved. The occupancies of the respective disordered positions are 0.4:0.4:0.2.
Energy Technology Data Exchange (ETDEWEB)
Imazono, Takashi [Quantum Beam Science Center, Japan Atomic Energy Agency, 8-1-7, Umemidai, Kizugawa, Kyoto 619-0216 (Japan)
2016-07-27
To develop a flat-field spectrometer with coverage of the 1–3.5 keV range, a wideband Ni/C multilayer grating was invented. The multilayer consists of two kinds of layer structures. One is a conventional periodic multilayer of thickness D{sub 1} = 5.6 nm, Ni thickness ratio to the multilayer period γ{sub 1} = 0.5 and the number of layers N{sub 1} = 79. Both the first and last layers are Ni. The other is a C/Ni bilayer of D{sub 2} = 8.4 nm, γ{sub 2} = 0.53 and N{sub 2} = 2. The first layer is C and then Ni. The aperiodic multilayer from the topmost C/Ni bilayer was coated on a laminar-type grating having an effective grating constant of 1/2400 mm, groove depth of 2.8 nm, and duty ratio (land width/groove period) of 0.5. In a preliminary experiment, the diffraction efficiency was in excess of 0.8% in the energy range of 2.1-3.3 keV and the maximum of 5.4% at 3.1 keV at a constant angle of incidence of 88.54°, which is considerably higher than that of an Au-coated grating before deposition of the multilayer.
Diaqua(1,10-phenanthrolin-2-olnickel(II dinitrate
Directory of Open Access Journals (Sweden)
Qi Sheng Liu
2009-08-01
Full Text Available In the mononuclear title complex, [Ni(C12H8N2O2(H2O2](NO32, the NiII ion is coordinated in a distorted octahedral geometry. The dihedral angle between the two mean planes defined by the phenanthroline ligands is 88.26 (6°. Intra- and intermolecular O—H...O hydrogen bonds between the cation and the anions lead to the formation of a layered arrangement parallel to (010.
Bis(tripyrazol-1-ylmethanenickel(II tetracyanidonickelate(II dihydrate
Directory of Open Access Journals (Sweden)
Sean Parkin
2009-12-01
Full Text Available The title complex, [Ni(C10H10N62][Ni(CN4]·2H2O, contains an octahedral nickel(II cation and a square-planar nickel(II anion. Both the cation and the anion reside on a crystallographic center of inversion. The NiII center in the cation is coordinated by six pyrazol-1-yl rings of two chelating tripyrazol-1-ylmethane [HC(pz3] ligands, with Ni—N distances that range between 2.0647 (19 and 2.0828 (19 Å. The NiII center in the anion is coordinated by four cyanide ligands, with Ni—C distances in the range 1.869 (2–1.869 (3 Å. The [Ni(CN4]2− anions are linked by inversion-related water molecules into extended chains that run parallel to the a axis.
Directory of Open Access Journals (Sweden)
Angelo Antonio Pires de Oliveira
2017-08-01
Full Text Available In this paper, I put under scrutiny the arguments put forward by Aristotle in Nicomachean Ethics (NE VI.9. The paper has two main parts. In the first, I examine the NE VI.9’s first part where Aristotle develops the concept of good deliberation, offering its definition in 1142b27-28. In the second, I examine the connection between good deliberation and phronesis, and, then, discuss the vexata quæstio about if the lines 1142b31-33 might be read as introducing the claim that phronesis provides moral ends. [Neste artigo, analiso pormenorizadamente os argumentos apresentados por Aristóteles em Ética a Nicômaco (EN VI.9. O artigo é dividido em duas partes principais. Na primeira, abordo a primeira parte de EN VI.9 onde Aristóteles desenvolve a noção de boa deliberação, culminando com a apresentação da sua definição em 1142b27-28. Na segunda, abordo a conexão entre boa deliberação e phronesis e discuto a vexata quaestio de se as linhas 1142b31-33 podem ser lidas como introduzindo a tese de que a phronesis fornece os fins morais
Alasmari, Fawaz; Bell, Richard L; Rao, P S S; Hammad, Alaa M; Sari, Youssef
2018-07-01
Impairment in glutamate neurotransmission mediates the development of dependence upon nicotine (NIC) and ethanol (EtOH). Previous work indicates that continuous access to EtOH or phasic exposure to NIC reduces expression of the glutamate transporter-1 (GLT-1) and cystine/glutamate antiporter (xCT) but not the glutamate/aspartate transporter (GLAST). Additionally, metabotropic glutamate receptors (mGluRs) expression was affected following exposure to EtOH or NIC. However, little is known about the effects of EtOH and NIC co-consumption on GLT-1, xCT, GLAST, and mGluR1 expression. In this study, peri-adolescent female alcohol preferring (P) rats were given binge-like access to water, sucrose (SUC), SUC-NIC, EtOH, or EtOH-NIC for four weeks. The present study determined the effects of these reinforcers on GLT-1, xCT, GLAST, and mGluR1 expression in the nucleus accumbens (NAc), hippocampus (HIP) and prefrontal cortex (PFC). GLT-1 and xCT expression were decreased in the NAc following both SUC-NIC and EtOH-NIC. In addition, only xCT expression was downregulated in the HIP in both of these latter groups. Also, glutathione peroxidase (GPx) activity in the HIP was reduced following SUC, SUC-NIC, EtOH, and EtOH-NIC consumption. Similar to previous work, GLAST expression was not altered in any brain region by any of the reinforcers. However, mGluR1 expression was increased in the NAc in the SUC-NIC, EtOH, and EtOH-NIC groups. These results indicate that peri-adolescent binge-like drinking of EtOH or SUC with or without NIC may exert differential effects on astroglial glutamate transporters and receptors. Our data further parallel some of the previous findings observed in adult rats. Copyright © 2018. Published by Elsevier Inc.
Poly[(dimethylformamide(μ4-2,2′-sulfanediyldibenzoatonickel(II
Directory of Open Access Journals (Sweden)
Jiang-Bo Xie
2010-04-01
Full Text Available The title centrosymmetric dinuclear NiII complex, [Ni(C14H8O4S(C3H7NO]n, was prepared via reaction of Ni(NO32·6H2O and thiosalicylic acid, with H2O and dimethylformamide (DMF as the mixed solvent. The central NiII ion is five-coordinated by five O atoms from DMF and from the carboxylate groups of the organic ligand. The symmetry-related coordination polyhedra interlink into centrosymmetric dimeric units and these, in turn, are linked into infinite chains propagating parallel to [100].
Directory of Open Access Journals (Sweden)
Lluís Carreras
2013-09-01
Full Text Available Objecte: L'aplicació de la NIC 32 en les cooperatives ha generat una important controvèrsia en els últims anys. Fins al moment, s'han realitzat diversos treballs que intenten preveure els possibles efectes de la seva aplicació. Aquest treball pretén analitzar l'impacte de la primera aplicació de la NIC 32 en el sector cooperatiu. Disseny/metodologia/enfocament: S'ha seleccionat una mostra de 98 cooperatives, i s'ha realitzat una anàlisi comparativa de la seva informació financera presentada abans i després de l'aplicació de la NIC 32, per a determinar les diferències existents. S’ha utilitzat la prova de la suma de rangs de Wilcoxon per comprovar si aquestes diferències són significatives. També s’ha utilitzat la prova de la U de Mann Whitney per comprovar si existeixen diferències significatives en l’impacte relatiu de l’aplicació de la NIC 32 entre diversos grups de cooperatives. Finalment, s'ha realitzat una anàlisi dels efectes de l'aplicació de la NIC 32 en la situació patrimonial i econòmica de les cooperatives, i en l'evolució dels seus actius intangibles, mitjançant l’ús de tècniques d’anàlisi econòmico-financera. Aportacions i resultats: Els resultats obtinguts confirmen que l'aplicació de la NIC 32 provoca diferències significatives en algunes partides del balanç de situació i el compte de pèrdues i guanys, així com en les ràtios analitzades. Les principals diferències es concreten en una reducció del nivell de capitalització i un augment de l'endeutament de les cooperatives, així com un empitjorament general dels ràtios de solvència i autonomia financera. Limitacions: Cal tenir en compte que el treball s'ha realitzat amb una mostra de cooperatives que estan obligades a auditar els seus comptes anuals. Per tant, els resultats obtinguts han d'interpretar-se en un context de cooperatives de tamany elevat. També cal tenir en compte que hem realitzat una anàlisi comparativa dels comptes
Institute of Scientific and Technical Information of China (English)
Gabriel Clavijo; Trevor Williams; Delia Mu(n)oz; Miguel L(o)pez-Ferber; Primitivo Caballero
2009-01-01
An isolate of the Spodoptera frugiperda multiple nucleopolyhedrovirus comprises a stable proportion of deletion genotypes (e.g., SfNIC-C), that lack pif1 and pif2 rendering them noninfectious per os, and that survive by complementation with a complete genotype (SfNIC-B) in coinfected cells. To determine whether selection for particular ratios of complete and deletion genotypes occurs mainly during the establishment of the primary infection in insect midgut cells or during subsequent systemic infection, we examined genotype frequencies in insects that fed on OBs comprising different co-occluded mixtures of genotypes. Dramatic changes in genotype frequencies were observed between the OB inoculum and budded virus (BV) samples taken from larvae inoculated with OBs comprising 10% SfNIC-B + 90% SfNIC-C indicating that a marked reduction of SfNIC-C genotype had occurred in the insect midgut due to the immediate elimination of all OBs that originated from cells that had been infected only by SfNIC-C. In contrast, immediate changes were not observed in OBs comprising mixtures of 50% SfNIC-B + 50% SfNIC-C or those comprising 10% SfNIC-B + 90% SfNIC-C as most of the OBs in these mixtures originated from cells that had been infected by both genotypes. Subsequent changes in genotypic frequencies during five days of systemic infection were fairly small in magnitude for all genotypic mixtures. We conclude that the prevalence of defective genotypes in the SfNIC population is likely determined by a balance between host selection against OBs produced in cells infected by SfNIC-C alone and within-host selection for fast-replicating deletion genotypes. The strength of intra-host selection is likely modulated by changes in MOI during the infection period.
Simvastatin-nicotinamide co-crystal: design, preparation and ...
African Journals Online (AJOL)
Purpose: To improve the solubility of simvastatin (SV) by co-crystallization using nicotinamide (Nic) as co-crystal agent (co-former). Methods: In silico molecular modeling of Nic counter to SV were investigated using Auto Dock 4.2. Cocrystal of Nic-SV was obtained by solvent evaporation (SE) using an equimolar ratio of Nic ...
Directory of Open Access Journals (Sweden)
Ken Aizawa
2015-03-01
Full Text Available Sirolimus (SRL is widely used to prevent restenosis after percutaneous coronary intervention. However, its beneficial effect is hampered by complications of thrombosis. Several studies imply that reactive oxygen species (ROS play a critical role in endothelial dysfunction and thrombus formation. The present study investigated the protective effect of nicorandil (NIC, an anti-angina agent, on SRL-associated thrombosis. In human coronary artery endothelial cells (HCAECs, SRL stimulated ROS production, which was prevented by co-treatment with NIC. The preventive effect of NIC on ROS was abolished by 5-hydroxydecanoate but not by 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one. NIC also inhibited SRL-induced up-regulation of NADPH oxidase subunit p22phox mRNA. Co-treatment with NIC and SRL significantly up-regulated superoxide dismutase 2. NIC treatment significantly improved SRL-induced decrease in viability of HCAECs. The functional relevance of the preventive effects of NIC on SRL-induced ROS production and impairment of endothelial viability was investigated in a mouse model of thrombosis. Pretreatment with NIC inhibited the SRL-induced acceleration of FeCl3-initiated thrombus formation and ROS production in the testicular arteries of mice. In conclusion, NIC prevented SRL-induced thrombus formation, presumably due to the reduction of ROS and to endothelial protection. The therapeutic efficacy of NIC could represent an additional option in the prevention of SRL-related thrombosis.
Energy Technology Data Exchange (ETDEWEB)
Jiao, Yong-Kun [School of Chemistry and Chemical Engineering, Tianjin University of Technology, Tianjin 300384 (China); Li, Xiu-Ping [Technical center for safety of industrial products of Tianjin entry-exit inspection and quarantine bureau, Tianjin 300201 (China); Zhao, Cui; Wang, Hai-Chao; Xue, Min [School of Chemistry and Chemical Engineering, Tianjin University of Technology, Tianjin 300384 (China); Zhao, Jiong-Peng, E-mail: horryzhao@yahoo.com [School of Chemistry and Chemical Engineering, Tianjin University of Technology, Tianjin 300384 (China); Liu, Fu-Chen, E-mail: fuchenliutj@yahoo.com [School of Chemistry and Chemical Engineering, Tianjin University of Technology, Tianjin 300384 (China); Lanzhou Petrochemical College of Vocational Technology, Lanzhou 730060 (China)
2013-06-15
A novel heterometallic complex, [Ni{sub 2}Mn(N{sub 3}){sub 2}(nic){sub 4}·(H{sub 2}O){sub 2}]{sub n} (1) (nic=nicotinate), was obtained by assembling MnCl{sub 2}·4H{sub 2}O, Ni(NO{sub 3}){sub 2}·6H{sub 2}O, NaN{sub 3} and nicotinic acid with a “one step” synthetic strategy—hydrothermal reaction. The 3D structure of the complex can be described as end-on (EO) azido and syn,syn carboxylates mixed bridged by alternate Ni–Mn–Ni trimers linked by the nicotinate. Dominant ferromagnetic interactions were observed between the Ni{sup II} and Mn{sup II} ions in the trimer. - Graphical abstract: A novel heterometallic 3D complex [Ni{sub 2}Mn(N{sub 3}){sub 2}(nic){sub 4}·(H{sub 2}O){sub 2}]{sub n} (1) (nic=nicotinate) was synthesized by hydrothermal reaction. This complex exhibits interesting structural and magnetic properties. - Highlights: • It is difficult to construct simple coordination complexes with azide as “ligands” to obtain heterometallic metal–azido compounds. • A “one-step” method—hydrothermal reaction— was introduced to avoid the disadvantages of azide mentioned above. • The magnetic property is different with the isostructural homometal–azido complex due to the changed metal center.
Li, Mingzhong; Qiao, Ning; Wang, Ke
2013-01-01
The influence of the surfactants of sodium lauryl sulfate (SLS) and Tween 80 on carbamazepine–nicotinamide (CBZ–NIC) cocrystal solubility and dissolution behaviour has been studied in this work. The solubility of the CBZ–NIC cocrystal was determined by measuring the eutectic concentrations of the drug and the coformer. Evolution of the intrinsic dissolution rate (IDR) of the CBZ–NIC cocrystal was monitored by the UV imaging dissolution system during dissolution. Experimental results indicated that SLS and Tween 80 had little influence upon the solubility of the CBZ–NIC cocrystal but they had totally opposite effects on the IDR of the CBZ–NIC cocrystal during dissolution. SLS significantly increased the IDR of the CBZ–NIC cocrystal while Tween 80 decreased its IDR. PMID:24300560
Directory of Open Access Journals (Sweden)
Ke Wang
2013-10-01
Full Text Available The influence of the surfactants of sodium lauryl sulfate (SLS and Tween 80 on carbamazepine–nicotinamide (CBZ–NIC cocrystal solubility and dissolution behaviour has been studied in this work. The solubility of the CBZ–NIC cocrystal was determined by measuring the eutectic concentrations of the drug and the coformer. Evolution of the intrinsic dissolution rate (IDR of the CBZ–NIC cocrystal was monitored by the UV imaging dissolution system during dissolution. Experimental results indicated that SLS and Tween 80 had little influence upon the solubility of the CBZ–NIC cocrystal but they had totally opposite effects on the IDR of the CBZ–NIC cocrystal during dissolution. SLS significantly increased the IDR of the CBZ–NIC cocrystal while Tween 80 decreased its IDR.
Li, Mingzhong; Qiao, Ning; Wang, Ke
2013-10-11
The influence of the surfactants of sodium lauryl sulfate (SLS) and Tween 80 on carbamazepine-nicotinamide (CBZ-NIC) cocrystal solubility and dissolution behaviour has been studied in this work. The solubility of the CBZ-NIC cocrystal was determined by measuring the eutectic concentrations of the drug and the coformer. Evolution of the intrinsic dissolution rate (IDR) of the CBZ-NIC cocrystal was monitored by the UV imaging dissolution system during dissolution. Experimental results indicated that SLS and Tween 80 had little influence upon the solubility of the CBZ-NIC cocrystal but they had totally opposite effects on the IDR of the CBZ-NIC cocrystal during dissolution. SLS significantly increased the IDR of the CBZ-NIC cocrystal while Tween 80 decreased its IDR.
Directory of Open Access Journals (Sweden)
Souheyla Chetioui
2016-08-01
Full Text Available In the copper(II complex, bis{(E-1-[(2,4,6-tribromophenyldiazenyl]naphthalen-2-olato}copper(II, [Cu(C16H8Br3N2O2], (I, the metal cation is coordinated by two N atoms and two O atoms from two bidentate (E-1-[(2,4,6-tribromophenyldiazenyl]naphthalen-2-olate ligands, forming a slightly distorted square-planar environment. In one of the ligands, the tribromobenzene ring is inclined to the naphthalene ring system by 37.4 (5°, creating a weak intramolecular Cu...Br interaction [3.134 (2 Å], while in the other ligand, the tribromobenzene ring is inclined to the naphthalene ring system by 72.1 (6°. In the isotypic nickel(II and palladium(II complexes, namely bis{(E-1-[(2,4,6-tribromophenyldiazenyl]naphthalen-2-olato}nickel(II, [Ni(C16H8Br3N2O2], (II, and bis{(E-1-[(2,4,6-tribromophenyldiazenyl]naphthalen-2-olato}palladium(II, [Pd(C16H8Br3N2O2], (III, respectively, the metal atoms are located on centres of inversion, hence the metal coordination spheres have perfect square-planar geometries. The tribromobenzene rings are inclined to the naphthalene ring systems by 80.79 (18° in (II and by 80.8 (3° in (III. In the crystal of (I, molecules are linked by C—H...Br hydrogen bonds, forming chains along [010]. The chains are linked by C—H...π interactions, forming sheets parallel to (011. In the crystals of (II and (III, molecules are linked by C—H...π interactions, forming slabs parallel to (10-1. For the copper(II complex (I, a region of disordered electron density was corrected for using the SQUEEZE routine in PLATON [Spek (2015. Acta Cryst. C71, 9–18]. The formula mass and unit-cell characteristics of the disordered solvent molecules were not taken into account during refinement.
Bis(3-acetyl-6-methyl-2-oxo-2H-pyran-4-olatobis(dimethyl sulfoxidenickel(II
Directory of Open Access Journals (Sweden)
Amel Djedouani
2009-10-01
Full Text Available In the title compound, [Ni(C8H7O42{(CH32SO}2], the NiII atom is located on a crystallographic centre of symmetry and has a distorted octahedral coordination geometry of type MO6. The bidentate dehydroacetic acid (DHA ligands occupy the equatorial plane of the complex in a trans configuration, and the dimethyl sulfoxide (DMSO ligands are weakly coordinated through their O atoms in the axial positions.
Schreier, Theresa M.; Dawson, V.K.; Cho, Yirang; Spanjers, N.J.; Boogaard, M.A.
2000-01-01
Bayluscide [the ethanolamine salt of niclosamide (NIC)] is a registered piscicide used in combination with 3-(trifluoromethyl)-4-nitrophenol (TFM) to control sea lamprey populations in streams tributary to the Great Lakes. A high-performance liquid chromatography (HPLC) method was developed for the determination of NIC residues in muscle fillet tissues of fish exposed to NIC and TFM during sea lamprey control treatments. NIC was extracted from fortified channel catfish and rainbow trout fillet tissue with a series of acetone extractions and cleaned up on C-18 solid-phase extraction cartridges. NIC concentrations were determined by HPLC with detection at 360 and 335 nm for rainbow trout and catfish, respectively. Recovery of NIC from rainbow trout (n = 7) fortified at 0.04 mu g/g was 77 +/- 6.5% and from channel catfish (n = 7) fortified at 0.02 mu g/g was 113 +/- 11%. NIC detection limit was 0.0107 mu g/g for rainbow trout and 0.0063 mu g/g for catfish. Percent recovery of incurred radioactive residues by this method from catfish exposed to [C-14]NIC was 89.3 +/- 4.1%. Percent recoveries of NIC from fortified storage stability tissue samples for rainbow trout (n = 3) analyzed at 5 and 7.5 month periods were 78 +/- 5.1 and 68 +/- 2.4%, respectively. Percent recoveries of NIC from fortified storage stability tissue samples for channel catfish (n = 3) analyzed at 5 and 7.5 month periods were 88 +/- 13 and 76 +/- 21%, respectively.
Directory of Open Access Journals (Sweden)
James Alan Townsend
2012-08-01
Full Text Available The crystal structure of the title complex, [Ni(C12H28N4(H2O2]Cl2·2H2O, displays O—H...Cl and O—H...O hydrogen bonding. The tetraazacyclotetradecane ligand interacts with the NiII atom in the cis V configuration and the final two ligand binding sites are occupied by water.
Mateuszuk, Lukasz; Jasztal, Agnieszka; Maslak, Edyta; Gasior-Glogowska, Marlena; Baranska, Malgorzata; Sitek, Barbara; Kostogrys, Renata; Zakrzewska, Agnieszka; Kij, Agnieszka; Walczak, Maria; Chlopicki, Stefan
2016-02-01
1-Methylnicotinamide (MNA), the major endogenous metabolite of nicotinic acid (NicA), may partially contribute to the vasoprotective properties of NicA. Here we compared the antiatherosclerotic effects of MNA and NicA in apolipoprotein E (ApoE)/low-density lipoprotein receptor (LDLR)-deficient mice. ApoE/LDLR(-/-) mice were treated with MNA or NicA (100 mg/kg). Plaque size, macrophages, and cholesterol content in the brachiocephalic artery, endothelial function in the aorta, systemic inflammation, platelet activation, as well as the concentration of MNA and its metabolites in plasma and urine were measured. MNA and NicA reduced atherosclerotic plaque area, plaque inflammation, and cholesterol content in the brachiocephalic artery. The antiatherosclerotic actions of MNA and NicA were associated with improved endothelial function, as evidenced by a higher concentration of 6-keto-prostaglandin F1 α and nitrite/nitrate in the aortic ring effluent, inhibition of platelets (blunted thromboxane B2 generation), and inhibition of systemic inflammation (lower plasma concentration of serum amyloid P, haptoglobin). NicA treatment resulted in an approximately 2-fold higher concentration of MNA and its metabolites in urine and a 4-fold higher nicotinamide/MNA ratio in plasma, compared with MNA treatment. In summary; MNA displays pronounced antiatherosclerotic action in ApoE/LDLR(-/-) mice, an effect associated with an improvement in prostacyclin- and nitric oxide-dependent endothelial function, inhibition of platelet activation, inhibition of inflammatory burden in plaques, and diminished systemic inflammation. Despite substantially higher MNA availability after NicA treatment, compared with an equivalent dose of MNA, the antiatherosclerotic effect of NicA was not stronger. We suggest that detrimental effects of NicA or its metabolites other than MNA may limit beneficial effects of NicA-derived MNA. Copyright © 2016 by The American Society for Pharmacology and Experimental
[2,6-Bis(di-tert-butyl-phosphinometh-yl)-phen-yl-κP,C,P'](nitrato-κO)nickel(II).
Boro, Brian J; Dickie, Diane A; Duesler, Eileen N; Goldberg, Karen I; Kemp, Richard A
2008-10-15
The Ni(II) atom in the title compound, [Ni(C(24)H(43)P(2))(NO(3))], adopts a distorted square-planar geometry with the P atoms in a trans arrangement. The compound contains a twofold rotational axis with the nitrate group offset from this axis, except for an O atom of the nitrate group, generating two positions of 50% occupancy for the other atoms of the nitrate group.
Combined effects of marijuana and nicotine on memory performance and hippocampal volume.
Filbey, Francesca M; McQueeny, Tim; Kadamangudi, Shrinath; Bice, Collette; Ketcherside, Ariel
2015-10-15
Combined use of marijuana (MJ) and tobacco is highly prevalent in today's population. Individual use of either substance is linked to structural brain changes and altered cognitive function, especially with consistent reports of hippocampal volume deficits and poorer memory performance. However, the combined effects of MJ and tobacco on hippocampal structure and on learning and memory processes remain unknown. In this study, we examined both the individual and combined effects of MJ and tobacco on hippocampal volumes and memory performance in four groups of adults taken from two larger studies: MJ-only users (n=36), nicotine-only (Nic-only, n=19), combined marijuana and nicotine users (MJ+Nic, n=19) and non-using healthy controls (n=16). Total bilateral hippocampal volumes and memory performance (WMS-III logical memory) were compared across groups controlling for total brain size and recent alcohol use. Results found MJ and MJ+Nic groups had smaller total hippocampal volumes compared to Nic-only and controls. No significant difference between groups was found between immediate and delayed story recall. However, the controls showed a trend for larger hippocampal volumes being associated with better memory scores, while MJ+Nic users showed a unique inversion, whereby smaller hippocampal volume was associated with better memory. Overall, results suggest abnormalities in the brain-behavior relationships underlying memory processes with combined use of marijuana and nicotine use. Further research will need to address these complex interactions between MJ and nicotine. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.
Li, Qing; Li, Chun-Min; Xu, Hong-Liang; Su, Zhong-Min
2017-08-01
A graphene nanoflake (GNF) is a polycyclic aromatic hydrocarbon (PAH) with a huge two-dimensional π-conjugated carbon material in which a central benzene ring is surrounded by identical benzene-type rings through infinite alternant method. In this paper, we explore the structure-aromaticity relationship of the GNFs and the GNFs with hollow sites (GNFHs) by combining the nucleus-independent chemical shifts (NICS) with the anisotropy of the current induced density (ACID). Firstly, the benzene is a typical aromatic molecule (NICS = -9.671 ppm), GNFs 1-6 is darned with benzene and the corresponding GNFHs 1'-6'. Secondly, the NICS values of GNFs 1-6 alternately vary: -1.214 (1) > -13.847 (2) -14.530 (4) -13.978 (6) ppm, the GNFs (2, 4, 6) with even fragments of annulene have larger aromaticity than that of GNFs (1, 3, 5) with odd fragments of annulene. Significantly, the NICS values of GNFs 1-6 can also be fragment analyzed by the NICS values and ACID of benzene and corresponding GNFHs 1'-6'. The NICS values for GNFs (2, 4, 6) can be roughly estimated by the NICS value of benzene minus the NICS value of the GNFHs (2', 4', 6'), respectively. The NICS values for GNFs (1, 3, 5) can be roughly estimated by the NICS value of the GNFHs (1', 3', 5') minus the NICS value of benzene, respectively. We hope that the present work can provide a simple and reliable method for the rational design of the GNF with aromaticity, which may be used to understand the origin of the graphene nanoflake aromatic properties.
Directory of Open Access Journals (Sweden)
Chih-Lung Shen
2016-10-01
Full Text Available This paper presents a novel interleaved converter (NIC with extra-high voltage gain to process the power of low-voltage renewable-energy generators such as photovoltaic (PV panel, wind turbine, and fuel cells. The NIC can boost a low input voltage to a much higher voltage level to inject renewable energy to DC bus for grid applications. Since the NIC has two circuit branches in parallel at frond end to share input current, it is suitable for high power applications. In addition, the NIC is controlled in an interleaving pattern, which has the advantages that the NIC has lower input current ripple, and the frequency of the ripple is twice the switching frequency. Two coupled inductors and two switched capacitors are incorporated to achieve a much higher voltage gain than conventional high step-up converters. The proposed NIC has intrinsic features such as leakage energy totally recycling and low voltage stress on power semiconductor. Thorough theoretical analysis and key parameter design are presented in this paper. A prototype is built for practical measurements to validate the proposed NIC.
Bis(dicyanamido-κN[tris(3-aminopropylamine-κ4N]nickel(II
Directory of Open Access Journals (Sweden)
Jun Luo
2013-07-01
Full Text Available In the title complex, [Ni(C2N32(C9H24N4], the NiII atom is coordinated in a distorted octahedral geometry by one tris(3-aminopropylamine (trisapa ligand and two dicyanamide (dca ligands [one of them disordered in a 0.681 (19:0319 (19 ratio]. Intermolecular N—H...N hydrogen bonds involving the N atoms of the dca anions and the trisapa amine H atoms result in the formation of a three-dimensional network.
catena-Poly[[bis(pyridine-κNnickel(II]-μ-oxalato-κ4O1,O2:O1′,O2′
Directory of Open Access Journals (Sweden)
Zhen-Yu Xuan
2008-08-01
Full Text Available The title compound, [Ni(C2O4(C5H5N2]n, was synthesized under hydro(solvothermal conditions. The NiII atom, lying on a twofold rotation axis, has an octahedral coordination geometry involving two N atoms from two pyridine ligands and four O atoms from two oxalate ligands. The Ni atoms are connected by the tetradentate bridging oxalate ligands into a one-dimensional zigzag chain.
Directory of Open Access Journals (Sweden)
Pan W
2016-08-01
Full Text Available Wenhui Pan, Mengyao Qin, Guoguang Zhang, Yueming Long, Wenyi Ruan, Jingtong Pan, Zushuai Wu, Tao Wan, Chuanbin Wu, Yuehong Xu Department of Pharmaceutics, School of Pharmaceutical Sciences, Sun Yat-sen University, Guangzhou, People’s Republic of China Abstract: Tacrolimus (FK506, an effective immunosuppressant for treating inflammatory skin diseases, hardly penetrates into and through the skin owing to its high hydrophobicity and molecular weight. The aim of this study was to develop a hybrid system based on nicotinamide (NIC and nanoparticles (NPs encapsulating FK506, such as FK506–NPs–NIC, for facilitating percutaneous delivery, which exploited virtues of both NIC and NPs to obtain the synergetic effect. Solubility and percutaneous permeation studies were carried out. The results showed that NIC could increase the solubility and permeability of FK506 and that 20% (w/v NIC presented higher FK506 permeability and was thus chosen as the hydrotropic solution to solubilize FK506 and prepare FK506–NPs–NIC. Hyaluronic acid (HA was chemically conjugated with cholesterol (Chol to obtain amphiphilic conjugate of HA–Chol, which self-assembled NPs in 20% NIC solution containing FK506. The particle size, zeta potential, and morphology of NPs were characterized. The encapsulation efficiency and in vitro percutaneous permeation of NPs were evaluated in the presence and absence of NIC. The results demonstrated that hydrotropic solubilizing FK506 was readily encapsulated into NPs with a higher encapsulation efficiency of 79.2%±4.2%, and the combination of NPs with NIC exhibited a significantly synergistic effect on FK506 deposition within the skin (2.39±0.53 µg/cm2 and penetration through the skin (13.38±2.26 µg/cm2. The effect of the combination of NPs with NIC on drug permeation was further visualized by confocal laser scanning microscope through in vivo permeation studies, and the results confirmed that NPs–NIC synergistically enhanced
Simvastatin-nicotinamide co-crystal: design, preparation and ...
African Journals Online (AJOL)
Methods: In silico molecular modeling of Nic counter to SV were investigated using ... Results: In silico results showed that the interaction of Nic with SV took place through ... Conclusion: Co-crystallization using Nic has the potential to enhance drug ... directed to convert the ligand protein data bank ... after each sampling.
Directory of Open Access Journals (Sweden)
Thomas PATERNOSTER
2011-05-01
Full Text Available Normal 0 14 false false false IT ZH-TW X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabella normale"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Fire blight, caused by Erwinia amylovora, is a devastating disease of pear (Pyrus communis and apple (Malus × domestica in many areas of the world. The disease is often initiated by epiphytic populations that multiply on flowers and colonize the hypanthia. In vitro, E. amylovora requires nicotinic acid (NicAc and/or nicotinamide (NicNH2 as essential growth factors. The amount of NicAc on pear hypanthia was positively correlated with the altitude of the growing site and was inversely correlated with the sum of the maximum temperatures in the 30 days before flowering. The sum of the amounts of NicAc and NicNH2 on the hypanthia was about 6 to 23 times higher in pear, and about 1.2 to 3.5 times higher in apple, than the amounts of NicAc or NicNH2 necessary to support maximum E. amylovora growth in vitro. No correlation was found between the amounts of NicAc and NicNH2 on the hypanthia of different pear and apple cultivars and at different growth stages and the growth of E. amylovora after experimental inoculation. In conclusion, NicAc and NicNH2 are essential for E. amylovora growth but the amounts of these chemicals on pear and apple flowers do not limit the establishment of the pathogen when competing bacteria
Directory of Open Access Journals (Sweden)
Aymen Yangui
2014-06-01
Full Text Available In the title compound, [Ni(C3H10N23]2[Ni(C3H10N22(H2O2]Br6·2H2O, one Ni2+ cation, located on an inversion centre, is coordinated by four N atoms from two ligands and by two water O atoms. The other Ni2+ cation, located in a general position, is coordinated by six N atoms from three ligands. In both cases, the Ni2+ cation has an octahedral coordination environment. The overall structural cohesion is ensured by three types of hydrogen bonds, N—H...Br, O—H...Br and O—H...O, which connect the two types of complex cations, the bromide counter-anions and the lattice water molecules into a three-dimensional network.
Directory of Open Access Journals (Sweden)
Sarian Luis Otávio Zanatta
2003-01-01
Full Text Available OBJETIVO: avaliar o desempenho da carga viral do HPV por captura de híbridos II (CHII na predição da gravidade das lesões cervicais. MÉTODOS: foram incluídas 309 mulheres admitidas por resultado anormal da colpocitologia oncológica (CO entre agosto de 200 e novembro de 2002. Todas foram submetidas a avaliação histológica, sendo que a presença de neoplasia intra-epitelial cervical (NIC grau 2 ou mais (NIC 3, carcinoma invasor foi considerada doença grave. A CHII foi realizada para tipos de HPV de alto risco oncogênico e a carga viral medida em unidades relativas de luz (URL. O desempenho da CHII foi avaliado por curva receiver operating characteristics (ROC. RESULTADOS: na avaliação histológica, 140 (45,3% mulheres apresentavam cervicite ou NIC 1 e 199 (54,7%, NIC 2/3, adenocarcinoma in situ ou câncer invasor. O melhor ponto de corte da CHII para a detecção de doença grave foi 35 URL, com sensibilidade de 69% e especificidade de 70%. O valor preditivo positivo das alterações compatíveis com lesão de alto grau na CO associado a CHII de 35 URL (unidades relativas de luz foi de 88,2% para a detecção de NIC 2 ou mais. Já 95,7% das mulheres com lesões de baixo grau na CO e CHII menor que 1 URL não apresentaram lesões histológicas graves. CONCLUSÃO: o melhor desempenho da CHII no diagnóstico de NIC 2 ou lesão mais grave foi encontrado com 35 URL. A associação da CO com a CHII em diferentes cargas virais mostrou valores preditivos positivos e negativos muito altos.
trans-(1,8-Dibenzyl-1,3,6,8,10,13-hexaazacyclotetradecanediisonicotinatonickel(II
Directory of Open Access Journals (Sweden)
Kil Sik Min
2008-02-01
Full Text Available In the centrosymmetric title compound, [Ni(C6H4NO22(C22H34N6], the NiII ion is bonded to the four secondary N atoms of the macrocyclic ligand in a square-planar fashion and two carboxylate O atoms of the isonicotinate ions in axial positions, resulting in a tetragonally distorted octahedron. An offset face-to-face π–π stacking interaction [centroid–centroid distance = 3.674(4 Å] and N—H...N and N—H...O hydrogen-bonding interactions give rise to a one-dimensional supramolecular structure in the solid state.
Nicotinamidase activity is important for germination.
Hunt, Lee; Holdsworth, Michael J; Gray, Julie E
2007-08-01
It has been suggested that nicotinamide must be degraded during germination; however, the enzyme responsible and its physiological role have not been previously studied. We have identified an Arabidopsis gene, NIC2, that is expressed at relatively high levels in mature seed, and encodes a nicotinamidase enzyme with homology to yeast and bacterial nicotinamidases. Seed of a knockout mutant, nic2-1, had reduced nicotinamidase activity, retarded germination and impaired germination potential. nic2-1 germination was restored by after-ripening or moist chilling, but remained hypersensitive to application of nicotinamide or ABA. Nicotinamide is a known inhibitor of NAD-degrading poly(ADP-ribose) polymerases (PARP enzymes) that are implicated in DNA repair. We found reduced poly(ADP)ribosylation levels in nic2-1 seed, which were restored by moist chilling. Furthermore, nic2-1 seed had elevated levels of NAD, and germination was hypersensitive to methyl methanesulphonate (MMS), suggesting that PARP activity and DNA repair responses were impaired. We suggest that nicotinamide is normally metabolized by NIC2 during moist chilling or after-ripening, which relieves inhibition of PARP activity and allows DNA repair to occur prior to germination.
trans-Bis(5,5-diphenylhydantoinato-κN3bis(propane-1,2-diamine-κ2N,N′nickel(II
Directory of Open Access Journals (Sweden)
Xiaojiao Li
2008-12-01
Full Text Available The asymmetric unit of the title complex, [Ni(pht2(pn2] (pht is 5,5-diphenylhydantoinate and pn is propane-1,2-diamine or [Ni(C15H11N2O22(C3H10N22], contains one-half [Ni(pht2(pn2] molecule. The NiII atom is situated on a crystallographic center of inversion and shows a distorted octahedral coordination geometry. A three-dimensional network structure is assembled by inter- and intramolecular N—H...O=C interactions.
Directory of Open Access Journals (Sweden)
Hong Wang
Full Text Available Adverse experiences by the developing fetus and in early childhood are associated with profound effects on learning, emotional behavior, and cognition as a whole. In this study we investigated the effects of prenatal nicotine exposure (NIC, postnatal maternal deprivation (MD or the combination of the two (NIC+MD to determine if hippocampal neuron development is modulated by exposure to drugs of abuse and/or stress. Growth of rat offspring exposed to MD alone or NIC+MD was repressed until after weaning. In CA1 but not CA3 of postnatal day 14 (P14 pups, MD increased pyramidal neurons, however, in dentate gyrus (DG, decreased granule neurons. NIC had no effect on neuron number in CA1, CA3 or DG. Unexpectedly, NIC plus MD combined caused a synergistic increase in the number of CA1 or CA3 neurons. Neuron density in CA regions was unaffected by treatment, but in the DG, granule neurons had a looser packing density after NIC, MD or NIC+MD exposure. When septotemporal axes were analyzed, the synergism of stress and drug exposure in CA1 and CA3 was associated with rostral, whereas MD effects were predominantly associated with caudal neurons. TUNEL labeling suggests no active apoptosis at P14, and doublecortin positive neurons and mossy fibers were diminished in NIC+MD relative to controls. The laterality of the effect of nicotine and/or maternal deprivation in right versus left hippocampus was also analyzed and found to be insiginificant. We report for the first time that early life stressors such as postnatal MD and prenatal NIC exposure, when combined, may exhibit synergistic consequences for CA1 and CA3 pyramidal neuron development, and a potential antagonistic influence on developing DG neurons. These results suggest that early stressors may modulate neurogenesis, apoptosis, or maturation of glutamatergic neurons in the hippocampus in a region-specific manner during critical periods of neurodevelopment.
Directory of Open Access Journals (Sweden)
Feifei Shi
2010-06-01
Full Text Available The asymmetric unit of the title complex, [Ni(C16H32N4]Br2·2H2O, contains two [Ni(C16H32N4]2+ cations, four Br− anions and four uncoordinated H2O molecules. The Ni atoms are in a slightly distorted square-planar coordination by the four macrocyclic N atoms, which are almost coplanar [N—N—N—N torsion angles of 2.97 (6 and 3.12 (7°]. In the crystal, a network of N—H...Br, O—H...Br and N—H...O hydrogen bonds leads to the formation of a chain structure.
Detection of nicotine based on molecularly imprinted TiO{sub 2}-modified electrodes
Energy Technology Data Exchange (ETDEWEB)
Wu, C.-T.; Chen, P.-Y.; Chen, J.-G.; Suryanarayanan, Vembu [Department of Chemical Engineering, National Taiwan University, Taipei 10617, Taiwan (China); Ho, K.-C. [Department of Chemical Engineering, National Taiwan University, Taipei 10617, Taiwan (China); Institute of Polymer Science and Engineering, National Taiwan University, Taipei 10617, Taiwan (China)], E-mail: kcho@ntu.edu.tw
2009-02-02
Amperometric detection of nicotine (NIC) was carried out on a titanium dioxide (TiO{sub 2})/poly(3,4-ethylenedioxythiophene) (PEDOT)-modified electrode by a molecular imprinting technique. In order to improve the conductivity of the substrate, PEDOT was coated onto the sintered electrode by in situ electrochemical polymerization of the monomer. The sensing potential of the NIC-imprinted TiO{sub 2} electrode (ITO/TiO{sub 2}[NIC]/PEDOT) in a phosphate-buffered saline (PBS) solution (pH 7.4) containing 0.1 M KCl was determined to be 0.88 V (vs. Ag/AgCl/saturated KCl). The linear detection range for NIC oxidation on the so-called ITO/TiO{sub 2}[NIC]/PEDOT electrode was 0-5 mM, with a sensitivity and limit of detection of 31.35 {mu}A mM{sup -1} cm{sup -2} and 4.9 {mu}M, respectively. When comparing with the performance of the non-imprinted one, the sensitivity ratio was about 1.24. The sensitivity enhancement was attributed to the increase in the electroactive area of the imprinted electrode. The at-rest stability of the ITO/TiO{sub 2}[NIC]/PEDOT electrode was tested over a period of 3 days. The current response remained about 85% of its initial value at the end of 2 days. The ITO/TiO{sub 2}[NIC]/PEDOT electrode showed reasonably good selectivity in distinguishing NIC from its major interferent, (-)-cotinine (COT). Moreover, scanning electrochemical microscopy (SECM) was employed to elucidate the surface morphology of the imprinted and non-imprinted electrodes using Fe(CN){sub 6}{sup 3-}/Fe(CN){sub 6}{sup 4-} as a redox probe on a platinum tip. The imprinted electrode was further characterized by scanning electron microscopy (SEM) and Fourier transform infrared spectroscopy (FTIR)
Bis[1-(3-cyanobenzylpyridinium] bis(1,2-dicyanoethene-1,2-dithiolatonickelate(II
Directory of Open Access Journals (Sweden)
Hai-Bao Duan
2011-01-01
Full Text Available In the ionic title complex, (C13H11N22[Ni(C4N2S22], the NiII ion is located on an inversion centre so the asymmetric unit contains one-half [Ni(mnt2]2− dianion (mnt2− is maleonitriledithiolate and one 1-(3-cyanobenzylpyridinium cation ([CNBzPy]+. The NiII ion in the [Ni(mnt2]2− anion is coordinated by four S atoms of two mnt2− ligands, and exhibits square-planar coordination geometry. In the [CNBzPy]+ cation, the benzene and pyridine rings are twisted with respect to the C/C/N plane incorporating the methylene C atom that links them. The crystal structure is stabilized by Coulombic interactions.
[Correlation of hybrid II capture cytologic exam in diagnosis of cervical lesions related to HPV].
Saturnino, Ana Conceição Ribeiro Dantas; Diniz, Veruska Cassandra; Sisenando, Herbert Ary Arzabe Anteza Costa Nóbrega; de Souza, Eroisa Maria Conceição Oliveira; de Paiva, Magnus Sérgio Martins; de Brito, Maria Helena Marques Fonseca; Ramos, Eleni Souto Nóbrega
2005-01-01
The aim of the present study was confront the results of the cytological examination with hybrid capture II in the diagnosis of induced cervical intraepithelial lesion-HPV, correlating the cytological findings with biomoleculares. The research was carried through in a group of 160 sexually active women who had espontaneamente looked its gynecologists for consultation of routine, having been submitted to the collection of cervicovaginal material for cytology and for examination of hybrid capture II in the Centro de Patologia Clínica and the Hospital e Maternidade Promater, in the city of the Natal-RN. The results had shown to relatively high numbers of positive cases for HPV using hybrid capture II (41.87%) and the cytology (23.75%). The agreement between the two studied methods relatively was raised (59.38%). It was evident also that the viruses with high oncogênico potential had presented found in the compatible cytology with Lesion of low risk (11.88%), followed of Lesion of high risk (NIC II and III); already the viruses with low oncogênico potential were more associates the Lesion of low risk (6.25%), followed of Lesion of high risk. The cytology, exactly with its limitations, is an important method in the detention of attributable patologias to the HPV, emphasizing that the molecular method comes to complement it and to consolidate the cytological findings.
Ke Wang; Ning Qiao; Mingzhong Li
2013-01-01
The influence of the surfactants of sodium lauryl sulfate (SLS) and Tween 80 on carbamazepine–nicotinamide (CBZ–NIC) cocrystal solubility and dissolution behaviour has been studied in this work. The solubility of the CBZ–NIC cocrystal was determined by measuring the eutectic concentrations of the drug and the coformer. Evolution of the intrinsic dissolution rate (IDR) of the CBZ–NIC cocrystal was monitored by the UV imaging dissolution system during dissolution. Experimental results indicated...
GENGE BELA; SIATERLIS CHRISTOS
2011-01-01
The fact that modern Networked Industrial Control Systems (NICS) depend on Information and Communication Technologies (ICT), is well known. Although many studies have focused on the security of these systems, today we still lack the proper understanding of the effects that cyber attacks have on NICS. In this paper we use our previously developed framework to study the effects of coordinated cyber attacks against NICS. Coordinated attacks rely on several infected hosts to disrupt the ...
Directory of Open Access Journals (Sweden)
Raquel Autran Coelho
2004-03-01
Full Text Available OBJETIVVO: relacionar a gravidade de lesão cervical diagnosticada por exame citopatológico à contagem de células CD4+ e à carga viral de RNA-HIV em pacientes HIV-soropositivas. MÉTODOS: foram avaliadas retrospectivamente, por meio de revisão de prontuários, 115 pacientes HIV-positivas atendidas em ambulatório de hospital universitário, no período de janeiro de 2002 até abril de 2003. Oitenta e três casos apresentaram diagnóstico de neoplasia intra-epitelial cervical (NIC ao exame citopatológico, e trinta e dois, exames sem alterações. Todas as pacientes apresentavam contagem de células CD4+ e carga viral à época do exame. Os casos foram distribuídos quanto ao índice de células CD4+ em três grupos: CD4 acima de 500 cel/mm³, entre 200 e 500 cel/mm³ ou abaixo de 200 cel/mm³, e, em outros três grupos, quanto à carga viral de HIV: menor do que 10.000 cópias RNA-HIV/mL, entre 10.000 e 100.000 cópias RNA-HIV/mL ou maior do que 100.000 cópias RNA-HIV/mL. A verificação da hipótese de associação foi realizada por meio do teste exato de Fisher. RESULTADOS: das 83 pacientes com NIC citopatológico, 73% apresentaram contagem de células CD4+ abaixo de 500 células/mm³. Em qualquer das faixas de contagem de células CD4+, mais da metade das pacientes apresentavam NIC I citopatológico. Quanto à carga viral de HIV, 71,7% das pacientes com menor carga viral de HIV apresentaram NIC I, ao passo que 11,3% revelaram NIC III. Já no grupo com maior carga viral (100.000 cópias/mL, em 61,5% do total de pacientes o exame citopatológico foi compatível com NIC I, e 30,8% com NIC III. CONCLUSÃO: houve evidência de associação entre carga viral e NIC (p=0.013, não sendo observado o mesmo em relação à contagem de linfócitos CD4+. A presença de infecção secundária cervicovaginal foi considerada possível fator confundidor.PURPOSE: to correlate the type of cervical lesion diagnosed by Pap smear with CD4 cell counts and HIV
Nadi, Mustafa; Ramachandran, Sudheesh; Islam, Abir; Forden, Joanne; Guo, Gui Fang; Midha, Rajiv
2018-05-18
OBJECTIVE Supercharge end-to-side (SETS) transfer, also referred to as reverse end-to-side transfer, distal to severe nerve compression neuropathy or in-continuity nerve injury is gaining clinical popularity despite questions about its effectiveness. Here, the authors examined SETS distal to experimental neuroma in-continuity (NIC) injuries for efficacy in enhancing neuronal regeneration and functional outcome, and, for the first time, they definitively evaluated the degree of contribution of the native and donor motor neuron pools. METHODS This study was conducted in 2 phases. In phase I, rats (n = 35) were assigned to one of 5 groups for unilateral sciatic nerve surgeries: group 1, tibial NIC with distal peroneal-tibial SETS; group 2, tibial NIC without SETS; group 3, intact tibial and severed peroneal nerves; group 4, tibial transection with SETS; and group 5, severed tibial and peroneal nerves. Recovery was evaluated biweekly using electrophysiology and locomotion tasks. At the phase I end point, after retrograde labeling, the spinal cords were analyzed to assess the degree of neuronal regeneration. In phase II, 20 new animals underwent primary retrograde labeling of the tibial nerve, following which they were assigned to one of the following 3 groups: group 1, group 2, and group 4. Then, secondary retrograde labeling from the tibial nerve was performed at the study end point to quantify the native versus donor regenerated neuronal pool. RESULTS In phase I studies, a significantly increased neuronal regeneration in group 1 (SETS) compared with all other groups was observed, but with modest (nonsignificant) improvement in electrophysiological and behavioral outcomes. In phase II experiments, the authors discovered that secondary labeling in group 1 was predominantly contributed from the donor (peroneal) pool. Double-labeling counts were dramatically higher in group 2 than in group 1, suggestive of hampered regeneration from the native tibial motor neuron pool
Shock formation and structure in magnetic reconnection with a streaming flow.
Wu, Liangneng; Ma, Zhiwei; Zhang, Haowei
2017-08-18
The features of magnetic reconnection with a streaming flow have been investigated on the basis of compressible resistive magnetohydrodynamic (MHD) model. The super-Alfvenic streaming flow largely enhances magnetic reconnection. The maximum reconnection rate is almost four times larger with super-Alfvenic streaming flow than sub-Alfvénic streaming flow. In the nonlinear stage, it is found that there is a pair of shocks observed in the inflow region, which are manifested to be slow shocks for sub-Alfvénic streaming flow, and fast shocks for super-Alfvénic streaming flow. The quasi-period oscillation of reconnection rates in the decaying phase for super-Alfvénic streaming flow is resulted from the different drifting velocities of the shock and the X point.
González-Cerón, Lilia; Montoya, Alberto; Corzo-Gómez, Josselin C; Cerritos, Rene; Santillán, Frida; Sandoval, Marco A
2017-07-01
The Plasmodium vivax multidrug resistant 1 gene (pvmdr1) codes for a transmembrane protein of the parasite's digestive vacuole. It is likely that the pvmdr1 gene mutations occur at different sites by convergent evolution. In here, the genetic variation of pvmdr1 at three sites of the Mesoamerican region was studied. Since 1950s, malarious patients of those areas have been treated only with chloroquine and primaquine. Blood samples from patients infected with P. vivax were obtained in southern Mexico (SMX), in the Northwest (NIC-NW) and in the northeast (NIC-NE) of Nicaragua. Genomic DNA was obtained and fragments of pvmdr1 were amplified and sequenced. The nucleotide and amino acid changes as well as the haplotype frequency in pvmdr1 were determined per strain and per geographic site. The sequences of pvmdr1 obtained from the studied regions were compared with homologous sequences from the GenBank database to explore the P. vivax genetic structure. In 141 parasites, eight nucleotide changes (two changes were synonymous and other six were nonsynonymous) were detected in 1536 bp. The PvMDR1 amino acid changes Y976F, F1076FL were predominant in endemic parasites from NIC-NE and outbreak parasites in NIC-NW but absent in SMX. Thirteen haplotypes were resolved, and found to be closely related, but their frequency at each geographic site was different (P = 0.0001). The pvmdr1 codons 925-1083 gene fragment showed higher genetic and haplotype diversity in parasites from NIC-NE than the other areas outside Latin America. The haplotype networks suggested local diversification of pvmdr1 and no significant departure from neutrality. The F ST values were low to moderate regionally, but high between NIC-NE or NIC-NW and other regions inside and outside Latin America. The pvmdr1 gene might have diversified recently at regional level. In the absence of significant natural, genetic drift might have caused differential pvmdr1 haplotype frequencies at different geographic sites
Directory of Open Access Journals (Sweden)
Luiz Carlos Zeferino
1998-12-01
Full Text Available Objetivo: estimar a duração e o tempo de evolução da neoplasia do colo uterino, a partir da infecção por papilomavírus humano (HPV até as formas invasoras avançadas, tomando como parâmetro a idade média ao diagnóstico. Método: estudo observacional-transversal que incluiu 1.177 mulheres com infecção por HPV, 1.561 com neoplasia intra-epitelial cervical (NIV e 773 com carcinoma invasor. Resultados: não houve diferença estatisticamente significante entre as médias de idade ao diagnóstico da NIC 1 e NIC 2. A duração da NIC 2 foi 2,2 anos e da NIC 3 foi 10,3 anos, sendo 4,1 anos como displasia grave e 6,2 anos como carcinoma in situ (CIS. A duração da lesão intra-epitelial escamosa de alto grau foi 12,5 anos e do carcinoma invasor estádio Ia, Ib e II foram, respectivamente, 3,0, 2,7 e 3,7 anos. Conclusões: de acordo com os resultados deste estudo, as NIC 1 e NIC 2 originam-se diretamente da infecção por HPV e a maioria das NIC 2 seria uma lesão transiente. A lesão de maior duração é o CIS e o tempo médio do período subclínico da neoplasia do colo uterino é de 18,2 anos. Estes resultados são discutidos em função do conhecimento mais atual da história natural do carcinoma do colo uterino e de outros estudos que estimaram a duração desta neoplasia.Purpose: to estimate the duration of cervical neoplasia from human pappilomavirus (HPV infection to advanced invasive carcinoma, using as paremeter the mean age of the women at diagnosis. Methods: this cross-sectional study included 1,177 women with HPV infection, 1,561 with cervical intraepithelial neoplasia (CIN and 773 with invasive carcinoma. Results: the mean ages of CIN 1 and CIN 2 on diagnosis were not statistically different. The mean duration of CIN 2 was 2.2 years. The mean duration of CIN 3 was 10.3 years, with 4.1 years as severe dysplasia and 6.2 years as carcinoma in situ (CIS. The mean duration of high grade squamous intraepithelial lesions was 12
Nursing to achieve organizational performance: Consider the role of nursing intellectual capital.
Harris, Alexandra
2016-05-01
The success and performance of healthcare organizations relies on the strategic management of knowledge. Nursing Intellectual Capital (NIC) has emerged as a concept involving nursing knowledge resources that create value in healthcare organizations. This article aims to discuss the importance of considering knowledge resources in the context of healthcare performance, with specific reference to NIC. Reflections are then provided on how leaders can look to advance NIC for improved performance. © 2016 The Canadian College of Health Leaders.
Guan, Zhi-Heng; Jiang, Zhang; Wang, Fang-Ming
2011-01-01
In the title ion-pair complex, (C10H10NO)2[Ni(C4N2S2)2]·2H2O, the anion has crystallographically imposed centre of symmetry. The NiII atom exhibits a slightly distorted square-planar coordination geometry. In the crystal, the water molecule links anions and cations into a three-dimensional network via O—H...N, O—H...S and O—H...O hydrogen bonds. The structure is further stabilized by weak S...π contacts [S...centroid = 3.8047 (9)...
Keilbach, D.; Drews, C.; Berger, L.; Marsch, E.; Wimmer-Schweingruber, R. F.
2017-12-01
Using a test particle approach we have investigated, how an oxygen pickup ion torus velocity distribution is modified by continuous and intermittent alfvènic waves on timescales, where the gyro trajectory of each particle can be traced.We have therefore exposed the test particles to mono frequent waves, which expanded through the whole simulation in time and space. The general behavior of the pitch angle distribution is found to be stationary and a nonlinear function of the wave frequency, amplitude and the initial angle between wave elongation and field-perpendicular particle velocity vector. The figure shows the time-averaged pitch angle distributions as a function of the Doppler shifted wave frequency (where the Doppler shift was calculated with respect to the particles initial velocity) for three different wave amplitudes (labeled in each panel). The background field is chosen to be 5 nT and the 500 test particles were initially distributed on a torus with 120° pitch angle at a solar wind velocity of 450 km/s. Each y-slice of the histogram (which has been normalized to it's respective maximum) represents an individual run of the simulation.The frequency-dependent behavior of the test particles is found to be classifiable into the regimes of very low/high frequencies and frequencies close to first order resonance. We have found, that only in the latter regime the particles interact strongly with the wave, where in the time averaged histograms a branch structure is found, which was identified as a trace of particles co-moving with the wave phase. The magnitude of pitch angle change of these particles is as well as the frequency margin, where the branch structure is found, an increasing function with the wave amplitude.We have also investigated the interaction with mono frequent intermittent waves. Exposed to such waves a torus distribution is scattered in pitch angle space, whereas the pitch angle distribution is broadened systematically over time similar to
Directory of Open Access Journals (Sweden)
Hadi Kargar
2012-07-01
Full Text Available The asymmetric unit of the title compound, [Ni(C19H16I4N2O2], comprises half of a Schiff base complex. The NiII atom is located on a twofold rotation axis which also bisects the central C atom of the 2,2-dimethylpropane group of the ligand. The geometry around the NiII atom is distorted square-planar, with a dihedral angle of 21.7 (3° between the symmetry-related N/Ni/O coordination planes. The dihedral angle between the symmetry-related benzene rings is 27.9 (3°. In the crystal, short intermolecular I...I [3.8178 (9 and 3.9013 (10 Å] interactions are present.
1983-03-01
Tic, equals to (NI/ Nic ) where Nic , defined as the net chemical production rate of i-th species, is in general the algebraic sum of terms which are...detailed analysis has shown that in preignition regions the chemical rates which make a significant contribution to any of the Nic are such that at least...Elkton Division Lab., Inc. ATTN. R. Biddle ATTN: M. Summeitield Tech Lib. 1041 US Hlighway One North P. 0. Box 241 Princeton, NJ 08540 Elkton, MD
Wang, X.; Tu, C. Y.; He, J.; Wang, L.
2017-12-01
It has been a longstanding debate on what the nature of Elsässer variables z- observed in the Alfvénic solar wind is. It is widely believed that z- represents inward propagating Alfvén waves and undergoes non-linear interaction with z+ to produce energy cascade. However, z- variations sometimes show nature of convective structures. Here we present a new data analysis on z- autocorrelation functions to get some definite information on its nature. We find that there is usually a break point on the z- auto-correlation function when the fluctuations show nearly pure Alfvénicity. The break point observed by Helios-2 spacecraft near 0.3 AU is at the first time lag ( 81 s), where the autocorrelation coefficient has the value less than that at zero-time lag by a factor of more than 0.4. The autocorrelation function breaks also appear in the WIND observations near 1 AU. The z- autocorrelation function is separated by the break into two parts: fast decreasing part and slowly decreasing part, which cannot be described in a whole by an exponential formula. The breaks in the z- autocorrelation function may represent that the z- time series are composed of high-frequency white noise and low-frequency apparent structures, which correspond to the flat and steep parts of the function, respectively. This explanation is supported by a simple test with a superposition of an artificial random data series and a smoothed random data series. Since in many cases z- autocorrelation functions do not decrease very quickly at large time lag and cannot be considered as the Lanczos type, no reliable value for correlation-time can be derived. Our results showed that in these cases with high Alfvénicity, z- should not be considered as inward-propagating wave. The power-law spectrum of z+ should be made by fluid turbulence cascade process presented by Kolmogorov.
Three-dimensional simulations of turbulent spectra in the local interstellar medium
Directory of Open Access Journals (Sweden)
D. Shaikh
2007-07-01
Full Text Available Three-dimensional time dependent numerical simulations of compressible magnetohydrodynamic fluids describing super-Alfvénic, supersonic and strongly magnetized space and laboratory plasmas show a nonlinear relaxation towards a state of near incompressibility. The latter is characterized essentially by a subsonic turbulent Mach number. This transition is mediated dynamically by disparate spectral energy dissipation rates in compressible magnetosonic and shear Alfvénic modes. Nonlinear cascades lead to super-Alfvénic turbulent motions decaying to a sub-Alfvénic regime that couples weakly with (magnetoacoustic cascades. Consequently, the supersonic plasma motion is transformed into highly subsonic motion and density fluctuations experience a passive convection. This model provides a self-consistent explaination of the ubiquitous nature of incompressible magnetoplasma fluctuations in the solar wind and the interstellar medium.
Cr(III,Mn(II,Fe(III,Co(II,Ni(II,Cu(II and Zn(II Complexes with Diisobutyldithiocarbamato Ligand
Directory of Open Access Journals (Sweden)
Mohammad Tarique
2011-01-01
Full Text Available The synthesis of sulphur and nitrogen containing dithiocarbamato ligand derived from diisobutylamine as well as its coordination compounds with 3d series transition metals is presented. These synthesized compounds were characterized on the basis of elemental analysis, conductometric measurements and IR spectral studies. The analytical data showed the stoichiometry 1:2 and 1:3 for the compounds of the types ML2 {M=Mn(II, Co(II, Ni(II, Cu(II and Zn(II} and M'L3{M'=Cr(III and Fe(III} respectively. The conductometric measurements proved the non-electrolytic behaviour of all the compounds. The bidentate nature of dithiocarbamato moiety was confirmed on the basis of IR spectral data.
Sunakawa, Mitsuhiro; Matsumoto, Hiroyuki
2009-03-01
It has been planned to give pre-clinical practice in the clinic, so-called inclusive clinical practice phase I, for fifth-grade students in the School of Dentistry, Faculty of Dentistry, Tokyo Medical and Dental University, to give them the clinical training needed to perform dental practice and clinical practicum for comprehensive patient care, namely inclusive clinical practice phase II. This study analyzed the educative efficiency of the class on nosocomial infection control (NIC) by comparing achievements pre- and post-test, and discussed appropriate education planning on the NIC for dental students. Sixty-two fifth-grade students in the 2007 academic year sat the pre- and post-tests; the mean score and standard deviation of these tests were 5.30 +/- 1.26 (n = 56) and 8.59 +/- 1.18 (n = 59), respectively. There was a statistically significant difference between them (paired t-test, p < 0.01). Another finding was that students with high scores in the post-test did not necessarily achieve high ratings in the pre-test. It is suggested that the introduction of pre- and post-tests and the clarification of main points in the class as a theme of NIC could be a useful tool for increasing the comprehension of students on the theme. Since students at lower grades will attend clinical practice in the university hospital, it is thought that students should be given NIC training early in the clinical course, and the current curriculum should be improved to increase the opportunity for students to study this important issue.
Wavelet analysis of near-inertial currents at the East Flower Garden Bank
Teague, W. J.; Wijesekera, H. W.; Jarosz, E.; Lugo-Fernández, A.; Hallock, Z. R.
2014-10-01
Near-inertial currents (NICs) often dominate the mean circulation at the East Flower Garden Bank (EFGB), part of the Flower Garden Banks National Marine Sanctuary. The EFGB, one of several submerged coral reefs, is located in the northwestern Gulf of Mexico, about 190 km southeast of Galveston, Texas. The bank is about 6 km wide in the east-west direction and rises to within about 20 m from the surface. NICs near the EFGB are described using current data from 5 acoustic Doppler current profilers that were moored at the edges of the bank and on top of the bank for about a year. A wavelet analysis was used in order to better describe the nonstationarity of the NICs. NICs were strongest during spring and summer due to their near resonant response with sea breeze and the shallowness of the mixed layer, and exhibited a first-baroclinic-mode vertical structure. NICS were generally larger near the surface and extended to the bottom on the west side of the EFGB but only to within about 20 m of the bottom on the eastern side of the bank. NIC ellipses were nearly circular and rotated clockwise above the top of the EFGB but became flatter and aligned with the bathymetry with increasing depth; occasionally, on the eastern side of the bank, the NIC vectors rotated counterclockwise due to probable effects of lee vortices arising from the mean flow interacting with the bank. Most energy input by the wind at the surface was likely transferred downward through divergence of the meridional flow against the coastal boundary. The inertial currents were at times more energetic than the mean flow, and often accounted for more than 50% of the total current energy.
Yataco, Maria L; Difato, Thomas; Bargehr, Johannes; Rosser, Barry G; Patel, Tushar; Trejo-Gutierrez, Jorge F; Pungpapong, Surakit; Taner, C Burcin; Aranda-Michel, Jaime
2014-07-01
Non-ischaemic cardiomyopathy (NIC) is an early complication of liver transplantation (LT). Our aims were to define the prevalence, associated clinical factors, and prognosis of this condition. A retrospective study was performed on patients undergoing LT at our institution from January 2005 to December 2012. Patients who developed NIC were identified. Data collected included demographic and clinical data. A total 1460 transplants were performed in this period and seventeen patients developed NIC. Pretransplant median QTc interval was 459 (range, 405-530), and median E/A ratio was 1 (range, 0.71-1.67). Fourteen patients (82%) were severely malnourished and required nutritional support. Thirteen patients (76%) had renal insufficiency. Median time to onset was 2 days post-transplant (range, 0-20). Echocardiograms showed global left ventricular hypokinesis and a decrease in ejection fraction (EF) from a median of 65% (range, 50-81) pretransplant to a median of 21% (range, 15-32). Median raw model for end-stage liver disease (MELD) score was 29 in patients with NIC vs. 18 in patients without cardiomyopathy (P = 0.01). There was no significant difference between recipients with NIC vs. recipients without cardiomyopathy regarding donor age, donor risk index, and cold and warm ischaemia time. Recovery of cardiac function occurred in 16 patients, with a median EF of 44% (range, 25-65%) at the time of discharge. The last echocardiogram available showed a median EF of 59% (range, 49-73%). One-year survival of NIC patients was 94.1%. Non-ischaemic cardiomyopathy is a rare complication after LT. Patients with NIC are critically ill, with high MELD score, and severe malnutrition. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
In vitro antibacterial effect of tobacco leaf exudates against two bacterial plant pathogens
Directory of Open Access Journals (Sweden)
Yanelis Karina Capdesuñer
2015-01-01
Full Text Available Natural products are an alternative to control microorganisms that cause diseases in crops. This work aimed to evaluate different solvents for obtaining crude extracts from tobacco leaf exudates and to determine in vitro effect of these extracts against two phytopathogenic bacteria: Xanthomonas campestris(Xc and Pectobacterium carotovorum(Pc. Crude extracts from ten tobacco lines using solvents with polarities between 3.1 and 6.2 (dichloromethane, n-butanol, ethyl acetate, methanol and ethanol 90% were obtained. Ethanol 90% was selected as the best solvent for obtaining extracts from tobacco leaf exudates and as a substitute of dichloromethane due to the best yield. The chemical composition diversity of the ethanolic extracts was revealed by thin-layer chromatography. The antibacterial activity was evaluated by agar disk diffusion method recording the inhibition zones. Growth inhibition was observed for all extracts against Xc, and the better activity corresponded to the lines Nic 1061"TI 1738" and Nic 1016 "Incekara" until a minimal amount of 5 µg/ disc, with higher yield in case of the line Nic1061 . Only the extract of the line Nic 1015 was able to inhibit the growth of Pc until a minimal inhibitory concentration of 5 µg/disc. These results suggest a potential use of crude extracts from lines Nic 1061 and Nic 1015 "TI 1341" as an effective agent for the crop protection against Xc and Pc respectively.
Nefropatía por contraste en el síndrome coronario agudo
Directory of Open Access Journals (Sweden)
Mariana Carnevalini
2011-10-01
Full Text Available La nefropatía inducida por contraste (NIC es una de las causas más frecuentes de insuficiencia renal en pacientes internados. En el síndrome coronario agudo (SCA, la presencia de NIC aumenta la morbimortalidad. Las medidas de profilaxis y los factores de riesgo intervinientes de NIC en SCA no han sido determinados con exactitud. El objetivo de este estudio fue evaluar la incidencia de NIC y los factores asociados a su desarrollo en pacientes ingresados en unidad coronaria con requerimiento de cinecoronariografía (CCG. Se realizó un estudio de cohorte retrospectivo. Se incluyeron pacientes consecutivos cursando SCA estudiados con CCG dentro de las 72 horas de su admisión. Se definió NIC al aumento del 25% del valor de creatinina a las 48 h sobre el nivel basal de ingreso. El período de inclusión fue entre el 1° de enero de 2004 hasta el 30 de junio de 2010. Se analizaron 125 casos. La incidencia de NIC fue del 10.4% (n = 13. En el análisis multivariado, los factores asociados independientemente a su desarrollo fueron la edad [OR 1.05 (IC 95% 1.004 - 1.11 p = 0.034], la angioplastia a múltiple vaso [OR 2.2 (IC 95% 1.07 - 4.8, p = 0.03] y el volumen de contraste utilizado [OR 1.007 (IC 95% 1.001 - 1.01, p = 0.014].
CONDITIONED ANALYSIS OF HIGH-LATITUDE SOLAR WIND INTERMITTENCY
International Nuclear Information System (INIS)
D'Amicis, R.; Consolini, G.; Bavassano, B.; Bruno, R.
2012-01-01
The solar wind is a turbulent medium displaying intermittency. Its intermittent features have been widely documented and studied, showing how the intermittent character is different in fast and slow wind. In this paper, a statistical conditioned analysis of the solar wind intermittency for a period of high-latitude fast solar wind is presented. In particular, the intermittent features are investigated as a function of the Alfvénic degree of fluctuations at a given scale. The results show that the main contribution to solar wind intermittency is due to non-Alfvénic structures, while Alfvénic increments are found to be characterized by a smaller level of intermittency than the previous ones. Furthermore, the lifetime statistics of Alfvénic periods are discussed in terms of a multiscale texture of randomly oriented flux tubes.
Graphene-based tunable non-foster circuit for VHF applications
Energy Technology Data Exchange (ETDEWEB)
Tian, Jing; Nagarkoti, Deepak Singh; Rajab, Khalid Z.; Hao, Yang, E-mail: y.hao@qmul.ac.uk [School of Electronic Engineering and Computer Science, Queen Mary, University of London, London, E1 4NS (United Kingdom)
2016-06-15
This paper presents a negative impedance converter (NIC) based on graphene field effect transistors (GFETs) for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS) topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010)] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS) show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency) using Nyquist stability criterion to ensure there are no oscillation issues.
Graphene-based tunable non-foster circuit for VHF applications
Directory of Open Access Journals (Sweden)
Jing Tian
2016-06-01
Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.
Bis(8-hydroxy-1-methylquinolin-1-ium bis(1,2-dicyanoethene-1,2-dithiolatonickelate(II dihydrate
Directory of Open Access Journals (Sweden)
Zhi-Heng Guan
2011-12-01
Full Text Available In the title ion-pair complex, (C10H10NO2[Ni(C4N2S22]·2H2O, the anion has crystallographically imposed centre of symmetry. The NiII atom exhibits a slightly distorted square-planar coordination geometry. In the crystal, the water molecule links anions and cations into a three-dimensional network via O—H...N, O—H...S and O—H...O hydrogen bonds. The structure is further stabilized by weak S...π contacts [S...centroid = 3.8047 (9 Å] and π–π stacking interactions [centriod–centroid distance = 3.8653 (7 Å].
Directory of Open Access Journals (Sweden)
La Harimu
2010-06-01
Full Text Available Fe (III, Cr(III, Cu(II, Ni(II, Co(II, and Pb(II metal ions had been separated using poly(eugenyl oxyacetic acid as an ion carrier by bulk liquid membrane transport method. The effect of pH, polyeugenyl oxyacetic acid ion carrier concentration, nitric acid concentration in the stripping solution, transport time, and metal concentration were optimized. The result showed that the optimum condition for transport of metal ions was at pH 4 for ion Fe(III and at pH 5 for Cr(III, Cu(II, Ni(II, Co(II, and Pb(II ions. The carrier volumes were optimum with concentration of 1 x 10-3 M at 7.5 mL for Cr(III, Cu (II, Ni(II, Co(II ions and at 8.5 mL for Fe(III and Pb(II ions. The concentration of HNO3 in stripping phase was optimum at 2 M for Fe(III and Cu(II ions, 1 M for Cr(III, Ni(II and Co(II ions, and 0.5 M for Pb(II ion. The optimum transport times were 36 h for Fe(III and Co(II ions, and 48 h for Cr(III, Cu (II, Ni(II, and Pb(II ions. The concentration of metal ions accurately transported were 2.5 x 10-4 M for Fe(III and Cr(III ions, and 1 M for Cu (II, Ni(II, Co(II, and Pb(II ions. Compared to other metal ions the transport of Fe(III was the highest with selectivity order of Fe(III > Cr(III > Pb(II > Cu(II > Ni(II > Co(II. At optimum condition, Fe(III ion was transported through the membrane at 46.46%. Keywords: poly(eugenyl oxyacetic acid, transport, liquid membrane, Fe (III, Cr(III, Cu(II, Ni(II, Co(II, and Pb(II ions
Directory of Open Access Journals (Sweden)
Ganna Lyubartseva
2011-12-01
Full Text Available Attempts to prepare the mononuclear [(tpmNiIIL3]−1 [tpm = tris(1H-pyrazol-1-ylmethane and L = thiocyanate] anion yielded the methanol-solvated salt, [(tpm2NiII][(tpmNiII(NCS3]2·2CH3OH or [Ni(C10H10N62][Ni(NCS3(C10H10N6]2·2CH3OH. The asymmetric unit consists of half a centrosymmetric bis[tris(1H-pyrazol-1-ylmethane]nickel(II cation and an octahedral nickelate(II anion bound to one tpm and three L ligands, and a methanol solvent molecule. One of the L ligands is disordered over two positions with occupancy factors of 0.650 (3 and 0.350 (3. There are O—H...S interactions between the methanol and the disordered thiocyanate anion, and a weak C—H...O hydrogen bond between the cation and the methanol O atom.
Assignment of element and isotope factors
International Nuclear Information System (INIS)
Schneider, R.A.
1984-01-01
Element and isotope factors are assigned in the NICS internal accounting system at the Exxon Fuel Fabrication Facility on the basis of coded information included on the material transfer documents. This paper explains more fully the manner in which NICS assigns these factors
Diaquabis[N,N′-(ethane-1,2-diylbis(isonicotinamide-κN]bis(hydrogen phthalato-κOnickel(II hexahydrate
Directory of Open Access Journals (Sweden)
Torél Beard
2016-07-01
Full Text Available In the title solvated coordination complex, [Ni(C8H5O42(C14H14N4O22(H2O2]·6H2O, the NiII cation is octahedrally coordinated by trans carboxylate O-atom donors from two crystallographically distinct monodentate hydrogen phthalate (Hpht− ligands, two trans aqua ligands, and trans pyridyl N-atom donors from two crystallographically distinct N,N′-(ethane-1,2-diylbis(isonicotinamide (ebin ligands. Extensive O—H...O and O—H...N hydrogen-bonding patterns involving the water molecules of crystallization anchor neighboring coordination complexes into a three-dimensional network.
Propagation of electro-kinetic waves in magnetized GaN semiconductor with nano-sized ion colloids
Energy Technology Data Exchange (ETDEWEB)
Saxena, Ajay [Government College, Garoth, Dist. Mandsaur (M P) (India); Sharma, Giriraj, E-mail: grsharma@gmail.com [SRJ Government Girls’ College, Neemuch (M P) (India); Jat, K. L. [Swami Vivekanand Government P G College, Neemuch (M P) (India); Rishi, M. P. [Shahid Bhagat Singh Government P G College, Jaora, Dist Ratlam (M P) (India)
2015-07-31
Based on hydrodynamic model of multi-component plasma, an analytical study on propagation of longitudinal electro-kinetic (LEK) waves in wurtzite and zincblende structures of GaN is carried out. Nano-sized ion colloids (NICs) are embedded in the sample by the technique of ion-implantation. The implanted NICs are considered massive by an order as compared to the host lattice points and do not participate in Based LEK perturbations. Though, the NICs are continuously bombarded by the electrons as well as the holes yet, the former acquires a net negative charge owing to relatively higher mobility of electrons and consequently results into depletion of electron density in the medium. It i s found that the presence of charged NICs significantly modifies the dispersion and amplification characteristics of LEK waves in magnetized GaN semiconductor plasma and their role becomes increasingly effective as the fraction of charge on them increases.
Propagation of electro-kinetic waves in magnetized GaN semiconductor with nano-sized ion colloids
International Nuclear Information System (INIS)
Saxena, Ajay; Sharma, Giriraj; Jat, K. L.; Rishi, M. P.
2015-01-01
Based on hydrodynamic model of multi-component plasma, an analytical study on propagation of longitudinal electro-kinetic (LEK) waves in wurtzite and zincblende structures of GaN is carried out. Nano-sized ion colloids (NICs) are embedded in the sample by the technique of ion-implantation. The implanted NICs are considered massive by an order as compared to the host lattice points and do not participate in Based LEK perturbations. Though, the NICs are continuously bombarded by the electrons as well as the holes yet, the former acquires a net negative charge owing to relatively higher mobility of electrons and consequently results into depletion of electron density in the medium. It i s found that the presence of charged NICs significantly modifies the dispersion and amplification characteristics of LEK waves in magnetized GaN semiconductor plasma and their role becomes increasingly effective as the fraction of charge on them increases
Directory of Open Access Journals (Sweden)
André Luís Ferreira Santos
Full Text Available Para avaliar o desempenho da colpocitologia (CO de encaminhamento e daquela coletada no serviço de referência, com revisão por diferentes técnicas e observadores, e da captura híbrida II (CH II no diagnóstico da neoplasia intra-epitelial cervical (NIC de alto grau, foram incluídas 105 mulheres atendidas entre agosto de 2000 e junho de 2001 por atipias pré-neoplásicas na CO. Todas foram submetidas à coleta de nova CO e CH II para detecção do DNA-HPV. Foi realizada biópsia cervical em 91, sendo o diagnóstico histológico considerado padrão ouro. Foram descritas a sensibilidade, especificidade e razão de verossimilhança positiva (RVP dos métodos propedêuticos com intervalo de confiança de 95% (IC95%. A sensibilidade e especificidade da CO de encaminhamento foi de 57% e 82% para o diagnóstico de NIC 2 e 3, e a RVP de 3,2 (IC95%: 1,5-6,8. A CO do serviço mostrou uma sensibilidade e especificidade 79% e 84%, respectivamente e RVP de 5,0 (IC95%: 2,5-10,0. A sensibilidade (86%, especificidade (80% e RVP (4,3 foram semelhantes com a revisão lenta realizada pelo segundo observador, havendo uma queda significativa da sensibilidade (64% à revisão rápida pelo terceiro observador. A CH II mostrou alta sensibilidade (100%, baixa especificidade (43% e baixa RVP (1,7, IC95%: 1,4-2,2.
Directory of Open Access Journals (Sweden)
Santos André Luís Ferreira
2003-01-01
Full Text Available Para avaliar o desempenho da colpocitologia (CO de encaminhamento e daquela coletada no serviço de referência, com revisão por diferentes técnicas e observadores, e da captura híbrida II (CH II no diagnóstico da neoplasia intra-epitelial cervical (NIC de alto grau, foram incluídas 105 mulheres atendidas entre agosto de 2000 e junho de 2001 por atipias pré-neoplásicas na CO. Todas foram submetidas à coleta de nova CO e CH II para detecção do DNA-HPV. Foi realizada biópsia cervical em 91, sendo o diagnóstico histológico considerado padrão ouro. Foram descritas a sensibilidade, especificidade e razão de verossimilhança positiva (RVP dos métodos propedêuticos com intervalo de confiança de 95% (IC95%. A sensibilidade e especificidade da CO de encaminhamento foi de 57% e 82% para o diagnóstico de NIC 2 e 3, e a RVP de 3,2 (IC95%: 1,5-6,8. A CO do serviço mostrou uma sensibilidade e especificidade 79% e 84%, respectivamente e RVP de 5,0 (IC95%: 2,5-10,0. A sensibilidade (86%, especificidade (80% e RVP (4,3 foram semelhantes com a revisão lenta realizada pelo segundo observador, havendo uma queda significativa da sensibilidade (64% à revisão rápida pelo terceiro observador. A CH II mostrou alta sensibilidade (100%, baixa especificidade (43% e baixa RVP (1,7, IC95%: 1,4-2,2.
Li, Qiaoyun; Wan, Xiaocao; Liu, Chao; Fang, Liang
2018-07-01
The aim of this study was to prepare a drug-in-adhesive patch of nicotine (NIC) and use ion-pair strategy to regulate drug delivery rate. Moreover, the mechanism of how ion-pair strategy regulated drug release was elucidated at molecular level. Formulation factors including pressure sensitive adhesives (PSAs), drug loading and counter ions (C 4 , C 6 , C 8 , C 10 , and C 12 ) were screened. In vitro release experiment and in vitro transdermal experiment were conducted to determine the rate-limiting step in drug delivery process. FT-IR and molecular modeling were used to characterize the interaction between drug and PSA. Thermal analysis and rheology study were conducted to investigate the mobility variation of PSA. The optimized patch prepared with NIC-C 8 had the transdermal profile fairly close to that of the commercial product (p > 0.05). The release rate constants (k) of NIC, NIC-C 4 and NIC-C 10 were 21.1, 14.4 and 32.4, respectively. Different release rates of NIC ion-pair complexes were attributed to the dual effect of ion-pair strategy on drug release. On one hand, ion-pair strategy enhanced the interaction between drug and PSA, which inhibited drug release. On the other hand, using ion-pair strategy improved the mobility of PSA, which facilitated drug release. Drug release behavior was determined by combined effect of two aspects above. These conclusions provided a new idea for us to regulate drug release behavior from patch. Copyright © 2018 Elsevier B.V. All rights reserved.
African Journals Online (AJOL)
Preferred Customer
Nuclear independent chemical shifts (NICS) calculations were carried out to determine the aromatic character. KEY WORDS: DFT calculations, Electronic effects, Singlet-triplet energies, Carbene, Five-membered, NICS. INTRODUCTION ... These divalent structures have been described in terms of the Huckel 4n+2 rule [5-8].
Aquabis(4-methylbenzoato-κO;κ2O,O′-bis(pyridine-κNnickel(II
Directory of Open Access Journals (Sweden)
Li-Li Ji
2008-04-01
Full Text Available In the title mononuclear complex, [Ni(C8H7O22(C5H5N2(H2O], the NiII atom is in a distorted octahedral arrangement, coordinated by three carboxylate O atoms from one bidentate 4-methylbenzoate ligand and one monodentate 4-methylbenzoate ligand, two N atoms from pyridine ligands, axially positioned, and a water molecule. The equatorially positioned water molecule and uncoordinated carboxylate O atom form an intramolecular hydrogen bond. An intermolecular O—H...O hydrogen bond between the coordinated water molecule and carboxylate O atom of the 4-methylbenzoate ligand forms infinite chains along the b axis. These chains are connected by C—H...π interactions.
Services of the Czechoslovak Nuclear Information Centre, based on IAEA information sources
International Nuclear Information System (INIS)
Dufkova, M.
1987-01-01
Information services provided by the Nuclear Information Centre (NIC) as the sector information centre for the Czechoslovak nuclear programme proceed primarily from its membership of INIS. From INIS Atomindex tapes are computer-processed SDI searches, their price for one query is 3,948 Czechoslovak crowns per year. The user can at any time put forward a request for tuning or for a change of the initially requested query formulation. A copy of SDI searches is provided for 1,200 Czechoslovak crowns per annum to other interested persons or institutions who cannot, however, influence the query formulation. Since 1979, the NIC has been processing retrospective searches by direct online access to the INIS data base. The price of these searches ranges between 1,000 and 1,500 Czechoslovak crowns. Under the same conditions the NIC also provides retrospective searches from AGRIS. Since 1986, the NIC has extended its services by providing data from the UVTEI-UTZ data base centre in Prague. Retrospective searches can since 1985 be processed directly at the workplace of those interested, this through mobile terminals. All said services are followed up by services provided by the NIC library which contains more than 215,000 microfiches with full texts of nonconventional documents incorporated in INIS. (Z.M.)
Yu, Jianguo; Dai, Tangming; Cao, Yuechao; Qu, Yuning; Li, Yao; Li, Juan; Zhao, Yongnan; Gao, Haiyan
2018-08-15
In this paper, platinum nanoparticles were deposited on a carbon carrier with the partly graphitized carbon and the highly dispersive carbon-coated nickel particles. An efficient electron transfer structure can be fabricated by controlling the contents of the deposited platinum. The high resolution transmission electron microscopy images of Pt 2 /Ni@C N-doped sample prove the electron transfer channel from Pt (1 1 1) crystal planes to graphite (1 0 0) or Ni (1 1 1) crystal planes due to these linked together crystal planes. The Pt 3 /Ni@C N-doped with low Pt contents cannot form the electron transfer structure and the Pt 1 /Ni@C N-doped with high Pt contents show an obvious aggregation of Pt nanoparticles. The electrochemical tests of all the catalysts show that the Pt 2 /Ni@C N-doped sample presents the highest catalytic activity, the strongest CO tolerance and the best catalytic stability. The high performance is attributed to the efficient electronic transport structure of the Pt 2 /Ni@C N-doped sample and the synergistic effect between Pt and Ni nanoparticles. This paper provides a promising method for enhancing the conductivity of electrode material. Copyright © 2018 Elsevier Inc. All rights reserved.
Croft, Arthur C; Philippens, Mathieu M G M
2007-03-01
Human subjects and the recently developed RID2 rear impact crash test dummy were exposed to a series of full scale, vehicle-to-vehicle crash tests. To evaluate the biofidelity of the RID2 anthropometric test dummy on the basis of calculated neck injury criterion (NIC) values by comparing these values to those obtained from human subjects exposed in the very same crashes. The widely used and familiar hybrid III dummy has been said to lack biofidelity in the special application of low speed rear impact crashes. Several attempts have been made to modify this dummy with only marginal success. Two completely new dummies have been developed; the BioRID and the RID2. Neither have been tested under real world crash boundary conditions in side-by-side comparisons with live human subjects. Volunteer subjects, including a 50th percentile male, a 95th percentile male, and a 50th percentile female, were placed in the driver's seat of a vehicle and subjected to a series of three low speed rear impact crashes each. The RID2 dummy, which is modeled after a 50th percentile male, was placed in the passenger seat in each case. Both subjects and dummy were fully instrumented and acceleration-time histories were recorded. From this data, velocities of the heads and torsos were determined and both were used to calculate the NIC values for both crash test subjects and the RID2. The RID2 demonstrated generally higher head accelerations and NIC values than those of the human subjects. Most of the observed variations might be explained on the basis of differing head restraint geometry, posture, and body size. The RID2 NIC values compared most favorably with those of the 50th percentile male subject. For the whole group, the correlations between RID2 and human subjects did not reach statistical significance. The small number of test subjects and crash tests limited the statistical power of this pilot study, and the correlation between the RID2 and human subject NIC values were not
Effect of agmatine on experimental vascular endothelial dysfunction.
Nader, M A; Gamiel, N M; El-Kashef, H; Zaghloul, M S
2016-05-01
This study was designed to investigate the effect of agmatine sulfate (AG, CAS2482-00-0) in nicotine (NIC)-induced vascular endothelial dysfunction (VED) in rabbits. NIC was administered to produce VED in rabbits with or without AG for 6 weeks. Serum lipid profile, serum thiobarbituric acid reactive substances, reduced glutathione, superoxide dismutase generation, serum nitrite/nitrate, serum vascular cellular adhesion molecule-1 (VCAM-1), and aortic nuclear factor κB (NF-κB) levels were analyzed.Treatment with AG markedly improves lipid profile and prevented NIC-induced VED and oxidative stress. The mechanism of AG in improving NIC-induced VED may be due to the significant reduction in serum VCAM-1 levels and aortic NF-κB. Thus, it may be concluded that AG reduces the oxidative stress, nitric oxide production, VCAM-1 levels, and aortic NF-κB expression, thereby consequently improving the integrity of vascular endothelium. © The Author(s) 2015.
Redetermination of aqua(dihydrogen ethylenediaminetetraacetato-κ5O,O′,N,N′,O′′nickel(II
Directory of Open Access Journals (Sweden)
Ivana Kočanová
2010-02-01
Full Text Available The crystal structure of the title compound, [Ni(C10H14N2O8(H2O] or [Ni(H2edta(H2O] (H4edta is ethylenediaminetetraacetic acid, originally determined by Smith & Hoard [J. Am. Chem. Soc. (1959, 81, 556–561] has been redetermined to a significantly higher precision. The NiII atom is coordinated in a distorted octahedral geometry by two N atoms and three O atoms from three carboxylate groups of the H2edta2− ligand and by an O atom of a water molecule. The complex molecules are linked by intermolecular O—H...O hydrogen bonds into layers perpendicular to [100].
Papaseit, Esther; Farré, Magí; Graziano, Silvia; Pacifici, Roberta; Pérez-Mañá, Clara; García-Algar, Oscar; Pichini, Simona
2017-03-01
Electronic cigarettes (e-cig) known as electronic nicotine devices recently gained popularity among smokers. Despite many studies investigating their safety and toxicity, few examined the delivery of e-cig-derived nicotine and its metabolites in alternative biological fluids. We performed a randomized, crossover, and controlled clinical trial in nine healthy smokers. Nicotine (NIC), cotinine (COT), and trans-3'-hydroxycotinine (3-HCOT) were measured in plasma and oral fluid by liquid chromatography-tandem mass spectrometry after consumption of two consecutive e-cig administrations or two consecutive tobacco cigarettes. NIC and its metabolites were detected both in oral fluid and plasma following both administration conditions. Concentrations in oral fluid resulted various orders of magnitude higher than those observed in plasma. Oral fluid concentration of tobacco cigarette and e-cig-derived NIC peaked at 15 min after each administration and ranged between 1.0 and 1396 μg/L and from 0.3 to 860 μg/L; those of COT between 52.8 and 110 μg/L and from 33.8 to 94.7 μg/L; and those of 3-HCOT between 12.4 and 23.5 μg/L and from 8.5 to 24.4 μg/L. The oral fluid to plasma concentration ratio of both e-cig- and tobacco cigarette-derived NIC peaked at 15 min after both administrations and correlated with oral fluid NIC concentration. The obtained results support the measurement of NIC and metabolites in oral fluid in the assessment of intake after e-cig use and appear to be a suitable alternative to plasma when monitoring nicotine delivery from e-cig for clinical and toxicological studies.
Solid-phase extraction and HPLC assay of nicotine and cotinine in plasma and brain.
Dawson, Ralph; Messina, S M; Stokes, C; Salyani, S; Alcalay, N; De Fiebre, N C; De Fiebre, C M
2002-01-01
The aim of this study was to develop a simple and reliable assay for nicotine (NIC) and its major metabolite, cotinine (COT), in plasma and brain. A method was developed that uses an extraction method compatible with reverse-phase high-performance liquid chromatography (HPLC) separation and ultraviolet (UV) detection. Sequential solid-phase extraction on silica columns followed by extraction using octadecyl (C18) columns resulted in mean percent recovery (n = 5) of 51 +/- 5, 64 +/- 10, and 52 +/- 10% for NIC, COT, and phenylimidazole (PI), respectively, in spiked 1-mL serum samples. Recovery (mean +/- SEM) of the internal standard (PI) from spiked samples of nicotine-injected rats averaged 64.1 +/- 1.5% (n = 138) from plasma, and 20.7+/-0.8% (n = 128) from brain. The limits of detection of NIC in plasma samples were approximately 8 ng per mL, and of COT, 13.6 ng per mL. Further optimization of our extraction method, using slower flow rates and solid-phase extraction on silica columns, followed by C18 column extraction, yielded somewhat better recoveries (38 +/-3%) for 1-mL brain homogenates. Interassay precision (coefficient of variation) was determined on the basis of daily calibrations for 2 months and was found to be 7%, 9%, and 9% for NIC, COT, and PI, respectively, whereas intra-assay variability was 3.9% for both NIC and COT. Limited studies were performed on analytical columns for comparison of retention, resolution, asymmetry, and column capacity. We concluded that a simple two-step solid-phase extraction method, coupled with HPLC separation and UV detection, can be used routinely to measure NIC and COT in biological fluids and tissues.
ROUNDTABLE SESSION 2B: NATIONAL INTERACTIONS BETWEEN NON-INDIGENOUS AND INDIGENOUS CRAYFISH SPECIES
Directory of Open Access Journals (Sweden)
GHERARDI F.
2002-07-01
Full Text Available The main object of the present essay is to summarise some aspects underlying the interactions between non-indigenous (NICS and indigenous (ICS crayfish species. The discussion has been also extended to the effects exercised by NICS on the natural habitats they occupy. While doing research on the dyads NICS/ICS, one starting point is to extrapolate common traits that make NICS good invaders from the analysis of their biology, ecology and ethology and the comparison with indigenous species. A subsequent step is to switch attention to the understanding of the characteristics that make ecosystems less vulnerable to invasions and then to analyse both the complex interactions of invaders and target communities and the negative and positive impacts exerted by NICS on the occupied habitats. Examples from Sweden, Britain, and Italy have shown that NICS can replace the native species by a combination of several interacting mechanisms. Besides the transmission of the crayfish plague fungus, mechanisms into action include mostly competitive interference, but also diverse life history traits, recruitment failure, differential susceptibility to predation, and reproductive interference. It has been claimed that invasion theory is full of rules of thumb that, having no precise predictive powers, are thus useless to guide reliable public policy. The solution of the prediction problem requires an in-depth study of every potential invader and target community, trespassing the boundaries among disciplines and having a look at crayfish as a whole and not a single entity. The expectation is thus the return to precise and clear empirical generalisations that can be most useful to develop management strategies.
Synthesizing and salvaging NAD: lessons learned from Chlamydomonas reinhardtii.
Directory of Open Access Journals (Sweden)
Huawen Lin
2010-09-01
Full Text Available The essential coenzyme nicotinamide adenine dinucleotide (NAD+ plays important roles in metabolic reactions and cell regulation in all organisms. Bacteria, fungi, plants, and animals use different pathways to synthesize NAD+. Our molecular and genetic data demonstrate that in the unicellular green alga Chlamydomonas NAD+ is synthesized from aspartate (de novo synthesis, as in plants, or nicotinamide, as in mammals (salvage synthesis. The de novo pathway requires five different enzymes: L-aspartate oxidase (ASO, quinolinate synthetase (QS, quinolate phosphoribosyltransferase (QPT, nicotinate/nicotinamide mononucleotide adenylyltransferase (NMNAT, and NAD+ synthetase (NS. Sequence similarity searches, gene isolation and sequencing of mutant loci indicate that mutations in each enzyme result in a nicotinamide-requiring mutant phenotype in the previously isolated nic mutants. We rescued the mutant phenotype by the introduction of BAC DNA (nic2-1 and nic13-1 or plasmids with cloned genes (nic1-1 and nic15-1 into the mutants. NMNAT, which is also in the de novo pathway, and nicotinamide phosphoribosyltransferase (NAMPT constitute the nicotinamide-dependent salvage pathway. A mutation in NAMPT (npt1-1 has no obvious growth defect and is not nicotinamide-dependent. However, double mutant strains with the npt1-1 mutation and any of the nic mutations are inviable. When the de novo pathway is inactive, the salvage pathway is essential to Chlamydomonas for the synthesis of NAD+. A homolog of the human SIRT6-like gene, SRT2, is upregulated in the NS mutant, which shows a longer vegetative life span than wild-type cells. Our results suggest that Chlamydomonas is an excellent model system to study NAD+ metabolism and cell longevity.
Directory of Open Access Journals (Sweden)
Daniella Borges Alves
2010-08-01
Full Text Available INTRODUÇÃO: A resposta imune pode ser um elemento chave para a progressão ou remissão da infecção pelo papilomavírus humano (HPV no estroma da cérvice uterina. Este estudo objetivou quantificar no estroma cervical a presença de linfócitos T CD4, CD8 e células NK, por imunohistoquímica, em lesões de alto e baixo grau em pacientes infectadas por HPV MÉTODOS: Utilizou-se 56 amostras de biópsia da estroma cervical, sendo 43 amostras positivas para DNA de HPV de alto risco oncogênico e com diagnóstico histopatológico de neoplasia intraepitelial cervical (NIC de alto e baixo grau, ou negativa para lesão intraepitelial e malignidade (NILM, e 13 amostras de pacientes negativas para DNA de HPV com diagnóstico histopatológico NILM RESULTADOS: Maior quantidade de linfócitos T CD4 foi observada em amostras NIC II/III, carcinoma e NILM (p=0,04 e naquelas cuja carga viral esteve entre 10 e 1,000 RLU/PCB. O predomínio de linfócitos T CD8 ocorreu em maior proporção nas amostras NIC II/III (p=0,02 e em amostras com carga viral entre 100 e 1.000 RLU/PCB. As células NK prevaleceram nas amostras com lesões de baixo grau e com baixa carga viral CONCLUSÕES: Este estudo comprovou que nas fases iniciais da infecção, onde não há ainda alterações celulares de alto grau, não temos a presença de células que possam desencadear a fase efetora da resposta imune.INTRODUCTION: Immune response might be a key element regarding the progression or regression of human papillomavirus (HPV infection in the stroma of the uterine cervix. This study aimed to quantify the presence of CD4 and CD8 T lymphocytes and NK cells in the cervical stroma, by means of immunohistochemistry, in high and low grade lesions in patients infected by HPV METHODS: Fifty-six biopsy samples from the uterine cervix were used. Forty-three samples were positive for oncogenic high-risk HPV DNA and had a histopathological diagnosis of high and low-grade cervical intraepithelial
Selective Recovery Of Copper From Solutions After Bioleaching Electronic Waste
Directory of Open Access Journals (Sweden)
Willner Joanna
2015-06-01
Full Text Available Research on selective extraction of copper from solution after bioleaching grounded printed circuit boards (PCBs using LIX 860N-IC were conducted. The effect of LIX 860N-IC concentration, phase ratio and influence of initial pH value of aqueous phase on the extraction of copper and iron was examined. It was found that the extraction rate of copper increases with the LIX 860N-IC concentration. Best results of Cu extraction (98 % were achieved with extractant concentration of 5 % and pH 1.9. Higher pH value of aqueous phase (pH=2.4 is conducive to the simultaneous effect of Fe co-extraction.
28 CFR 25.8 - System safeguards.
2010-07-01
... authentication mechanism that performs FFL dial-up user authentication before network access takes place; (2) The...) All failed authentications will be logged by the NICS and provided to the NICS security administrator... word, the type of sale, and the name, sex, race, date of birth, and state of residence of the...
Guan, Zhi-Heng; Jiang, Zhang; Wang, Fang-Ming
2011-12-01
In the title ion-pair complex, (C(10)H(10)NO)(2)[Ni(C(4)N(2)S(2))(2)]·2H(2)O, the anion has crystallographically imposed centre of symmetry. The Ni(II) atom exhibits a slightly distorted square-planar coordination geometry. In the crystal, the water mol-ecule links anions and cations into a three-dimensional network via O-H⋯N, O-H⋯S and O-H⋯O hydrogen bonds. The structure is further stabilized by weak S⋯π contacts [S⋯centroid = 3.8047 (9) Å] and π-π stacking inter-actions [centriod-centroid distance = 3.8653 (7) Å].
Bellés, Montserrat; Heredia, Luis; Serra, Noemí; Domingo, José L; Linares, Victoria
2016-11-01
Radiation therapy is a major cause of long-term complications observed in survivors of pediatric brain tumors. However, the effects of low-doses of ionizing radiation (IR) to the brain are less studied. On the other hand, tobacco is one of the most heavily abused drugs in the world. Tobacco is not only a health concern for adults. It has also shown to exert deleterious effects on fetuses, newborns, children and adolescents. Exposure to nicotine (Nic) from smoking may potentiate the toxic effects induced by IR on brain development. In this study, we evaluated in mice the cognitive effects of concomitant exposure to low doses of internal radiation ( 137 Cs) and Nic during neonatal brain development. On postnatal day 10 (PND10), two groups of C57BL/6J mice were subcutaneously exposed to 137-Cesium ( 137 Cs) (4000 and 8000 Bq/kg) and/or Nic (100 μg/ml). At the age of two months, neurobehavior of mice was assessed. Results showed that exposure to IR-alone or in combination with Nic-increased the anxiety-like of the animals without changing the activity levels. Moreover, exposure to IR impaired learning and spatial memory. However, Nic administration was able to reverse this effect, but only at the low dose of 137 Cs. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Lv, Peijie; Liu, Jie; Yan, Xiaopeng; Chai, Yaru; Chen, Yan; Gao, Jianbo; Pan, Yuanwei; Li, Shuai; Guo, Hua; Zhou, Yue [The First Affiliated Hospital of Zhengzhou University, The Department of Radiology, Zhengzhou, Henan Province (China)
2017-03-15
The aim of this study was to evaluate the value of computed tomography (CT) spectral imaging in assessing the therapeutic efficacy of a vascular endothelial growth factor (VEGF) receptor inhibitor AG-013736 in rabbit VX2 liver tumours. Twenty-three VX2 liver tumour-bearing rabbits were scanned with CT in spectral imaging mode during the arterial phase (AP) and portal phase (PP). The iodine concentrations(ICs)of tumours normalized to aorta (nICs) at different time points (baseline, 2, 4, 7, 10, and 14 days after treatment) were compared within the treated group (n = 17) as well as between the control (n = 6) and treated groups. Correlations between the tumour size, necrotic fraction (NF), microvessel density (MVD), and nICs were analysed. The change of nICs relative to baseline in the treated group was lower compared to the control group. A greater decrease in the nIC of a tumour at 2 days was positively correlated with a smaller increase in tumour size at 14 days (P < 0.05 for both). The tumour nIC values in AP and PP had correlations with MVD (r = 0.71 and 0.52) and NF (r = -0.54 and -0.51) (P < 0.05 for all). CT spectral imaging allows for the evaluation and early prediction of tumour response to AG-013736. (orig.)
Directory of Open Access Journals (Sweden)
Hiroyuki Ito, MD
2007-01-01
Full Text Available Introduction: Some studies have reported that transmural dispersion of repolarization (TDR is involved in the onset of ventricular arrhythmia. We investigated the effects of nicorandil (NIC and nifekalant (NIF injected into the pericardial space, on TDR and T waves in the pig. Methods and Results: We injected NIC 4 or 8 mg and NIF 50 or 100 mg at intervals into the pericardial space for eleven pigs. The effects of these drugs were investigated on the effective refractory period (ERP between the endocardial and epicardial myocardial cells, as well as on QT time, QT peak-end (QTcpe as an index of TDR, and T waveforms, respectively. QTcpe increased from 91 ± 21 to 116 ± 19 msec, 2.8 min after injection of NIC (p < 0.01, although corrected QT (QTc interval did not changed. But 5.5 min after injection, QTc decreased while QTcpe recovered. T wave amplitude significantly increased, and epicardium ERP decreased. When NIF was injected, TDR decreased from 55 ± 10 msec to 44 ± 8 msec (p < 0.01 although QTc did not change. In a later phase, QTc increased (p < 0.01 and QTcpe recovered. T wave amplitude rapidly decreased and became negative. Conclusion: Injected into the pericardial space, NIC and NIF brought about certain changes in ERP, QT and T waveform. Furthermore, NIC increased TDR while NIF decreased TDR.
{2,6-Bis[(di-tert-butyl-phosphino)-methyl]-phenyl}chloridonickel(II).
Boro, Brian J; Dickie, Diane A; Goldberg, Karen I; Kemp, Richard A
2008-09-20
In the title compound, [Ni(C(24)H(43)P(2))Cl], the Ni atom adopts a distorted square-planar geometry, with the P atoms of the 2,6-bis-[(di-tert-butyl-phosphino)meth-yl]phenyl ligand trans to one another. The P-Ni-P plane is twisted out of the plane of the aromatic ring by 21.97 (6)°.
Directory of Open Access Journals (Sweden)
Pía Villanueva
2009-09-01
Full Text Available OBJETIVO: determinar los patrones de articulación de fones consonánticos en sujetos de habla española chilena clases I, II y III esqueletal; comparar las diferencias fonéticas que existan entre clases esqueletales. MÉTODOS: se seleccionaron 54 individuos que cumplían con los criterios de inclusión determinados mediante un examen clínico intraoral y a través del análisis de Ricketts, y se conformaron los grupos de estudio de pacientes clases esqueletales I, II y III. Se les realizó un examen fonoarticulatorio estandarizado para determinar los fones modificados y el patrón articulatorio compensatorio realizado. RESULTADOS: se observaron cambios en el punto de articulación de fones consonánticos en las tres clases esqueletales, con diferencias significativas en los grupos de fones anteriores y medios entre pacientes clases I y II, sólo en el grupo de los fones anteriores entre pacientes I y III. Entre pacientes clases II y III no se observaron diferencias significativas. Se reportan modificaciones y compensaciones cualitativamente distintas entre las clases esqueletales. CONCLUSIONES: en relación a pacientes clase I, los pacientes clase II o III, presentan distinto grado de modificación en el punto de articulación de fones consonánticos. Las diferencias observadas se relacionan con los patrones esqueletales propios de cada clase.PURPOSE: to determine the consonant phonemes articulation patterns in Chilean skeletal class I, II and III Spanish speakers and compare their phonetic differences. METHODS: fifty-four skeletal class I, II and III subjects were selected, based on intraoral clinical examination and Ricketts cephalometric analysis, constituting the study groups. A standardized phonoarticulatory test was applied to each patient to determine the modified phonemes and their compensatory patterns. RESULTS: the findings indicate changes in articulation in all three groups. Significant differences were found in anterior and medium
International Nuclear Information System (INIS)
Abu El-Reash, G.M.; Ibrahim, M.M.; Kenawy; El-Ayaan, Usama; Khattab, M.A.
1994-01-01
A few complexes of Cr(III), Mn(II), Fe(III), Co(II), Ni(II), Cu(II), Zn(II), Cd(II) and dioxouranium(VI) with 4(2-pyridyl)-1-(2,4-dihydroxybenzaldehyde)-3-thiosemicarbazone have been synthesised and characterized on the basis of elemental analysis, IR, electronic NMR, and magnetic moment data. An octahedral structure is proposed for the Cr(III), Fe(III), Co(II) and Ni(H 3 PBT) 2 Cl 2 .2H 2 O complexes; a tetrahedral structure for the Mn(II) and Ni 2 (PBT)OAc.H 2 0 complexes and a square planar structure for the Cu(II) complexes. The antimicrobial and antifungal activities of H 3 PBT and of its metal(II) complexes are investigated. The results reveal that H 3 PBT exhibits greater antimicrobial activities than its complexes. (author). 34 refs., 4 figs., 2 tabs
the cord blood amniotic fluid the Complement activity of term ...
African Journals Online (AJOL)
nic intervillositis), fetal (chorionic and/or umbilical vasculitis) or mixed. A more detailed description of the method ofgrading has been published elsewhere.2. The placentas of the 11 infants with the AFIS had grade 2-3 inflammatory changes, whereas those of the II infants in the control group showed neither maternal nor ...
Hemgren, E; Persson, K
2007-01-01
Children who have needed neonatal intensive care (NIC) are considered to be at risk for deficits such as developmental co-ordination disorder and attention-deficit/hyperactivity disorder. By assessing motor-perceptual development, motor co-ordination and attention already at 3 years of age, it might be possible to identify such deficits earlier than they are today. To investigate the motor-perceptual development in a group of 202 NIC children but had no major impairments, to describe associations of deficits in co-ordination and attention with motor-perceptual delays, and to estimate the prevalence of NIC children with combined deficits together with a motor-perceptual delay. Co-ordination and attention in children born very preterm (n = 57), moderately preterm (n = 75) and full-term (n = 70) were observed according to a model for Combined Assessment of Motor Performance and Behaviour while they were assessed using a developmental scale, Motor-Perceptual Development, 0-7 years, MPU. In two out of 14 MPU areas, a larger proportion of very preterm than of moderately preterm and full-term children had marked developmental delay. Overall, the proportion of NIC children having a motor-perceptual delay increased with increasing incoordination and especially increasing lack of attention. Twenty-one (11%) of the NIC children had different motor-perceptual delays combined with pronounced incoordination and pronounced lack of attention. Deficits in co-ordination and attention were associated with motor-perceptual delays in areas important for daily living and development of academic skills. Therefore, to find children at risk for developmental co-ordination disorder and attention-deficit/hyperactivity disorder, assessments of co-ordination and attention should be added to assessments of motor-perceptual development in 3-year-old NIC children.
La telecol.laboració en la classe de llengua extranjera entre grups heterogenis d’estudiants
Directory of Open Access Journals (Sweden)
Mercedes López Santiago
2014-06-01
Full Text Available En l'ensenyament de llengües estrangeres, nombrosos professors treballen les competències lingüístiques i comunicatives mitjançant d'activitats que inclouen les TIC. Entre algunes, es troben els projectes de telecol·laboració per Internet, intercanvis asincrònics i sincrònics entre grups d'estudiants que pertanyen a diferents comunitats lingüístiques allunyades geogràficament. El nostre objectiu ha consistit a comprovar si un projecte de telecol·laboració sincrònic entre grups heterogenis d'estudiants, és factible i si contribueix al desenvolupament de les competències comunicatives, interculturals i tecnològiques.
Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste?
Directory of Open Access Journals (Sweden)
Luciano Passamani Diogo
Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.
Directory of Open Access Journals (Sweden)
Simone Cristina Castanho Sabaini de Melo
2009-12-01
Full Text Available O objetivo do estudo foi verificar alterações citopatológicas e fatores de risco para o câncer de colo uterino em mulheres usuárias do Sistema Único de Saúde de um município de pequeno porte do norte do Paraná, de 2001 a 2006. Trata-se de um estudo observacional transversal descritivo. A coleta de dados foi realizada com os resultados dos exames, prontuários e entrevistas. Foram realizados 6.356 exames e 65(1,02% apresentaram alterações. Dos exames realizados, 4.869 (70,8% foram em mulheres de 25 a 59 anos. 38,5% dos exames apresentaram Neoplasia Intraepitelial Cervical (NIC I, 32,3% NIC II e 18,5% NIC I e Papiloma Vírus Humano (HPV. Foram entrevistadas 25 mulheres, a maioria apresentou algum fator de risco como: tabagismo, doenças sexualmente transmissíveis, uso de anticoncepcional hormonal, número de parceiros, início precoce da atividade sexual. Conclui-se pela necessidade de ações educativas mais efetivas no sentido de reduzir as alterações principalmente entre as mulheres adolescentes.El objetivo del estudio fue verificar alteraciones citopatológicas y factores de riesgo para la ocurrencia del cáncer de cuello de útero en mujeres atendidas por el Sistema Único de la Salud de una ciudad de pequeño porte en la Región Norte de la Provincia del Paraná, Brasil en el período de 2001 al 2006. Se trata de un estudio observacional transversal descriptivo. La colección de los datos fue realizada con los resultados de los exámenes, prontuarios y entrevistas. Fueron realizados 6.356 exámenes y 65(1,02% presentaron alteraciones. De los exámenes hechos 4.869 (70,8% fue compuesto de mujeres con edad entre los 25 a los 59 años. Un total de 38,5% de los exámenes presentaron Neoplasia Intra-epitelial del Cuello Uterino (NIC I, 32,3% NIC II y 18,5% NIC I y Virus de Papiloma Humano (HPV. Fueron entrevistadas 25 mujeres, la mayoría presentó factores de riesgo como: tabaquismo, enfermedades de transmisión sexual, uso de
The Antiaircraft Journal. Volume 94, Number 4, July-August 1953
1953-08-01
JOHN A. 1\\lATTAS TIle writer of the following received _his commissioll from Virgillia Polytech- nic Institllte in 1939. Dllrillg "Varld \\Var II he...officer of Leaders Course. Other members of the staff include Lt. Robert G. Mangum, S3 officer, and Lt. Sam H. Biddle , Ad- jutant. Lt. Mangum has the
Nicotinamidase participates in the salvage pathway of NAD biosynthesis in Arabidopsis.
Wang, Guodong; Pichersky, Eran
2007-03-01
Nicotinamide adenine dinucleotide (NAD) and nicotinamide adenine dinucleotide phosphate (NADP), which is derived from NAD, have important roles as a redox carriers in metabolism. A combination of de novo and salvage pathways contribute to the biosynthesis of NAD in all organisms. The pathways and enzymes of the NAD salvage pathway in yeast and animals, which diverge at nicotinamide, have been extensively studied. Yeast cells convert nicotinamide to nicotinic acid, while mammals lack the enzyme nicotinamidase and instead convert nicotinamide to nicotinamide mononucleotide. Here we show that Arabidopsis thaliana gene At2g22570 encodes a nicotinamidase, which is expressed in all tissues, with the highest levels observed in roots and stems. The 244-residue protein, designated AtNIC1, converts nicotinamide to nicotinic acid and has a Km value of 118 +/- 17 microM and a Kcat value of 0.93 +/- 0.13 sec(-1). Plants homozygous for a null AtNIC1 allele, nic1-1, have lower levels of NAD and NADP under normal growth conditions, indicating that AtNIC1 participates in a yeast-type NAD salvage pathway. Mutant plants also exhibit hypersensitivity to treatments of abscisic acid and NaCl, which is correlated with their inability to increase the cellular levels of NAD(H) under these growth conditions, as occurs in wild-type plants. We also show that the growth of the roots of wild-type but not nic1-1 mutant plants is inhibited and distorted by nicotinamide.
Su, Yanping; Chen, Chun; Zhu, Xiaoguang; Zhang, Yong; Gong, Wanbing; Zhang, Haimin; Zhao, Huijun; Wang, Guozhong
2017-05-16
We report a fast and simple method for the synthesis of Ni-based metal-organic-frameworks (Ni-MOFs). Due to the existence of nickel ions and an organic ligand, the MOFs are employed as a sacrificial template for the facile preparation of carbon-embedded Ni (Ni/C) catalysts by a direct thermal decomposition method. The obtained Ni/C catalysts exhibit excellent catalytic activity for selectively transforming furfural (FAL) to tetrahydrofurfuryl alcohol (THFOL) due to the Ni nanoparticles (NPs) embedded uniformly in the ligand-derived carbon. The exemplified results illustrate that the catalytic performance of the Ni/C catalyst is greatly affected by the calcination conditions (temperature and time), composition of the Ni-MOF precursor and the catalysis conditions. The conversion of FAL and selectivity of THFOL both reached 100% under the conditions of 120 °C, 1 MPa H 2 pressure and 120 min of hydrogenation over the Ni/C-500 catalyst, derived from the pyrolysis of Ni-MOFs (Ni : BTC mole ratio of 1.0) at 500 °C for 120 min, which exhibits an average nanoparticle size of ∼14 nm and uniform dispersion, and the highest BET surface area (∼92 m 2 g -1 ) among all investigated Ni/C catalysts. This facilely prepared heterogeneous catalyst would be very promising for the replacement of noble metal catalysts for the efficient catalytic conversion of biomass-derived feedstocks into value-added chemicals.
National Research Council Canada - National Science Library
Nagel, Wolfgang E; Kröner, Dietmar; Resch, Michael
2010-01-01
...), NIC/JSC (J¨ u lich), and LRZ (Munich). As part of that strategic initiative, in May 2009 already NIC/JSC has installed the first phase of the GCS HPC Tier-0 resources, an IBM Blue Gene/P with roughly 300.000 Cores, this time in J¨ u lich, With that, the GCS provides the most powerful high-performance computing infrastructure in Europe alread...
A theoretical perspective of the nature of hydrogen-bond types - the atoms in molecules approach
Vijaya Pandiyan, B.; Kolandaivel, P.; Deepa, P.
2014-06-01
Hydrogen bonds and their strength were analysed based on their X-H proton-donor bond properties and the parameters of the H-Y distance (Y proton acceptor). Strong, moderate and weak interactions in hydrogen-bond types were verified through the proton affinities of bases (PA), deprotanation enthalpies of acids (DPE) and the chemical shift (σ). The aromaticity and anti-aromaticity were analysed by means of the NICS (0) (nucleus-independent chemical shift), NICS (1) and ΔNICS (0), ΔNICS (1) of hydrogen-bonded molecules. The strength of a hydrogen bond depends on the capacity of hydrogen atom engrossing into the electronegative acceptor atom. The correlation between the above parameters and their relations were discussed through curve fitting. Bader's theory of atoms in molecules has been applied to estimate the occurrence of hydrogen bonds through eight criteria reported by Popelier et al. The lengths and potential energy shifts have been found to have a strong negative linear correlation, whereas the lengths and Laplacian shifts have a strong positive linear correlation. This study illustrates the common factors responsible for strong, moderate and weak interactions in hydrogen-bond types.
International Nuclear Information System (INIS)
Moawad, S. M.; Ibrahim, D. A.
2016-01-01
The equilibrium properties of three-dimensional ideal magnetohydrodynamics (MHD) are investigated. Incompressible and compressible flows are considered. The governing equations are taken in a steady state such that the magnetic field is parallel to the plasma flow. Equations of stationary equilibrium for both of incompressible and compressible MHD flows are derived and described in a mathematical mode. For incompressible MHD flows, Alfvénic and non-Alfvénic flows with constant and variable magnetofluid density are investigated. For Alfvénic incompressible flows, the general three-dimensional solutions are determined with the aid of two potential functions of the velocity field. For non-Alfvénic incompressible flows, the stationary equilibrium equations are reduced to two differential constraints on the potential functions, flow velocity, magnetofluid density, and the static pressure. Some examples which may be of some relevance to axisymmetric confinement systems are presented. For compressible MHD flows, equations of the stationary equilibrium are derived with the aid of a single potential function of the velocity field. The existence of three-dimensional solutions for these MHD flows is investigated. Several classes of three-dimensional exact solutions for several cases of nonlinear equilibrium equations are presented.
Directory of Open Access Journals (Sweden)
Enis Nadia Md Yusof
2017-03-01
Full Text Available The complete molecule of the title hydrazine carbodithioate complex, [Ni(C19H21N2S22], is generated by the application of a centre of inversion. The NiII atom is N,S-chelated by two hydrazinecarbodithioate ligands, which provide a trans-N2S2 donor set that defines a distorted square-planar geometry. The conformation of the five-membered chelate ring is an envelope with the NiII atom being the flap atom. In the crystal, p-tolyl-C—H...π(benzene-iPr, iPr-C—H...π(p-tolyl and π–π interactions [between p-tolyl rings with inter-centroid distance = 3.8051 (12 Å] help to consolidate the three-dimensional architecture. The analysis of the Hirshfeld surface confirms the importance of H-atom contacts in establishing the packing.
International Nuclear Information System (INIS)
Konno, Yoshihiro; Sekimoto, Masashi; Nemoto, Kiyomitsu; Degawa, Masakuni
2004-01-01
Male and female of F344 rats were treated per os with nicardipine (Nic) and nifedipine (Nif), and changes in the levels of mRNA and protein of hepatic cytochrome P450 (P450) enzymes, CYP2B1, CYP2B2, CYP3A1, CYP3A2, CYP3A9, and CYP3A18 were examined. Furthermore, hepatic microsomal activities for pentoxyresorufin O-dealkylation (PROD) and nifedipine oxidation, which are mainly mediated by CYP2B and CYP3A subfamily enzymes, respectively, were measured. Analyses of RT-PCR and Western blotting revealed that Nic and Nif induced predominantly CYP3A and CYP2B enzymes, respectively. As for the gene activation of CYP2B enzymes, especially CYP2B1, Nif showed high capacity in both sexes of rats, whereas Nic did a definite capacity in the males but little in the females. Gene activations of CYP3A1, CYP3A2, and CYP3A18 by Nic occurred in both sexes of rats, although that of CYP3A9 did only in the male rats. Although gene activations of CYP3A1 and CYP3A2 by Nif were observed in both sexes of rats, a slight activation of the CYP3A9 gene occurred only in female rats, and the CYP3A18 gene activation, in neither male nor female rats. Thus, changes in levels of the mRNA or protein of CYP2B and CYP3A enzymes, especially CYP2B1 and CYP3A2, were closely correlated with those in hepatic PROD and nifedipine oxidation activities, respectively. The present findings demonstrate for the first time the sex difference in the Nic- and Nif-mediated induction of hepatic P450 enzymes in rats and further indicate that Nic and Nif show different specificities and sex dependencies in the induction of hepatic P450 enzymes
A review of the ever increasing threat to European crayfish from non-indigenous crayfish species
Directory of Open Access Journals (Sweden)
D.M. Holdich
2009-01-01
Full Text Available Non-indigenous crayfish species (NICS in Europe now outnumber indigenous crayfish species (ICS 2:1, and it has been predicted that they may dominate completely in the next few decades unless something is done to protect them. Of the ten NICS introduced at least nine have become established in areas occupied by four of the five ICS. A decline in stocks of ICS has been recorded in many countries in the face of increasing populations of NICS. Most European countries retain at least one ICS but all are under threat from habitat loss, deteriorating water quality, overfishing, climate change, and most importantly from NICS and crayfish plague. The threat to ICS is so great in some countries that “ark”sanctuary sites are being established.The three most widely-spread NICS are the North American species: Pacifastacus leniusculus, Orconectes limosus and Procambarus clarkii. These can be considered as “Old NICS”, which were introduced before 1975, compared with the “New NICS”, which were introduced after 1980, such as the North American species: Orconectes immunis, Orconectes juvenilis, Orconectes virilis, Procambarus sp. and Procambarus acutus; and the Australian species: Cherax destructor and Cherax quadricarinatus, all of which have much narrower ranges in Europe. The North American species are potentially capable of acting as vectors of crayfish plague. Outbreaks of this disease occur regularly where there are high concentrations of vectors.In addition to the NICS currently established in the wild, a further threat exists through the aquarium trade, where many American and Australian species are available via the internet and in aquarist centres. Owners of such species may discard them into the freshwater environment when they grow too big as with some Cherax spp. and Orconectes spp., or multiply too frequently as with Procambarus sp. (a parthenogenetic species. A conceptual model is presented as a possible way forward for protecting the
Hahn, Joan Earle
2014-09-01
To describe the most frequently reported and the most central nursing interventions in an advance practice registered nurse (APRN)-led in-home preventive intervention model for adults aging with developmental disabilities using the Nursing Intervention Classification (NIC) system. A descriptive data analysis and a market basket analysis were conducted on de-identified nominal nursing intervention data from two home visits conducted by nurse practitioners (NPs) from October 2010 to June 2012 for 80 community-dwelling adults with developmental disabilities, ages 29 to 68 years. The mean number of NIC interventions was 4.7 in the first visit and 6.0 in the second visit and last visit. NPs reported 45 different intervention types as classified using a standardized language, with 376 in Visit One and 470 in Visit Two. Approximately 85% of the sample received the Health education intervention. The market basket analysis revealed common pairs, triples, and quadruple sets of interventions in this preventive model. The NIC nursing interventions that occurred together repeatedly were: Health education, Weight management, Nutrition management, Health screening, and Behavior management. Five NIC interventions form the basis of an APRN-led preventive intervention model for individuals aging with lifelong disability, with health education as the most common intervention, combined with interventions to manage weight and nutrition, promote healthy behaviors, and encourage routine health screening. Less frequently reported NIC interventions suggest the need to tailor prevention to individual needs, whether acute or chronic. APRNs employing prevention among adults aging with developmental disabilities must anticipate the need to focus on health education strategies for health promotion and prevention as well as tailor and target a patient-centered approach to support self-management of health to promote healthy aging in place. These NIC interventions serve not only as a guide for
Crystal structure of bis{2-[(E-(4-fluorobenzyliminomethyl]phenolato-κ2N,O}nickel(II
Directory of Open Access Journals (Sweden)
Amalina Mohd Tajuddin
2014-10-01
Full Text Available The asymmetric unit of the title complex, [Ni(C14H11FNO2], contains one-half of the molecule with the NiII cation lying on an inversion centre coordinated by a bidentate Schiff base anion. The cationic NiII center is in a distorted square-planar coordination environment chelated by the imine N and phenolate O donor atoms of the two Schiff base ligands. The N and O donor atoms of the two ligands are mutually trans with Ni—N and Ni—O bond lengths of 1.9242 (10 and 1.8336 (9 Å, respectively. The fluorophenyl ring is almost orthogonal to the coordination plane and makes a dihedral angle of 82.98 (7° with the phenolate ring. In the crystal, molecules are linked into screw chains by weak C—H...F hydrogen bonds. Additional C—H...π contacts arrange the molecules into sheets parallel to the ac plane.
International Nuclear Information System (INIS)
Farkas, Svetlana; Hussein, Jabeen; Ariano, Robert E.; Sitar, Daniel S.; Hasan, Shabih U.
2006-01-01
Epidemiological studies support an association between perinatal cigarette smoke (CS) exposure and a number of severe pre- and postnatal complications. However, the mechanisms through which CS enhances such risks largely remain unknown. One of the reasons for our inability to discover such mechanisms has been the unavailability of a clinically relevant and physiologically concordant animal model. A number of studies have previously used nicotine (Nic) as surrogate for CS. We sought to (1) establish the amount of CS exposure to achieve plasma Nic concentrations observed among moderate to heavy smokers (20-60 ng/ml) (2) investigate the temporal changes in plasma Nic concentrations, carboxyhemoglobin, and hematocrit with advancing pregnancy, and (3) elucidate the effects of CS exposure on pregnancy outcome. Pregnant Sprague-Dawley rats were exposed to various doses of CS or room air (Sham) from days 6 to 21 of gestation. Exposure to 6000 ml/day of CS led to very high plasma Nic concentrations and increased maternal and fetal mortality (P < 0.001). The plasma Nic concentrations remained higher than those observed in moderate smokers until the CS dose was reduced to 1000 ml/day and showed dose-dependent temporal changes with advancing gestational age. Significant increases in carboxyhemoglobin and hematocrit were observed in the CS group as compared with the Sham group (P < 0.001). In addition, prenatally CS exposed fetuses had lower birth weight as compared with the Sham group (P = 0.04). Our current study establishes a newly standardized and physiologically relevant model to investigate the mechanisms of CS-mediated adverse effects during the critical period of fetal development
Ignition and Inertial Confinement Fusion at The National Ignition Facility
International Nuclear Information System (INIS)
Moses, E.
2009-01-01
The National Ignition Facility (NIF), the world's largest and most powerful laser system for inertial confinement fusion (ICF) and for studying high-energy-density (HED) science, is now operational at Lawrence Livermore National Laboratory (LLNL). The NIF is now conducting experiments to commission the laser drive, the hohlraum and the capsule and to develop the infrastructure needed to begin the first ignition experiments in FY 2010. Demonstration of ignition and thermonuclear burn in the laboratory is a major NIF goal. NIF will achieve this by concentrating the energy from the 192 beams into a mm 3 -sized target and igniting a deuterium-tritium mix, liberating more energy than is required to initiate the fusion reaction. NIF's ignition program is a national effort managed via the National Ignition Campaign (NIC). The NIC has two major goals: execution of DT ignition experiments starting in FY2010 with the goal of demonstrating ignition and a reliable, repeatable ignition platform by the conclusion of the NIC at the end of FY2012. The NIC will also develop the infrastructure and the processes required to operate NIF as a national user facility. The achievement of ignition at NIF will demonstrate the scientific feasibility of ICF and focus worldwide attention on laser fusion as a viable energy option. A laser fusion-based energy concept that builds on NIF, known as LIFE (Laser Inertial Fusion Energy), is currently under development. LIFE is inherently safe and can provide a global carbon-free energy generation solution in the 21st century. This paper describes recent progress on NIF, NIC, and the LIFE concept.
Vázquez-Palacios, G; Bonilla-Jaime, H; Velázquez-Moctezuma, J
2004-05-01
An antidepressant action of nicotine (NIC) has recently been suggested. Flouxetine, a selective serotonin reuptake inhibitor, is currently the most widely used antidepressant. In the present study, we analyzed the effects of the administration of NIC, fluoxetine (FLX), and the combination of both drugs given acutely, subchronically, and chronically as well as 7 days after chronic administration of these drugs on the forced swim test. Results showed that NIC induced a significant reduction of the time in immobility during the forced swim test (antidepressant effect), with a concomitant increase in swimming activity (serotonergic activation), after acute administration. These effects remain the same after subchronic and chronic administration. FLX failed to induce any effect after acute administration but did induce a significant decrease of immobility and an increase of swimming after subchronic administration. The effect of the chronic administration was significantly larger compared to subchronic administration. The combination of both drugs induced a larger effect than that observed after a single administration but only after subchronic treatment. No effect was observed after the end of the 7-day treatments. Data suggest that NIC has an antidepressant action that is expressed faster than FLX but remains the same later. Thus, cholinergic-serotonergic interactions could play an important role in the treatment of depression.
Directory of Open Access Journals (Sweden)
A. Reisi-Vanani
2014-04-01
Full Text Available Substitution of two or four carbon atoms by nitrogen in the corannulene molecule as a carbon nanostructure was done and the obtained structures were optimized at MP2/6-31G(d level of theory. Calculations of the nucleus-independent chemical shift (NICS were performed to analyze the aromaticity of the corannulene rings and its derivatives upon doping with N at B3LYP/6-31G(d level of theory. Results showed NICS values in six-membered and five-membered rings of two and four N atoms doped corannulene are different and very dependent to number and position of the N atoms. The values of the mean NICS of all N-doped structures are more positive than intact corannulene that show insertion of N atom to the structures causes to decreasing aromaticity of them.
[Nursing care mapping for patients at risk of falls in the Nursing Interventions Classification].
Luzia, Melissa de Freitas; Almeida, Miriam de Abreu; Lucena, Amália de Fátima
2014-08-01
Identifying the prescribed nursing care for hospitalized patients at risk of falls and comparing them with the interventions of the Nursing Interventions Classifications (NIC). A cross-sectional study carried out in a university hospital in southern Brazil. It was a retrospective data collection in the nursing records system. The sample consisted of 174 adult patients admitted to medical and surgical units with the Nursing Diagnosis of Risk for falls. The prescribed care were compared with the NIC interventions by the cross-mapping method. The most prevalent care were the following: keeping the bed rails, guiding patients/family regarding the risks and prevention of falls, keeping the bell within reach of patients, and maintaining patients' belongings nearby, mapped in the interventions Environmental Management: safety and Fall Prevention. The treatment prescribed in clinical practice was corroborated by the NIC reference.
International Nuclear Information System (INIS)
Galaburda, M.V.; Bogatyrov, V.M.; Skubiszewska-Zięba, J.; Oranska, O.I.; Sternik, D.; Gun’ko, V.M.
2016-01-01
Graphical abstract: - Highlights: • Facile synthesis of the Ni-doped carbon sorbents via carbonization of resorcinol–formaldehyde polymers/nickel(II) acetate mixtures in the inert atmosphere. • Effects of Ni content, as well as water volume and temperature treatment on the morphology and texture of the chars. • Ni/C composites are characterized by a core–shell structure with well-crystallized graphitic shells. • Ni content influences the structure of the carbon. • Nickel-doped carbon nanocomposites were used as a magnetically separable adsorbent. - Abstract: A series of meso- and microporous carbons containing magnetic Ni nanoparticles (Ni/C) with a variety of Ni loadings were synthesized by a simple one-pot procedure through carbonization of resorcinol–formaldehyde polymers containing various amounts of nickel(II) acetate. Such composite materials were characterized by N_2 sorption, Raman spectroscopy, X-ray diffraction (XRD), scanning electron microscopy (SEM) and Transmission electron microscope (TEM). The XRD patterns reveal peaks corresponding to face centered cubic nickel with the average size of crystallites of 17–18 nm. SEM and TEM results reveal that the formation of the nanoparticles took place mainly in the carbon spheres (1–2 μm in size) and on the outer surface as well. The as-prepared composites are characterized by a core–shell structure with well-crystallized graphitic shells about 8–15 nm in thickness. The Raman spectra show that Ni content influences the structure of the carbon. It was also shown that the morphology (particle shape and sizes) and porosity (pore volume and pore size distribution) of the chars are strongly dependent on water and nickel contents in the blends. One of the applications of Ni/C was demonstrated as a magnetically separable adsorbent.
Khaodee, Warangkhana; Aeungmaitrepirom, Wanlapa; Tuntulani, Thawatchai
Simultaneous determination of Cu(II), Pb(II), Al(III) and Fe(III) using cyanidin as a chelating agent was investigated in terms of both quantitative and qualitative detections. Cyanidin was extracted and purified from red cabbage which is a local plant in Thailand. The selectivity of this method was examined by regulating the pH of cyanidin solution operated together with masking agents. It was found that Cu(II), Pb(II), Al(III) and Fe(III) simultaneously responded with the color change at pH 7, pH 6, pH 5 and pH 4, respectively. KF, DMG and the mixture of KF and DMG were used as masking agents for the determination of Fe(III), Al(III) and Pb(II), respectively. Results from naked-eye detection were evaluated by comparing with those of inductively coupled plasma (ICP), and there was no significant difference noticed. Cyanidin using as a multianalyte reagent could be employed for simultaneous determination of Cu(II), Pb(II), Al(III) and Fe(III) at the lowest concentration at 50, 80, 50 and 200 μM, respectively, by slightly varying pHs. Moreover, the proposed method could be potentially applied for real water samples with simplicity, rapidity, low cost and environmental safety.
Keenan, G; Aquilino, M L
1998-01-01
Standardized nursing nomenclatures must be included in clinical documentation systems to generate data that more accurately represent nursing practice than outcomes-related measures currently used to support important policy decisions. NANDA, NIC, and NOC--comprehensive nomenclatures for the needed variables of nursing diagnoses, interventions, and outcomes--are described. Added benefits of using NANDA, NIC, and NOC in everyday practice are outlined, including facilitation of the continuity of care of patients in integrated health systems.
Non-Intrusive Intelligibility Prediction Using a Codebook-Based Approach
DEFF Research Database (Denmark)
Sørensen, Charlotte; Kavalekalam, Mathew Shaji; Xenaki, Angeliki
2017-01-01
It could be beneficial for users of hearing aids if these were able to automatically adjust the processing according to the speech intelligibility in the specific acoustic environment. Most speech intelligibility metrics are intrusive, i.e., they require a clean reference signal, which is rarely...... a high correlation between the proposed non-intrusive codebookbased STOI (NIC-STOI) and the intrusive STOI indicating that NIC-STOI is a suitable metric for automatic classification of speech signals...
International Nuclear Information System (INIS)
Kim, Hee Eun; Seo, Na Hyeon; Hyun, Myung Ho
2016-01-01
Cyclometalated iridium (III) complexes formed with three identical cyclometalating (C-N) ligands (homoleptic) or formed with two cyclometalating (C-N) ligands and one ancillary (LX) ligand (heteroleptic) have been known as highly phosphorescent materials and, thus, they have been utilized as efficient phosphorescent dopants in organic light emitting diodes (OLEDs) 1–3 or as effective phosphorescent chemosensors. 4–7 Cylometalated iridium (III) complexes are chiral compounds consisting of lambda (Λ, left-handed) and delta (Δ, right-handed) isomers. Racemic cyclometa- lated iridium (III) complexes emit light with no net polarization, but optically active cyclometalated iridium (III) complexes emit circularly polarized light. 8,9 Circularly polarized light can be used in various fields including highly efficient three dimensional electronic devices, photo nic devices for optical data storage, biological assays, and others. 8,9 In order to obtain optically active cylometalated iridium (III) complexes and to determine the enantiomeric composition of optically active cylometalated iridium (III) complexes, liquid chromatogr aphic enantiomer separation method on chiral stationary phases (CSPs) has been used. For example, Okamoto and coworkers first reported the high performance liquid chromatographic (HPLC) direct enantiomeric separation of two homoleptic cylometalated iridium (III) complexes on immobilized amylose tris(3,5- dimethylphenylcarbamate) (Chiralpak IA), coated cellulose tris(3,5-dimethylphenylcarbamate) (Chiralc el OD), and coated cellulose tris(4-methylbenzoate) (Chiralce l OJ). 10 Supercritical fluid chromatography (SFC) was also used by Bernhard and coworkers for the enantiomeric separation of cylometalated iridium (III) complexes on coated amylose tris(3,5-dimethylphenylcarbamate) (Chiralpak AD-H). 8 However, the general use of the HPLC method for the direct enantiomeric separation of homoleptic
Energy Technology Data Exchange (ETDEWEB)
Kim, Hee Eun; Seo, Na Hyeon; Hyun, Myung Ho [Dept. of Chemistry and Chemistry Institute for Functional Materials, Pusan National University, Busan (Korea, Republic of)
2016-12-15
Cyclometalated iridium (III) complexes formed with three identical cyclometalating (C-N) ligands (homoleptic) or formed with two cyclometalating (C-N) ligands and one ancillary (LX) ligand (heteroleptic) have been known as highly phosphorescent materials and, thus, they have been utilized as efficient phosphorescent dopants in organic light emitting diodes (OLEDs) 1–3 or as effective phosphorescent chemosensors. 4–7 Cylometalated iridium (III) complexes are chiral compounds consisting of lambda (Λ, left-handed) and delta (Δ, right-handed) isomers. Racemic cyclometa- lated iridium (III) complexes emit light with no net polarization, but optically active cyclometalated iridium (III) complexes emit circularly polarized light. 8,9 Circularly polarized light can be used in various fields including highly efficient three dimensional electronic devices, photo nic devices for optical data storage, biological assays, and others. 8,9 In order to obtain optically active cylometalated iridium (III) complexes and to determine the enantiomeric composition of optically active cylometalated iridium (III) complexes, liquid chromatogr aphic enantiomer separation method on chiral stationary phases (CSPs) has been used. For example, Okamoto and coworkers first reported the high performance liquid chromatographic (HPLC) direct enantiomeric separation of two homoleptic cylometalated iridium (III) complexes on immobilized amylose tris(3,5- dimethylphenylcarbamate) (Chiralpak IA), coated cellulose tris(3,5-dimethylphenylcarbamate) (Chiralc el OD), and coated cellulose tris(4-methylbenzoate) (Chiralce l OJ). 10 Supercritical fluid chromatography (SFC) was also used by Bernhard and coworkers for the enantiomeric separation of cylometalated iridium (III) complexes on coated amylose tris(3,5-dimethylphenylcarbamate) (Chiralpak AD-H). 8 However, the general use of the HPLC method for the direct enantiomeric separation of homoleptic.
2006-01-01
1974.60 • o -, aECHTE l CORPORATION [NGINf.f.RS AND CONSTRUCTOII~ DEPARTMENT OF -mE AIR FORCE AlA F"QRCE IALU , nIC "’UJU: OIVISION (AROC) .n...116, 118, 121 , 124, 126-128, 130, 141-]42, 152 Oregon, governor of, 51 Oregonian, 65 , 128, 142 Pacific and Biddle , 85 Pacific Coast, 18,24,35
Bis(O-ethyl dithio-carbonato-κS,S')bis-(pyridine-3-carbonitrile-κN)nickel(II).
Kapoor, Sanjay; Kour, Ramandeep; Sachar, Renu; Kant, Rajni; Gupta, Vivek K; Kapoor, Kamini
2012-01-01
The Ni(2+) ion in the title complex, [Ni(C(3)H(5)OS(2))(2)(C(6)H(4)N(2))(2)], is in a strongly distorted octa-hedral coordination environment formed by an N(2)S(4) donor set, with the Ni(2+) ion located on a centre of inversion. In the crystal, weak C-H⋯S and C-H⋯N inter-actions are observed.
Energy Technology Data Exchange (ETDEWEB)
Liu, Huanhuan [Department of Radiology, Ruijin Hospital Affiliated to Shanghai Jiaotong University, School of Medicine, Shanghai 200025 (China); Department of Radiology, Xinhua Hospital affiliated to Shanghai Jiaotong University School of Medicine (China); Yan, Fuhua; Pan, Zilai; Lin, Xiaozhu; Luo, Xianfu; Shi, Cen [Department of Radiology, Ruijin Hospital Affiliated to Shanghai Jiaotong University, School of Medicine, Shanghai 200025 (China); Chen, Xiaoyan [Department of Pathology, Ruijin Hospital Affiliated to Shanghai Jiaotong University, School of Medicine, Shanghai 200025 (China); Wang, Baisong [Department of Biomedical Statistics, Shanghai Jiaotong University, School of Medicine, Shanghai 200025 (China); Zhang, Huan, E-mail: huanzhangy@126.com [Department of Radiology, Ruijin Hospital Affiliated to Shanghai Jiaotong University, School of Medicine, Shanghai 200025 (China)
2015-02-15
Highlights: • Colorectal cancer is the third most prevalent cancer and the status of the regional lymph nodes in rectal cancer is considered to be one of the most powerful prognostic factor in the absence of distant metastatic disease. Detecting LNs metastasis is still a challenging problem due to the presence of microscopic metastasis or inflammatory swelling of LNs. • We investigated the value of dual energy spectral CT in differentiating metastatic from non-metastatic lymph nodes in rectal cancer. Our study demonstrated that the quantitative normalized iodine concentration (nIC) could be useful for differentiating metastatic and non-metastatic lymph nodes. The combination of nIC in portal venous phase and conventional size criterion could improve the diagnostic accuracy, sensitivity, specificity, positive predictive value and negative predictive value of rectal cancer. - Abstract: Objectives: To investigate the value of dual energy spectral CT (DEsCT) imaging in differentiating metastatic from non-metastatic lymph nodes in rectal cancer. Methods: Fifty-five patients with rectal cancer underwent the arterial phase (AP) and portal venous phase (PP) contrast-enhanced DEsCT imaging. The virtual monochromatic images and iodine-based material decomposition images derived from DEsCT imaging were interpreted for lymph nodes (LNs) measurement. The short axis diameter and the normalized iodine concentration (nIC) of metastatic and non-metastatic LNs were measured. The two-sample t test was used to compare the short axis diameters and nIC values of metastatic and non-metastatic LNs. ROC analysis was performed to assess the diagnostic performance. Results: One hundred and fifty two LNs including 92 non-metastatic LNs and 60 metastatic LNs were matched using the radiological-pathological correlation. The mean short axis diameter of metastatic LNs was significantly larger than that of the non-metastatic LNs (7.28 ± 2.28 mm vs. 4.90 ± 1.64 mm, P < 0.001). The mean nIC
International Nuclear Information System (INIS)
Nemani Murty, K.; Yedluri Rao, P.; Geddada Chalam, K.
1982-01-01
Sn(II), Ti(III), Cu(I),Fe(II), V(III) and V(II) can be titrated potentiometrically with cacotheline in 1-4 M hydrochloric acid, 0.5-2 M hydrochloric acid, 0.5-1.5 M sulphuric acid in presence of 4 ml of 10% EDTA solution in a total volume of 50 ml, 9-10 M phosphoric acid, 4-8 M acetic acid and 3-8 M acetic acid respectively. Cacotheline can be used for the assay of tin plate and solder. The cacotheline undergoes a 2-electron reduction reaction. A cacotheline solution (0.005 M) in 0.02 M hydrochloric acid is fairly stable for several months. The conditional redox potentials of cacotheline have been determined in sulphuric, phosphoric and acetic acid medium. (Author)
Oral Assessment Kit, Levels II & III. Draft.
Agrelo-Gonzalez, Maria; And Others
The assessment packet includes a series of oral tests to help develop speaking as an integral part of second language instruction at levels II and III. It contains: 8 mini-tests for use at level II; 9 mini-tests for use at level III; a rating scale and score sheet masters for evaluating performance on these tests; and a collection of suggested…
Bai, Yaohui; Chang, Yangyang; Liang, Jinsong; Chen, Chen; Qu, Jiuhui
2016-12-01
High concentrations of iron (Fe(II)) and manganese (Mn(II)) often occur simultaneously in groundwater. Previously, we demonstrated that Fe(II) and Mn(II) could be oxidized to biogenic Fe-Mn oxides (BFMO) via aeration and microbial oxidation, and the formed BFMO could further oxidize and adsorb other pollutants (e.g., arsenic (As(III)) and antimony (Sb(III))). To apply this finding to groundwater remediation, we established four quartz-sand columns for treating groundwater containing Fe(II), Mn(II), As(III), and Sb(III). A Mn-oxidizing bacterium (Pseudomonas sp. QJX-1) was inoculated into two parallel bioaugmented columns. Long-term treatment (120 d) showed that bioaugmentation accelerated the formation of Fe-Mn oxides, resulting in an increase in As and Sb removal. The bioaugmented columns also exhibited higher overall treatment effect and anti-shock load capacity than that of the non-bioaugmented columns. To clarify the causal relationship between the microbial community and treatment effect, we compared the biomass of active bacteria (reverse-transcribed real-time PCR), bacterial community composition (Miseq 16S rRNA sequencing) and community function (metagenomic sequencing) between the bioaugmented and non-bioaugmented columns. Results indicated that the QJX1 strain grew steadily and attached onto the filter material surface in the bioaugmented columns. In general, the inoculated strain did not significantly alter the composition of the indigenous bacterial community, but did improve the relative abundances of xenobiotic metabolism genes and Mn oxidation gene. Thus, bioaugmentation intensified microbial degradation/utilization for the direct removal of pollutants and increased the formation of Fe-Mn oxides for the indirect removal of pollutants. Our study provides an alternative method for the treatment of groundwater containing high Fe(II), Mn(II) and As/Sb. Copyright © 2016 Elsevier Ltd. All rights reserved.
1989-01-01
Title: P-3 gpdate IV Avi nics E. (U) COMPARISCN WITH AMENDED FY 1988/1989 DESCRIPTIVE SUHMARY: IMPACT OF CHANGES TYPE OF impact on Impact on Impact on...d. (U) Completed NTU TEMP 547 DT/OT-IIIA testing aboard USS BIDDLE (OG-34). e. (U) Initiated engineering design/development of modifications to...with the Royal and Royal Australian Navies for delivery of OBU under Foreign Military Sales (FMS) provisions. J. (U) TEST AND EVALUATION DATA: NIC /DIA
Climent Serrano, Salvador
1989-01-01
Història d'Internet on es realitza una descripció de la transmissió de les dades per TCP / IP i s'explica el nombre IP. S'estudien els serveis d'Internet com, Correu electrònic (e-mail), Transferència de fitxers (ftp), World wide wed (la teranyina mundial), Navegadors, URL (Uniform Resource Locator), 4.5 Notícies (news), Xats (IRC ), Webphone, Archie, Gopher, Wais, Comerç electrònic els seus components.
Directory of Open Access Journals (Sweden)
Mª del Carmen PASTOR SEMPERE
2006-09-01
Full Text Available En la colaboración que a continuación se desarrolla se parte del papel central que el régimen económico desempeña en la sociedad cooperativa, para acto seguido efectuar su análisis individualizado a través de las NIC y su influencia./The following contribution focuses on the central role placed by economic regulatations in cooperatives, analysing by NIC and its presence and influence.
Evolving a polymerase for hydrophobic base analogues.
Loakes, David; Gallego, José; Pinheiro, Vitor B; Kool, Eric T; Holliger, Philipp
2009-10-21
Hydrophobic base analogues (HBAs) have shown great promise for the expansion of the chemical and coding potential of nucleic acids but are generally poor polymerase substrates. While extensive synthetic efforts have yielded examples of HBAs with favorable substrate properties, their discovery has remained challenging. Here we describe a complementary strategy for improving HBA substrate properties by directed evolution of a dedicated polymerase using compartmentalized self-replication (CSR) with the archetypal HBA 5-nitroindole (d5NI) and its derivative 5-nitroindole-3-carboxamide (d5NIC) as selection substrates. Starting from a repertoire of chimeric polymerases generated by molecular breeding of DNA polymerase genes from the genus Thermus, we isolated a polymerase (5D4) with a generically enhanced ability to utilize HBAs. The selected polymerase. 5D4 was able to form and extend d5NI and d5NIC (d5NI(C)) self-pairs as well as d5NI(C) heteropairs with all four bases with efficiencies approaching, or exceeding, those of the cognate Watson-Crick pairs, despite significant distortions caused by the intercalation of the d5NI(C) heterocycles into the opposing strand base stack, as shown by nuclear magnetic resonance spectroscopy (NMR). Unlike Taq polymerase, 5D4 was also able to extend HBA pairs such as Pyrene: varphi (abasic site), d5NI: varphi, and isocarbostyril (ICS): 7-azaindole (7AI), allowed bypass of a chemically diverse spectrum of HBAs, and enabled PCR amplification with primers comprising multiple d5NI(C)-substitutions, while maintaining high levels of catalytic activity and fidelity. The selected polymerase 5D4 promises to expand the range of nucleobase analogues amenable to replication and should find numerous applications, including the synthesis and replication of nucleic acid polymers with expanded chemical and functional diversity.
Energy Technology Data Exchange (ETDEWEB)
Hu, Shudong [Jiangsu University, Department of Radiology, The Affiliated Renmin Hospital, Zhenjiang, Jiangsu (China); Shanghai Jiao tong University, School of Medicine, Department of Radiology, Ruijin Hospital, Shanghai (China); Huang, Wei; Song, Qi; Lin, Xiaozhu; Wang, Zhongmin; Chen, Kemin [Shanghai Jiao tong University, School of Medicine, Department of Radiology, Ruijin Hospital, Shanghai (China); Chen, Yerong [Jiangsu University, Department of Radiology, The Affiliated Renmin Hospital, Zhenjiang, Jiangsu (China)
2014-09-15
We sought to evaluate the capability of spectral CT to detect the therapeutic response to {sup 125}I interstitial brachytherapy in a pancreatic carcinoma xenograft nude mouse model. Twenty mice bearing SWl990 human pancreatic cancer cell xenografts were randomly separated into two groups: experimental (n = 10; 1.0 mCi) and control (n = 10; 0 mCi). After a two-week treatment, spectral CT was performed. Contrast-to-noise ratio (CNR) and iodine concentration (IC) in the lesions were measured and normalized to the muscle tissue, and nIC CD31 immunohistochemistry was used to measure microvessel density (MVD). The relationships between the nIC and MVD of the tumours were analysed. The nIC of the experimental group was significantly lower than that of the control group during the multiphase examination. A significant difference in the MVD was observed between the two groups (P <0.001). The nIC values of the three-phase scans have a certain positive correlation with MVD (r = 0.57, p < 0.0001; r = 0.48, p = 0.002; r = 0.63, p = 0.0017 in the 10, 25, and 60 s phase, respectively). Spectral CT can be a useful non-invasive imaging modality in evaluating the therapeutic effect of {sup 125}I interstitial brachytherapy to a pancreatic carcinoma. (orig.)
Cyclo nic separation of uranate dust
International Nuclear Information System (INIS)
Nadal, P.
1976-01-01
Size of particles of uranate dust which can be entrained by hot gases leaving a multiple-hearth furnace is determined. The convenience of the installation of a cyclone is discussed considering power of the fume-extractor and pressure-drop permissible in the system. (Author)
Organ nic pollutants in underground water
International Nuclear Information System (INIS)
Hussein, H. H.
1998-01-01
Many organic compounds have been diagnosed in underground and surface waters, and there are many theories that explain the source of the dangerous materials on Punic health. The source of pollution could be the underground stored fuel or the polluted water in farms saturated with agricultural insecticides and chemical fertilizers, or there could be leaks in sewage water wastes. The source of pollution could also be the water surfaces in the areas of garbage disposal or industrial and home waste discharge. Due to the fact that the underground water is separated from oxygen in the air, its ability on self-purification is very low, in that the micro-organism that will do the dismantling and decomposition of the organic materials that pollute the water are in need for oxygen. In the event that underground water is subject to pollution m there are many methods for t resting the polluted water including the chemical decomposition method by injecting the polluted areas with neutralizing or oxidizing chemicals, such as Ozone, Chlorine or Hydrogen Peroxide. The mechanical methods could be used for getting rid of the volatile organic materials. As to biological decomposition, it is done with the use of bacteria in dismantling the poisonous materials into un poisonous materials. The preliminary analysis of water samples in one of the water wells in Sar ir and Tazarbo in Great Jamahirieh indicated that the concentration of total organic compounds (TOC) exceeded the internationally allowed limits. This indicates a deterioration of quality of some of underground water resources. It is well known that some of the organic pollutants have a great role in causing dangerous diseases, such as the polynuclear aromatic hydrocarbons and some halogenated compounds that cause cancer. Therefore, much research is required in this field for diagnosing the polluting organic compounds and determining the suitability of this water for drinking or for human consumption. (author). 21 refs., 6 figs., 8 tabs
Yang, Yuqi; Zhou, Hongbo; Shen, Xiaoping
2013-01-01
The asymmetric unit of the title complex, [Fe2Ni(C19H12N3O)2(CN)6(C16H36N4)]?2.07H2O, contains one [Fe(qcq)(CN)3]? anion, half a [Ni(teta)]2+ cation and two partially occupied inter?stitial water mol?ecules [qcq? is the N-(quinolin-8-yl)quinoline-2-carboxamidate anion and teta is 5,5,7,12,12,14-hexa?methyl-1,4,8,11-tetra?aza?cyclo?tetra?deca?ne]. In the complex mol?ecule, two [Fe(qcq)(CN)3]? anions additionally coordinate the central [Ni(teta)]2+ cation through cyanide groups in a trans mode,...
IX Jornadas de educación emocional. Educación emocional y valores
Barredo Gutiérrez, Blanca; Bisquerra Alzina, Rafael; Blanco Cuch, Aida; Giner, Antoni; Pérez Escoda, Núria; Tey, Amèlia
2013-01-01
Barredo Gutierrez, B.; Bisquerra Alzina, R.; Blanco Cuch, A.; Giner Tarrida, A.; Perez Escoda, N.; Tey Teijón, A. (eds.) IX Jornades d’educació emocional. Educació emocional i valors / IX Jornadas de educación emocional. Educación emocional y valores. Barcelona, Universitat de Barcelona (Institut de Ciències de l’Educació), 2013. Document electrònic.valores. Barcelona, Universitat de Barcelona (Institut de Ciències de l’Educació), 2013. Document electrònic
Directory of Open Access Journals (Sweden)
Luciano Passamani Diogo
2010-12-01
Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.FUNDAMENTO: La asociación entre el uso de antiinflamatorios no esteroides (AINEs e insuficiencia renal aguda o crónica está bien documentada, pero evidencias sobre la asociación entre AINEs y nefropatía inducida por contraste (NIC no son encontradas en la literatura. OBJETIVO: Evaluar una posible asociación entre AINEs y NIC. MÉTODOS: En un estudio de cohorte, a través de la entrevista clínica de pacientes que fueron sometidos a cateterismo cardíaco, analizamos el
Tris(1,10-phenanthroline-κ2N,N′nickel(II dinitrate tetrahydrate
Directory of Open Access Journals (Sweden)
Masoumeh Tabatabaee
2011-12-01
Full Text Available In the title complex, [Ni(C12H8N23](NO32·4H2O, the NiII ion is octahedrally coordinated by three bidentate 1,10-phenanthroline ligands, each forming a five-membered chelate ring. In the crystal, O—H...O and C—H...O hydrogen bonds are present between the complex cations, nitrate anions and water molecules. O—H...O hydrogen bonds between the uncoordinated water molecules lead to the formation of a four-membered ring water cluster, with a planar configuration. There were an additional five grossly disordered water molecules in the asymmetric unit, which were removed by the subroutine SQUEEZE; these were were excluded in the calculation of the molecular weight, etc. π–π stacking interactions between the aromatic rings are also observed [centroid–centroid distances = 3.697 (2, 3.728 (2 and 3.761 (2 Å].
The generation of myricetin-nicotinamide nanococrystals by top down and bottom up technologies.
Liu, Mingyu; Hong, Chao; Li, Guowen; Ma, Ping; Xie, Yan
2016-09-30
Myricetin-nicotinamide (MYR-NIC) nanococrystal preparation methods were developed and optimized using both top down and bottom up approaches. The grinding (top down) method successfully achieved nanococrystals, but there were some micrometer range particles and aggregation. The key consideration of the grinding technology was to control the milling time to determine a balance between the particle size and distribution. In contrast, a modified bottom up approach based on a solution method in conjunction with sonochemistry resulted in a uniform MYR-NIC nanococrystal that was confirmed by powder x-ray diffraction, scanning electron microscopy, dynamic light scattering, and differential scanning calorimeter, and the particle dissolution rate and amount were significantly greater than that of MYR-NIC cocrystal. Notably, this was a simple method without the addition of any non-solvent. We anticipate our findings will provide some guidance for future nanococrystal preparation as well as its application in both chemical and pharmaceutical area.
Stress-temperature-lifetime response of nicalon fiber-reinforced SiC composites in air
International Nuclear Information System (INIS)
Lin, Hua-Tay; Becher, P.F.
1996-01-01
Time-to-failure tests were conducted in four-point flexure and in air as a function of stress levels and temperatures to study the lifetime response of various Nicalon fiber-reinforced SiC (designated as Nic/SiC) composites with a graphitic interfacial coating. The results indicated that all of the Nic/SiC composites exhibit a similar stress-dependent failure at applied stress greater than a threshold value. In this case, the lifetimes of the composites increased with decrease in both stress level and test temperature. The lifetime of the composites appeared to be relatively insensitive to the thickness of graphitic interface layer and was enhanced somewhat by the addition of oxidation inhibitors. Electron microscopy and oxidation studies indicated that the life of the Nic/SiC composites was governed by the oxidation of the graphitic interfaces and the on of glass(es) in composites due to the oxidation of the fiber and matrix, inhibitor phases
Achieving High-Energy-High-Power Density in a Flexible Quasi-Solid-State Sodium Ion Capacitor.
Li, Hongsen; Peng, Lele; Zhu, Yue; Zhang, Xiaogang; Yu, Guihua
2016-09-14
Simultaneous integration of high-energy output with high-power delivery is a major challenge for electrochemical energy storage systems, limiting dual fine attributes on a device. We introduce a quasi-solid-state sodium ion capacitor (NIC) based on a battery type urchin-like Na2Ti3O7 anode and a capacitor type peanut shell derived carbon cathode, using a sodium ion conducting gel polymer as electrolyte, achieving high-energy-high-power characteristics in solid state. Energy densities can reach 111.2 Wh kg(-1) at power density of 800 W kg(-1), and 33.2 Wh kg(-1) at power density of 11200 W kg(-1), which are among the best reported state-of-the-art NICs. The designed device also exhibits long-term cycling stability over 3000 cycles with capacity retention ∼86%. Furthermore, we demonstrate the assembly of a highly flexible quasi-solid-state NIC and it shows no obvious capacity loss under different bending conditions.
First-principle study of structure and stability of nickel carbides
Energy Technology Data Exchange (ETDEWEB)
Gibson, Josh S; Uddin, Jamal; Cundari, Thomas R; Bodiford, Nelli K; Wilson, Angela K [Center for Advanced Scientific Computing and Modeling, University of North Texas, Denton, TX 76203 (United States); Department of Chemistry, University of North Texas, 1155 Union Circle 305070, Denton, TX 76203 (United States)
2010-10-10
Computational studies of nickel carbides, particularly Ni{sub 2}C, are scarce. A systematic density functional theory study is reported for Ni{sub 2}C, along with NiC and Ni{sub 3}C, to understand the stability and electronic structure of nickel carbides of varying stoichiometry. A comprehensive study was executed that involved 28 trial structures of varying space group symmetry for Ni{sub 2}C. An analysis of the electronic structure, geometry and thermodynamics of Ni{sub 2}C is performed, and compared with that for Ni{sub 3}C and NiC as well as several defect structures of varying composition. It is found that the most stable ground state arrangement of Ni{sub 2}C exists within a simple orthorhombic lattice and that it has metallic character. The calculated formation energies (kcal mol{sup -1}) of NiC, Ni{sub 2}C, and Ni{sub 3}C are 48.6, 7.9 and 6.4, respectively.
Retrospective study of the implementation of the nursing process in a health area
Directory of Open Access Journals (Sweden)
Joseba Xabier Huitzi-Egilegor
2013-09-01
Full Text Available OBJECTIVES: to analyze when the nursing process began to be used in the public and private healthcare centers of Gipuzkoa (Basque Country, and when both NANDA-I nursing diagnoses and the NIC-NOC terminologies were incorporated into this process. METHOD: a retrospective study was conducted, based on the analysis of nursing records that were used in the 158 studied centers. RESULTS: the specific data provided showed that in Gipuzkoa, the nursing process began to be used in the 1990s. As for NANDA-I nursing diagnoses, they have been used since 1996, and the NIC-NOC terminologies has been used since 2004. CONCLUSION: it was concluded that public centers are the ones which, generally speaking, first began with the nursing methodology, and that in comparison to the United States and Canada, the nursing process started to be used about 20 years later, NANDA-I nursing diagnoses around 15 years later, and the NIC-NOC terminologies, around six years later.
Vanhorebeek, Ilse; Verbruggen, Sascha; Casaer, Michaël P; Gunst, Jan; Wouters, Pieter J; Hanot, Jan; Guerra, Gonzalo Garcia; Vlasselaers, Dirk; Joosten, Koen; Van den Berghe, Greet
2017-06-01
Large randomised controlled trials have shown that early supplemental parenteral nutrition in patients admitted to adult and paediatric intensive care units (PICUs) is harmful. Overdosing of energy with too little protein was suggested as a potential reason for this. This study analysed which macronutrient was associated with harm caused by early supplemental parenteral nutrition in the Paediatric Early versus Late Parenteral Nutrition In Critical Illness (PEPaNIC) randomised trial. Patients in the initial randomised controlled trial were randomly assigned to receive suppplemental parenteral nutrition (PN) within 24 h of PICU admission (early PN) or to receive such PN after 1 week (late PN) when enteral nutrition was insufficient. In this post-randomisation, observational study, doses of glucose, lipids, and aminoacids administered during the first 7 days of PICU stay were expressed as % of reference doses from published clinical guidelines for age and weight. Independent associations between average macronutrient doses up to each of the first 7 days and likelihood of acquiring an infection in the PICU, of earlier live weaning from mechanical ventilation, and of earlier live PICU discharge were investigated using multivariable Cox proportional hazard analyses. The three macronutrients were included in the analysis simultaneously and baseline risk factors were adjusted for. From June 18, 2012, to July 27, 2015, 7519 children aged between newborn and 17 years were assessed for eligibility. 6079 patients were excluded, and 1440 children were randomly assigned to receive either early PN (n=723) or late PN (n=717). With increasing doses of aminoacids, the likelihood of acquiring a new infection was higher (adjusted hazard ratios [HRs] per 10% increase between 1·043-1·134 for days 1-5, p≤0·029), while the likelihood of earlier live weaning from mechanical ventilation was lower (HRs 0·950-0·975 days 3-7, p≤0·045), and the likelihood of earlier live PICU
Study of Implosion of Combined Nested Arrays
Mitrofanov, K. N.; Aleksandrov, V. V.; Grabovski, E. V.; Sasorov, P. V.; Branitsky, A. V.; Gritsuk, A. N.; Frolov, I. N.; Laukhin, Ya. N.
2017-12-01
New experimental data on the implosion of plasma of nested kapron-tungsten arrays are obtained at the Angara-5-1 facility. The mode of plasma implosion is implemented in which a shock wave region forms in the space between the inner and outer arrays where a transition from the super-Alfvénic ( V r > V A ) to sub-Alfvénic ( V r Z-pinch and generation of a soft X-ray pulse with a peak power of 4 TW and duration of about 5 ns.
Bis(O-ethyl dithiocarbonato-κ2 S,S′)bis(pyridine-3-carbonitrile-κN 1)nickel(II)
Kapoor, Sanjay; Kour, Ramandeep; Sachar, Renu; Kant, Rajni; Gupta, Vivek K.; Kapoor, Kamini
2012-01-01
The Ni2+ ion in the title complex, [Ni(C3H5OS2)2(C6H4N2)2], is in a strongly distorted octahedral coordination environment formed by an N2S4 donor set, with the Ni2+ ion located on a centre of inversion. In the crystal, weak C—H⋯S and C—H⋯N interactions are observed. PMID:22259356
Pop, Raluca; van Staden, Jacobus; Diudea, Mircea
2015-03-01
The aromaticity of coronene derivatives where two C atoms of each outer six-membered ring are replaced by N have been investigated. Three types of substitution, namely 1,2-, 1,3-, and 1,4- are proposed. Computations of the geometric (HOMA index), energetic (HOMO-LUMO gap), and magnetic indices (NICS(0) and NICS(1)) were performed, and the results compared to the ones obtained for the all-carbon species. The results outline that the aza-derivatives have aromatic character comparable to the all-carbon species and an enlarged HOMO-LUMO gap.
Anàlisi, disseny i implementació d'una botiga virtual amb tecnologia J2EE
Antúnez Campo, Elisabet
2007-01-01
Aquest treball final de carrera té com a finalitat aprofundir en el coneixement de les plataformes tecnològiques que permeten el desenvolupament de solucions e-business, i conèixer el negoci del comerç electrònic, en aquest TFC es proposa desenvolupar una aplicació de comerç electrònic usant tecnologia J2EE. Este trabajo final de carrera tiene como finalidad profundizar en el conocimiento de las plataformas tecnológicas que permiten el desarrollo de soluciones e-business, y conocer el nego...
Rapid radioimmunoassay of human apolipoproteins C-II and C-III
Energy Technology Data Exchange (ETDEWEB)
Gustafson, S; Oestlund-Lindqvist, A M; Vessby, B [Uppsala Univ. (Sweden)
1984-06-01
Apolipoprotein (apo) C-II is an activator of lipoprotein lipase, while apo C-III has the ability to inhibit apo C-II activated lipolysis. In order to study further the relationship between lipoprotein lipase mediated hydrolysis and the serum concentrations of apo C-II and apo C-III radioimmunoassays for these apolipoproteins have been developed. Formalin-treated Staphylococcus aureus Cowan I was used for immunoprecipitation and were shown to give rapid uptake of immune complexes that could easily be harvested by centrifugation. The assays were shown to be sensitive (10 ..mu..g/1), specific, precise (inter- and intra-assay coefficients of variation below 10%), rapid (completed in less than 6 h) and simple to perform. Delipidation of serum and lipoproteins had no effect on the results, indicating that the immunologically active sites of apo C-II and apo C-III are exposed to the aqueous environment under assay conditions. Serum apo C-II and apo C-III levels of normolipidaemic subjects were approximately 25 mg/1 and 110 mg/1, respectively. Highly significant positive correlations were found between VLDL apo C-II and VLDL apo C-III, respectively, and VLDL triglycerides, VLDL cholesterol and total serum TG. There was also a highly significant correlation between the HDL cholesterol concentration and the HDL apo C-III concentration.
Platelet GP II b/III a inhibitors in neurointervention therapeutics
International Nuclear Information System (INIS)
Wang Kuizhong; Huang Qinghai; Liu Jianmin
2007-01-01
The platelet glucoprotein (GP) II b/III a inhibitors prossess inhibiting platelet aggregation effectly. As new drugs of antiplatelet, they are different in mechanism with action, application and dosage between the II b/III a inhibitors and other tradional antiplatelet drugs such as aspirin or clopidogrel. In familiar with the pharmacologic action and clinical application of II b/III a inhibitors is important for endovascular interventional radiology, especially with important significance for obtaining high quality neuro-endovascular stenting in the perioperative period. (authors)
Elmaci, Ayşe; Yonar, Taner; Ozengin, Nihan
2007-09-01
The aim of this research was to expose individual removals of copper, chromium, nickel, and lead from aqueous solutions via biosorption using nonliving algae species, Chara sp. and Cladophora sp. Optimum pH values for biosorption of copper (II), chromium (III), nickel (II), and lead (II) from aqueous solutions were determined to be 6, 7, 7, and 3 for Cladophora sp. and 5, 3, 5, and 4 for Chara sp. respectively. Maximum adsorption capacities of Chara sp. [10.54 for chromium (III) and 61.72 for lead (II)] and Cladophora sp. [6.59 for chromium (III) and 16.75 and 23.25 for lead (II)] for chromium (III) and lead (II) are similar. On the other hand, copper (II) and nickel (II) biosorption capacity of Cladophora sp. [14.28 for copper (II) and 16.75 for nickel (II)] is greater than Chara sp. [6.506 for copper (II) and 11.76 for nickel (II)]. Significantly high correlation coefficients indicated for the Langmuir adsorption isotherm models can be used to describe the equilibrium behavior of copper, chromium, nickel, and lead adsorption onto Cladophora sp. and Chara sp.
Archform comparisons between skeletal class II and III malocclusions.
Directory of Open Access Journals (Sweden)
Wei Zou
Full Text Available The purpose of this cross-sectional research was to explore the relationship of the mandibular dental and basal bone archforms between severe Skeletal Class II (SC2 and Skeletal Class III (SC3 malocclusions. We also compared intercanine and intermolar widths in these two malocclusion types. Thirty-three virtual pretreatment mandibular models (Skeletal Class III group and Thirty-five Skeletal Class II group pretreatment models were created with a laser scanning system. FA (the midpoint of the facial axis of the clinical crownand WALA points (the most prominent point on the soft-tissue ridgewere employed to produce dental and basal bone archforms, respectively. Gained scatter diagrams of the samples were processed by nonlinear regression analysis via SPSS 17.0. The mandibular dental and basal bone intercanine and intermolar widths were significantly greater in the Skeletal Class III group compared to the Skeletal Class II group. In both groups, a moderate correlation existed between dental and basal bone arch widths in the canine region, and a high correlation existed between dental and basal bone arch widths in the molar region. The coefficient of correlation of the Skeletal Class III group was greater than the Skeletal Class II group. Fourth degree, even order power functions were used as best-fit functions to fit the scatter plots. The radius of curvature was larger in Skeletal Class III malocclusions compared to Skeletal Class II malocclusions (rWALA3>rWALA2>rFA3>rFA2. In conclusion, mandibular dental and basal intercanine and intermolar widths were significantly different between the two groups. Compared with Skeletal Class II subjects, the mandibular archform was more flat for Skeletal Class III subjects.
Generation mean analysis for quantitative traits in sesame (Sesamum indicum L. crosses
Directory of Open Access Journals (Sweden)
Vijayarajan Sharmila
2007-01-01
Full Text Available To study the nature and magnitude of gene effects for yield and its components in sesame (Sesamum indicum L. we carried out generation mean analysis using the following four crosses of different sesame cultivars: VS 9510 x Co1; NIC 7907 x TMV 3; Cianno 13/10x VRI 1; and Si 1115/1 x TMV 3. The P1, P2, F1, F2, BC1 and BC2 of these generations were studied for seven quantitative traits. The analysis showed the presence of additive, dominance and epistatic gene interactions. The additive dominance model was adequate for plant height in the NIC 7907 x TMV3 and Si 1115/1x TMV 3 crosses and for capsule length in the VS 9510 x Co1, NIC 7907 x TMV 3 and Si 1115/1 x TMV 3 crosses. An epistatic digenic model was assumed for the remaining crosses. Duplicate-type epistasis played a greater role than complementary epistasis. The study revealed the importance of both additive and non-additive types of gene action for all the traits studied.
Combined enteral and parenteral nutrition.
Wernerman, Jan
2012-03-01
To review and discuss the evidence and arguments to combine enteral nutrition and parenteral nutrition in the ICU, in particular with reference to the Early Parenteral Nutrition Completing Enteral Nutrition in Adult Critically Ill Patients (EPaNIC) study. The EPaNIC study shows an advantage in terms of discharges alive from the ICU when parenteral nutrition is delayed to day 8 as compared with combining enteral nutrition and parenteral nutrition from day 3 of ICU stay. The difference between the guidelines from the European Society of Enteral and Parenteral Nutrition in Europe and American Society for Parenteral and Enteral Nutrition/Society of Critical Care Medicine in North America concerning the combination of enteral nutrition and parenteral nutrition during the initial week of ICU stay was reviewed. The EPaNIC study clearly demonstrates that early parenteral nutrition in the ICU is not in the best interests of most patients. Exactly at what time point the combination of enteral nutrition and parenteral nutrition should be considered is still an open question.
Vibrational spectroscopic investigation of polymorphs and cocrystals of indomethacin.
Ali, Hassan Refat H; Alhalaweh, Amjad; Velaga, Sitaram P
2013-05-01
Identification of optimal solid form of an active pharmaceutical ingredient and form control are very important in drug development. Thus, the structural information of these forms and in-depth insight on the modes of molecular interactions are necessary, and vibrational spectroscopic methods are well suited for this purpose. In-depth structural analysis of different solid forms of indomethacin (IND) using Raman and infrared (IR) spectroscopy is the objective. We have investigated the modes of molecular interactions in polymorphs (α and γ), amorphous and discovered cocrystals of IND with nicotinamide (NIC) and trans-cinnamic acid (CIN) coformers. The solid forms of IND have been prepared; their purity has been verified by differential scanning calorimetry and powder X-ray diffractometry and then studied in the solid-state by Raman and IR spectroscopy. The modes of the interactions were closely investigated from the vibrational data. The key vibrational features of IND solid forms have been specified. The IR (C=O) band at 1713 cm(-1) attributed to cyclic acid dimer of γ IND has disappeared in IND-NIC/CIN whilst retained in IND-SAC cocrystal. IND cocrystallizes in different conformations and crystal lattices with different coformers. The cyclic acid dimer of IND has been kept on its cocrystallization with saccharin and it could have been broken with NIC and CIN. The complementary nature of Raman and IR spectroscopy allowed unambiguous investigation of the chemical composition of pharmaceutical materials which is of particular importance in the absence of detailed structural information, as in the case of IND-NIC and IND-CIN.
Optimizing megakaryocyte polyploidization by targeting multiple pathways of cytokinesis.
Avanzi, Mauro P; Chen, Amanda; He, Wu; Mitchell, W Beau
2012-11-01
Large-scale in vitro production of platelets (PLTs) from cord blood stem cells is one goal of stem cell research. One step toward this goal will be to produce polyploid megakaryocytes capable of releasing high numbers of PLTs. Megakaryocyte polyploidization requires distinct cytoskeletal and cellular mechanisms, including actin polymerization, myosin activation, microtubule formation, and increased DNA production. In this study we variably combined inhibition of these principal mechanisms of cytokinesis with the goal of driving polyploidization in megakaryocytes. Megakaryocytes were derived from umbilical cord blood and cultured with reagents that inhibit distinct mechanisms of cytokinesis: Rho-Rock inhibitor (RRI), Src inhibitor (SI), nicotinamide (NIC), aurora B inhibitor (ABI), and myosin light chain kinase inhibitor (MLCKI). Combinations of reagents were used to determine their interactions and to maximize megakaryocyte ploidy. Treatment with RRI, NIC, SI, and ABI, but not with MLCKI, increased the final ploidy and RRI was the most effective single reagent. RRI and MLCKI, both inhibitors of MLC activation, resulted in opposite ploidy outcomes. Combinations of reagents also increased ploidy and the use of NIC, SI, and ABI was as effective as RRI alone. Addition of MLCKI to NIC, SI, and ABI reached the highest level of polyploidization. Megakaryocyte polyploidization results from modulation of a combination of distinct cytokinesis pathways. Reagents targeting distinct cytoskeletal pathways produced additive effects in final megakaryocyte ploidy. The RRI, however, showed no additive effect but produced a high final ploidy due to overlapping inhibition of multiple cytokinesis pathways. © 2012 American Association of Blood Banks.
Wilson, Sarah E; Quach, Susan; MacDonald, Shannon E; Naus, Monika; Deeks, Shelley L; Crowcroft, Natasha S; Mahmud, Salaheddin M; Tran, Dat; Kwong, Jeff; Tu, Karen; Gilbert, Nicolas L; Johnson, Caitlin; Desai, Shalini
2017-08-03
Accurate and complete immunization data are necessary to assess vaccine coverage, safety and effectiveness. Across Canada, different methods and data sources are used to assess vaccine coverage, but these have not been systematically described. Our primary objective was to examine and describe the methods used to determine immunization coverage in Canada. The secondary objective was to compare routine infant and childhood coverage estimates derived from the Canadian 2013 Childhood National Immunization Coverage Survey (cNICS) with estimates collected from provinces and territories (P/Ts). We collected information from key informants regarding their provincial, territorial or federal methods for assessing immunization coverage. We also collected P/T coverage estimates for select antigens and birth cohorts to determine absolute differences between these and estimates from cNICS. Twenty-six individuals across 16 public health organizations participated between April and August 2015. Coverage surveys are conducted regularly for toddlers in Quebec and in one health authority in British Columbia. Across P/Ts, different methodologies for measuring coverage are used (e.g., valid doses, grace periods). Most P/Ts, except Ontario, measure up-to-date (UTD) coverage and 4 P/Ts also assess on-time coverage. The degree of concordance between P/T and cNICS coverage estimates varied by jurisdiction, antigen and age group. In addition to differences in the data sources and processes used for coverage assessment, there are also differences between Canadian P/Ts in the methods used for calculating immunization coverage. Comparisons between P/T and cNICS estimates leave remaining questions about the proportion of children fully vaccinated in Canada.
Energy Technology Data Exchange (ETDEWEB)
Clark, D. S.; Marinak, M. M.; Weber, C. R.; Eder, D. C.; Haan, S. W.; Hammel, B. A.; Hinkel, D. E.; Jones, O. S.; Milovich, J. L.; Patel, P. K.; Robey, H. F.; Salmonson, J. D.; Sepke, S. M.; Thomas, C. A. [Lawrence Livermore National Laboratory, Livermore, California 94551 (United States)
2015-02-15
The recently completed National Ignition Campaign (NIC) on the National Ignition Facility (NIF) showed significant discrepancies between post-shot simulations of implosion performance and experimentally measured performance, particularly in thermonuclear yield. This discrepancy between simulation and observation persisted despite concerted efforts to include all of the known sources of performance degradation within a reasonable two-dimensional (2-D), and even three-dimensional (3-D), simulation model, e.g., using measured surface imperfections and radiation drives adjusted to reproduce observed implosion trajectories [Clark et al., Phys. Plasmas 20, 056318 (2013)]. Since the completion of the NIC, several effects have been identified that could explain these discrepancies and that were omitted in previous simulations. In particular, there is now clear evidence for larger than anticipated long-wavelength radiation drive asymmetries and a larger than expected perturbation seeded by the capsule support tent. This paper describes an updated suite of one-dimensional (1-D), 2-D, and 3-D simulations that include the current best understanding of these effects identified since the NIC, as applied to a specific NIC shot. The relative importance of each effect on the experimental observables is compared. In combination, these effects reduce the simulated-to-measured yield ratio from 125:1 in 1-D to 1.5:1 in 3-D, as compared to 15:1 in the best 2-D simulations published previously. While the agreement with the experimental data remains imperfect, the comparison to the data is significantly improved and suggests that the largest sources for the previous discrepancies between simulation and experiment are now being included.
International Nuclear Information System (INIS)
Foerster Schreiber, N. M.; Genzel, R.; Davies, R.; Genel, S.; Lutz, D.; Tacconi, L. J.; Shapley, A. E.; Bouche, N.; Cresci, G.; Erb, D. K.; Newman, S.; Shapiro, K. L.; Steidel, C. C.; Sternberg, A.
2011-01-01
We study the properties of luminous stellar 'clumps' identified in deep, high-resolution Hubble Space Telescope NIC2/F160W imaging at 1.6 μm of six z ∼ 2 star-forming galaxies with existing near-infrared integral field spectroscopy from SINFONI at the Very Large Telescope. Individual clumps contribute ∼0.5%-15% of the galaxy-integrated rest-frame ∼5000 A emission, with median of ∼2%; the total contribution of clump light ranges from 10% to 25%. The median intrinsic clump size and stellar mass are ∼1 kpc and ∼10 9 M sun , in the ranges for clumps identified in rest-UV or line emission in other studies. The clump sizes and masses in the subset of disks are broadly consistent with expectations for clump formation through gravitational instabilities in gas-rich, turbulent disks given the host galaxies' global properties. By combining the NIC2 data with Advanced Camera for Surveys (ACS)/F814W imaging available for one source, and adaptive-optics-assisted SINFONI Hα data for another, we infer modest color, M/L, and stellar age variations within each galaxy. In these two objects, sets of clumps identified at different wavelengths do not fully overlap; NIC2-identified clumps tend to be redder/older than ACS- or Hα-identified clumps without rest-frame optical counterparts. There is evidence for a systematic trend of older ages at smaller galactocentric radii among the clumps, consistent with scenarios where inward migration of clumps transports material toward the central regions. From constraints on a bulge-like component at radii ∼< 1-3 kpc, none of the five disks in our sample appears to contain a compact massive stellar core, and we do not discern a trend of bulge stellar mass fraction with stellar age of the galaxy. Further observations are necessary to probe the buildup of stellar bulges and the role of clumps in this process.
Ehama, Kiyomi; Ohmichi, Yusuke; Sakamoto, Soichiro; Fujinami, Takeshi; Matsumoto, Naohide; Mochida, Naotaka; Ishida, Takayuki; Sunatsuki, Yukinari; Tsuchimoto, Masanobu; Re, Nazzareno
2013-11-04
Carbonato-bridged Zn(II)2Ln(III)2 complexes [(μ4-CO3)2{Zn(II)L(n)Ln(III)(NO3)}2]·solvent were synthesized through atmospheric CO2 fixation reaction of [Zn(II)L(n)(H2O)2]·xH2O, Ln(III)(NO3)3·6H2O, and triethylamine, where Ln(III) = Gd(III), Tb(III), Dy(III); L(1) = N,N'-bis(3-methoxy-2-oxybenzylidene)-1,3-propanediaminato, L(2) = N,N'-bis(3-ethoxy-2-oxybenzylidene)-1,3-propanediaminato. Each Zn(II)2Ln(III)2 structure possessing an inversion center can be described as two di-μ-phenoxo-bridged {Zn(II)L(n)Ln(III)(NO3)} binuclear units bridged by two carbonato CO3(2-) ions. The Zn(II) ion has square pyramidal coordination geometry with N2O2 donor atoms of L(n) and one oxygen atom of a bridging carbonato ion at the axial site. Ln(III) ion is coordinated by nine oxygen atoms consisting of four from the deprotonated Schiff-base L(n), two from a chelating nitrate, and three from two carbonate groups. The temperature-dependent magnetic susceptibilities in the range 1.9-300 K, field-dependent magnetization from 0 to 5 T at 1.9 K, and alternating current magnetic susceptibilities under the direct current bias fields of 0 and 1000 Oe were measured. The magnetic properties of the Zn(II)2Ln(III)2 complexes are analyzed on the basis of the dicarbonato-bridged binuclear Ln(III)-Ln(III) structure, as the Zn(II) ion with d(10) electronic configuration is diamagnetic. ZnGd1 (L(1)) and ZnGd2 (L(2)) show a ferromagnetic Gd(III)-Gd(III) interaction with J(Gd-Gd) = +0.042 and +0.028 cm(-1), respectively, on the basis of the Hamiltonian H = -2J(Gd-Gd)ŜGd1·ŜGd2. The magnetic data of the Zn(II)2Ln(III)2 complexes (Ln(III) = Tb(III), Dy(III)) were analyzed by a spin Hamiltonian including the crystal field effect on the Ln(III) ions and the Ln(III)-Ln(III) magnetic interaction. The Stark splitting of the ground state was so evaluated, and the energy pattern indicates a strong easy axis (Ising type) anisotropy. Luminescence spectra of Zn(II)2Tb(III)2 complexes were observed, while those
Pankow, James F; Barsanti, Kelley C; Peyton, David H
2003-01-01
Solution 1H NMR (proton-NMR) spectroscopy was used to measure the distribution of nicotine between its free-base and protonated forms at 20 degrees C in (a) water; (b) glycerin/water mixtures; and (c) puff-averaged "smoke" particulate matter (PM) produced by the Eclipse cigarette, a so-called "harm reduction" cigarette manufactured by R. J. Reynolds (RJR) Tobacco Co. Smoke PM from the Eclipse contains glycerin, water, nicotine, and numerous other components. Smoke PM from the Eclipse yielded a signal for the three N-methyl protons on nicotine at a chemical shift of delta (ppm) = 2.79 relative to a trimethylsilane standard. With alpha fb = fraction of the total liquid nicotine in free-base form, and alpha a = fraction in the acidic, monoprotonated NicH+ form, then alpha a + alpha fb approximately 1. (The diprotonated form of nicotine was assumed negligible.) When the three types of solutions were adjusted so that alpha a approximately 1, the N-methyl protons yielded delta a = 2.82 (Eclipse smoke PM); 2.79 (35% water/65% glycerin); and 2.74 (water). When the solutions were adjusted so that alpha fb approximately 1, the N-methyl protons yielded delta fb = 2.16 (Eclipse smoke PM); 2.13 (35% water/65% glycerin); and 2.10 (water). In all of the solutions, the rate of proton exchange between NicH+ and Nic was fast relative to the 1H-NMR chemical shift difference in hertz. Each solution containing both NicH+ and Nic thus yielded a single N-methyl peak at a delta given by delta = alpha a delta a + alpha fb delta fb so that delta varied linearly between delta a and delta fb. Since alpha fb = (delta a-delta)/(delta a-delta fb), then delta = 2.79 for the unadjusted Eclipse smoke PM indicates alpha fb approximately 0.04. The effective pH of the Eclipse smoke PM at 20 degrees C may then be calculated as pHeff = 8.06 + log[alpha fb/(1-alpha fb)] = 6.69, where 8.06 is the pKa of NicH+ in water at 20 degrees C. The measurements obtained for the puff-averaged Eclipse smoke PM
New trends in the treatment of nicotine addiction.
Sliwińska-Mossoń, Mariola; Zieleń, Iwona; Milnerowicz, Halina
2014-01-01
The aim of this study was to discuss the therapeutic substances used to treat nicotine addiction, not registered in Poland. This paper presents the results of the latest clinical trials and the possibility of their use in the treatment of nicotine addiction. The first two discussed drugs clonidine and nortriptyline are recommended by clinical practice guidelines AHRQ (Agency for Healthcare Research and Quality) as the substance of the second line in the fight against addiction. Nortriptyline belongs to tricyclic antidepressants. Its mechanism of action is the inhibition of the reuptake of norepinephrine. It is suggested as the antagonist of activity of nicotinic receptors. The results confirm its efficacy in the treatment of nicotine addiction, but many side effects limit its use. Clonidine acts presumably by inhibition of sympathetic hyperactivity characteristic of symptoms associated with nicotine rehab. The remaining compounds under discussion, such as: venlafaxine, fluoxetine, moclobemide and rimonabant, are not registered in any country with an indication to use in the treatment of nicotine addiction, however, due to the mechanism in which they act, the possibility of their use in the treatment of this disease is considered. The possibility of using anxiolytics such as: buspirone, diazepam, meprobamate and beta-blockers: metoprolol and oxprenolol is also considered in order to treat the anxiety appearing as one of the symptoms of abstinence. An interesting proposal to combat nicotine addiction are vaccines--NicVAX, CYT002-NicQb and TA-NIC. Currently, they are in clinical phase I and II of their development. Their operation would be based on the induction of specific antibodies that bind nicotine in the plasma, thus prevent it reaching the nicotinic receptors. Preliminary results confirm the possible positive effects in the prevention and treatment of nicotine addiction.
Solid State Power Controller Fuse Development Program.
1983-10-01
4NYP Appendix A nic =,-, ’XW LX, nII4CD1AFam" CC,’AP44 257-290 TABLE I - FAULT CURRENT TRIP TJMWS Fa’ Ii AC Volts Seconds Rema:ks 1. 1.6 100Z 234.0 417.0...calibration date: 12 July 1983 Biddle Power Rheostat, 1000 W, Cat. No. 20 4.2 Procedure Testing was accomplished in two lots, one consisting of the SPC-2A and...Last calibration date: 12 July 1983 Biddle 100dW Power Rheostat, Cat. No. 20 Variac, Environ No. 380-503 4.2 Procedure The test specimens were suspended
Interaction of Cr (III), Ni (II), Pb (II) with DTPA complexes of essential metal ions
International Nuclear Information System (INIS)
Gulzar, S.; Zahida; Maqsood, T.; Naqvi, R.R.
2002-01-01
With the increase of anthropogenic activities in the environment, heavy metal toxicity (Chromium, Nickel and Lead) is more common now. DTPA (diethylene triamine pentaacetic acid) a polyamino carboxylic acid is widely used to form hydrophilic and stable complexes with most of the metal ions. In this spectrophotometric study, concentration of Cr(III), Ni(II) and Pb(II) (toxic metal ions) exchanged with Fe(III), Zn(II) and Ca(II) from their DTPA complexes were estimated at pH 4,7 and 9. Concentration of added metal was varied from 1-4 times to that of complexed metal. (author)
New spectroscopic results in Xe II, Xe III, and Xe IV
Reyna Almandos, Jorge Guillermo; Gallardo, Mario; Garavaglia, Mario J.
1982-01-01
New results obtained in spontaneous xenon spectrum employing a conventional pulsed gaseous laser tube as light source, are presented in this work. A total of 626 spectral lines has been ionically assigned as follows: 50 to Xe II spectrum, 103 to Xe III spectrum, arid 222 to Xe IV spectrum. 30 Lines previously assigned to Xe II were reassigned as belonging to Xe III, 94 lines were assigned with some doubts to Xe II-III spectrum and 84 lines to Xe Ill-IV spectrum. Also there were clas...
Romain, Sophie; Rich, Jordi; Sens, Cristina; Stoll, Thibaut; Benet-Buchholz, Jordi; Llobet, Antoni; Rodriguez, Montserrat; Romero, Isabel; Clérac, Rodolphe; Mathonière, Corine; Duboc, Carole; Deronzier, Alain; Collomb, Marie-Noëlle
2011-09-05
A new pentanuclear bis(triple-helical) manganese complex has been isolated and characterized by X-ray diffraction in two oxidation states: [{Mn(II)(μ-bpp)(3)}(2)Mn(II)(2)Mn(III)(μ-O)](3+) (1(3+)) and [{Mn(II)(μ-bpp)(3)}(2)Mn(II)Mn(III)(2)(μ-O)](4+) (1(4+)). The structure consists of a central {Mn(3)(μ(3)-O)} core of Mn(II)(2)Mn(III) (1(3+)) or Mn(II)Mn(III)(2) ions (1(4+)) which is connected to two apical Mn(II) ions through six bpp(-) ligands. Both cations have a triple-stranded helicate configuration, and a pair of enantiomers is present in each crystal. The redox properties of 1(3+) have been investigated in CH(3)CN. A series of five distinct and reversible one-electron waves is observed in the -1.0 and +1.50 V potential range, assigned to the Mn(II)(4)Mn(III)/Mn(II)(5), Mn(II)(3)Mn(III)(2)/Mn(II)(4)Mn(III), Mn(II)(2)Mn(III)(3)/Mn(II)(3)Mn(III)(2), Mn(II)Mn(III)(4)/Mn(II)(2)Mn(III)(3), and Mn(III)(5)/Mn(II)Mn(III)(4) redox couples. The two first oxidation processes leading to Mn(II)(3)Mn(III)(2) (1(4+)) and Mn(II)(2)Mn(III)(3) (1(5+)) are related to the oxidation of the Mn(II) ions of the central core and the two higher oxidation waves, close in potential, are thus assigned to the oxidation of the two apical Mn(II) ions. The 1(4+) and 1(5+) oxidized species and the reduced Mn(4)(II) (1(2+)) species are quantitatively generated by bulk electrolyses demonstrating the high stability of the pentanuclear structure in four oxidation states (1(2+) to 1(5+)). The spectroscopic characteristics (X-band electron paramagnetic resonance, EPR, and UV-visible) of these species are also described as well as the magnetic properties of 1(3+) and 1(4+) in solid state. The powder X- and Q-band EPR signature of 1(3+) corresponds to an S = 5/2 spin state characterized by a small zero-field splitting parameter (|D| = 0.071 cm(-1)) attributed to the two apical Mn(II) ions. At 40 K, the magnetic behavior is consistent for 1(3+) with two apical S = 5/2 {Mn(II)(bpp)(3)}(-) and one S
Bis[1-methoxy-2,2,2-tris(pyrazol-1-yl-κN2ethane]nickel(II bis(trifluoromethanesulfonate dihydrate
Directory of Open Access Journals (Sweden)
Ganna Lyubartseva
2013-10-01
Full Text Available In the title salt, [Ni(C12H14N6O2](CF3SO32·2H2O, the NiII cation is located on an inversion centre and is coordinated by six N atoms from two tridentate 1-methoxy-2,2,2-tris(pyrazol-1-ylethane ligands in a distorted octahedral geometry. The Ni—N distances range from 2.0594 (12 to 2.0664 (12 Å, intra-ligand N—Ni—N angles range from 84.59 (5 to 86.06 (5°, and adjacent inter-ligand N—Ni—N angles range between 93.94 (5 and 95.41 (5°. In the crystal, inversion-related pyrazole rings are π–π stacked, with an interplanar spacing of 3.4494 (18 Å, forming chains that propagate parallel to the a-axis direction. Intermolecular O—H...O hydrogen bonds are present between water molecules and trifluoromethanesulfonate anions.
trans-Bis(N,N-diethylethylenediaminenickel(II dibromide
Directory of Open Access Journals (Sweden)
James P. Donahue
2011-01-01
Full Text Available The structure of the title compound, [Ni(C6H16N22]Br2 or [Ni(Et2en2]Br2 (Et2en is asymmetric N,N-diethylethylenediamine, containing an NiII atom (site symmetry overline{1} in square-planar NiN4 coordination, is described and contrasted with related structures containing NiII in octahedral coordination with axial X− ligands (X− = variable anions. The dialkylated N atom has an appreciably longer bond length to the NiII atom [1.9666 (13 Å] than does the unsubstituted N atom [1.9202 (14 Å]. The Ni—N bond lengths in [Ni(Et2en2]Br2 are significantly shorter than corresponding values in tetragonally distorted [Ni(Et2en2X2] compounds (X = −O2CCF3, OH2, or −NCS, which have a triplet ground state. The electronic configuration in these axially ligated [Ni(Et2en2X2] compounds populates the metal-based dx2-y2 orbital, which is Ni—N antibonding in character. Each Et2en ligand in each [Ni(Et2en2]2+ cation forms a pair of N—H...Br hydrogen bonds to the Br− anions, one above and below the NiN4 square plane. Thus, a ribbon of alternating Br− pairs and [Ni(Et2en2]2+ cations that are canted at 65° relative to one another is formed by hydrogen bonds.
Poly[[diaqua-μ2-4,4′-bipyridyl-μ2-o-phthalato-nickel(II] dihydrate
Directory of Open Access Journals (Sweden)
Bing Li
2008-02-01
Full Text Available In the title layer complex, {[Ni(C8H4O4(C10H8N2(H2O2]·2H2O}n, the Ni atom has a distorted octahedral environment, defined by the phthalate and 4,4′-bipyridyl ligands which link the Ni atoms, forming a square lattice in the bc plane. This extends into a three-dimensional supramolecular network through O—H...O hydrogen-bonding interactions. The Ni atom lies on, and both ligands are bisected by, a crystallographic twofold axis.
Determination of Proton Relaxivities of Mn(II, Cu(II and Cr(III added to Solutions of Serum Proteins
Directory of Open Access Journals (Sweden)
Ali Yilmaz
2009-04-01
Full Text Available Relaxometric studies are still of scientific interest due to their use in medicine and biology. In this study, proton T1 and T2 relaxivities of Mn(II, Cu(II and Cr(III in water were determined in the presence and absence of various proteins (albumin, α-globulin, γ-globulin, lysozyme, fibrinogen. The 1/T1 and 1/T2 in all solutions are linearly proportional to the concentration of the paramagnetic ions. Mn(II has the great influence to alter relaxations in all protein solutions, while Cu(II and Cr(III have a poor influence on the relaxations. In addition, Mn(II and Cu(II are bound to each protein, but Cr(III is not bound to any protein.
International Nuclear Information System (INIS)
Yu, Y.; Guo, L.; Hu, C.; Chen, K.
2014-01-01
Aim: To explore the value of CT spectral imaging in the differential diagnosis of necrotic hepatocellular carcinoma (nHCC) and hepatic abscess (HA) during the arterial phase (AP) and portal venous phase (PP). Materials and methods: Sixty patients with 36 nHCCs and 24 HAs underwent spectral CT during AP and PP. Iodine or water concentration were measured and the normalized iodine concentration (NIC) and lesion-normal parenchyma iodine concentration ratio (LNR) were calculated. The two-sample t-test was used to compare quantitative parameters. Two readers qualitatively assessed lesion types according to imaging features. Sensitivity and specificity were compared between the qualitative and quantitative studies. Results: NIC and LNR in the AP for the wall of nHCC (0.14 ± 0.04 mg/ml; 2.77 ± 0.74) were higher than those of HA (0.13 ± 0.02 mg/ml; 1.4 ± 0.9). NIC and LNR in the PP for the wall of HA (0.66 ± 0.05 mg/ml; 1.2 ± 0.2) were higher than those of nHCC (0.5 ± 0.11 mg/ml; 0.94 ± 0.12). The differences in NIC in the AP were not significant but the differences in LNR in AP, and NIC and LNR in the PP were significant. The best quantitative parameter was LNR in AP, and a threshold of 1.52 would yield a sensitivity and specificity of 100% and 91.7%, respectively, for differentiating nHCC from HA. Conclusion: CT spectral imaging with quantitative iodine concentration analysis may help to increase the accuracy of differentiating nHCC from HA. - Highlights: • We preliminarily investigate the usefulness of CT spectral imaging in differentiating nHCC from HA. • CT spectral imaging may help differentiate necrotic hepatocellular carcinoma from hepatic abscess. • CT spectral imaging can evaluate the blood supply and necrotic degree of lesions. • Quantitative analysis of iodine concentration provides greater diagnostic confidence
Sakamoto, Soichiro; Fujinami, Takeshi; Nishi, Koshiro; Matsumoto, Naohide; Mochida, Naotaka; Ishida, Takayuki; Sunatsuki, Yukinari; Re, Nazzareno
2013-06-17
Atmospheric CO2 fixation of [Ni(II)(3-MeOsaltn)(H2O)2]·2.5H2O [3-MeOsaltn = N,N'-bis(3-methoxy-2-oxybenzylidene)-1,3-propanediaminato], Ln(III)(NO3)3·6H2O, and triethylamine occurred in methanol/acetone, giving a first series of carbonato-bridged Ni(II)2Ln(III)2 complexes [(μ4-CO3)2{Ni(II)(3-MeOsaltn)(MeOH)Ln(III)(NO3)}2] (1Gd, 1Tb, and 1Dy). When the reaction was carried out in acetonitrile/water, it gave a second series of complexes [(μ4-CO3)2{Ni(II)(3-MeOsaltn)(H2O)Ln(III)(NO3)}2]·2CH3CN·2H2O (2Gd, 2Tb, and 2Dy). For both series, each Ni(II)2Ln(III)2 structure can be described as two di-μ-phenoxo-bridged Ni(II)Ln(III) binuclear units bridged by two carbonato CO3(2-) units to form a carbonato-bridged (μ4-CO3)2{Ni(II)2Ln(III)2} structure. The high-spin Ni(II) ion has octahedral coordination geometry, and the Ln(III) ion is coordinated by O9 donor atoms from Ni(II)(3-MeOsaltn), bidentate NO3(-), and one and two oxygen atoms of two CO3(2-) ions. The NO3(-) ion for the first series roughly lie on Ln-O(methoxy) bonds and are tilted toward the outside, while for the second series, the two oxygen atoms roughly lie on one of the Ln-O(phenoxy) bonds due to the intramolecular hydrogen bond. The temperature-dependent magnetic susceptibilities indicated a ferromagnetic interaction between the Ni(II) and Ln(III) ions (Ln(III) = Gd(III), Tb(III), Dy(III)) for all of the complexes, with a distinctly different magnetic behavior between the two series in the lowest-temperature region due to the Ln(III)-Ln(III) magnetic interaction and/or different magnetic anisotropies of the Tb(III) or Dy(III) ion. Alternating-current susceptibility measurements under the 0 and 1000 Oe direct-current (dc) bias fields showed no magnetic relaxation for the Ni(II)2Gd(III)2 complexes but exhibited an out-of-phase signal for Ni(II)2Tb(III)2 and Ni(II)2Dy(III)2, indicative of slow relaxation of magnetization. The energy barriers, Δ/kB, for the spin flipping were estimated from the Arrhenius
Magnetospheric structure and atmospheric Joule heating of habitable planets orbiting M-dwarf stars
Energy Technology Data Exchange (ETDEWEB)
Cohen, O.; Drake, J. J.; Garraffo, C.; Poppenhaeger, K. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Glocer, A. [NASA/GSFC, Code 673, Greenbelt, MD 20771 (United States); Bell, J. M. [Center for Planetary Atmospheres and Flight Sciences, National Institute of Aerospace, Hampton, VA 23666 (United States); Ridley, A. J.; Gombosi, T. I. [Center for Space Environment Modeling, University of Michigan, 2455 Hayward Street, Ann Arbor, MI 48109 (United States)
2014-07-20
We study the magnetospheric structure and the ionospheric Joule Heating of planets orbiting M-dwarf stars in the habitable zone using a set of magnetohydrodynamic models. The stellar wind solution is used to drive a model for the planetary magnetosphere, which is coupled with a model for the planetary ionosphere. Our simulations reveal that the space environment around close-in habitable planets is extreme, and the stellar wind plasma conditions change from sub- to super-Alfvénic along the planetary orbit. As a result, the magnetospheric structure changes dramatically with a bow shock forming in the super-Alfvénic sectors, while no bow shock forms in the sub-Alfvénic sectors. The planets reside most of the time in the sub-Alfvénic sectors with poor atmospheric protection. A significant amount of Joule Heating is provided at the top of the atmosphere as a result of the intense stellar wind. For the steady-state solution, the heating is about 0.1%-3% of the total incoming stellar irradiation, and it is enhanced by 50% for the time-dependent case. The significant Joule Heating obtained here should be considered in models for the atmospheres of habitable planets in terms of the thickness of the atmosphere, the top-side temperature and density, the boundary conditions for the atmospheric pressure, and particle radiation and transport. Here we assume constant ionospheric Pedersen conductance similar to that of the Earth. The conductance could be greater due to the intense EUV radiation leading to smaller heating rates. We plan to quantify the ionospheric conductance in future study.
Alfvén wave mixing and non-JWKB waves in stellar winds
International Nuclear Information System (INIS)
Webb, G M; McKenzie, J F; Hu, Q; Zank, G P
2013-01-01
Alfvén wave mixing equations used in locally incompressible turbulence transport equations in the solar wind contain as a special case, non-Jeffreys–Wentzel–Kramers–Brouillon (non-JWKB) wave equations used in models of Alfvén wave driven winds. We discuss the canonical wave energy equation; the physical wave energy equation, and the JWKB limit of the wave interaction equations. Lagrangian and Hamiltonian variational principles for the waves are developed. Noether’s theorem is used to derive the canonical wave energy equation which is associated with the linearity symmetry of the equations. A further conservation law associated with time translation invariance of the action, applicable for steady background wind flows is also derived. In the latter case, the conserved density is the Hamiltonian density for the waves, which is distinct from the canonical wave energy density. The canonical wave energy conservation law is a special case of a wider class of conservation laws associated with Green’s theorem for the wave mixing system and the adjoint wave mixing system, which are related to Noether’s second theorem. In the sub-Alfvénic flow, inside the Alfvén point of the wind, the backward and forward waves have positive canonical energy densities, but in the super-Alfvénic flow outside the Alfvén critical point, the backward Alfvén waves are negative canonical energy waves, and the forward Alfvén waves are positive canonical energy waves. Reflection and transmission coefficients for the backward and forward waves in both the sub-Alfvénic and super-Alfvénic regions of the flow are discussed. (paper)
International Nuclear Information System (INIS)
De Serres, F.J.
1990-01-01
More extensive complementation tests than those performed initially on a series of 832 X-ray-induced specific-locus mutations in the adenine-4 (ad-3) region of a two-component heterokaryon (H-12) of Neurospora crassa showed that unexpectedly high frequencies of specific-locus mutations in the ad-3 region have additional, but separate, sites of recessive lethal damage in the immediately adjacent genetic regions. In the present paper, X-ray-induced irreparable ad-3 mutants of the folowing genotypes and numbers (ad-3A ad-3B, ad-3A ad-3B nic-2, and ad-3B nic-2) have also subjected to the same genetic fine structure analysis. These experiments, in the previous and present papers, were designed to determine the extent of the functional inactivation in the ad-3 and immediately adjacent genetic regions in individual mutants classified as presumptive multilocus deletions or multiplelocus mutations. The data in the present paper have shown that in Neurospora crassa most X-ray-induced irreparable mutants of genotype ad-3A ad-3B, ad-3A ad-3B nic-2, and ad-3 nic-2 map as a series of overlapping multilocus deletions. In addition, genetic fine structure analysis has shown that some of the mutants classified, initially, as multilocus deletions, are actually multiple-locus mutations: multilocus deletions with closely linked, and separate, sites of recessive lethal damage with a wide variety of genotyes. Combining data from the present experiments with previously published date, the frequency of multiple-locus mutations among X-ray-induced gene/point mutations and multilocus deletions in the ad-3 region is 6.2%. (author). 27 refs.; 4 figs.; 7 tab
Ajuria, Jon; Redondo, Edurne; Arnaiz, Maria; Mysyk, Roman; Rojo, Teófilo; Goikolea, Eider
2017-08-01
In this work, we are presenting both lithium and sodium ion capacitors (LIC and NIC) entirely based on electrodes designed from recycled olive pit bio-waste derived carbon materials. On the one hand, olive pits were pyrolized to obtain a low specific surface area semigraphitic hard carbon to be used as the ion intercalation (battery-type) negative electrode. On the other hand, the same hard carbon was chemically activated with KOH to obtain a high specific surface area activated carbon that was further used as the ion-adsorption (capacitor-type) positive electrode. Both electrodes were custom-made to be assembled in a hybrid cell to either build a LIC or NIC in the corresponding Li- and Na-based electrolytes. For comparison purposes, a symmetric EDLC supercapacitor cell using the same activated carbon in 1.5 M Et4NBF4/acetonitrile electrolyte was also built. Both LIC and NIC systems demonstrate remarkable energy and power density enhancement over its EDLC counterpart while showing good cycle life. This breakthrough offers the possibility to easily fabricate versatile hybrid ion capacitors, covering a wide variety of applications where different requirements are demanded.
Directory of Open Access Journals (Sweden)
Reza Aprianti
2016-02-01
Full Text Available This study discuss the tendency of broadcast media commercialization in the four newly industrialized countries in Asia, which are known as NICs (Newly Industrialized Countries consisting of Taiwan, South Korea, Singapore and Hong Kong. The objective of this study is to find out the characteristics of the commercial media in Asia along with the trend and limitation. Which are any changes directly or indirectly in the form of broadcasting in the Asia that much influence on the political and social system. In addition to discussing the state of the four NICs (Taiwan, South Korea, Singapore and Hong Kong, the study will also discuss other Asian countries in general. In simple terms this study assumed that: (1 the tendency of media liberalization and rules on the Asian NICs that have made great contributions for creating media commercialization. (2 The most important of the commercialization of the media against the political and social system is that the commercialization of the media can be an alternative or indirectly be the way for the success of democratic media, which would be the first step for the creation of political and social democracy in Asia.
Directory of Open Access Journals (Sweden)
Ramaiyer Venkatraman
2010-05-01
Full Text Available In the title compound, [Ni(C12H11N4S2(C12H12N4S2]Cl·H2O, the NiII ion is chelated by two 2-acetylthiazole-3-phenylthiosemicarbazone ligands, forming a distorted octahedral complex. The metal ion is coordinated via the thiazole nitrogen, imine nitrogen and thione sulfur atoms from each thiosemicarbazone ligand, and two coordinating units lie almost perpendicular to each other give dihedral angle = 81.89 (1°]. One thiosemicarbazone unit is found to bind a chloride anion through two hydrogen bonds, while the other is linked with the disordered crystal water molecule. Two molecules are connected to each other through an intermolecular N—H...S interaction, forming a centrosymmetric dimer. Dimers are linked into sheets by π–π stacking of two phenyl rings [shortest C...C distance = 4.041 (3 Å].
Observation of low frequency electromagnetic activity at 1000 km altitude
Directory of Open Access Journals (Sweden)
N. Ivchenko
Full Text Available We present a statistical study of low frequency fluctuations of electric and magnetic fields, commonly interpreted as Alfvénic activity. The data base consists of six months of electric and magnetic field measurements by the Astrid-2 microsatellite. The occurrence of the events is studied with respect to the location and general activity. Large regions of broadband Alfvénic activity are persistently observed in the cusp/cleft and, during the periods of high geo-magnetic activity, also in the pre-midnight sector of the auroral oval.
Key words. Ionosphere (auroral ionosphere – Space plasma physics (waves and instabilities – Magnetospheric physics (magnetosphere-ionosphere interactions
Architectural improvements and technological enhancements for the APEnet+ interconnect system
International Nuclear Information System (INIS)
Ammendola, R.; Biagioni, A.; Frezza, O.; Lonardo, A.; Cicero, F. Lo; Martinelli, M.; Paolucci, P.S.; Pastorelli, E.; Simula, F.; Tosoratto, L.; Vicini, P.; Rossetti, D.
2015-01-01
The APEnet+ board delivers a point-to-point, low-latency, 3D torus network interface card. In this paper we describe the latest generation of APEnet NIC, APEnet v5, integrated in a PCIe Gen3 board based on a state-of-the-art, 28 nm Altera Stratix V FPGA. The NIC features a network architecture designed following the Remote DMA paradigm and tailored to tightly bind the computing power of modern GPUs to the communication fabric. For the APEnet v5 board we show characterizing figures as achieved bandwidth and BER obtained by exploiting new high performance ALTERA transceivers and PCIe Gen3 compliancy
Gene expression profiles in stages II and III colon cancers
DEFF Research Database (Denmark)
Thorsteinsson, Morten; Kirkeby, Lene T; Hansen, Raino
2012-01-01
PURPOSE: A 128-gene signature has been proposed to predict outcome in patients with stages II and III colorectal cancers. In the present study, we aimed to reproduce and validate the 128-gene signature in external and independent material. METHODS: Gene expression data from the original material...... were retrieved from the Gene Expression Omnibus (GEO) (n¿=¿111) in addition to a Danish data set (n¿=¿37). All patients had stages II and III colon cancers. A Prediction Analysis of Microarray classifier, based on the 128-gene signature and the original training set of stage I (n¿=¿65) and stage IV (n...... correctly predicted as stage IV-like, and the remaining patients were predicted as stage I-like and unclassifiable, respectively. Stage II patients could not be stratified. CONCLUSIONS: The 128-gene signature showed reproducibility in stage III colon cancer, but could not predict recurrence in stage II...
Energy Technology Data Exchange (ETDEWEB)
Jayakumar, M.; Venkatesan, K.A. [Fuel Chemistry Division, Indira Gandhi Centre for Atomic Research, Kalpakkam 603102 (India); Srinivasan, T.G. [Fuel Chemistry Division, Indira Gandhi Centre for Atomic Research, Kalpakkam 603102 (India)], E-mail: tgs@igcar.gov.in; Vasudeva Rao, P.R. [Fuel Chemistry Division, Indira Gandhi Centre for Atomic Research, Kalpakkam 603102 (India)
2009-11-01
Electrochemical behavior of ruthenium (III), rhodium (III) and palladium (II) in 1-butyl-3-methylimidazolium chloride (bmimCl) and their ternary and binary solutions in bmimCl was studied at various working electrodes at 373 K by cyclic voltammetry and chronoamperometry. Ruthenium (III) chloride forms a stable solution with bmimCl and the cyclic voltammogram of ruthenium (III) in bmimCl recorded at glassy carbon electrode consisted of several redox waves due to the complex nature of ruthenium to exist in several oxidation states. Electrolysis of ruthenium (III) chloride in bmimCl at the cathodic limit of bmimCl (-1.8 V (vs. Pd)) did not result in ruthenium metal deposition. However, it was deposited from bmimPF{sub 6} and bmimNTf{sub 2} room temperature ionic liquids at -0.8 V (vs. Pd). The electrochemical behavior of ruthenium (III) in bmimCl in the presence of palladium (II) and rhodium (III) was studied by cyclic voltammetry. The presence of palladium (II) in bmimCl favors underpotential deposition of ruthenium metal. The nuclear loop at -0.5 V (vs. Pd) was observed in all solutions when palladium (II) co-existed with other two metal ions. Nucleation and growth of the metal on glassy carbon working electrode was investigated by chronoamperometry. The growth and decay of chronocurrents has been found to follow the instantaneous nucleation model with three-dimensional growth of nuclei.
Directory of Open Access Journals (Sweden)
Mariana Carnevalini
2011-10-01
Full Text Available La nefropatía inducida por contraste (NIC es una de las causas más frecuentes de insuficiencia renal en pacientes internados. En el síndrome coronario agudo (SCA, la presencia de NIC aumenta la morbimortalidad. Las medidas de profilaxis y los factores de riesgo intervinientes de NIC en SCA no han sido determinados con exactitud. El objetivo de este estudio fue evaluar la incidencia de NIC y los factores asociados a su desarrollo en pacientes ingresados en unidad coronaria con requerimiento de cinecoronariografía (CCG. Se realizó un estudio de cohorte retrospectivo. Se incluyeron pacientes consecutivos cursando SCA estudiados con CCG dentro de las 72 horas de su admisión. Se definió NIC al aumento del 25% del valor de creatinina a las 48 h sobre el nivel basal de ingreso. El período de inclusión fue entre el 1° de enero de 2004 hasta el 30 de junio de 2010. Se analizaron 125 casos. La incidencia de NIC fue del 10.4% (n = 13. En el análisis multivariado, los factores asociados independientemente a su desarrollo fueron la edad [OR 1.05 (IC 95% 1.004 - 1.11 p = 0.034], la angioplastia a múltiple vaso [OR 2.2 (IC 95% 1.07 - 4.8, p = 0.03] y el volumen de contraste utilizado [OR 1.007 (IC 95% 1.001 - 1.01, p = 0.014].Contrast induced nephropathy (CIN is one of the most frequent causes of acute renal failure in hospitalized patients. It is associated with an increase in morbidity and mortality in patients hospitalized for acute coronary syndrome (ACS undergoing percutaneous coronary intervention (PCI. Risk factors and prevention strategies are not well defined. The aim of this study was to assess the incidence and clinical risk factors associated to the development of contrast induced nephropathy in patients hospitalized for ACS. In a retrospective cohort we analyzed consecutive patients hospitalized for ACS undergoing urgent PCI within 72 hours from the admission. CIN was defined as a 25% increase of creatinine levels from baseline at 48
van Ree, R; van Leeuwen, W A; van den Berg, M; Weller, H H; Aalberse, R C
1994-04-01
In this study, the homologous C-termini of Lol p I, Lol p II, and Lol p III were shown to contain cross-reactive B-cell epitopes. This was demonstrated by inhibition studies with purified Lol p I, II, and III and synthetic peptides of their C-termini. It was ruled out that the observed cross-reactivity was caused by cross-contamination of the purified allergens. Both human IgE and IgG bound to the C-terminus of Lol p I. These antibodies were cross-reactive with Lol p II and, more specifically, with its C-terminus. Within a small panel of allergic patients, no cross-reactivity with Lol p III was found. A hyperimmune polyclonal rabbit antiserum against Lol p I also recognized the Lol p I C-terminus. As for human antibodies, cross-reactivity with Lol p II and its C-terminus was demonstrated. Cross-reactivity with Lol p III was demonstrated with C-terminal peptides, but not with native Lol p III. A polyclonal rabbit antiserum against Lol p II bound to the C-terminal peptides of both Lol p II and III. This binding was inhibited with Lol p I, confirming that cross-reactive structures exist not only on the C-termini of Lol p II and Lol p I, but also of Lol p III and Lol p I. The existence of cross-reactivity between Lol p I and Lol p II and III possibly contributes to the frequently observed cosensitization for these allergens in grass-pollen-allergic patients.
Finishing occlusion in Class II or Class III molar relation: therapeutic Class II and III.
Nangia, A; Darendeliler, M A
2001-11-01
The most frequent extraction regime consists of the removal of upper and lower premolars. Depending on anchorage requirements, camouflage treatment options, surgical intervention, or the absence of teeth in only one arch, it may become necessary to finalize the occlusion with a one-dental-unit discrepancy between the upper and lower dental arches. Guidelines are presented for finishing occlusions in Class II or Class III molar relation.
Ramos, Christian Paul L.; Conato, Marlon T.
2018-05-01
Despite the numerous researches in metal-organic frameworks (MOFs), there are only few reports on biologically important amino acids, histidine in particular, on its use as bridging ligand in the construction of open-framework architectures. In this work, hydrothermal synthesis was used to prepare a compound based on Ni2+ and histidine. The coordination assembly of imidazole side chain of histidine with divalent nickel ions in aqueous condition yielded purple prismatic solids. Single crystal X-ray diffraction (XRD) analysis of the product revealed structure for Ni(C6H8N3O2)2 • H2O that has a monoclinic (C2) structure with lattice parameters, a = 29.41, b = 8.27, c = 6.31 Å, β = 90.01 ˚. Circular dichroism - optical rotatory dispersion (CD-ORD), Powder X-ray diffraction (PXRD) and Fourier transform - infrared spectroscopy (FT-IR) analyses are conducted to further characterize the crystals. Enantioselective adsorption analysis using racemic mixture of 2-butanol confirmed bis(L-histidinato)nickel(II) monohydrate MOF crystal's enantioselective property preferentially favoring the adsorption of (S)-2-butanol isomer.
Tartrazine modified activated carbon for the removal of Pb(II), Cd(II) and Cr(III).
Monser, Lotfi; Adhoum, Nafaâ
2009-01-15
A two in one attempt for the removal of tartrazine and metal ions on activated carbon has been developed. The method was based on the modification of activated carbon with tartrazine then its application for the removal of Pb(II), Cd(II) and Cr(III) ions at different pH values. Tartrazine adsorption data were modelled using both Langmuir and Freundlich classical adsorption isotherms. The adsorption capacities qm were 121.3, 67 and 56.7mgg(-1) at initial pH values of 1.0, 6.0 and 10, respectively. The adsorption of tartrazine onto activated carbon followed second-order kinetic model. The equilibrium time was found to be 240min at pH 1.0 and 120min at pH 10 for 500mgL(-1) tartrazine concentration. A maximum removal of 85% was obtained after 1h of contact time. The presence of tartrazine as modifier enhances attractive electrostatic interactions between metal ions and carbon surface. The adsorption capacity for Pb(II), Cd(II) and Cr(III) ions has been improved with respect to non-modified carbon reaching a maximum of 140%. The adsorption capacity was found to be a pH dependent for both modified and non-modified carbon with a greater adsorption at higher pH values except for Cr(III). The enhancement percent of Pb(II), Cd(II) and Cr(III) at different pH values was varied from 28% to 140% with respect to non-modified carbon. The amount of metal ions adsorbed using static regime was 11-40% higher than that with dynamic mode. The difference between adsorption capacities could be attributed to the applied flow rate.
Distinct Molecular Effects of Angiotensin II and Angiotensin III in Rat Astrocytes
Directory of Open Access Journals (Sweden)
Michelle A. Clark
2013-01-01
Full Text Available It is postulated that central effects of angiotensin (Ang II may be indirect due to rapid conversion to Ang III by aminopeptidase A (APA. Previously, we showed that Ang II and Ang III induced mitogen-activated protein (MAP kinases ERK1/2 and stress-activated protein kinase/Jun-terminal kinases (SAPK/JNK phosphorylation in cultured rat astrocytes. Most importantly, both peptides were equipotent in causing phosphorylation of these MAP kinases. In these studies, we used brainstem and cerebellum astrocytes to determine whether Ang II’s phosphorylation of these MAP kinases is due to the conversion of the peptide to Ang III. We pretreated astrocytes with 10 μM amastatin A or 100 μM glutamate phosphonate, selective APA inhibitors, prior to stimulating with either Ang II or Ang III. Both peptides were equipotent in stimulating ERK1/2 and SAPK/JNK phosphorylation. The APA inhibitors failed to prevent Ang II- and Ang III-mediated phosphorylation of the MAP kinases. Further, pretreatment of astrocytes with the APA inhibitors did not affect Ang II- or Ang III-induced astrocyte growth. These findings suggest that both peptides directly induce phosphorylation of these MAP kinases as well as induce astrocyte growth. These studies establish both peptides as biologically active with similar intracellular and physiological effects.
Effects of adolescent treatment with nicotine, harmane, or norharmane in male Sprague-Dawley rats.
Goodwin, Amy K; Lantz-McPeak, Susan M; Robinson, Bonnie L; Law, C Delbert; Ali, Syed F; Ferguson, Sherry A
2015-01-01
The initiation of tobacco use occurs most often in adolescence and may be especially detrimental as the adolescent brain is undergoing substantial development. In addition to nicotine, there are over 9000 other compounds present in tobacco products, including the β-carbolines harmane and norharmane. The present study aimed to determine the long-term effects of adolescent exposure to nicotine (NIC), harmane (HAR), or norharmane (NOR) on locomotor activity, learning and memory, anxiety-like behavior, motor coordination, and monoamine/metabolite concentrations in the striatum and nucleus accumbens of male Sprague-Dawley rats. Beginning on postnatal day (PND) 27 and continuing through PND 55, subjects received twice daily intraperitoneal injections of 1ml/kg saline (CON), 0.5mg NIC/kg, 0.5mg HAR/kg, or 0.5mg NOR/kg. Body weight, food, and water intake were measured daily (PNDs 27-96). Locomotor activity was assessed on PND 40 or 41, PND 55, and PNDs 81 and 82. Other behaviors (anxiety-like behavior, motor coordination, and spatial learning and memory) were assessed at least 25 days after drug exposure ended (PNDs 80-91). On PND 97, subjects were decapitated and the striatum and nucleus accumbens were dissected and frozen for analysis. NIC treatment significantly decreased food intake, but did not alter locomotor activity during or after treatment. HAR and NOR treatment, however, caused significant open field hypoactivity. Motor coordination, water maze performance, and concentrations of monoamines and metabolites in the striatum and nucleus accumbens were unaltered by any drug treatment. These results indicate a long-lasting effect on activity levels from adolescent HAR or NOR treatment; however, there were few long-lasting NIC effects. Given the paucity of data describing effects of HAR or NOR exposure, these data should encourage additional studies of these tobacco constituents as well as constituent combination studies. Published by Elsevier Inc.
Febriana, Sri Awalia; Jungbauer, Frank; Soebono, Hardyanto; Coenraads, Pieter-Jan
2012-07-01
Tannery workers are exposed to hazardous chemicals. Tannery work is outsourced to newly industrialized countries (NICs) where attention into occupational health hazards is limited. In this study, we investigated the skin exposure to hazardous chemicals in tannery workers and determined the prevalence of occupational skin diseases (OSDs) at tanneries in a NIC. A cross-sectional study on the observation of the working process and an inventory and risk assessment of the chemicals used. Classification of chemicals as potential sensitizers/irritants and a qualitative assessment of exposure to these chemicals. Workers were examined and interviewed using Nordic Occupational Skin Questionnaire-2002/LONG. The risk of OSDs at the investigated tanneries was mainly related to the exposure of the workers' skin to chemicals in hot and humid environmental conditions. In 472 workers, 12% reported a current OSD and 9% reported a history of OSD. In 10% of all cases, an OSD was confirmed by a dermatologist and 7.4% had an occupational contact dermatitis (OCD). We observed that personal protective equipment (PPE) used was mainly because of skin problems in the past and not as a primary protection against OSD. We observed a high frequency and prolonged exposure to many skin hazardous factors in tannery work although PPE was relatively easily available and which was generally used as a secondary preventative measure. The observed point-prevalence in this study was at the same level as that reported for other high-risk OSDs in Western countries and other tanneries in NICs. However, the observed point-prevalence in this study was lower than that reported in India and Korea. The results of our study and those of other studies at tanneries from other NICs were probably influenced by Healthy Worker Survivor Effect (HWSE).
What is Lethe hyrania (Kollar, 1844) (Lepidoptera, Nymphalidae, Satyrinae)?
Lang, Song-Yun; Lamas, Gerardo
2016-02-02
Known for a long time as "Lethe insana [sic] (Kollar, 1844)" (e.g. Fruhstorfer, 1911; D'Abrera, 1985), Lethe hyrania (Kollar, 1844) is a common, sexually-dimorphic, satyrine butterfly, found in the Sino-Himalayan region. Kollar (1844) described simultaneously both Satyrus isana and S. hyrania, as separate but closely related species, from northwestern India. Kollar (1844) spelt the name of the former in two different ways, as isana in the text (pp. 448, 449, 585), and as jsana in the legend for plate 16. Westwood (1851) maintained isana and hyrania as separate species but transferred them to the genus Debis Doubleday, whereas both Butler (1868) and Kirby (1871) assigned them to the genus Lethe Hübner, synonymizing isana under L. rohria (Fabricius). Moore (1882) was the first author to regard isana and hyrania as conspecific, the former representing the female sex and the latter the male, though he misspelt isana as "isania". Acting as First Reviser, Article 24.2 of ICZN (1999), Moore (1882) gave precedence to hyrania, thus the valid name for the species is Lethe hyrania. Later, Marshall & Nicéville (1883), Nicéville (1886), Doherty (1886), Elwes (1888), and Moore (1892) followed Moore's (1882) opinion, though afterwards Mackinnon & Nicéville (1897) argued that isana had priority over hyrania, based on "page precedence", ignoring Moore's (1882) previous action. Bingham (1905) was the first author to introduce the incorrect subsequent spelling "insana" and, apparently following Mackinnon & Nicéville (1897), also gave precedence to "insana" over hyrania. Most subsequent authors followed Bingham's (1905) error, and used Lethe "insana" for this species (for instance, Fruhstorfer, 1911; Evans, 1923, 1927; Gaede, 1931; Talbot, [1949]; Lesse, 1957; D'Abrera, 1985, 1990; Bozano, 1999). Except for Bozano (1999), who listed both hyrania and "insana" as valid species, without further comment, the name hyrania has been forgotten for over a hundred years.
Berber, Hale; Alpdogan, Güzin
2017-01-01
In this study, poly(glycidyl methacrylate-methyl methacrylate-divinylbenzene) was synthesized in the form of microspheres, and then functionalized by 2-aminobenzothiazole ligand. The sorption properties of these functionalized microspheres were investigated for separation, preconcentration and determination of Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) ions using flame atomic absorption spectrometry. The optimum pH values for quantitative sorption were 2 - 4, 5 - 8, 6 - 8, 4 - 6, 2 - 6 and 2 - 3 for Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II), respectively, and also the highest sorption capacity of the functionalized microspheres was found to be for Cu(II) with the value of 1.87 mmol g -1 . The detection limits (3σ; N = 6) obtained for the studied metals in the optimal conditions were observed in the range of 0.26 - 2.20 μg L -1 . The proposed method was successfully applied to different beverage samples for the determination of Al(III), Fe(II), Co(II), Cu(II), Cd(II) and Pb(II) ions, with the relative standard deviation of <3.7%.
Type I-II laryngeal cleft: clinical course and outcome.
Slonimsky, Guy; Carmel, Eldar; Drendel, Michael; Lipschitz, Noga; Wolf, Michael
2015-04-01
Laryngeal cleft (LC) is a rare congenital anomaly manifesting in a variety of symptoms, including swallowing disorders and aspirations, dyspnea, stridor and hoarseness. The mild forms (types I-II) may be underdiagnosed, leading to protracted symptomatology and morbidity. To evaluate the diagnostic process, clinical course, management and outcome in children with type I-II laryngeal clefts. We conducted a retrospective case analysis for the years 2005-2012 in a tertiary referral center. Seven children were reviewed: five boys and two girls ranging in age from birth to 5 years. The most common presenting symptoms were cough, aspirations and pneumonia. Evaluation procedures included fiber-optic laryngoscopy (FOL), direct laryngoscopy (DL) and videofluoroscopy. Other pathologies were seen in three children. Six children underwent successful endoscopic surgery and one child was treated conservatively. The postoperative clinical course was uneventful in most of the cases. Types I-II LC should be considered in the differential diagnosis of children presenting with protracted cough and aspirations. DL is crucial for establishing the diagnosis. Endoscopic surgery is safe and should be applied promptly when conservative measures fail.
Aportació al coneixement de l’herbari Trèmols de l’Institut Botànic de Barcelona
Directory of Open Access Journals (Sweden)
Gavioli, L.
2013-12-01
ha llevado a cabo un inventario a nivel de género de todos los volúmenes y se ha informatizado el catálogo original del herbario y el fichero taxonómico existente. También se ha elaborado un inventario preliminar del contenido de las cajas adicionales. El análisis de los 3695 especímenes revela que el herbario está formado mayoritariamente (67,1% por pliegos de intercambio obtenidos principalmente a través de la Société Helvétique pour l’Échange des Plantes y la Societat Botànica Barcelonesa. Entre los materiales estudiados se han localizado dos pliegos que consideramos interesantes desde un punto de vista taxonómico y/o nomenclatural (isótipos de Silene holzmanii Heldr. ex Boiss. y de Arenaria minutiflora Loscos. El interés principal del herbario radica, pues, en la gran diversidad de procedencias geográficas de las plantas, que hacen de esta colección uno de los primeros «herbarios europeos» de Cataluña. [ca] L’herbari BC-Trèmols fou creat durant la segona meitat del segle XIX pel químic i botànic català Frederic Trèmols i Borrell. Entre 1930 i 1960, el tècnic Antoni Marcos va fer-ne una profunda revisió. La col·lecció actual consta aproximadament d’uns 9000 plecs; està formada per 58 volums reordenats per Marcos, dos volums amb l’estructura original, quatre capses de Hieracium i 85 capses de material addicional. Fins ara s’han informatitzat 22 dels volums i les quatre capses de Hieracium (3695 espècimens, s’ha realitzat un inventari a nivell de gènere de tots els volums i s’ha informatitzat el catàleg original de l’herbari i el fitxer taxonòmic existent. També s’ha elaborat un inventari preliminar del contingut de les capses addicionals. L’anàlisi dels 3695 espècimens fa evident que l’herbari està format majoritàriament (67,1% per plecs d’intercanvi obtinguts sobretot mitjançant la Société Helvétique pour l’Échange des i la Societat Botànica Barcelonesa. Entre els materials estudiats s
Bahrami, Homayoon; Farhadi, Saeed; Siadatnasab, Firouzeh
2016-07-01
The chelating properties of diethanoldithiocarbamate (DEDC) and π-electron flow from the nitrogen atom to the sulfur atom via a plane-delocalized π-orbital system (quasi ring) was studied using a density functional theory method. The molecular structure of DEDC and its complexes with Zn(II), Cd(II), and Hg(II) were also considered. First, the geometries of this ligand and DEDC-Zn(II), DEDC-Cd(II), and DEDC-Hg(II) were optimized, and the formation energies of these complexes were then calculated based on the electronic energy, or sum of electronic energies, with the zero point energy of each species. Formation energies indicated the DEDC-Zn(II) complex as the most stable complex, and DEDC-Cd(II) as the least stable. Structural data showed that the N1-C2 π-bond was localized in the complexes rather than the ligand, and a delocalized π-bond over S7-C2-S8 was also present. The stability of DEDC-Zn(II), DEDC-Cd(II), and DEDC-Hg(II) complexes increased in the presence of the non-specific effects of the solvent (PCM model), and their relative stability did not change. There was π-electron flow or resonance along N1-C2-S7 and along S7-C2-S8 in the ligand. The π-electron flow or resonance along N1-C2-S7 was abolished when the metal interacted with sulfur atoms. Energy belonging to van der Waals interactions and non-covalent delocalization effects between the metal and sulfur atoms of the ligand was calculated for each complex. The results of nucleus-independent chemical shift (NICS) indicated a decreasing trend as Zn(II) Hg(II) for the aromaticity of the quasi-rings. Finally, by ignoring van der Waals interactions and non-covalent delocalization effects between the metal and sulfur atoms of the ligand, the relative stability of the complexes was changed as follows:[Formula: see text] Graphical Abstract Huge electronic cloud localized on Hg(II) in the Hg(II)-DEDC complex.
Colorimeter determination of Fe(II)/Fe(III) ratio in glass
International Nuclear Information System (INIS)
Baumann, E.W.; Coleman, C.J.; Karraker, D.G.; Scott, W.H.
1987-01-01
A colorimetric method has been developed to determine the Fe(II)/Fe(III) ratio in glass containing nuclear waste. Fe(II) is stabilized with pentavalent vanadium during dissolution in sulfuric and hydrofluoric acids. The chromogen is FerroZine (Hach Chemical Company), which forms a magenta complex with Fe(II). The two-step color development consists of determining the Fe(II) by adding FerroZine, followed by determining total Fe after the Fe(III) present is reduced with ascorbic acid. The method was validated by analyzing mixtures of ferrous/ferric solutions and nonferrous glass frit, and by comparison with Moessbauer spectroscopy. The effect of gamma radiation was established. The procedure is generally applicable to nonradioactive materials such as minerals and other glasses
Kim, Taek-Seung; Song, Hee Jo; Dar, Mushtaq Ahmad; Lee, Hack-Jun; Kim, Dong-Wan
2018-05-01
Magnetic metal/carbon nano-materials are attractive for pollutant adsorption and removal. In this study, ultrafine nickel/carbon nanoparticles are successfully prepared via electrical wire explosion processing in ethanol media for the elimination of pollutant organic dyes such as Rhodamine B and methylene blue in aqueous solutions. High specific surface areas originating from both the nano-sized particles and the existence of carbon on the surface of Ni nanoparticles enhance dye adsorption capacity. In addition to this, the excellent dispersity of Ni/C nanoparticles in aqueous dye solutions leads to superior adsorption rates. The adsorption kinetics for the removal of organic dyes by Ni/C nanoparticles agree with a pseudo-second-order model and follow Freundlich adsorption isotherm behavior.
DEFF Research Database (Denmark)
Draper, Elizabeth S; Zeitlin, Jennifer; Fenton, Alan C
2008-01-01
OBJECTIVE: To investigate the variation in the survival rate and the mortality rates for very preterm infants across Europe. DESIGN: A prospective birth cohort of very preterm infants for ten geographically defined European regions during 2003 followed to discharge home from hospital. PARTICIPANTS...... to directly compare international statistics for mortality in very preterm infants, data collection needs to be standardised. We believe that the standard point of comparison should be using all those infants alive at the onset of labour as the denominator for comparisons of mortality rates for very preterm...... for NIC. For babies rates to discharge from NIC for very preterm deliveries and in the timing of death across the MOSAIC regions. In order...
Event building in an intelligent network interface card for the LHCb readout network
Dufey, J P; Neufeld, N; Zuin, M
2001-01-01
LHCb is an experiment being constructed at CERN's LHC accelerator for the purpose of studying precisely the CP violation parameters in the B-B system. Triggering poses special problems since the interesting events containing B-mesons are immersed in a large background of inelastic p-p reactions. Therefore, a 4 Level Triggering scheme (Level 0 to Level 3) has been implemented. Powerful embedded processors, used in modern intelligent Network Interface Cards (smart NICs), make it attractive to use them to handle the event building protocol in the high-speed data acquisition system of the LHCb experiment. The implementation of an event building algorithm developed for a specific Gigabit Ethernet NIC is presented and performance data are discussed. 5 Refs.
Energy Technology Data Exchange (ETDEWEB)
Syuhada, Ibnu, E-mail: ibnu-syuhada-p3@yahoo.com; Rosikhin, Ahmad, E-mail: aulia-fikri-h@yahoo.co.id; Fikri, Aulia, E-mail: a.rosikhin86@yahoo.co.id; Noor, Fatimah A., E-mail: fatimah@fi.itb.ac.id; Winata, Toto, E-mail: toto@fi.itb.ac.id [Departement of Physics, Institute of Technology Bandung, Tamansari 64 Street, East Java (Indonesia)
2016-02-08
In this study, atomic simulation for graphene growth on Ni (100) at initial stage via chemical vapor deposition method has been developed. The C-C atoms interaction was performed by Terasoff potential mean while Ni-Ni interaction was specified by EAM (Embedded Atom Modified). On the other hand, we used very simple interatomic potential to describe Ni-C interaction during deposition process. From this simulation, it shows that the formation of graphene is not occurs through a combined deposition mechanism on Ni substrate but via C segregation. It means, Ni-C amorphous is source for graphene growth when cooling down of Ni substrate. This result is appropriate with experiments, tight binding and quantum mechanics simulation.
Remote direct memory access over datagrams
Grant, Ryan Eric; Rashti, Mohammad Javad; Balaji, Pavan; Afsahi, Ahmad
2014-12-02
A communication stack for providing remote direct memory access (RDMA) over a datagram network is disclosed. The communication stack has a user level interface configured to accept datagram related input and communicate with an RDMA enabled network interface card (NIC) via an NIC driver. The communication stack also has an RDMA protocol layer configured to supply one or more data transfer primitives for the datagram related input of the user level. The communication stack further has a direct data placement (DDP) layer configured to transfer the datagram related input from a user storage to a transport layer based on the one or more data transfer primitives by way of a lower layer protocol (LLP) over the datagram network.
Identification of type II and type III pyoverdine receptors from Pseudomonas aeruginosa.
de Chial, Magaly; Ghysels, Bart; Beatson, Scott A; Geoffroy, Valérie; Meyer, Jean Marie; Pattery, Theresa; Baysse, Christine; Chablain, Patrice; Parsons, Yasmin N; Winstanley, Craig; Cordwell, Stuart J; Cornelis, Pierre
2003-04-01
Pseudomonas aeruginosa produces, under conditions of iron limitation, a high-affinity siderophore, pyoverdine (PVD), which is recognized at the level of the outer membrane by a specific TonB-dependent receptor, FpvA. So far, for P. aeruginosa, three different PVDs, differing in their peptide chain, have been described (types I-III), but only the FpvA receptor for type I is known. Two PVD-producing P. aeruginosa strains, one type II and one type III, were mutagenized by a mini-TnphoA3 transposon. In each case, one mutant unable to grow in the presence of the strong iron chelator ethylenediaminedihydroxyphenylacetic acid (EDDHA) and the cognate PVD was selected. The first mutant, which had an insertion in the pvdE gene, upstream of fpvA, was unable to take up type II PVD and showed resistance to pyocin S3, which is known to use type II FpvA as receptor. The second mutant was unable to take up type III PVD and had the transposon insertion in fpvA. Cosmid libraries of the respective type II and type III PVD wild-type strains were constructed and screened for clones restoring the capacity to grow in the presence of PVD. From the respective complementing genomic fragments, type II and type III fpvA sequences were determined. When in trans, type II and type III fpvA restored PVD production, uptake, growth in the presence of EDDHA and, in the case of type II fpvA, pyocin S3 sensitivity. Complementation of fpvA mutants obtained by allelic exchange was achieved by the presence of cognate fpvA in trans. All three receptors posses an N-terminal extension of about 70 amino acids, similar to FecA of Escherichia coli, but only FpvAI has a TAT export sequence at its N-terminal end.
Roberts, Linda C; Hug, Stephan J; Ruettimann, Thomas; Billah, Morsaline; Khan, Abdul Wahab; Rahman, Mohammad Tariqur
2004-01-01
Arsenic removal by passive treatment, in which naturally present Fe(II) is oxidized by aeration and the forming iron(III) (hydr)oxides precipitate with adsorbed arsenic, is the simplest conceivable water treatment option. However, competing anions and low iron concentrations often require additional iron. Application of Fe(II) instead of the usually applied Fe(III) is shown to be advantageous, as oxidation of Fe(II) by dissolved oxygen causes partial oxidation of As(III) and iron(III) (hydr)oxides formed from Fe(II) have higher sorption capacities. In simulated groundwater (8.2 mM HCO3(-), 2.5 mM Ca2+, 1.6 mM Mg2+, 30 mg/L Si, 3 mg/L P, 500 ppb As(III), or As(V), pH 7.0 +/- 0.1), addition of Fe(II) clearly leads to better As removal than Fe(III). Multiple additions of Fe(II) further improved the removal of As(II). A competitive coprecipitation model that considers As(III) oxidation explains the observed results and allows the estimation of arsenic removal under different conditions. Lowering 500 microg/L As(III) to below 50 microg/L As(tot) in filtered water required > 80 mg/L Fe(III), 50-55 mg/L Fe(II) in one single addition, and 20-25 mg/L in multiple additions. With As(V), 10-12 mg/L Fe(II) and 15-18 mg/L Fe(III) was required. In the absence of Si and P, removal efficiencies for Fe(II) and Fe(III) were similar: 30-40 mg/L was required for As(II), and 2.0-2.5 mg/L was required for As(V). In a field study with 22 tubewells in Bangladesh, passive treatment efficiently removed phosphate, but iron contents were generally too low for efficient arsenic removal.
Chen, Zhongxue; Yuan, Tianci; Pu, Xiangjun; Yang, Hanxi; Ai, Xinping; Xia, Yongyao; Cao, Yuliang
2018-04-11
Batteries and electrochemical capacitors play very important roles in the portable electronic devices and electric vehicles and have shown promising potential for large-scale energy storage applications. However, batteries or capacitors alone cannot meet the energy and power density requirements because rechargeable batteries have a poor power property, whereas supercapacitors offer limited capacity. Here, a novel symmetric sodium-ion capacitor (NIC) is developed based on low-cost Na 0.44 MnO 2 nanorods. The Na 0.44 MnO 2 with unique nanoarchitectures and iso-oriented feature offers shortened diffusion path lengths for both electronic and Na + transport and reduces the stress associated with Na + insertion and extraction. Benefiting from these merits, the symmetric device achieves a high power density of 2432.7 W kg -1 , an improved energy density of 27.9 Wh kg -1 , and a capacitance retention of 85.2% over 5000 cycles. Particularly, the symmetric NIC based on Na 0.44 MnO 2 permits repeatedly reverse-polarity characteristics, thus simplifying energy management system and greatly enhancing the safety under abuse condition. This cost-effective, high-safety, and high-performance symmetric NIC can balance the energy and power density between batteries and capacitors and serve as an electric power source for future low-maintenance large-scale energy storage systems.
Intervenções de enfermagem em pediatria: contribuição para a mensuração da carga de trabalho
Directory of Open Access Journals (Sweden)
Melissa Nardini de Assis
2015-12-01
Full Text Available RESUMO Objetivo Identificar e validar as intervenções/atividades desenvolvidas pela equipe de enfermagem em unidade pediátrica. Método Pesquisa descritiva, transversal, observacional, desenvolvida na Clínica Pediátrica do Hospital Universitário da Universidade de São Paulo, São Paulo, Brasil, organizada nas etapas: identificação das atividades realizadas pela equipe (registros em prontuários e observação direta; mapeamento e validação das atividades identificadas em intervenções, segundo a Nursing Intervention Classification (NIC. Resultados As 275 atividades identificadas foram mapeadas em 63 intervenções, 22 classes e sete domínios da NIC, 25 atividades associadas e 13 pessoais. Após validação, o número de atividades passou para 244, correspondendo a 53 intervenções, 20 classes e seis domínios da NIC, 30 atividades associadase nove pessoais. Conclusão A identificação das intervenções/atividades executadas pela equipe de enfermagem favorece a mensuração da carga de trabalho, constituindo importante contribuição para a superação das dificuldades relacionadas à operacionalização do processo de dimensionamento de profissionais na área de pediatria.
Determination of Cu(III) and Cu(II)+Cu(III) in superconducting copper ceramics
International Nuclear Information System (INIS)
Nedelcheva, T.; Kostadinova, L.; Stoyanova-Ivanova, A.; Ivanova, I.
1992-01-01
Copper(III) and total copper in superconducting Y-Ba-Cu oxide and related compounds can be determinated by two successive iodimetric titrations after the sample has been dissolved under Ar in HCl/KI medium. First, the iodine equivalent to copper(III) is titrated with Na 2 S 2 O 3 solution at pH 4.8, copper(II) being masked with EDTA. The total copper is then determined in the same solution by demasking with acid and iodide, followed by iodimetric titration. The method is both accurate and reproducible. The relative standard deviations for 1.074% copper(III) and 23.37% total copper are 0.8% and 0.3%, respectively. (orig.)
Dicty_cDB: FC-IC0242 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available *fshvqml*mr*lveisl kekarlkclmm*llihswrf*nic Translated Amino Acid sequence (All Frames) Frame A: tnstsyatsr*...gfftlvc*itlirmtnfkrqlhwqrvsassi*qvlvrmcwvvmki*i hrlals*mtnwvklvksysllkrfylifnsslkadqflhikh*fshvqml*mr*lveisl kekarlkclmm
THE ADSORPTION OF Pb(II AND Cr(III BY POLYPROPYLCALIX[4]ARENE POLYMER
Directory of Open Access Journals (Sweden)
Suryadi Budi Utomo
2010-06-01
Full Text Available A research has been conducted to investigate the adsorption behavior of Pb(II and Cr(III onto polypropylcalix[4]arene polymer. The polypropylcalix[4]arene polymer was synthesized in the presence of H2SO4 catalyst and chloroform under N2 condition for 5 h using 25-allyloxy-26,27,28-trihydroxycalyx[4]arene as the precursor. The Polymer was obtained as yellow crystal with melting point of 288-290 °C and its relative molecular weight was 44.810 g.mol-1. The application of polypropylcalix[4]arene for trapping heavy metal cations and its adsorption model were examined by stirring the suspension of the calixarene in the sample solutions for various pH, time, and concentration of Pb(II and Cr(III solution. Effect of pH on batch experiments for the mentioned ions indicated that the optimum pH for metal binding were 5 for lead(II and chromium(III. The adsorption model of metal ions on polypropylcalix[4]arene followed both the pseudo second order adsorption of Ho's and Langmuir isotherm adsorption kinetics models with rate constant (k were 6.81 x 101 min-1 for Pb(II and 2.64 x 10-2 min-1 for Cr(III. The adsorption equilibrium constant, K, were 5.84 x 105 L.mol-1 for Pb(II and 4.66 x 105 L.mol-1 for Cr(III. The maximum adsorption capacity of polypropylcalix[4]arene to Pb(II and Cr(III were 16.31 and 18.14 mg.g-1 with adsorption energy of 32.90 and 32.34 kJ.mol-1, respectively. Keywords: polypropylcalix[4]arene, adsorption, Pb(II, and Cr(III
Biosorption kinetics of Cd (II, Cr (III and Pb (II in aqueous solutions by olive stone
Directory of Open Access Journals (Sweden)
M. Calero
2009-06-01
Full Text Available A by-product from olive oil production, olive stone, was investigated for the removal of Cd (II, Cr (III and Pb (II from aqueous solutions. The kinetics of biosorption are studied, analyzing the effect of the initial concentration of metal and temperature. Pseudo-first-order, pseudo-second-order, Elovich and intraparticle diffusion models have been used to represent the kinetics of the process and obtain the main kinetic parameters. The results show that the pseudo-second order model is the one that best describes the biosorption of the three metal ions for all the range of experimental conditions investigated. For the three metal ions, the maximum biosoption capacity and the initial biosorption rate increase when the initial metal concentration rises. However, the kinetic constant decreases when the initial metal concentration increases. The temperature effect on biosorption capacity for Cd (II and Cr (III is less significant; however, for Pb (II the effect of temperature is more important, especially when temperature rises from 25 to 40ºC. The biosorption capacity at mmol/g of olive stone changes in the following order: Cr>Cd>Pb. Thus, for an initial concentration of 220 mg/ℓ, a maximum sorption capacity of 0.079 mmol/g for Cr (III, 0.065 mmol/g for Cd (II and 0.028 mmol/g for Pb (II has been obtained.
Khaledi, Hamid; Olmstead, Marilyn M; Ali, Hapipah Mohd; Thomas, Noel F
2013-02-18
A new dibenzotetraaza[14]annulene bearing two 3,3-dimethylindolenine fragments at the meso positions (LH(2)), has been synthesized through a nontemplate method. X-ray crystallography shows that the whole molecule is planar. The basicity of the indolenine ring permits the macrocycle to be protonated external to the core and form LH(4)(2+)·2Cl(-). Yet another structural modification having strong C-H···π interactions was found in the chloroform solvate of LH(2). The latter two modifications are accompanied by a degree of nonplanar distortion. The antiaromatic core of the macrocycle can accommodate a number of metal ions, Mn(III), Fe(III), Co(II), Ni(II) and Cu(II), to form complexes of [Mn(L)Br], [Mn(L)Cl], [Fe(LH(2))Cl(2)](+)·Cl(-), [Co(L)], [Ni(L)], and [Cu(L)]. In addition, the reaction of LH(2) with the larger Pd(II) ion leads to the formation of [Pd(2)(LH(2))(2)(OAc)(4)] wherein the macrocycle acts as a semiflexible ditopic ligand to coordinate pairs of metal ions via its indolenine N atoms into dinuclear metallocycles. The compounds LH(2), [Co(L)], and [Ni(L)] are isostructural and feature close π-stacking as well as linear chain arrangements in the case of the metal complexes. Variable temperature magnetic susceptibility measurements showed thermally induced paramagnetism in [Ni(L)].
Apolipoprotein C-II and C-III metabolism in a kindred of familial hypobetalipoproteinemia
International Nuclear Information System (INIS)
Malmendier, C.L.; Delcroix, C.; Lontie, J.F.; Dubois, D.Y.
1991-01-01
Three affected members of a kindred with asymptomatic hypobetalipoproteinemia (HBL) showed low levels of triglycerides, low-density lipoprotein (LDL)-cholesterol, and apolipoproteins (apo) B, C-II, and C-III. Turnover of iodine-labeled apo C-II and apo C-III associated in vitro to plasma lipoproteins was studied after intravenous injection. Radioactivity in plasma and lipoproteins (95% recovered in high-density lipoprotein [HDL] density range) and in 24-hour urine samples was observed for 16 days. A parallelism of the slowest slopes of plasma decay curves was observed between apo C-II and apo C-III, indicating a partial common catabolic route. Urine/plasma radioactivity ratio (U/P) varied with time, suggesting heterogeneity of metabolic pathways. A new compartmental model using the SAAM program was built, not only fitting simultaneously plasma and urine data, but also taking into account the partial common metabolism of lipoprotein particles (LP) containing apo C-II and apo C-III. The low apo C-II and C-III plasma concentrations observed in HBL compared with normal resulted from both an increased catabolism and a reduced synthesis, these changes being more marked for apo C-III. The modifications in the rate constants of the different pathways calculated from the new model are in favor of an increased direct removal of particles following the fast pathway, likely in the very-low-density lipoprotein (VLDL) density range
Proton Beam Therapy of Stage II and III Non–Small-Cell Lung Cancer
International Nuclear Information System (INIS)
Nakayama, Hidetsugu; Satoh, Hiroaki; Sugahara, Shinji; Kurishima, Koichi; Tsuboi, Koji; Sakurai, Hideyuki; Ishikawa, Shigemi; Tokuuye, Koichi
2011-01-01
Purpose: The present retrospective study assessed the role of proton beam therapy (PBT) in the treatment of patients with Stage II or III non–small-cell lung cancer who were inoperable or ineligible for chemotherapy because of co-existing disease or refusal. Patients and Methods: Between November 2001 and July 2008, PBT was given to 35 patients (5 patients with Stage II, 12 with Stage IIIA, and 18 with Stage IIIB) whose median age was 70.3 years (range, 47.4–85.4). The median proton dose given was 78.3 Gy (range, 67.1–91.3) (relative biologic effectiveness). Results: Local progression-free survival for Stage II-III patients was 93.3% at 1 year and 65.9% at 2 years during a median observation period of 16.9 months. Four patients (11.4%) developed local recurrence, 13 (37.1%) developed regional recurrence, and 7 (20.0%) developed distant metastases. The progression-free survival rate for Stage II-III patients was 59.6% at 1 year and 29.2% at 2 years. The overall survival rate of Stage II-III patients was 81.8% at 1 year and 58.9% at 2 years. Grade 3 or greater toxicity was not observed. A total of 15 patients (42.9%) developed Grade 1 and 6 (17.1%) Grade 2 toxicity. Conclusion: PBT for Stage II-III non–small-cell lung cancer without chemotherapy resulted in good local control and low toxicity. PBT has a definite role in the treatment of patients with Stage II-III non–small-cell lung cancer who are unsuitable for surgery or chemotherapy.
Proton Beam Therapy of Stage II and III Non-Small-Cell Lung Cancer
Energy Technology Data Exchange (ETDEWEB)
Nakayama, Hidetsugu, E-mail: hnakayam@tokyo-med.ac.jp [Proton Medical Research Center, University of Tsukuba Graduate School of Comprehensive Human Sciences, Tsukuba, Ibaraki (Japan); Department of Radiation Oncology, Tokyo Medical University, Shinjuku, Tokyo (Japan); Satoh, Hiroaki [Department of Respiratory Medicine, University of Tsukuba Graduate School of Comprehensive Human Sciences, Tsukuba, Ibaraki (Japan); Sugahara, Shinji [Proton Medical Research Center, University of Tsukuba Graduate School of Comprehensive Human Sciences, Tsukuba, Ibaraki (Japan); Department of Radiation Oncology, Tokyo Medical University, Shinjuku, Tokyo (Japan); Kurishima, Koichi [Department of Respiratory Medicine, University of Tsukuba Graduate School of Comprehensive Human Sciences, Tsukuba, Ibaraki (Japan); Tsuboi, Koji; Sakurai, Hideyuki [Proton Medical Research Center, University of Tsukuba Graduate School of Comprehensive Human Sciences, Tsukuba, Ibaraki (Japan); Ishikawa, Shigemi [Department of Thoracic Surgery, University of Tsukuba Graduate School of Comprehensive Human Sciences, Tsukuba, Ibaraki (Japan); Tokuuye, Koichi [Proton Medical Research Center, University of Tsukuba Graduate School of Comprehensive Human Sciences, Tsukuba, Ibaraki (Japan); Department of Radiation Oncology, Tokyo Medical University, Shinjuku, Tokyo (Japan)
2011-11-15
Purpose: The present retrospective study assessed the role of proton beam therapy (PBT) in the treatment of patients with Stage II or III non-small-cell lung cancer who were inoperable or ineligible for chemotherapy because of co-existing disease or refusal. Patients and Methods: Between November 2001 and July 2008, PBT was given to 35 patients (5 patients with Stage II, 12 with Stage IIIA, and 18 with Stage IIIB) whose median age was 70.3 years (range, 47.4-85.4). The median proton dose given was 78.3 Gy (range, 67.1-91.3) (relative biologic effectiveness). Results: Local progression-free survival for Stage II-III patients was 93.3% at 1 year and 65.9% at 2 years during a median observation period of 16.9 months. Four patients (11.4%) developed local recurrence, 13 (37.1%) developed regional recurrence, and 7 (20.0%) developed distant metastases. The progression-free survival rate for Stage II-III patients was 59.6% at 1 year and 29.2% at 2 years. The overall survival rate of Stage II-III patients was 81.8% at 1 year and 58.9% at 2 years. Grade 3 or greater toxicity was not observed. A total of 15 patients (42.9%) developed Grade 1 and 6 (17.1%) Grade 2 toxicity. Conclusion: PBT for Stage II-III non-small-cell lung cancer without chemotherapy resulted in good local control and low toxicity. PBT has a definite role in the treatment of patients with Stage II-III non-small-cell lung cancer who are unsuitable for surgery or chemotherapy.
International Nuclear Information System (INIS)
Sunarhadijoso Soenarjo; Swasono R Tamat; Lukiyawati; Lintang Maharani
2002-01-01
The potency of production and application of 111 In in Indonesia is not supported yet by capability in required processing technology. The presented paper is a preliminary study on processing technology of 111 In production from 112 Cd target covering simulated target preparation and separation of Cd(II)-In(III) matrices. The target preparation was performed by means of electroplating of CdSO 4 solution prepared from reaction of CdO and sulphuric acid. The separation of Cd(II)-In(III) matrices was proceeded by means of solvent extraction in the presence of 8-hydroxyquinoline as In(III)-complexing agent. The Cd-electroplating deposit was satisfactorily found by using 40-60 mA currents with an electroplating time of 5-7 hours. Simulated matrix solution containing mixture of Cd(II) and In(III) was extracted into chloroform with the presence of 8-hydroxyquinoline. The chloroform phase being assumed to contain In(III)-8-hydroxyquinoline complex was then re-extracted with 1 M HCl or saline solution. Each extraction fraction was spectrophotometrically identified in the region of 200-400 nm. From the resulting absorption spectra, it can be shown that the In(III) species is selectively separated from the Cd(II)-matrix. The use of saline in the re-extraction process is better then 1 M HCl solution due to solubility of 8-hydroxyquinoline in HCl. (author)
International Nuclear Information System (INIS)
Khojali, Inas Osman
1999-04-01
Two hydrazones were synthesised, namely salicylhyrazone (SH) and trihydroxyacetophenone (THAPH) were synthesised with the objective of developing a method for determining of Fe(II) and Fe(III) in the presence of each other and hence the total iron.those hydrazones were selected so as to combine the ability of phenolic compounds to complex Fe(III) ions and the complexing characteristics of hydrazones. The complexes of Fe(II) S H and Fe(III) S H as well those of Fe(II)-THAPH and Fe(III)-THAPH had shown maximum absorbance at λ=412 nm which was not not modified by presence of micelles i.e. sodium n-dodecyl sulphate (SDS) and n-hexa dodecyl pyridinium bromide. The maximum absorbance for all complexes takes place around a neutral pH. Generally, in addition, of n-hexa dodecylpyridinium bromide to fe(II)-SH and Fe(III)-SH absorbance of the complexes increases with increasing the concentration of the micelle. The effects of the addition of sodium n-dodecyle sulphate (SDS) to Fe(III)-SH is also studied. Generally, increasing the concentration of the micelle decrease the absorbance of the complexes. To study the effect of the presence of Fe(II) and Fe(III) on the determination of each other,mixtures of Fe(II)-SH and Fe(III)-SH are studied. However, the use of ascorbic acid as a reducing reagent for Fe(III) did not produce the needed results but non reducible results, which may be due to the masking effect of ascorbic acid and thus making the metal not available to the ligand. However, conversion of Fe(II) to Fe(III) prior to the determination was avoided as this requires the use of oxidant, which will oxidise the ligand as well. To establish the condition for the maximum absorbance of THAPH complexes, the effect of the base was investigated by using sodium and ammonium hydroxide. Generally, increasing the concentration of the base decreases the abosrbance. as expected, ammonium hydroxide produced positive results than sodium hydroxide. After establishing the optimum Fi
Incremental binding free energies of aluminum (III) vs. magnesium (II) complexes
International Nuclear Information System (INIS)
Mercero, Jose M.; Mujika, Jon I.; Matxain, Jon M.; Lopez, Xabier; Ugalde, Jesus M.
2003-01-01
A sequential ligand addition to the aluminum (III) cation has been studied using the B3LYP functional and a combined all-electron/pseudopotentials basis set. The aluminum complexes are compared with analogous magnesium (II) complexes. Different thermodynamical data, such as incremental binding energies, enthalpies, entropies and free energies, are presented for these addition reactions. While the magnesium (II) cation can only accommodate three negatively charged ligands, aluminum (III) accommodates four even after including bulk solvent effects. The main differences between both cations complexing with the neutral ligands, is that aluminum (III) is not able to form complexes with methanol until the number of methanol ligands is equal to 3. Magnesium (II) prefers to bind methanol and formamide when the number of ligands is small, while aluminum prefers formamide. For the largest complexes both cations prefer to bind water
Ultra High Mode Mix in NIF NIC Implosions
Scott, Robbie; Garbett, Warren
2017-10-01
This work re-examines a sub-set of the low adiabat implosions from the National Ignition Campaign in an effort to better understand potential phenomenological sources of `excess' mix observed experimentally. An extensive effort has been made to match both shock-timing and backlit radiography (Con-A) implosion data in an effort to reproduce the experimental conditions as accurately as possible. Notably a 30% reduction in ablation pressure at peak drive is required to match the experimental data. The reduced ablation pressure required to match the experimental data allows the ablator to decompress, in turn causing the DT ice-ablator interface to go Rayleigh-Taylor unstable early in the implosion acceleration phase. Post-processing the runs with various mix models indicates high-mode mix from the DT ice-ablator interface may penetrate deep into the hotspot. This work offers a potential explanation of why these low-adiabat implosions exhibited significantly higher levels of mix than expected from high-fidelity multi-dimensional simulations. Through this new understanding, a possible route forward for low-adiabat implosions on NIF is suggested.
International Nuclear Information System (INIS)
Wilcox, B.E.; Deutsch, E.
1991-01-01
The redox properties of a series of technetium(III/II) complexes of the general formula cis(X), trans(P)-[Tc III/II X 2 (PR w R') 2 L] 10+ , where X = Cl or Br, PR 2 R' = dimethylphenylphosphine or ethyldiphenylphosphine, and L = 2,2'-bipyridine (bpy), 4,4'-dimethyl-2,2'-bipyridine (Me 2 bpy), or 1,10-phenanthroline (phen), were investigated in 0.1 M TEAP/acetonitrile by cyclic voltammetry at a platinum-disk electrode. These complexes exhibit diffusion-controlled, 1-equiv Tc(IV)/Tc(III) redox couples and also Tc(III)/Tc(II) redox couples. Spectropotentiostatic experiments on three complexes of this class in 0.5 M TEAP/DMF confirm the 1-equiv character of the Tc(III)/Tc(II) couple. The electrochemical behavior of Tc(II) complexes of the general formula trans(P)-[TcX(PR 2 R') 2 terpy] + , terpy = 2,2':6',2 double-prime-terpyridine, was also investigated under the same conditions as above. These complexes exhibit diffusion-controlled, 1-equiv Tc(III)/Tc(II) redox couples and Tc(II)/Tc(I) redox couples. Spectropotentiostatic experiments on trans(P)-[TcCl(PMe 2 Ph) 2 terpy] + confirm the 1-equiv character of the Tc(III)/Tc(II) couple but show that the Tc(II)/Tc(I) couple is not reversible on the spectropotentiostatic time scale
Directory of Open Access Journals (Sweden)
André Luís Ferreira Santos
2003-08-01
Full Text Available Para avaliar o desempenho da colpocitologia (CO de encaminhamento e daquela coletada no serviço de referência, com revisão por diferentes técnicas e observadores, e da captura híbrida II (CH II no diagnóstico da neoplasia intra-epitelial cervical (NIC de alto grau, foram incluídas 105 mulheres atendidas entre agosto de 2000 e junho de 2001 por atipias pré-neoplásicas na CO. Todas foram submetidas à coleta de nova CO e CH II para detecção do DNA-HPV. Foi realizada biópsia cervical em 91, sendo o diagnóstico histológico considerado padrão ouro. Foram descritas a sensibilidade, especificidade e razão de verossimilhança positiva (RVP dos métodos propedêuticos com intervalo de confiança de 95% (IC95%. A sensibilidade e especificidade da CO de encaminhamento foi de 57% e 82% para o diagnóstico de NIC 2 e 3, e a RVP de 3,2 (IC95%: 1,5-6,8. A CO do serviço mostrou uma sensibilidade e especificidade 79% e 84%, respectivamente e RVP de 5,0 (IC95%: 2,5-10,0. A sensibilidade (86%, especificidade (80% e RVP (4,3 foram semelhantes com a revisão lenta realizada pelo segundo observador, havendo uma queda significativa da sensibilidade (64% à revisão rápida pelo terceiro observador. A CH II mostrou alta sensibilidade (100%, baixa especificidade (43% e baixa RVP (1,7, IC95%: 1,4-2,2.To evaluate the performance of initial cervical cytology and that collected at the reference service with a review conducted by different observers and techniques, as well as hybrid capture II, in the diagnosis of high-grade cervical intraepithelial neoplasia (CIN, 105 women attended from August 2000 to June 2001 for preneoplastic atypia upon cervical cytology were included. A new cervical cytology and hybrid capture II for DNA-HPV were conducted in all the patients. Cervical biopsies were taken in 91 women. Performance of the investigative procedures was described by estimating the sensitivity, specificity, and positive likelihood ratio (PLR, with a 95
Patterns of Pelvic Radiotherapy in Patients with Stage II/III Rectal Cancer
International Nuclear Information System (INIS)
Fitzgerald, T. L.; Zervos, E.; Wong, J. H.; Fitzgerald, T. L.; Zervos, E.; Wong, J. H.; Fitzgerald, T. L.; Zervos, E.; Wong, J. H.
2013-01-01
High-level evidence supports adjuvant radiotherapy for rectal cancer. We examined the influence of socio demographic factors on patterns of adjuvant radiotherapy for resected Stage II/III rectal cancer. Methods. Patients undergoing surgical resection for stage II/III rectal cancer were identified in SEER registry. Results. A total of 21,683 patients were identified. Majority of patients were male (58.8%), white (83%), and with stage III (54.9%) and received radiotherapy (66%). On univariate analysis, male gender, stage III, younger age, year of diagnosis, and higher socioeconomic status (SES) were associated with radiotherapy. Radiotherapy was delivered in 84.4% of patients <50; however, only 32.8% of those are >80 years. Logistic regression demonstrated a significant increase in the use of radiotherapy in younger patients who are 50 (OR, 10.3), with stage III (OR, 1.21), males (OR, 1.18), and with higher SES. Conclusions. There is a failure to conform to standard adjuvant radiotherapy in one-third of patients, and this is associated with older age, stage II, area-level of socioeconomic deprivation, and female sex.
Supporting breast-feeding when a woman is homeless.
Crespo-Fierro, Michele; Lunney, Margaret
2011-01-01
This case study demonstrates use of standardized nursing languages in the care of new mothers in community settings. The author collected data from clinical practice as an instructor in a baccalaureate nursing program and from the research literature. The appropriate nursing diagnoses, outcomes, and interventions were identified in partnership with the new mother. This case shows that NANDA International (NANDA-I), the Nursing Outcomes Classification (NOC), and the Nursing Interventions Classification (NIC) are useful to direct nursing care in community settings. When teaching nursing students in a baccalaureate program, nurse faculty can use NANDA-I, NOC, and NIC classifications to guide the growing practice of nursing students in community settings. © 2011, The Authors. International Journal of Nursing Terminologies and Classifications © 2011, NANDA International.
LLE 2010 Annual Report October 2009 - September 2010
Energy Technology Data Exchange (ETDEWEB)
None
2011-01-01
The fiscal year ending September 2010 (FY10) concluded the third year of the third five-year renewal of Cooperative Agreement DE-FC52-08NA28302 with the U.S. Department of Energy (DOE). This annual report summarizes progress in inertial fusion research at the Laboratory for Laser Energetics (LLE) during the past fiscal year including work on the National Ignition Campaign (NIC). It also reports on LLE's progress on laboratory basic science research; laser, optical materials, and advanced technology development; operation of OMEGA and OMEGA EP for the NIC and high-energy density (HED) campaigns, the National Laser Users Facility (NLUF), and for other external users; and programs focusing on the education of high school, undergraduate, and graduate students during the year.
International Nuclear Information System (INIS)
Chumakov, Yu. M.; Tsapkov, V. I.; Bocelli, G.; Antosyak, B. Ya.; Shova, S. G.; Gulea, A. P.
2006-01-01
The crystal structures of salicylideneguanylhydrazinium chloride hydrate hemiethanol solvate (I), salicylideneguanylhydrazinium trichloroaquacuprate(II) (II), and bis(salicylideneguanylhydrazino)cobalt(III) chloride trihydrate (III) are determined using X-ray diffraction. The structures of compounds I, II, and III are solved by direct methods and refined using the least-squares procedure in the anisotropic approximation for the non-hydrogen atoms to the final factors R = 0.0597, 0.0212, and 0.0283, respectively. In the structure of compound I, the monoprotonated molecules and chlorine ions linked by hydrogen bonds form layers aligned parallel to the (010) plane. In the structure of compound II, the salicylaldehyde guanylhydrazone cations and polymer chains consisting of trichloroaquacuprate(II) anions are joined by an extended three-dimensional network of hydrogen bonds. In the structure of compound III, the [Co(LH) 2 ] + cations, chloride ions, and molecules of crystallization water are linked together by a similar network
2010-08-26
..., supervisors must possess effective communication skills and the ability to enhance internal motivation. They... in blue ink. Authority: Public Law 93-415. Funds Available: NIC is seeking the applicant's best ideas...
Fe(II)/Fe(III)-Catalyzed Intramolecular Didehydro-Diels-Alder Reaction of Styrene-ynes.
Mun, Hyeon Jin; Seong, Eun Young; Ahn, Kwang-Hyun; Kang, Eun Joo
2018-02-02
The intramolecular didehydro-Diels-Alder reaction of styrene-ynes was catalyzed by Fe(II) and Fe(III) to produce various naphthalene derivatives under microwave heating conditions. Mechanistic calculations found that the Fe(II) catalyst activates the styrenyl diene in an inverse-electron-demand Diels-Alder reaction, and the consecutive dehydrogenation reaction can be promoted by either Fe(II)-catalyzed direct dehydrogenation or an Fe(III)-catalyzed rearomatization/dehydrogenation pathway.
Immunochemical studies of Lolium perenne (rye grass) pollen allergens, Lol p I, II, and III.
Ansari, A A; Kihara, T K; Marsh, D G
1987-12-15
It was reported earlier that human immune responses to three perennial rye grass (Lolium perenne) pollen allergens, Lol p I, II, and III, are associated with histocompatibility leukocyte antigen (HLA)-DR3. Rye-allergic people are often concordantly sensitive to all three of these allergens. Since earlier studies suggested that these antigens are non-cross-reactive, their immunologic relatedness by double antibody radioimmunoassay (DARIA) was studied in order to understand further the immunochemical basis for the concordant recognition of the three allergens. Direct binding DARIA studies were performed with human sera from 189 allergic subjects. Inhibition DARIA studies were carried out with 17 human sera from grass-allergic patients who were on grass immunotherapy, one goat anti-serum, and six rabbit antisera. None of the sera detected any significant degree of two-way cross-reactivity between Lol p I and II, or between Lol p I and III. However, the degree of two-way cross-reactivity between Lol p II and III exhibited by individual human and animal antisera varied between undetectable and 100%. In general, the degree of cross-reactivity between Lol p II and III was higher among human sera than among animal sera. Taken together with earlier findings that antibody responses to Lol p I, II and III are associated with HLA-HDR3, and that most Lol p II and III responders are also Lol p I responders, but not vice versa, our present results suggest the following: the HLA-DR3-encoded Ia molecule recognizes a similar immunodominant Ia recognition site (agretope) shared between Lol p I and Lol p II and/or III; in addition, Lol p I appears to contain unique Ia recognition site(s) not present in Lol p II and III. However, further epitope analyses are required to investigate these possibilities.
Longhurst, H J; Zanichelli, A; Caballero, T; Bouillet, L; Aberer, W; Maurer, M; Fain, O; Fabien, V; Andresen, I
2017-04-01
Icatibant is used to treat acute hereditary angioedema with C1 inhibitor deficiency types I/II (C1-INH-HAE types I/II) and has shown promise in angioedema due to acquired C1 inhibitor deficiency (C1-INH-AAE). Data from the Icatibant Outcome Survey (IOS) were analysed to evaluate the effectiveness of icatibant in the treatment of patients with C1-INH-AAE and compare disease characteristics with those with C1-INH-HAE types I/II. Key medical history (including prior occurrence of attacks) was recorded upon IOS enrolment. Thereafter, data were recorded retrospectively at approximately 6-month intervals during patient follow-up visits. In the icatibant-treated population, 16 patients with C1-INH-AAE had 287 attacks and 415 patients with C1-INH-HAE types I/II had 2245 attacks. Patients with C1-INH-AAE versus C1-INH-HAE types I/II were more often male (69 versus 42%; P = 0·035) and had a significantly later mean (95% confidence interval) age of symptom onset [57·9 (51·33-64·53) versus 14·0 (12·70-15·26) years]. Time from symptom onset to diagnosis was significantly shorter in patients with C1-INH-AAE versus C1-INH-HAE types I/II (mean 12·3 months versus 118·1 months; P = 0·006). Patients with C1-INH-AAE showed a trend for higher occurrence of attacks involving the face (35 versus 21% of attacks; P = 0·064). Overall, angioedema attacks were more severe in patients with C1-INH-HAE types I/II versus C1-INH-AAE (61 versus 40% of attacks were classified as severe to very severe; P types I/II, respectively. © 2016 British Society for Immunology.
OPTIMIZATION OF NICKEL (II) AND CHROMIUM (III) REMOVAL ...
African Journals Online (AJOL)
RSM)was used to study the effect of three adsorption variables (pH, initial concentration, and adsorbent dosage) in order to determine the optimum process conditions for the adsorptions of Ni (II) and Cr (III) onto sulphuric acid modified sorghum ...
Measurement of multinucleon transfer cross-sections
Indian Academy of Sciences (India)
Keywords. Ni(C, ), Fe(C, ), =C, C, B, B, Be, Be, Be, Be, Li, Li; = 60 MeV; measured reaction cross-section; elastic scattering angular distribution; deduced transfer probabilities and enhancement factors.
Exploration of minima on the C7H surface: Structural, stability- and ...
Indian Academy of Sciences (India)
index for aromaticity could distinguish well between aromatic, non-aromatic and anti-aromatic ... 7 isomers; cation stability; cation geometry; charge distribution; NICS; hybridization state; ..... resonance hybrid or as the most important canoni-.
Intercalation of hydrotalcites with hexacyanoferrate(II) and (III)-a thermoRaman spectroscopic study
International Nuclear Information System (INIS)
Frost, Ray L.; Musumeci, Anthony W.; Bouzaid, Jocelyn; Adebajo, Moses O.; Martens, Wayde N.; Theo Kloprogge, J.
2005-01-01
Raman spectroscopy using a hot stage indicates that the intercalation of hexacyanoferrate(II) and (III) in the interlayer space of a Mg, Al hydrotalcites leads to layered solids where the intercalated species is both hexacyanoferrate(II) and (III). Raman spectroscopy shows that depending on the oxidation state of the initial hexacyanoferrate partial oxidation and reduction takes place upon intercalation. For the hexacyanoferrate(III) some partial reduction occurs during synthesis. The symmetry of the hexacyanoferrate decreases from O h existing for the free anions to D 3d in the hexacyanoferrate interlayered hydrotalcite complexes. Hot stage Raman spectroscopy reveals the oxidation of the hexacyanoferrate(II) to hexacyanoferrate(III) in the hydrotalcite interlayer with the removal of the cyanide anions above 250 deg. C. Thermal treatment causes the loss of CN ions through the observation of a band at 2080cm -1 . The hexacyanoferrate (III) interlayered Mg, Al hydrotalcites decomposes above 150 deg. C
Adsorption of Cs(I), Sr(II), Eu(III), Co(II) and Cd(II) by Al2O3
International Nuclear Information System (INIS)
Shiao, S.Y.; Egozy, Y.; Meyer, R.E.
1981-01-01
Adsorption of Cs(I), Sr(II), Eu(III), Co(II) and Cd(II) by Al 2 O 3 was carried out over a wide range of NaCl concentration and solution pH. In the medium pH region (pH 5 to 9), adsorption depends strongly on pH and less on salt concentration. However, in the high pH region (pH above 9), the salt dependence of the distribution coefficient becomes important. (author)
Effects of Pop III to PopII transition on the lowest metallicity stars in dwarf galaxies
Zhang, Yimiao; Keres, Dusan; FIRE Team
2018-01-01
We examine the effects of the enrichments from Population III (Pop III) stars on the formation and properties of the first generation of the Population II (Pop II) stars. Pop III stars begin to transition towards Pop II stars when the metals dispersed in Pop III supernovae pollute the nearby gas. However, details of this transition are still largely unknown. We use dwarf galaxy simulations from the Feedback In Realistic Environments (FIRE) project to identify the star-forming gas that is likely to be pre-enriched by Pop III supernovae and follow the stars that form in such gas. This pre-enrichment will leave the signature in the lowest metallicity stars that can be used to better constrain the details of the Pop III-to-Pop II transition.
Ontogeny of neuro-insular complexes and islets innervation in the human pancreas.
Proshchina, Alexandra E; Krivova, Yulia S; Barabanov, Valeriy M; Saveliev, Sergey V
2014-01-01
The ontogeny of the neuro-insular complexes (NIC) and the islets innervation in human pancreas has not been studied in detail. Our aim was to describe the developmental dynamics and distribution of the nervous system structures in the endocrine part of human pancreas. We used double-staining with antibodies specific to pan-neural markers [neuron-specific enolase (NSE) and S100 protein] and to hormones of pancreatic endocrine cells. NSE and S100-positive nerves and ganglia were identified in the human fetal pancreas from gestation week (gw) 10 onward. Later the density of S100 and NSE-positive fibers increased. In adults, this network was sparse. The islets innervation started to form from gw 14. NSE-containing endocrine cells were identified from gw 12 onward. Additionally, S100-positive cells were detected both in the periphery and within some of the islets starting at gw 14. The analysis of islets innervation has shown that the fetal pancreas contained NIC and the number of these complexes was reduced in adults. The highest density of NIC is detected during middle and late fetal periods, when the mosaic islets, typical for adults, form. The close integration between the developing pancreatic islets and the nervous system structures may play an important role not only in the hormone secretion, but also in the islets morphogenesis.
International Nuclear Information System (INIS)
Isidoro, Roberta Alvarenga
2015-01-01
Pd/C, Pd Cu/C, Pd Ni/C and Pd Ag/C electrocatalysts were produced by microwave method to be used as cathode in alkaline fuel cell in the absence and presence of alcohol. This method showed to be effective for the materials production, the particles exhibited good dispersion in carbon support and it produced electrocatalysts with a particle size of about 3.5 nm, according to XRD and TEM analysis. In cyclic voltammetry is observed that Pd Cu/C and Pd Ni/C electrocatalysts has higher active area with higher amount of Cu and Ni, respectively. Rotating ring disk analysis in the electrocatalysts showed that the amount of peroxide produced was at most 4%. This data is similar to Koutecky-Levich analysis, once for both the ORR occurs via 4 electrons. Materials stability analysis showed that they kept or improve performance in ORR, comparing the data before and after 1000 voltammetric cycles. Tolerance tests in methanol and ethanol were performed in a half cell in all electrocatalysts compositions. In presence of methanol and ethanol the compositions 50:50, to all materials studied, showed less influence in the presence of alcohol in ORR linear scan. In alkaline fuel cell Pd Ag/C 70:30 showed better performance for ORR in presence of methanol and Pd Ni/C 70:30 showed better performance for ORR in ethanol presence. (author)
International Nuclear Information System (INIS)
Eliseeva, Svetlana V.; Golovach, Iurii P.; Liasotskyi, Valerii S.; Antonovich, Valery P.; Petoud, Stéphane; Meshkova, Svetlana B.
2016-01-01
Most of the existing optical methods for Cu II detection rely on a “turn-off” approach using visible lanthanide(III) luminescence. In this work we present an innovative molecular systems where the podands bis(2-hydrazinocarbonylphenyl) ethers of ethylene glycol (L1) and diethylene glycol (L2) have been designed, synthesised and tested with an ultimate goal to create a "turn-on" lanthanide(III)-based molecular probe for the specific detection of Cu II ions based on both visible (Tb III , Eu III ) and near-infrared (Nd III , Yb III ) emission. Quantum yields of the characteristic Ln III emission signals increases by at least two-orders of magnitude upon addition of Cu II into water/acetonitrile (9/1) solutions of LnL (L=L1, L2) complexes. A detailed investigation of ligand-centred photophysical properties of water/acetonitrile (9/1) solutions of CuL, GdL and GdCuL complexes revealed that the presence of Cu II ions does not significantly affect the energy positions of the singlet (32,260 cm −1 ) and triplet (25,640–25,970 cm −1 ) states, but partially or fully eliminates the singlet state quenching through an electron transfer mechanism. This effect increases the probability of intersystem crossing leading to enhanced triplet-to-singlet emission ratio and to longer triplet state lifetimes. The redox activity of hydrazine moieties and their ability to reduce Cu II to Cu I has been indicated by a qualitative assay with neocuproine. Finally, the probe demonstrates a good selectivity towards Cu II over other transition metal ions: the addition of divalent Zn II , Cd II , Pd II , Ni II , Co II or trivalent Fe III , Ga III , In III ion salts into solutions of TbL either does not affect emission intensity or increases it to a maximum of 2–3 times, while, under similar experimental conditions, the presence of Cu II results in a 20- to 30-times lanthanide luminescence enhancement. This new strategy results in a versatile and selective optical platform for the
Calix[4]arene supported clusters: a dimer of [Mn(III)Mn(II)] dimers
DEFF Research Database (Denmark)
Taylor, Stephanie M; McIntosh, Ruaraidh D; Beavers, Christine M
2011-01-01
Phosphinate ligands allow for the transformation of a calix[4]arene supported [Mn(III)(2)Mn(II)(2)] tetramer cluster motif into an unusual [Mn(III)Mn(II)](2) dimer of dimers; the clusters self-assemble in the crystal to form bi-layer arrays reminiscent of the typical packing of calixarene solvates....
2011-02-03
... program will be determined by the content, the awardee should project that the program will last no more... determined by NIC and in consultation with its writer/editor, webmaster, and audiovisual staff. Curriculum...
Arévalo Venegas, Claudia Elena
2014-01-01
Este trabajo buscó describir el cuidado de enfermería en el hogar, a una madre con VIH/SIDA y su recién nacido durante el postparto, basado en las cinco categorías de la Teoría de Kristen Swanson, en Bogotá durante el II semestre de 2014. Por medio de un estudio de caso, utilizando la estrategia de seguimiento domiciliario en donde se realizaron 5 visitas al hogar, durante las cuales se desarrolló un plan de cuidado basado en las taxonomías NANDA, NIC, NOC. Previamente se realizó revisión de ...
Directory of Open Access Journals (Sweden)
Mady Charles
2007-09-01
Full Text Available Abstract Background In patients with advanced non-ischemic cardiomyopathy (NIC, right-sided cardiac disturbances has prognostic implications. Right coronary artery (RCA flow pattern and flow reserve (CFR are not well known in this setting. The purpose of this study was to assess, in human advanced NIC, the RCA phasic flow pattern and CFR, also under right-sided cardiac disturbances, and compare with left coronary circulation. As well as to investigate any correlation between the cardiac structural, mechanical and hemodynamic parameters with RCA phasic flow pattern or CFR. Methods Twenty four patients with dilated severe NIC were evaluated non-invasively, even by echocardiography, and also by cardiac catheterization, inclusive with Swan-Ganz catheter. Intracoronary Doppler (Flowire data was obtained in RCA and left anterior descendent coronary artery (LAD before and after adenosine. Resting RCA phasic pattern (diastolic/systolic was compared between subgroups with and without pulmonary hypertension, and with and without right ventricular (RV dysfunction; and also with LAD. RCA-CFR was compared with LAD, as well as in those subgroups. Pearson's correlation analysis was accomplished among echocardiographic (including LV fractional shortening, mass index, end systolic wall stress more hemodynamic parameters with RCA phasic flow pattern or RCA-CFR. Results LV fractional shortening and end diastolic diameter were 15.3 ± 3.5 % and 69.4 ± 12.2 mm. Resting RCA phasic pattern had no difference comparing subgroups with vs. without pulmonary hypertension (1.45 vs. 1.29, p = NS either with vs. without RV dysfunction (1.47 vs. 1.23, p = NS; RCA vs. LAD was 1.35 vs. 2.85 (p Conclusion In patients with chronic advanced NIC, RCA phasic flow pattern has a mild diastolic predominance, less marked than in LAD, with no effects from pulmonary artery hypertension or RV dysfunction. There is no significant correlation between any cardiac mechanical-structural or
Energy Technology Data Exchange (ETDEWEB)
Harish, S. [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India); Joseph, James, E-mail: jameskavlam@yahoo.com [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India); Phani, K.L.N. [Electrodics and Electrocatalysis Division, CSIR-Central Electrochemical Research Institute, Karaikudi 630006, Tamilnadu (India)
2011-06-30
Highlights: > In group IB, Cu and Ag form Prussian blue analogues but similar formation of gold hexacyanoferrate was not found in the literature and non-existence of gold hexacyanoferrate remains a mystery. > Potential cycling of gold chloride and potassium ferro/ferri cyanide was resulted in the formation of Au-PB nano-composite. > Redox reaction between gold chloride and potassium ferrocyanide ion is spontaneous but no reaction occurs when gold chloride and potassium ferricyanide is mixed. > We are proposing the formation of a compound with general formula 'KFe{sub x}[Au(CN){sub 2}]{sub y}' and discussing the formation of gold hexacyanoferrate is not feasible by simple chemical or electrochemical reaction in contrast to other PB analogues. - Abstract: Prussian blue analogues are a class of compounds formed by the reaction between metal salt and potassium hexacyanoferrate (II/III). In our earlier report, the formation of Au-Prussian blue nano-composite was noticed on potential cycling the glassy carbon electrode in a medium containing gold (III) chloride and potassium hexacyanoferrate (III). Hence in this work, the formation of gold hexacyanoferrate was attempted by a simple chemical reaction. The reaction of gold (III) chloride with potassium hexacyanoferrate (II/III) was examined by UV-Vis spectroscopy and found that there is no redox reaction between gold (III) chloride and potassium hexacyanoferrate (III). However, the redox reaction occurs between gold (III) chloride and potassium hexacyanoferrate (II) leading to the formation of charge transfer band and the conversion of hexacyanoferrate (II) to hexacyanoferrate (III) was evidenced by the emergence of new absorption peaks in UV-Vis spectra. The oxidation state of gold in Au-Fe complex was found to be +1 from X-ray photoelectron spectroscopy. The stability of the Au-Fe complex was also studied by cyclic voltammetry. Cyclic voltammetric results indicated the presence of high spin iron in Au
International Nuclear Information System (INIS)
Harish, S.; Joseph, James; Phani, K.L.N.
2011-01-01
Highlights: → In group IB, Cu and Ag form Prussian blue analogues but similar formation of gold hexacyanoferrate was not found in the literature and non-existence of gold hexacyanoferrate remains a mystery. → Potential cycling of gold chloride and potassium ferro/ferri cyanide was resulted in the formation of Au-PB nano-composite. → Redox reaction between gold chloride and potassium ferrocyanide ion is spontaneous but no reaction occurs when gold chloride and potassium ferricyanide is mixed. → We are proposing the formation of a compound with general formula 'KFe x [Au(CN) 2 ] y ' and discussing the formation of gold hexacyanoferrate is not feasible by simple chemical or electrochemical reaction in contrast to other PB analogues. - Abstract: Prussian blue analogues are a class of compounds formed by the reaction between metal salt and potassium hexacyanoferrate (II/III). In our earlier report, the formation of Au-Prussian blue nano-composite was noticed on potential cycling the glassy carbon electrode in a medium containing gold (III) chloride and potassium hexacyanoferrate (III). Hence in this work, the formation of gold hexacyanoferrate was attempted by a simple chemical reaction. The reaction of gold (III) chloride with potassium hexacyanoferrate (II/III) was examined by UV-Vis spectroscopy and found that there is no redox reaction between gold (III) chloride and potassium hexacyanoferrate (III). However, the redox reaction occurs between gold (III) chloride and potassium hexacyanoferrate (II) leading to the formation of charge transfer band and the conversion of hexacyanoferrate (II) to hexacyanoferrate (III) was evidenced by the emergence of new absorption peaks in UV-Vis spectra. The oxidation state of gold in Au-Fe complex was found to be +1 from X-ray photoelectron spectroscopy. The stability of the Au-Fe complex was also studied by cyclic voltammetry. Cyclic voltammetric results indicated the presence of high spin iron in Au-Fe complex. Hence 'as
2011-07-25
... proofread and edited for grammar, spelling, punctuation, formatting, and clarity. The awardee will deliver all materials in hard copy (2) and on a disk (2). The awardee must ensure that all products meet NIC's...
2011-12-15
... is possible. The award recipient will become familiar with the work currently being done at NIC that... above; (7) a description of the staffing plan, including the role and time commitment for each project...
Senko, John M.; Dewers , Thomas A.; Krumholz, Lee R.
2005-01-01
A nitrate-dependent Fe(II)-oxidizing bacterium was isolated and used to evaluate whether Fe(II) chemical form or oxidation rate had an effect on the mineralogy of biogenic Fe(III) (hydr)oxides resulting from nitrate-dependent Fe(II) oxidation. The isolate (designated FW33AN) had 99% 16S rRNA sequence similarity to Klebsiella oxytoca. FW33AN produced Fe(III) (hydr)oxides by oxidation of soluble Fe(II) [Fe(II)sol] or FeS under nitrate-reducing conditions. Based on X-ray diffraction (XRD) analysis, Fe(III) (hydr)oxide produced by oxidation of FeS was shown to be amorphous, while oxidation of Fe(II)sol yielded goethite. The rate of Fe(II) oxidation was then manipulated by incubating various cell concentrations of FW33AN with Fe(II)sol and nitrate. Characterization of products revealed that as Fe(II) oxidation rates slowed, a stronger goethite signal was observed by XRD and a larger proportion of Fe(III) was in the crystalline fraction. Since the mineralogy of Fe(III) (hydr)oxides may control the extent of subsequent Fe(III) reduction, the variables we identify here may have an effect on the biogeochemical cycling of Fe in anoxic ecosystems.
Effect of magnetic configuration on frequency of NBI-driven Alfvén modes in TJ-II
Melnikov, A. V.; Ochando, M.; Ascasibar, E.; Castejon, F.; Cappa, A.; Eliseev, L. G.; Hidalgo, C.; Krupnik, L. I.; Lopez-Fraguas, A.; Liniers, M.; Lysenko, S. E.; de Pablos, J. L.; Perfilov, S. V.; Sharapov, S. E.; Spong, D. A.; Jimenez, J. A.; Ufimtsev, M. V.; Breizman, B. N.; HIBP Group; the TJ-II Team
2014-12-01
Excitation of modes in the Alfvénic frequency range, 30 kHz values, 1.51advantage of the unique TJ-II capabilities, a dynamic magnetic configuration experiment with \\unicode{7548} (ρ , t) variation during discharges has shown strong effects on the mode frequency via both vacuum \\unicode{7548} changes and induced net plasma current. A drastic frequency increase from ˜50 to ˜250 kHz was observed for some modes when plasma current as low as ±2 kA was induced by small (10%) changes in the vertical field. A comprehensive set of diagnostics including a heavy ion beam probe, magnetic probes and a multi-chord bolometer made it possible to identify the spatial spread of the modes and deduce the internal amplitudes of their plasma density and magnetic field perturbations. A simple analytical model for fAE, based on the local Alfvén eigenmode (AE) dispersion relation, was proposed to characterize the observation. It was shown that all the observations, including vacuum iota and plasma current variations, may be fitted by the model, so the linear mode frequency dependence on \\unicode{7548} (plasma current) and one over square root density dependence present the major features of the NBI-induced AEs in TJ-II, and provide the framework for further experiment-to-theory comparison.
[Identification and mapping of prescribed nursing actions for patients in an adult ICU].
Salgado, Patricia Oliveira; Tannure, Meire Chucre; Oliveira, Cleydson Rodrigues; Chianca, Tânia Couto Machado
2012-01-01
Descriptive study that aimed to identify nursing actions prescribed by nurses in the medical records of patients admitted to an Intensive Care Unit (ICU) for adults, in Belo Horizonte (MG), the terms used, their frequency and map the actions to the Theory of Basic Human Needs and NIC interventions. It was obtained a sample of 44 patient records. It was identified 2,260 nursing actions. After exclusion of repetitions, it was found 124 different actions. All nursing actions have been mapped to physiological needs and also to NIC interventions. It was obtained 100% of agreement among experts in the validation of the mapping process. It is suggested that similar studies in ICUs from other locations and different contexts / specialties should be driven to identify nursing actions developed and its evolution.
International Nuclear Information System (INIS)
Chun-Mei, Tang; Wei-Hua, Zhu; Kai-Ming, Deng
2010-01-01
This paper uses the generalised gradient approximation based on density functional theory to analyse the geometric structure and properties of the 3d transition metal atom doped endohedral fullerene M@C 20 F 20 (M = Sc–Ni). The geometric optimization shows that the cage centre is the most stable position for M, forming the structure named as M@C 20 F 20 -4. The inclusion energy, zero-point energy, and energy gap calculations tell us that N@C 20 F 20 -4 should be thermodynamically and kinetically stablest. M@C 20 F 20 -4 (M = Sc–Co) possesses high magnetic moments varied from 1 to 6 μ B , while Ni@C 20 F 20 -4 is nonmagnetic. The Ni–C bond in Ni@C 20 F 20 -4 contains both the covalent and ionic characters
The magnetic field of molecular clouds
Padoan, P.
2018-01-01
The magnetic field of molecular clouds (MCs) plays an important role in the process of star formation: it determines the statistical properties of supersonic turbulence that controls the fragmentation of MCs, controls the angular momentum transport during the protostellar collapse, and affects the stability of circumstellar disks. In this work, we focus on the problem of the determination of the magnetic field strength. We review the idea that the MC turbulence is super-Alfvénic, and we argue that MCs are bound to be born super-Alfvénic. We show that this scenario is supported by results from a recent simulation of supernova-driven turbulence on a scale of 250 pc, where the turbulent cascade is resolved on a wide range of scales, including the interior of MCs.
Peng, Hongliang; Huang, Pengru; Yi, Pinggui; Xu, Fen; Sun, Lixian
2018-02-01
Proton transfer processes of 15 benzimidazole compounds are studied by density functional theory methods, and natural orbital energy index (NOEI) is introduced. Here, NOEI and nucleus independent chemical shift (NICS) are applied to estimate the π-electron localization and delocalization, respectively. Proton transfer potential energy surfaces are calculated to explore these processes, and the results show that the changes of the π-electron delocalization of the phenyl (pyridyl) is the main factors for the stability of keto form. There is high correlation between the π-electron delocalization and the proton transfer barrier. When the π-electron localization is considered, the regression increases the correlation coefficient, increasing from 0.9663 to 0.9864. NOEI index is sensitive to π-electron localization; it is a beneficial and useful complement to NICS.
Energy Technology Data Exchange (ETDEWEB)
S.S. Medley, R. Andre, R.E. Bell, D.S. Darrow, C.W. Domier, E.D. Fredrickson, N.N. Gorelenkov, S.M. Kaye, B.P. LeBlanc, K.C. Lee, F.M. Levinton, D. Liu, N.C. Luhmann, Jr., J.E. Menard, H. Park, D. Stutman, A.L. Roquemore, K. Tritz, H. Yuh and the NSTX Team
2007-11-15
Observations of magneto-hydro-dynamic (MHD) induced redistribution or loss of energetic ions measured using the vertically scanning capability of the Neutral Particle Analyzer diagnostic on the National Spherical Torus Experiment (NSTX) are presented along with TRANSP and ORBIT code analysis of the results. Although redistribution or loss of energetic ions due to bursting fishbone-like and low-frequency (f ~ 10 kHz) kinktype MHD activity has been reported previously, the primary goal of this work is to study redistribution or loss due to continuous Alfvénic (f ~ 20 – 150 kHz) modes, a topic that heretofore has not been investigated in detail for NSTX plasmas. Initial indications are that the former drive energetic ion loss whereas the continuous Alfvénic modes only cause redistribution and the energetic ions remain confined.
Synthesis and physicochemical analysis of Sm (II, III) acetylacetone chelate complexes
International Nuclear Information System (INIS)
Kostyuk, N.N.; Dik, T.A.; Trebnikov, A.G.
2004-01-01
Sm (II, III) acetylacetone chelate complexes were synthesized by electrochemical method. It was shown that anode dissolution of the metal samarium over acetylacetone leads to formation of the Sm (II, III) chelate complexes: xSm(acac)2 · ySm(acac)3 · zH(acac). Factors x, y and z depend on quantity of the electricity, which flew through the electrolysis cell. The compositions of the obtained substances were confirmed by the physicochemical analysis (ultimate analysis, IR-, mass spectroscopy and thermal analysis (thermogravimetric, isothermal warming-up and differential scanning colorimetry). (Authors)
Energy Technology Data Exchange (ETDEWEB)
Eliseeva, Svetlana V., E-mail: svetlana.eliseeva@cnrs-orleans.fr [Centre de Biophysique Moléculaire CNRS UPR 4301, Rue Charles Sadron, 45071 Orléans Cedex 2 (France); Le Studium, Loire Valley Institute for Advanced Studies, 1 Rue Dupanloup, 45000 Orléans (France); Golovach, Iurii P.; Liasotskyi, Valerii S. [I.I.Mechnikov Odessa National University, 2 Dvoryanska street, 65082 Odessa (Ukraine); Antonovich, Valery P. [A.V. Bogatsky Physico-Chemical Institute of the National Academy of Sciences of Ukraine, 86 Lustdorfskaya doroga, 65080 Odessa (Ukraine); Petoud, Stéphane, E-mail: stephane.petoud@inserm.fr [Centre de Biophysique Moléculaire CNRS UPR 4301, Rue Charles Sadron, 45071 Orléans Cedex 2 (France); Meshkova, Svetlana B., E-mail: s_meshkova@ukr.net [A.V. Bogatsky Physico-Chemical Institute of the National Academy of Sciences of Ukraine, 86 Lustdorfskaya doroga, 65080 Odessa (Ukraine)
2016-03-15
Most of the existing optical methods for Cu{sup II} detection rely on a “turn-off” approach using visible lanthanide(III) luminescence. In this work we present an innovative molecular systems where the podands bis(2-hydrazinocarbonylphenyl) ethers of ethylene glycol (L1) and diethylene glycol (L2) have been designed, synthesised and tested with an ultimate goal to create a 'turn-on' lanthanide(III)-based molecular probe for the specific detection of Cu{sup II} ions based on both visible (Tb{sup III}, Eu{sup III}) and near-infrared (Nd{sup III}, Yb{sup III}) emission. Quantum yields of the characteristic Ln{sup III} emission signals increases by at least two-orders of magnitude upon addition of Cu{sup II} into water/acetonitrile (9/1) solutions of LnL (L=L1, L2) complexes. A detailed investigation of ligand-centred photophysical properties of water/acetonitrile (9/1) solutions of CuL, GdL and GdCuL complexes revealed that the presence of Cu{sup II} ions does not significantly affect the energy positions of the singlet (32,260 cm{sup −1}) and triplet (25,640–25,970 cm{sup −1}) states, but partially or fully eliminates the singlet state quenching through an electron transfer mechanism. This effect increases the probability of intersystem crossing leading to enhanced triplet-to-singlet emission ratio and to longer triplet state lifetimes. The redox activity of hydrazine moieties and their ability to reduce Cu{sup II} to Cu{sup I} has been indicated by a qualitative assay with neocuproine. Finally, the probe demonstrates a good selectivity towards Cu{sup II} over other transition metal ions: the addition of divalent Zn{sup II}, Cd{sup II}, Pd{sup II}, Ni{sup II}, Co{sup II} or trivalent Fe{sup III}, Ga{sup III}, In{sup III} ion salts into solutions of TbL either does not affect emission intensity or increases it to a maximum of 2–3 times, while, under similar experimental conditions, the presence of Cu{sup II} results in a 20- to 30-times
Directory of Open Access Journals (Sweden)
Miriam de Abreu Almeida
2010-02-01
Full Text Available This study mapped the 52 nursing care actions prescribed for orthopedic patients onto Self-care Deficit: bathing and/or hygiene, Impaired Physical Mobility and Risk for Infection, according to the Nursing Interventions Classification (NIC. The study was developed at a University Hospital in Porto Alegre, Brazil, using the Delphi Technique as the content validation method, considering a level of 70% of agreement among experts. Data were analyzed through descriptive statistics. Twenty-two experts validated the mapping of 51 nursing care actions onto 56 NIC interventions in two rounds. The objective was achieved because only one mapped care action did not reach the established level of agreement. None of the mapped care actions reached 100% consensus, which evidences the various possibilities of comparison and the importance of validation studies.Este trabajo tuvo como objetivo validar el mapeo de los 52 cuidados de enfermería prescritos para pacientes ortopédicos con la Clasificación de las Intervenciones de Enfermería (NIC, referente a tres diagnósticos: déficit en el autocuidado (baño y/o higiene, movilidad física perjudicada y riesgo de infección. El estudio fue desarrollado en el Hospital de Clínicas de Porto Alegre, utilizándose el método de validación de contenido por medio de la aplicación de la Técnica Delphi, considerándose 70% de acuerdo entre jueces. Los datos fueron analizados por medio de estadística descriptiva. Participaron del estudio 22 jueces que, en dos rodadas, validaron el mapeo de 51 cuidados de enfermería con 56 intervenciones de la NIC. Es posible afirmar que el objetivo fue alcanzado, ya que apenas un cuidado no alcanzó la relación establecida. Ninguno de los cuidados alcanzó un consenso de 100%, colocando en evidencia las varias posibilidades de comparación y la importancia de los estudios de validación.Este trabalho teve como objetivo validar o mapeamento dos 52 cuidados de enfermagem, prescritos
Ding, Dahu; Lei, Zhongfang; Yang, Yingnan; Feng, Chuanping; Zhang, Zhenya
2014-04-15
A novel nickel (II) hexacyanoferrate (III) functionalized agricultural residue-walnut shell (Ni(II)HCF(III)-WS) was developed to selectively remove cesium ion (Cs(+)) from aqueous solutions. This paper showed the first integral study on Cs(+) removal behavior and waste reduction analysis by using biomass adsorption material. The results indicated that the removal process was rapid and reached saturation within 2h. As a special characteristic of Ni(II)HCF(III)-WS, acidic condition was preferred for Cs(+) removal, which was useful for extending the application scope of the prepared biomass material in treating acidic radioactive liquid waste. The newly developed Ni(II)HCF(III)-WS could selectively remove Cs(+) though the coexisting ions (Na(+) and K(+) in this study) exhibited negative effects. In addition, approximately 99.8% (in volume) of the liquid waste was reduced by using Ni(II)HCF(III)-WS and furthermore 91.9% (in volume) of the spent biomass material (Cs-Ni(II)HCF(III)-WS) was reduced after incineration (at 500°C for 2h). Due to its relatively high distribution coefficient and significant volume reduction, Ni(II)HCF(III)-WS is expected to be a promising material for Cs(+) removal in practice. Copyright © 2014 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Hu, J.; Wang, X.K. [School of Nuclear Science and Engineering, North China Electric Power Univ., BJ (China); Key Lab. of Novel Thin Film Solar Cells, Inst. of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Chen, C.L.; Sheng, G.D.; Li, J.X. [Key Lab. of Novel Thin Film Solar Cells, Inst. of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Chen, Y.X. [School of Nuclear Science and Engineering, North China Electric Power Univ., BJ (China)
2010-07-01
The surface charge characteristics of Na-rectorite (NaAl{sub 4}[Si,Al]{sub 8}O{sub 20}(OH){sub 4}.nH{sub 2}O;) were studied by potentiometric acid-base titrations. Sr(II) and Eu(III) adsorptions on Na-rectorite as a function of pH, ionic strength, and Sr(II)/Eu(III) concentrations were carried out to investigate the surface interactions between Sr(II)/Eu(III) with Na-rectorite. The results indicated that the adsorptions of Sr(II) and Eu(III) on Na-rectorite increased with increasing pH and decreased with increasing ionic strength and initial Sr(II)/Eu(III) concentrations, and that the affinity of Na-rectorite for Eu(III) was much higher than for Sr(II). The experimental data of Sr(II)/Eu(III) adsorption were simulated by the diffuse-layer model (DLM) well with the aid of FITEQL 3.2. Simultaneous adsorptions of Sr(II) and Eu(III) on Na-rectorite were also modeled using the DLM. The adsorption mechanisms of Sr(II) and Eu(III) on Na-rectorite may be dominated by ion exchange interaction at low pH or moderate pH, and by surface complexation interaction at high pH. (orig.)
Removal or excitation of a 1s electron in Kr II and Kr III
International Nuclear Information System (INIS)
Pan Lin; Beck, Donald R; O'Malley, Steven M
2005-01-01
Relativistic configuration interaction calculations are done for Kr ions Kr II and Kr III. Transition energies and transition probabilities for 122 transitions between Kr II 4p 5 J = 1/2, 3/2→ 1s 4p 6 , 1s 4p 5 np (n = 5-8) J = 1/2, 3/2, 5/2; 437 transitions between Kr III 4p 4 J = 0, 1, 2→ 1s 4p 5 , 1s 4p 4 np (n = 5-8) J = 0, 1, 2, 3 have been calculated. These data have been used by experiment to reproduce the absorption spectrum of Kr II and Kr III and found to be in good agreement with their measurement. Also, the K-edge energy of neutral Kr, Kr II and Kr III has been calculated. The first is within 0.94 eV of an existing experiment, while the last two are calculated for the first time
Chemical carcinogenesis and chemoprevention: Scientific priority ...
African Journals Online (AJOL)
Administrator
substances beside coal tar. Industrial chemicals .... induced cell signaling and transcriptional activation. Chro- nic alteration ... well known that both oil soluble and water-soluble .... vention and treatment strategies might be applied to these risk ...
Vähemuskeelte õiguste tõlgendusi / Ilmar Tomusk
Tomusk, Ilmar, 1964-
2004-01-01
10.-14. novembril 2003 Turu rootsikeelse ülikooli inimõiguste instituudis toimunud rahvusvahelisest keele- ja vähemuste õiguste seminarist. Ülevaade Martin Sheinini, Fernand de Varennesi, Kristian Myntti, Niamh Nic Shuibhne sõnavõttudest
Sevgi, Fatih; Bagkesici, Ugur; Kursunlu, Ahmed Nuri; Guler, Ersin
2018-02-01
Zinc (II), copper (II), nickel (II), cobalt (II) and iron (III) complexes of Schiff bases (LG, LP) derived from 2-hydroxynaphthaldehyde with glycine and phenylalanine were reported and characterized by 1H NMR, 13C NMR, elemental analyses, melting point, FT-IR, magnetic susceptibility and thermal analyses (TGA). TGA data show that iron and cobalt include to the coordinated water and metal:ligand ratio is 1:2 while the complex stoichiometry for Ni (II), Cu (II) and Zn (II) complexes is 1:1. As expected, Ni (II) and Zn (II) complexes are diamagnetic; Cu (II), Co (II) and Fe (III) complexes are paramagnetic character due to a strong ligand of LG and LP. The LG, LP and their metal complexes were screened for their antimicrobial activities against five Gram-positive (Staphylococcus aureus, Methicillin resistant Staphylococcus aureus (MRSA), Bacillus cereus, Streptococcus mutans and Enterococcus faecalis) and three Gram-negative (Escherichia coli, Klebsiella pneumoniae and Pseudomonas aeruginosa) and one fungi (Candida albicans) by using broth microdilution techniques. The activity data show that ligands and their metal complexes exhibited moderate to good activity against Gram-positive bacteria and fungi.
Procykličnost v Basel II a Basel III
Šobotníková, Petra
2011-01-01
The term procyclicality refers to the ability of a system to amplify business cycles. The recent financial crisis has revealed that the current regulatory framework, Basel II, affects the business cycle in exactly that manner. The newly published Basel III therefore sought to include tools that would mitigate the procyclical nature of regulatory framework. The aim of the thesis is to analyze whether such tools are effective and whether the procyclicality under Basel III has been mitigated whe...
Considerations Related to LTO for Gen II/III NPP
International Nuclear Information System (INIS)
Cojan, Mihail
2012-01-01
Today there are some 435 nuclear power reactors operating in 30 countries with a combined capacity of over 372 GWe. In 2011 these provided 2518 billion kWh, about 14% of the world's electricity [1]. The next evolutionary design of Generation III reactors to be deployed over many decades will represent a large part of the worldwide fleet throughout the 21st century. Generation III reactors are the future NPPs with improved safety and reliability, with passive safety systems and with a very low probability for core melt. The objective of this paper is to present the R and D activities that support LTO for Generation II / III Nuclear Reactors. (author)
DEFF Research Database (Denmark)
Yin, Weizhao
In the present PhD project, novel synthesis and modifications of layered Fe(II)-Fe(III) hydroxides (green rusts, GRs) were investigated with focus on improved dehalogenation of carbon tetrachloride by using modified green rusts and/or altered reaction conditions. The Ph.D. project has comprised: 1...... sulphate green rust formation by aerial oxidation of FeII or co-precipitation by adding Fe(III) salt to Fe(II). In comparison with traditional green rust synthesis, pure GRs were synthesized in minutes. 2. Enhanced dehalogenation of CT by GR in presence of selected amino acids. In presence of glycine......, chloroform (CF) formation is effectively suppressed: less than 10% of CT is transformed to CF, and more than 90% of dehalogenation products are found to be formic acid and carbon monoxide in presence of 60 mM glycine; while a 80% of CF recovery was obtained without amino acids addition. 3. A “switch...
Recovery of copper(II) and chromium(III) from nitrate medium with ...
African Journals Online (AJOL)
The solvent extraction of copper(II) and chromium(III) from nitrate medium with salicylideneaniline (HL) is studied as a function of various parameters: pH, concentration of salicylideneaniline, contact time and the nature of anoin (nitrate and sulfate) in aqueous phase. Chromium(III) is not extracted by salicylideneaniline ...
Ion flotation of rhodium(III) and palladium(II) with anionic surfactants.
He, X C
1991-03-01
The ion flotation of rhodium(III) and palladium(II) with some anionic surfactants has been investigated. Two flotation procedures are proposed for the separation of some platinum metals, based on differences in the kinetic properties of the chloro-complexes of rhodium(III), palladium(II) and platinum(IV). The first involves the selective flotation of Rh(H(2)O)(3+)(6) from PdCl(2-)(4) and PtCl(2-)(6) in dilute hydrochloric acid with sodium dodecylbenzenesulfonate (SDBS). After precipitation of the hydroxide and redissolution in dilute acid, the Rh(III) is converted into Rh(H(2)O)(3+)(6), Pd(II) and Pt(IV) remaining as PdCl(2-)(4) and PtCl(2-)(6) respectively, and separation is achieved by floating the Rh(H(2)O)(3+)(6) with SDBS. The second is for separation of Pd(II). Prior to flotation, the solution of PdCl(2-)(4) and PtCl(2-)(6) is heated with ammonium acetate to convert PdCl(2-)(4) into Pd(NH(3))(2+)(4). The chloro-complex of Pt(IV) is unaffected. The complex cation, Pd(NH(3))(2+)(4), is then selectively floated with SDBS. The procedures are fast, simple and do not require expensive reagents and apparatus.
van Ree, R.; van Leeuwen, W. A.; van den Berg, M.; Weller, H. H.; Aalberse, R. C.
1994-01-01
In this study, the homologous C-termini of Lol p I, Lol p II, and Lol p III were shown to contain cross-reactive B-cell epitopes. This was demonstrated by inhibition studies with purified Lol p I, II, and III and synthetic peptides of their C-termini. It was ruled out that the observed
Triglyceride-rich lipoprotein metabolism in women: roles of apoC-II and apoC-III.
Ooi, Esther M; Chan, Dick C; Hodson, Leanne; Adiels, Martin; Boren, Jan; Karpe, Fredrik; Fielding, Barbara A; Watts, Gerald F; Barrett, P Hugh R
2016-08-01
Experimental data suggest that apolipoprotein (apo) C-II and C-III regulate triglyceride-rich lipoprotein (TRL) metabolism, but there are limited studies in humans. We investigated the metabolic associations of TRLs with apoC-II and apoC-III concentrations and kinetics in women. The kinetics of plasma apoC-II, apoC-III and very low-density lipoprotein (VLDL) apoB-100 and triglycerides were measured in the postabsorptive state using stable isotopic techniques and compartmental modelling in 60 women with wide-ranging body mass index (19·5-32·9 kg/m(2) ). Plasma apoC-II and apoC-III concentrations were positively associated with the concentrations of plasma triglycerides, VLDL1 - and VLDL2 -apoB-100 and triglyceride (all P triglyceride concentration and VLDL1 triglyceride PR, while apoC-II fractional catabolic rate (FCR) was positively associated with VLDL1 triglyceride FCR (all P triglyceride kinetics. ApoC-III PR, but not FCR, was positively associated with VLDL1 triglyceride, and VLDL2 -apoB-100 and triglyceride concentrations (all P triglyceride kinetics. In multivariable analysis, including homoeostasis model assessment score, menopausal status and obesity, apoC-II concentration was significantly associated with plasma triglyceride, VLDL1 -apoB-100 and VLDL1 triglyceride concentrations and PR. Using the same multivariable analysis, apoC-III was significantly associated with plasma triglyceride and VLDL1 - and VLDL2 -apoB-100 and triglyceride concentrations and FCR. In women, plasma apoC-II and apoC-III concentrations are regulated by their respective PR and are significant, independent determinants of the kinetics and plasma concentrations of TRLs. © 2016 Stichting European Society for Clinical Investigation Journal Foundation.
Wang, Jia-Bin; Lin, Man-Qiang; Li, Ping; Xie, Jian-Wei; Lin, Jian-Xian; Lu, Jun; Chen, Qi-Yue; Cao, Long-Long; Lin, Mi; Zheng, Chao-Hui; Huang, Chang-Ming
2017-12-01
The purpose of this study was to evaluate the prognosis of patients with Siewert type II/III adenocarcinoma of the esophagogastric junction (AEG) with parapyloric lymph node (No. 5 and 6 lymph nodes, PLN) metastasis and to determine the need for PLN dissection for patients with type II/III AEG. A total of 1008 patients with type II/III AEG who underwent a transabdominal total gastrectomy were enrolled. The long-term surgical outcome of PLN-positive patients and the therapeutic value of PLN dissection were analyzed. There was no significant difference in the incidence of PLN metastasis between type II and III cancers (5.7% vs. 8.5%, P > 0.05). PLN metastasis was a significant prognostic factor for type II/III cancers (HR 1.63; P = 0.001). Among type II/III cancers, the 5-year survival of patients with PLN-positive cancers was much lower than that of patients with PLN-negative cancers (21.3% vs. 60.8%, P 0.05). In the analysis of the therapeutic value of lymph node dissection in each station for type II and III cancers after radical resection, lymph nodes with the lowest therapeutic value index after No. 12a were No. 5 and 6 lymph nodes. Patients with type II/III AEG with PLN metastasis have a poor prognosis, similar to patients with stage IV disease. PLN dissection offers marginal therapeutic value for patients with type II/III AEG. Copyright © 2017 Elsevier Ltd, BASO ~ The Association for Cancer Surgery, and the European Society of Surgical Oncology. All rights reserved.
National Ice Center Arctic Sea Ice Charts and Climatologies in Gridded Format
National Oceanic and Atmospheric Administration, Department of Commerce — The U.S. National Ice Center (NIC) is an inter-agency sea ice analysis and forecasting center comprised of the Department of Commerce/NOAA, the Department of...
Reference: 156 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available dopsis thaliana . We demonstrate that loss of DEL1 function resulted in increased ploidy levels, whereas ectopic...nics. DEL1 inhibited the endoreduplication phenotype, but not the ectopic cell divisions that resulted from
Fantola Lazzarini, Anna L.; Lazzarini, Ennio
The o-Ps quenching reactions promoted in aqueous solutions by the following six cyanocomplexes: [Fe(CN) 6] 4-; [Co(CN) 6] 3-; [Zn(CN) 4] 2-; [Cd(CN) 6] 2-; [Fe(CN) 6] 3-; [Ni(CN) 4] 2- were investigated. The first four reactions probably consist in o-Ps addition across the CN bond, their rate constants at room temperature, Tr, being ⩽(0.04±0.02) × 10 9 M -1 s -1, i.e. almost at the limit of experimental errors. The rate constant of the fifth reaction, in o-Ps oxydation, at Tr is (20.3±0.4) × 10 9 M -1 s -1. The [Ni(CN) 4] 2-k value at Tr, is (0.27±0.01) × 10 9 M -1 s -1, i.e. 100 times less than the rate constants of o-Ps oxydation, but 10 times larger than those of the o-Ps addition across the CN bond. The [Ni(CN) 4] 2- reaction probably results in formation of the following positronido complex: [Ni(CN) 4Ps] 2-. However, it is worth noting that the existence of such a complex is only indirectly deduced. In fact it arises from comparison of the [Ni(CN) 4] 2- rate constant with those of the Fe(II), Zn(II), Cd(II), and Co(III) cyanocomplexes, which, like the Ni(II) cyanocomplex, do not promote o-Ps oxydation or spin exchange reactions.
Han, Lanfang; Sun, Haoran; Ro, Kyoung S; Sun, Ke; Libra, Judy A; Xing, Baoshan
2017-06-01
In this study, hydrochars and pyrochars prepared from animal manures were characterized and were used to remove Sb (III) and Cd (II) from aqueous solution. Fourier transform infrared spectroscopy (FTIR) analysis revealed the interaction between Cd (II) and CO and CO groups within biochars and between Sb (III) and CO, CO and OH groups, respectively. Additionally, the lower absolute value of zeta potential of biochar after loading Sb (III) and Cd (II) suggested the occurrence of surface complexation. Existing primarily in the form of Sb (OH) 3 , the maximum adsorption capacities (Q max ) for Sb (III) were lower than those for Cd (II). Due to the lower contents of surface polar functional groups and less negative surface charge, hydrochars exhibited lower Q max for Sb (III) and Cd (II) than pyrochars. However, hydrochars in this study had higher sorption capacities for Cd (II) than most of plant-based pyrochars reported by other literature. Copyright © 2017 Elsevier Ltd. All rights reserved.
Mandibular condyle dimensions in Peruvian patients with Class II and Class III skeletal patterns.
Directory of Open Access Journals (Sweden)
Hugo Zegarra-Baquerizo
2017-10-01
Full Text Available Objective: To compare condylar dimensions of young adults with Class II and Class III skeletal patterns using cone-beam computed tomography (CBCT. Materials and methods: 124 CBCTs from 18-30 year-old patients, divided into 2 groups according to skeletal patterns (Class II and Class III were evaluated. Skeletal patterns were classified by measuring the ANB angle of each patient. The anteroposterior diameter (A and P of the right and left mandibular condyle was assessed from a sagittal view by a line drawn from point A (anterior to P (posterior. The coronal plane allowed the evaluation of the medio-lateral diameter by drawing a line from point M (medium to L (lateral; all distances were measured in mm. Results: In Class II the A-P diameter was 9.06±1.33 and 8.86±1.56 for the right and left condyles respectively, in Class III these values were 8.71±1.2 and 8.84±1.42. In Class II the M-L diameter was 17.94±2.68 and 17.67±2.44 for the right and left condyles respectively, in Class III these values were 19.16±2.75 and 19.16±2.54. Conclusion: Class III M-L dimensions showed higher values than Class II, whereas these differences were minimal in A-P.
Directory of Open Access Journals (Sweden)
Samar A. Aly
2017-04-01
Thermal studies of these chelates before and after γ-irradiation stable that the complexes of Ru(III and Pd (II after γ-irradiation are more thermal show than Hg(II complexes before and after γ-irradiation.
Mohamed, Gehad G.; El-Gamel, Nadia E. A.
2004-11-01
The ternary piroxicam (Pir; 4-hydroxy-2-methyl- N-(2-pyridyl)-2H-1,2-benzothiazine-3-carboxamide 1,1-dioxide) complexes of Fe(II), Fe(III), Co(II), Ni(II), Cu(II) and Zn(II) with various amino acids (AA) such as glycine (Gly) or DL-phenylalanine (PhA) were prepared and characterized by elemental analyses, molar conductance, IR, UV-Vis, magnetic moment, diffuse reflectance and X-ray powder diffraction. The UV-Vis spectra of Pir and the effect of metal chelation on the different interligand transitions are discussed in detailed manner. IR and UV-Vis spectra confirm that Pir behaves as a neutral bidentate ligand coordinated to the metal ions via the pyridine- N and carbonyl group of the amide moiety. Gly molecule acted as a uninegatively monodentate ligand and coordinate to the metal ions through its carboxylic group, in addition PhA acted as a uninegatively bidentate ligand and coordinate to the metal ions through its carboxylic and amino groups. All the chelates have octahedral geometrical structures while Cu(II)- and Zn(II)-ternary chelates with PhA have square planar geometrical structures. The molar conductance data reveal that most of these chelates are non electrolytes, while Fe(III)-Pir-Gly, Co(II)-, Ni(II)-, Cu(II)- and Zn(II)-Pir-PhA cheletes were 1:1 electrolytes. X-ray powder diffraction is used as a new tool to estimate the crystallinity of chelates as well as to elucidate their geometrical structures.
DEFF Research Database (Denmark)
Huang, Li‐Zhi; Ayala‐Luis, Karina B.; Fang, Liping
2013-01-01
hydroxide planar layer were preserved during the oxidation, as shown by FTIR spectroscopy. The high positive charge in the hydroxide layer produced by the oxidation of iron(II) to iron(III) is partially compensated by the deprotonation of hydroxy groups, as shown by X‐ray photoelectron spectroscopy...... between the alkyl chains of the intercalated dodecanoate anions play a crucial role in stabilizing the structure and hindering the collapse of the iron(II)–iron(III) (hydr)oxide structure during oxidation. This is the first report describing the formation of a stable planar layered octahedral iron......(III) (hydr)oxide. oxGRC12 shows promise as a sorbent and host for hydrophobic reagents, and as a possible source of single planar layers of iron(III) (hydr)oxide....
Indian Academy of Sciences (India)
Unknown
diversity and ecology. Teaching and research had ... The habitats have a longer life, show a succession of species and end up with flagellates or with ... nic continuity (like protoplasmic connections) between the neighbouring cells. Instead of ...
RECOVERY OF COPPER(II) AND CHROMIUM(III) FROM NITRATE ...
African Journals Online (AJOL)
Guerdouh A and Barkat D
2016-05-01
May 1, 2016 ... The ionic strength of the aqueous medium was ... phases were separated completely, concentrations of the copper(II) and chromium(III) ..... [18] Huff M M, Otu E O. Solvent Extraction and Ion Exchange, 2004, 22(4), 695-712.
Perotto, Carlo U; Sodipo, Charlene L; Jones, Graham J; Tidey, Jeremiah P; Blake, Alexander J; Lewis, William; Davies, E Stephen; McMaster, Jonathan; Schröder, Martin
2018-03-05
The development of synthetic analogs of the active sites of [NiFe] hydrogenases remains challenging, and, in spite of the number of complexes featuring a [NiFe] center, those featuring CO and CN - ligands at the Fe center are under-represented. We report herein the synthesis of three bimetallic [NiFe] complexes [Ni( N 2 S 2 )Fe(CO) 2 (CN) 2 ], [Ni( S 4 )Fe(CO) 2 (CN) 2 ], and [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] that each contain a Ni center that bridges through two thiolato S donors to a {Fe(CO) 2 (CN) 2 } unit. X-ray crystallographic studies on [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ], supported by DFT calculations, are consistent with a solid-state structure containing distinct molecules in the singlet ( S = 0) and triplet ( S = 1) states. Each cluster exhibits irreversible reduction processes between -1.45 and -1.67 V vs Fc + /Fc and [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] possesses a reversible oxidation process at 0.17 V vs Fc + /Fc. Spectroelectrochemical infrared (IR) and electron paramagnetic resonance (EPR) studies, supported by density functional theory (DFT) calculations, are consistent with a Ni III Fe II formulation for [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] + . The singly occupied molecular orbital (SOMO) in [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] + is based on Ni 3d z 2 and 3p S with the S contributions deriving principally from the apical S-donor. The nature of the SOMO corresponds to that proposed for the Ni-C state of the [NiFe] hydrogenases for which a Ni III Fe II formulation has also been proposed. A comparison of the experimental structures, and the electrochemical and spectroscopic properties of [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] and its [Ni( N 2 S 3 )] precursor, together with calculations on the oxidized [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] + and [Ni( N 2 S 3 )] + forms suggests that the binding of the {Fe(CO)(CN) 2 } unit to the {Ni(CysS) 4 } center at the active site of the [NiFe] hydrogenases suppresses thiolate-based oxidative chemistry involving the bridging thiolate S donors
Clark, D. S.; Weber, C. R.; Eder, D. C.; Haan, S. W.; Hammel, B. A.; Hinkel, D. E.; Jones, O. S.; Kritcher, A. L.; Marinak, M. M.; Milovich, J. L.; Patel, P. K.; Robey, H. F.; Salmonson, J. D.; Sepke, S. M.
2016-05-01
Several dozen high convergence inertial confinement fusion ignition experiments have now been completed on the National Ignition Facility (NIF). These include both “low foot” experiments from the National Ignition Campaign (NIC) and more recent “high foot” experiments. At the time of the NIC, there were large discrepancies between simulated implosion performance and experimental data. In particular, simulations over predicted neutron yields by up to an order of magnitude, and some experiments showed clear evidence of mixing of ablator material deep into the hot spot that could not be explained at the time. While the agreement between data and simulation improved for high foot implosion experiments, discrepancies nevertheless remain. This paper describes the state of detailed modelling of both low foot and high foot implosions using 1-D, 2-D, and 3-D radiation hydrodynamics simulations with HYDRA. The simulations include a range of effects, in particular, the impact of the plastic membrane used to support the capsule in the hohlraum, as well as low-mode radiation asymmetries tuned to match radiography measurements. The same simulation methodology is applied to low foot NIC implosion experiments and high foot implosions, and shows a qualitatively similar level of agreement for both types of implosions. While comparison with the experimental data remains imperfect, a reasonable level of agreement is emerging and shows a growing understanding of the high-convergence implosions being performed on NIF.
Directory of Open Access Journals (Sweden)
Luciana Gabriel Nogueira
2014-01-01
Full Text Available Background. Chronic Chagas disease cardiomyopathy (CCC, a late consequence of Trypanosoma cruzi infection, is an inflammatory cardiomyopathy with prognosis worse than those of noninflammatory etiology (NIC. Although the T cell-rich myocarditis is known to play a pathogenetic role, the relative contribution of each of the functional T cell subsets has never been thoroughly investigated. We therefore assessed gene expression of cytokines and transcription factors involved in differentiation and effector function of each functional T cell subset (TH1/TH2/TH17/Treg in CCC, NIC, and heart donor myocardial samples. Methods and Results. Quantitative PCR showed markedly upregulated expression of IFN-γ and transcription factor T-bet, and minor increases of GATA-3; FoxP3 and CTLA-4; IL-17 and IL-18 in CCC as compared with NIC samples. Conversely, cytokines expressed by TH2 cells (IL-4, IL-5, and IL-13 or associated with Treg (TGF-β and IL-10 were not upregulated in CCC myocardium. Expression of TH1-related genes such as T-bet, IFN-γ, and IL-18 correlated with ventricular dilation, FoxP3, and CTLA-4. Conclusions. Results are consistent with a strong local TH1-mediated response in most samples, possibly associated with pathological myocardial remodeling, and a proportionally smaller FoxP3+CTLA4+ Treg cell population, which is unable to completely curb IFN-γ production in CCC myocardium, therefore fueling inflammation.
International Nuclear Information System (INIS)
Clark, D S; Weber, C R; Eder, D C; Haan, S W; Hammel, B A; Hinkel, D E; Jones, O S; Kritcher, A L; Marinak, M M; Milovich, J L; Patel, P K; Robey, H F; Salmonson, J D; Sepke, S M
2016-01-01
Several dozen high convergence inertial confinement fusion ignition experiments have now been completed on the National Ignition Facility (NIF). These include both “low foot” experiments from the National Ignition Campaign (NIC) and more recent “high foot” experiments. At the time of the NIC, there were large discrepancies between simulated implosion performance and experimental data. In particular, simulations over predicted neutron yields by up to an order of magnitude, and some experiments showed clear evidence of mixing of ablator material deep into the hot spot that could not be explained at the time. While the agreement between data and simulation improved for high foot implosion experiments, discrepancies nevertheless remain. This paper describes the state of detailed modelling of both low foot and high foot implosions using 1-D, 2-D, and 3-D radiation hydrodynamics simulations with HYDRA. The simulations include a range of effects, in particular, the impact of the plastic membrane used to support the capsule in the hohlraum, as well as low-mode radiation asymmetries tuned to match radiography measurements. The same simulation methodology is applied to low foot NIC implosion experiments and high foot implosions, and shows a qualitatively similar level of agreement for both types of implosions. While comparison with the experimental data remains imperfect, a reasonable level of agreement is emerging and shows a growing understanding of the high-convergence implosions being performed on NIF. (paper)
A review of ecological interactions between crayfish and fish, indigenous and introduced
Directory of Open Access Journals (Sweden)
Reynolds J.D.
2011-05-01
Full Text Available Crayfish (decapods and fish are both long-lived large members of freshwater communities, often functioning as keystone species. This paper reviews interactions between these, with emphasis on the European context. Native crayfish and fish are in ecological balance, which may involve mutual predation, competition and sometimes habitat disturbance. This balance is disrupted by range extensions and translocations of native fish or crayfish into exotic situations. Some fish and crayfish have been translocated globally, chiefly from North America to other continents. Non-indigenous crayfish species (NICS may impact on native fish, just as introduced fish impact on indigenous crayfish species (ICS. Competition between ICS and NICS may result in making the former susceptible to various mechanisms of interaction with fish, indigenous or introduced. In Europe, long-established NICS – signals, spiny-cheek and red swamp crayfish – may occur in greater densities than ICS; they are more tolerant and aggressive and show more interactions with fish. More recent introductions, still restricted in distribution, have not yet received enough study for their impacts to be assessed. Interactions between fish and crayfish in North and South America, Madagascar and Australasia are also explored. Mechanisms of interaction between fish and crayfish include mutual predation, competition for food and spatial resources, food-web alteration and habitat modification. Resultant changes in communities and ecosystems may be physical or biotal, and affect both ecosystem services and exploitation potential.
Ramos Fransi, Alba
2013-01-01
Els anticossos contra el receptor de l'acetilcolina representen el principal mecanisme patogènic en la Miastènia Gravis, però la seva utilitat com a biomarcador durant el seguiment de la malaltia és desconeguda.
Scientific Values: Ethical Guidelines and Procedures
Indian Academy of Sciences (India)
2017-01-01
Jan 1, 2017 ... detrimental influence on the integrity of the system and could lead to unfair and ... http://cpcsea.nic.in), Ministry of Environment, Forests and Climate. Change .... locally by the institution where the person under cloud of.
Evaluation of fertility traits of Friesian X Bunaji dairy cows ...
African Journals Online (AJOL)
Evaluation of fertility traits of Friesian X Bunaji dairy cows. ... days open (DO) , number of insemination per conception (NIC), and non- return rate 56 days ... Keywords: Fertility, Friesian x Bunaji cows, Parity, Body condition score, Season, Year ...
International Nuclear Information System (INIS)
Taj, S.; Ashraf Chaudhry, M.; Mazhar, M.
2009-01-01
Potassium iron(III)hexacyanoferrate(II) supported on poly metylmethacrylate has been synthesized and investigated for the strontium(II) removal from HNO 3 and HCl solutions. The ion exchange material characterized by different techniques and found to be stable in 1.0-4.0 M HNO 3 solutions, has been used to elaborate different parameters related to ion exchange and sorption processes involved. The data collected suggested its use to undertake removal of Sr(II) from more acidic active waste solutions. Thus the material synthesized had been adjudged to present better chances of application for Sr(II) removal as compared to other such materials. (author)
Role of CSL-dependent and independent Notch signaling pathways in cell apoptosis.
Zeng, Chong; Xing, Rui; Liu, Jing; Xing, Feiyue
2016-01-01
Apoptosis is a normally biological phenomenon in various organisms, involving complexly molecular mechanisms with a series of signaling processes. Notch signaling is found evolutionarily conserved in many species, playing a critical role in embryonic development, normal tissue homeostasis, angiogenesis and immunoregulation. The focus of this review is on currently novel advances about roles of CSL-dependent and independent Notch signaling pathways in cell apoptosis. The CSL can bind Notch intracellular domain (NIC) to act as a switch in mediating transcriptional activation or inactivation of the Notch signaling pathway downstream genes in the nucleus. It shows that CSL-dependent signaling regulates the cell apoptosis through Hes-1-PTEN-AKT-mTOR signaling, but rather the CSL-independent signaling mediates the cell apoptosis possibly via NIC-mTORC2-AKT-mTOR signaling, providing a new insight into apoptotic mechanisms.
International Nuclear Information System (INIS)
Sebuov, F.A.; Dzhemilev, U.M.; Ruttan, O.G.
1986-01-01
A study was carried out on the reaction of C 2 -C 6 aliphatic acid chlorides with t-BuOH, isobutylene and NH 3 by the action of transition and non-transition metal salts (A1C1 3 , ZnC1 2 , InC1 3 , TiC1 4 , TiC1 3 , WC1 6 , FeC1 3 , CoC1 2 , NiC1 2 and PdC1 2 ) and bimetallic systems A1C1 3 -NiC1 2 and A1C1 3 -PdC1 2 in a search for new catalysts for this reaction which provide for the formation of 2,4,6-trimethylpyridine (I), which has practical importance, and to determine the possibility of using other acid chlorides and isobutylene in this reaction
LLE 2008 annual report, October 2007 - September 2008
Energy Technology Data Exchange (ETDEWEB)
None
2009-01-31
The research program at the University of Rochester’s Laboratory for Laser Energetics (LLE) focuses on inertial confinement fusion (ICF) research supporting the goal of achieving ignition on the National Ignition Facility (NIF). This program includes the full use of the OMEGA EP Laser System. Within the National Ignition Campaign (NIC), LLE is the lead laboratory for the validation of the performance of cryogenic target implosions, essential to all forms of ICF ignition. LLE has taken responsibility for a number of critical elements within the Integrated Experimental Teams (IET’s) supporting the demonstration of indirect-drive ignition on the NIF and is the lead laboratory for the validation of the polardrive approach to ignition on the NIF. LLE is also developing, testing, and building a number of diagnostics to be deployed on the NIF for the NIC.
International Nuclear Information System (INIS)
Iftikhar, Abdur Rauf; Bhatti, Haq Nawaz; Hanif, Muhammad Asif; Nadeem, Razyia
2009-01-01
Distillation waste of rose petals was used to remove Cu(II) and Cr(III) from aqueous solutions. The results demonstrated the dependency of metal sorption on pH, sorbent dose, sorbent size, initial bulk concentration, time and temperature. A dosage of 1 g/L of rose waste biomass was found to be effective for maximum uptake of Cu(II) and Cr(III). Optimum sorption temperature and pH for Cu(II) and Cr(III) were 303 ± 1 K and 5, respectively. The Freundlich regression model and pseudo-second-order kinetic model were resulted in high correlation coefficients and described well the sorption of Cu(II) and Cr(III) on rose waste biomass. At equilibrium q max (mg/g) of Cu(II) and Cr(III) was 55.79 and 67.34, respectively. The free energy change (ΔG o ) for Cu(II) and Cr(III) sorption process was found to be -0.829 kJ/mol and -1.85 kJ/mol, respectively, which indicates the spontaneous nature of sorption process. Other thermodynamic parameters such as entropy change (ΔS o ), enthalpy (ΔH o )and activation energy (ΔE) were found to be 0.604 J mol -1 K -1 , -186.95 kJ/mol and 68.53 kJ/mol, respectively for Cu(II) and 0.397 J mol -1 K -1 , -119.79 kJ/mol and 114.45 kJ/mol, respectively for Cr(III). The main novelty of this work was the determination of shortest possible sorption time for Cu(II) and Cr(III) in comparison to earlier studies. Almost over 98% of Cu(II) and Cr(III) were removed in only first 20 min at an initial concentration of 100 mg/L
Investigation on the electrode process of the Mn(II)/Mn(III) couple in redox flow battery
International Nuclear Information System (INIS)
Xue Fangqin; Wang Yongliang; Wang Wenhong; Wang Xindong
2008-01-01
The Mn(II)/Mn(III) couple has been recognized as a potential anode for redox flow batteries to take the place of the V(IV)/V(V) in all-vanadium redox battery (VRB) and the Br 2 /Br - in sodium polysulfide/bromine (PSB) because it has higher standard electrode potential. In this study, the electrochemical behavior of the Mn(II)/Mn(III) couple on carbon felt and spectral pure graphite were investigated by cyclic voltammetry, steady polarization curve, electrochemical impedance spectroscopy, transient potential-step experiment, X-ray diffraction and charge-discharge experiments. Results show that the Mn(III) disproportionation reaction phenomena is obvious on the carbon felt electrode while it is weak on the graphite electrode owing to its fewer active sites. The reaction mechanism on carbon felt was discussed in detail. The reversibility of Mn(II)/Mn(III) is best when the sulfuric acid concentration is 5 M on the graphite electrode. Performance of a RFB employing Mn(II)/Mn(III) couple as anolyte active species and V(III)/V(II) as catholyte ones was evaluated with constant-current charge-discharge tests. The average columbic efficiency is 69.4% and the voltage efficiency is 90.4% at a current density of 20 mA cm -2 . The whole energy efficiency is 62.7% close to that of the all-vanadium battery and the average discharge voltage is about 14% higher than that of an all-vanadium battery. The preliminary exploration shows that the Mn(II)/Mn(III) couple is electrochemically promising for redox flow battery
AIDS IN DENTAL PRACTICE IN THE TROPICS.
African Journals Online (AJOL)
DENTAL JOURNAL ol. iour with- eds. n the ese, .... In a preliminary investigation of 40 patients aHending Dental. OPD cli'nic in the period ..... ty is largely of academic and epidemiological values. TABLE: ... Nodular and plaque like hyperplasia.
Genetic admixture studies on four in situ evolved, two migrant and ...
Indian Academy of Sciences (India)
2011-08-19
Aug 19, 2011 ... hand, in hypergamy women can adopt the caste and social status of the men ..... priestly communities), Nattukkottai Chettiar (trading com- munity) and ..... nic groups at varied times as a result of interaction with the prevailing ...
Indian Academy of Sciences (India)
user
insa.ac.in; http://www.nasi.nic. N Mukunda and S C Lakhotia. 1. Chairman, Science Education Panel, Indian Academy of Sciences, Bangalore 560 012, India. Email: nmukunda@ias.ernet.in. 2. Convener, Panel for Science Education, Indian ...
Sequence Classification: 378211 [
Lifescience Database Archive (English)
Full Text Available nic acid to mannopinic acid || http://www.ncbi.nlm.nih.gov/protein/13475930 ... ...Non-TMB TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|13475930|ref|NP_107500.1| AgaE protein, conversion of agropi
Alcuni aspetti della discalculia e della dislessia
Directory of Open Access Journals (Sweden)
Domenico Lenzi
2014-01-01
Full Text Available In this paper some difficulties associated with dyscalculia and dyslexia are examined. Several of these difficulties depend either on mnemo-nic problems or on lateralization defects. Here some suggestions in order to weaken them are proposed
International Nuclear Information System (INIS)
Islam, M.F.; Begum, D.A.; Rahman, M.; Rahman, M.S.
2009-01-01
In the study of the extractive separation of Al(III) and Ni(II) by di-2-ethylhexyl phosphoric acid D2EHPA-kerosene from aqueous fluoride medium, about 94% Al(III) and 2% Ni(II) were extracted with 0.3 M D2EHPA (pH 2.1 and temperature 30+-1 degree C). Extraction of Ni(II) decreased with increasing extractant concentration. D2EHPA-kerosene-fluoride system showed better extraction of Al(III) with higher extractant concentration and aqueous pH and vice versa for the extraction of Ni(II). The maximum separation factor (beta 1380) was obtained for Al(III) at 20 degree C and decreased to (beta 732) at 60 degree C. The separation of Al(III) from Ni(II) was favoured at normal temperature. Extraction followed the order Al(III), Ni(II). About 99% stripping of Al(III) was attained from the loaded 0.20 M D2EHPA. Much faster extraction of Al(III) compared to Ni(II) and preferential loading were shown by D2EHPA-kerosene in the presence of fluoride ion in the aqueous phase. Separation of Al(III) was the most outstanding from Ni-Al-F-complex solution. (author)
Mechanism of selective recruitment of RNA polymerases II and III to snRNA gene promoters.
Dergai, Oleksandr; Cousin, Pascal; Gouge, Jerome; Satia, Karishma; Praz, Viviane; Kuhlman, Tracy; Lhôte, Philippe; Vannini, Alessandro; Hernandez, Nouria
2018-05-01
RNA polymerase II (Pol II) small nuclear RNA (snRNA) promoters and type 3 Pol III promoters have highly similar structures; both contain an interchangeable enhancer and "proximal sequence element" (PSE), which recruits the SNAP complex (SNAPc). The main distinguishing feature is the presence, in the type 3 promoters only, of a TATA box, which determines Pol III specificity. To understand the mechanism by which the absence or presence of a TATA box results in specific Pol recruitment, we examined how SNAPc and general transcription factors required for Pol II or Pol III transcription of SNAPc-dependent genes (i.e., TATA-box-binding protein [TBP], TFIIB, and TFIIA for Pol II transcription and TBP and BRF2 for Pol III transcription) assemble to ensure specific Pol recruitment. TFIIB and BRF2 could each, in a mutually exclusive fashion, be recruited to SNAPc. In contrast, TBP-TFIIB and TBP-BRF2 complexes were not recruited unless a TATA box was present, which allowed selective and efficient recruitment of the TBP-BRF2 complex. Thus, TBP both prevented BRF2 recruitment to Pol II promoters and enhanced BRF2 recruitment to Pol III promoters. On Pol II promoters, TBP recruitment was separate from TFIIB recruitment and enhanced by TFIIA. Our results provide a model for specific Pol recruitment at SNAPc-dependent promoters. © 2018 Dergai et al.; Published by Cold Spring Harbor Laboratory Press.
International Nuclear Information System (INIS)
Ding, Dahu; Lei, Zhongfang; Yang, Yingnan; Feng, Chuanping; Zhang, Zhenya
2014-01-01
Highlights: • Novel biosorbent for cesium removal was derived from agricultural residue. • It could remove cesium effectively from aqueous solution. • Large size of granules makes it easy to be separated from solutions. • The volume of used biosorbent could be significantly reduced after incineration. • Incinerated biosorbent has a low volume and a low cost final disposal. - Abstract: A novel nickel (II) hexacyanoferrate (III) functionalized agricultural residue-walnut shell (Ni II HCF III -WS) was developed to selectively remove cesium ion (Cs + ) from aqueous solutions. This paper showed the first integral study on Cs + removal behavior and waste reduction analysis by using biomass adsorption material. The results indicated that the removal process was rapid and reached saturation within 2 h. As a special characteristic of Ni II HCF III -WS, acidic condition was preferred for Cs + removal, which was useful for extending the application scope of the prepared biomass material in treating acidic radioactive liquid waste. The newly developed Ni II HCF III -WS could selectively remove Cs + though the coexisting ions (Na + and K + in this study) exhibited negative effects. In addition, approximately 99.8% (in volume) of the liquid waste was reduced by using Ni II HCF III -WS and furthermore 91.9% (in volume) of the spent biomass material (Cs-Ni II HCF III -WS) was reduced after incineration (at 500 °C for 2 h). Due to its relatively high distribution coefficient and significant volume reduction, Ni II HCF III -WS is expected to be a promising material for Cs + removal in practice
Identification and characterization of Bms3a in Bombyx mori L.
African Journals Online (AJOL)
STORAGESEVER
2008-10-06
Oct 6, 2008 ... nic line 306NNZZ, were raised on artificial diet to the fifth instar. For each strain, 50 newly ..... It is reasonable to note that silkworm body performs self- defence resulting in cells ... 07080703023), China Postdoc- toral Science ...
Febriana, Sri Awalia; Jungbauer, Frank; Soebono, Hardyanto; Coenraads, Pieter-Jan
Tannery workers are exposed to hazardous chemicals. Tannery work is outsourced to newly industrialized countries (NICs) where attention into occupational health hazards is limited. In this study, we investigated the skin exposure to hazardous chemicals in tannery workers and determined the
Directory of Open Access Journals (Sweden)
Luciana Regina Ferreira da Mata
2012-12-01
Full Text Available Este estudo faz uma análise sobre o uso de diferentes sistemas de classificação e o atendimento aos padrões estabelecidos pela ISO 18.104:2003 a partir de uma situação clínica fictícia. Foram elaborados diagnósticos e intervenções de enfermagem utilizando a NANDA-I, NIC e CIPE®, e analisou-se a correspondência terminológica destes sistemas de classificação ao modelo proposto pela norma ISO 18.104:2003. Para a construção de diagnósticos de enfermagem, a NANDA-I e a CIPE® adequando-se à norma ISO 18.104:2003. Para a construção das intervenções de enfermagem, a CIPE® atende ao modelo de referência terminológica proposto pela ISO 18104:2003. Por sua vez, a NIC não propõe um modelo de referência terminológica combinatória. A unificação das terminologias de enfermagem depende da revisão, padronização e teste dessas classificações para o estabelecimento de uma linguagem comum e sólida da profissão.El estudio analiza el uso de diferentes sistemas de clasificación y la atención de los patrones establecidos por la ISO 18.104:2003, a partir de una situación clínica ficticia. Fueron elaborados diagnósticos e intervenciones de enfermería utilizando la NANDA-I, NIC y CIPE® y se analizó la correspondencia terminológica de tales sistemas de clasificación al modelo propuesto por la norma ISO 18.104:2003. Para la construcción de diagnósticos de enfermería, la NANDA-I y la CIPE® se adecuan a la construcción de diagnósticos de enfermería. Para la construcción de intervenciones de enfermería, la CIPE® atiende al modelo de referencia terminológica propuesto por la ISO 18.104:2003. A su vez, la NIC no propone un modelo de referencia terminológica combinatoria. La unificación de las terminologías de enfermería depende de la revisión, estandarización y prueba de dichas clasificaciones para el establecimiento de un lenguaje común y sólido propio de la profesión.This study analyzes the use of
The Barcelona Hospital Clínic therapeutic apheresis database.
Cid, Joan; Carbassé, Gloria; Cid-Caballero, Marc; López-Púa, Yolanda; Alba, Cristina; Perea, Dolores; Lozano, Miguel
2017-09-22
A therapeutic apheresis (TA) database helps to increase knowledge about indications and type of apheresis procedures that are performed in clinical practice. The objective of the present report was to describe the type and number of TA procedures that were performed at our institution in a 10-year period, from 2007 to 2016. The TA electronic database was created by transferring patient data from electronic medical records and consultation forms into a Microsoft Access database developed exclusively for this purpose. Since 2007, prospective data from every TA procedure were entered in the database. A total of 5940 TA procedures were performed: 3762 (63.3%) plasma exchange (PE) procedures, 1096 (18.5%) hematopoietic progenitor cell (HPC) collections, and 1082 (18.2%) TA procedures other than PEs and HPC collections. The overall trend for the time-period was progressive increase in total number of TA procedures performed each year (from 483 TA procedures in 2007 to 822 in 2016). The tracking trend of each procedure during the 10-year period was different: the number of PE and other type of TA procedures increased 22% and 2818%, respectively, and the number of HPC collections decreased 28%. The TA database helped us to increase our knowledge about various indications and type of TA procedures that were performed in our current practice. We also believe that this database could serve as a model that other institutions can use to track service metrics. © 2017 Wiley Periodicals, Inc.
Cunha, Graziele da Costa; Goveia, Danielle; Romão, Luciane Pimenta Cruz; de Oliveira, Luciana Camargo
2015-05-01
The effect of competition of Cu(II) and Ni(II) on the kinetic stability of Cr(III) complexed with natural organic matter (NOM) was characterized using EDTA exchange with single-stage tangential-flow ultrafiltration. For a water sample from Serra de Itabaiana, 3% of spiked Cr(III) was exchanged, while for a sample from the Itapanhaú River, 7, 10, 10, and 21% was exchanged in experiments using Cr(III) alone and in combination with Cu(II), Ni(II), or Cu(II) + Ni(II), respectively. Times required to reach exchange equilibrium with EDTA were less than 360 min. The influence of competition from Ni(II) and Cu(II) on the availability of complexed Cr(III) was low, demonstrating preference of the ligand sites for Cr(III). This was correlated with sample humification, as confirmed by EPR and (13)C NMR analyses. Exchange efficiency was in the order Cu > Ni > Cr, and the process could be readily described by first order kinetics, with average rate constants of 0.35-0.37 h(-1). Copyright © 2015 Elsevier Ltd. All rights reserved.
Separation of americium (III) and strontium (II) using TEHDGA and 18-crown-6
Energy Technology Data Exchange (ETDEWEB)
Sinharoy, Prithwish; Khan, Pasupati Nath; Nair, Deepika; Jagasia, Poonam; Dhami, P.S.; Kaushik, C.P.; Banerjee, Kalyan [Bhabha Atomic Research Centre, Mumbai (India). Nuclear Recycle Group; Anitha, M. [Bhabha Atomic Research Centre, Mumbai (India). Rare Earth Development Section; Sharma, J.N. [Bhabha Atomic Research Centre, Mumbai (India). Process Development Div.
2017-06-01
This work describes extraction of Am(III) and Sr(II) together with tetra(2-ethylhexyl) diglycolamide (TEHDGA) and selective back-extraction of strontium with a strontium complexant, 18-crown-6, leading to their separation from each other. 0.3 M TEHDGA+5% isodecyl alcohol/n-dodecane was used to extract Am(III) and Sr(II) from 4 M nitric acid into organic phase with very high D (D{sub Am}=1000, D{sub Sr}=22) and 0.1 M 18-crown-6 dissolved in 4 M nitric acid is used for selective stripping of Sr(II) from loaded extract phase. Am(III) left in the extract phase was then stripped with 0.01 M nitric acid. Stripping of Sr(II) was found to increase with increase in 18-crown-6 concentration, at 0.1 M 18-crown-6 dissolved in 4 M nitric acid, 83% of the loaded strontium (D{sub Sr}=0.20) was back-extracted in a single contact while loss of Am(III) was 0.8% (D{sub Am}=122.45). Stoichiometry limit of 1:1 was observed between strontium and 18-crown-6. Strontium was precipitated and separated from the complexant by Na{sub 2}SO{sub 4} or Na{sub 2}CO{sub 3}. This process was tested with simulated solution of high level waste and found suitable for quantitative recovery of strontium with high purity.
Evaluation of lymph node numbers for adequate staging of Stage II and III colon cancer
Directory of Open Access Journals (Sweden)
Bumpers Harvey L
2011-05-01
Full Text Available Abstract Background Although evaluation of at least 12 lymph nodes (LNs is recommended as the minimum number of nodes required for accurate staging of colon cancer patients, there is disagreement on what constitutes an adequate identification of such LNs. Methods To evaluate the minimum number of LNs for adequate staging of Stage II and III colon cancer, 490 patients were categorized into groups based on 1-6, 7-11, 12-19, and ≥ 20 LNs collected. Results For patients with Stage II or III disease, examination of 12 LNs was not significantly associated with recurrence or mortality. For Stage II (HR = 0.33; 95% CI, 0.12-0.91, but not for Stage III patients (HR = 1.59; 95% CI, 0.54-4.64, examination of ≥20 LNs was associated with a reduced risk of recurrence within 2 years. However, examination of ≥20 LNs had a 55% (Stage II, HR = 0.45; 95% CI, 0.23-0.87 and a 31% (Stage III, HR = 0.69; 95% CI, 0.38-1.26 decreased risk of mortality, respectively. For each six additional LNs examined from Stage III patients, there was a 19% increased probability of finding a positive LN (parameter estimate = 0.18510, p Conclusions Thus, the 12 LN cut-off point cannot be supported as requisite in determining adequate staging of colon cancer based on current data. However, a minimum of 6 LNs should be examined for adequate staging of Stage II and III colon cancer patients.
Kinetics and Products of Chromium(VI) Reduction by Iron(II/III)-Bearing Clay Minerals.
Joe-Wong, Claresta; Brown, Gordon E; Maher, Kate
2017-09-05
Hexavalent chromium is a water-soluble pollutant, the mobility of which can be controlled by reduction of Cr(VI) to less soluble, environmentally benign Cr(III). Iron(II/III)-bearing clay minerals are widespread potential reductants of Cr(VI), but the kinetics and pathways of Cr(VI) reduction by such clay minerals are poorly understood. We reacted aqueous Cr(VI) with two abiotically reduced clay minerals: an Fe-poor montmorillonite and an Fe-rich nontronite. The effects of ionic strength, pH, total Fe content, and the fraction of reduced structural Fe(II) [Fe(II)/Fe(total)] were examined. The last variable had the largest effect on Cr(VI) reduction kinetics: for both clay minerals, the rate constant of Cr(VI) reduction varies by more than 3 orders of magnitude with Fe(II)/Fe(total) and is described by a linear free energy relationship. Under all conditions examined, Cr and Fe K-edge X-ray absorption near-edge structure spectra show that the main Cr-bearing product is a Cr(III)-hydroxide and that Fe remains in the clay structure after reacting with Cr(VI). This study helps to quantify our understanding of the kinetics of Cr(VI) reduction by Fe(II/III)-bearing clay minerals and may improve predictions of Cr(VI) behavior in subsurface environments.
AbouEl-Enein, S A; El-Saied, F A; Kasher, T I; El-Wardany, A H
2007-07-01
Salicylidene-N-anilinoacetohydrazone (H(2)L(1)) and 2-hydroxy-1-naphthylidene-N-anilinoacetohydrazone (H(2)L(2)) and their iron(III), manganese(II), cobalt(II), nickel(II), copper(II) and zinc(II) complexes have been synthesized and characterized by IR, electronic spectra, molar conductivities, magnetic susceptibilities and ESR. Mononuclear complexes are formed with molar ratios of 1:1, 1:2 and 1:3 (M:L). The IR studies reveal various modes of chelation. The electronic absorption spectra and magnetic susceptibility measurements show that the iron(III), nickel(II) and cobalt(II) complexes of H(2)L(1) have octahedral geometry. While the cobalt(II) complexes of H(2)L(2) were separated as tetrahedral structure. The copper(II) complexes have square planar stereochemistry. The ESR parameters of the copper(II) complexes at room temperature were calculated. The g values for copper(II) complexes proved that the Cu-O and Cu-N bonds are of high covalency.
Effect of ionizing radiation on the activity of restriction nucleases PvuII and HindIII
International Nuclear Information System (INIS)
Luzova, M.; Michaelidesova, A.; Davidkova, M.
2014-01-01
The research is focused on the influence of the ionizing radiation on the activity of the restriction enzymes PvuII and HindIII. Enzymes PvuII and HindIII are restriction endonucleases of type II. These enzymes can be found in bacteria and they have a significant role in defense mechanisms of bacteria against viruses. They cleave DNA double helix at specific recognition palindromic sequences in the presence of cofactor Mg 2+ . PvuII cleaves the sequence CAG↓CTG and HindIII cleaves the sequence A↓AGCTT in marked places. Plasmid pcDNA3 has been used as the DNA substrate for the whole experimental study. It is 5446 base pairs (bp) long, circular DNA molecule and it contains three recognition sites for enzyme PvuII and one recognition site for enzyme HindIII. After the correct interaction of pcDNA3 with PvuII, we thus have three plasmid fragments with lengths 1069, 1097 and 3280 bp. When HindIII is incubated with this plasmid, we shall obtain the linear form of the DNA plasmid.The method for processing the cleaved DNA samples is the agarose gel electrophoresis. The activity of the irradiated enzymes decreases with increasing dose of radiation, because a part of the enzymes is deactivated due to induced radiation damage. To determine effect of radiation quality, samples were irradiated using proton and gamma sources. The results of our experimental study will be presented and discussed with respect to molecular structure of both enzymes and particular sites of radical damage influencing their function. (authors)
Zabolotskikh, I B; Musaeva, T S; Denisova, E A
2012-01-01
to estimate efficiency of APACHE II, APACHE III, SAPS II, SAPS III, SOFA scales for obstetric patients with heavy sepsis. 186 medical cards retrospective analysis of pregnant women with pulmonary sepsis, 40 women with urosepsis and puerperas with abdominal sepsis--66 was performed. Middle age of women was 26.7 (22.4-34.5). In population of puerperas with abdominal sepsis APACHE II, APACHE III, SAPS 2, SAPS 3, SOFA scales showed to good calibration, however, high resolution was observed only in APACHE III, SAPS 3 and SOFA (AUROC 0.95; 0.93; 0.92 respectively). APACHE III and SOFA scales provided qualitative prognosis in pregnant women with urosepsis; resolution ratio of these scales considerably exceeds APACHE II, SAPS 2 and SAPS 3 (AUROC 0.73; 0.74; 0.79 respectively). APACHE II scale is inapplicable because of a lack of calibration (X2 = 13.1; p < 0.01), and at other scales (APACHE III, SAPS 2, SAPS 3, SOFA) was observed the insufficient resolution (AUROC < 0.9) in pregnant women with pulmonary sepsis. Prognostic possibilities assessment of score scales showed that APACHE III, SAPS 3 and SOFA scales can be used for a lethality prognosis for puerperas with abdominal sepsis, in population of pregnant women with urosepsis--only APACHE III and SOFA, and with pulmonary sepsis--SAPS 3 and APACHE III only in case of additional clinical information.
Energy Technology Data Exchange (ETDEWEB)
Ding, Dahu, E-mail: dingdahu@gmail.com [Graduate School of Life and Environmental Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8572 (Japan); Lei, Zhongfang; Yang, Yingnan [Graduate School of Life and Environmental Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8572 (Japan); Feng, Chuanping [School of Water Resources and Environment, China University of Geosciences (Beijing), Key Laboratory of Groundwater Circulation and Evolution, Ministry of Education, Beijing 100083 (China); Zhang, Zhenya, E-mail: zhang.zhenya.fu@u.tsukuba.ac.jp [Graduate School of Life and Environmental Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8572 (Japan)
2014-04-01
Highlights: • Novel biosorbent for cesium removal was derived from agricultural residue. • It could remove cesium effectively from aqueous solution. • Large size of granules makes it easy to be separated from solutions. • The volume of used biosorbent could be significantly reduced after incineration. • Incinerated biosorbent has a low volume and a low cost final disposal. - Abstract: A novel nickel (II) hexacyanoferrate (III) functionalized agricultural residue-walnut shell (Ni{sup II}HCF{sup III}-WS) was developed to selectively remove cesium ion (Cs{sup +}) from aqueous solutions. This paper showed the first integral study on Cs{sup +} removal behavior and waste reduction analysis by using biomass adsorption material. The results indicated that the removal process was rapid and reached saturation within 2 h. As a special characteristic of Ni{sup II}HCF{sup III}-WS, acidic condition was preferred for Cs{sup +} removal, which was useful for extending the application scope of the prepared biomass material in treating acidic radioactive liquid waste. The newly developed Ni{sup II}HCF{sup III}-WS could selectively remove Cs{sup +} though the coexisting ions (Na{sup +} and K{sup +} in this study) exhibited negative effects. In addition, approximately 99.8% (in volume) of the liquid waste was reduced by using Ni{sup II}HCF{sup III}-WS and furthermore 91.9% (in volume) of the spent biomass material (Cs-Ni{sup II}HCF{sup III}-WS) was reduced after incineration (at 500 °C for 2 h). Due to its relatively high distribution coefficient and significant volume reduction, Ni{sup II}HCF{sup III}-WS is expected to be a promising material for Cs{sup +} removal in practice.
[meso-5,10,15,20-Tetrakis(5-bromothiophen-2-ylporphyrinato-κ4N,N′,N′′,N′′′]nickel(II
Directory of Open Access Journals (Sweden)
R. Prasath
2012-04-01
Full Text Available The NiII atom in the title porphyrin complex, [Ni(C36H16Br4N4S4], is in a square-planar geometry defined by four pyrrole N atoms. There is considerable buckling in the porphyrin ring with the dihedral angles between the N4 donor set and the pyrrole rings being in the range 17.0 (3–18.8 (3°. Each of the six-membered chelate rings is twisted about an Ni—N bond and the dihedral angles between diagonally opposite chelate rings are 13.08 (15 and 13.45 (11°; each pair of rings is orientated in opposite directions. The bromothienyl rings are twisted out of the plane of the central N4 core with dihedral angles in the range 51.7 (2–74.65 (19°. Supramolecular chains along [001] are formed through C—H...Br interactions in the crystal packing. Three of the four bromothienyl units are disordered over two coplanar positions of opposite orientation with the major components being in 0.691 (3, 0.738 (3 and 0.929 (9 fractions.
50 CFR 23.4 - What are Appendices I, II, and III?
2010-10-01
... (CONTINUED) TAKING, POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF... of Appendix-I, -II, and -III species and their parts, products, and derivatives through a system of...
Rao, Tadimeti S; Adams, Pamala B; Correa, Lucia D; Santori, Emily M; Sacaan, Aida I; Reid, Richard T; Suto, Carla M; Vernier, Jean Michel
2003-08-15
SIB-1553A ((+/-)-4-[2-(1-methyl-2-pyrrolidinyl)ethyl]thio]phenol HCl) is a neuronal nicotinic acetylcholine receptor (nAChR) ligand which displaced the binding of [3H]nicotine (NIC) to the rat brain nAChRs with an IC(50) value of 110 nM with no appreciable affinity to the alpha7 nAhRs. SIB-1553A showed modest affinity for histaminergic (H3) and serotonergic (5-HT1 and 5-HT2) receptors, and sigma binding sites. In calcium flux assays, SIB-1553A (0.1-5 microM), in contrast to nicotine, showed a greater selectivity for beta4-subunit containing recombinant hnAChRs (alpha2beta4, alpha3beta4 and alpha4beta4) vs. beta2-subunit containing nAChRs (alpha4beta2 and alpha3beta2) both in terms of efficacy and potency. While NIC (10-30 microM) and epibatidine (0.01-0.1 microM) fully activated human muscle-type AChRs expressed by RD cell line, SIB-1553A was virtually ineffective for up to >100 microM and elicited less than 10% of the response due to suberyldicholine. SIB-1553A (< or =30 microM) evoked [3H]DA release from striatum, olfactory tubercles and prefrontal cortex (PFC), and [3H]NE release from hippocampus and PFC, and this evoked release was sensitive to mecamylamine (MEC). SIB-1553A-evoked neurotransmitter release exhibited region- and transmitter-specific antagonism by dehydro-beta-erythroidine (DHbetaE). SIB-1553A was less efficacious than NIC at evoking [3H]NE from the rat hippocampus and antagonized NIC response upon co-application implying partial agonist properties. SIB-1553A did not evoke basal [3H]ACh release from the rat striatum or hippocampus, but attenuated NMDA-evoked [3H]ACh release from the rat striatum. SIB-1553A did not inhibit rat brain cholinesterase for up to 1 mM. Multiple receptor affinities and release of several neurotransmitters may underlie the cognitive-enhancing effects of SIB-1553A documented in rodent and primate models.
Directory of Open Access Journals (Sweden)
Carla Weidle Marques da Cruz
2013-01-01
Full Text Available OBJETIVO: Desenvolver um instrumento para medir o tempo despendido pela equipe de enfermagem, nas intervenções realizadas em centros de diagnóstico por imagem. MÉTODOS: Estudo transversal desenvolvido em hospital geral particular, conforme estas etapas: A Identificação das atividades de enfermagem por meio de revisão bibliográfica e observação em campo. B Mapeamento cruzado das atividades identificadas em intervenções de enfermagem, conforme a Classificação de Intervenções de Enfermagem (NIC. C Validação das intervenções. D Teste-piloto do instrumento com utilização da técnica de amostragem do trabalho. RESULTADOS: Foram validadas pelos juízes 92 atividades de enfermagem correspondentes a 32 intervenções da Classificação de Intervenções de Enfermagem NIC. As intervenções mais frequentes foram: Assistência em Exames, Documentação, Gerenciamento de Caso, Acompanhamento por telefone, Cuidados na admissão e Troca de Informações sobre cuidados de Saúde. CONCLUSÃO: O instrumento proposto para medição do tempo de trabalho da enfermagem, fundamentado nas intervenções de enfermagem em Centro de Diagnóstico por Imagem, foi validado e encontra-se disponível para utilização.OBJECTIVE: To develop an instrument to measure the time spent by nursing staff in interventions performed in diagnostic imaging centers. METHODS: Cross-sectional study conducted in private general hospital, according to these steps: A Identification of nursing activities through literature review and field observation. B Crossed-mapping of the activities identified in nursing interventions, according to the Nursing Interventions Classification (NIC. C Validation of interventions. D Pilot-test with instrument's utilization, with work-sampling technique. RESULTS: Were validated by the judges 92 nursing activities corresponding to 32 interventions NIC.. These interventions were most frequent: Assistance in exams, Documentation, Case Management
Directory of Open Access Journals (Sweden)
Jacob Thomas
Full Text Available Integrative and conjugative elements (ICEs are agents of horizontal gene transfer and have major roles in evolution and acquisition of new traits, including antibiotic resistances. ICEs are found integrated in a host chromosome and can excise and transfer to recipient bacteria via conjugation. Conjugation involves nicking of the ICE origin of transfer (oriT by the ICE-encoded relaxase and transfer of the nicked single strand of ICE DNA. For ICEBs1 of Bacillus subtilis, nicking of oriT by the ICEBs1 relaxase NicK also initiates rolling circle replication. This autonomous replication of ICEBs1 is critical for stability of the excised element in growing cells. We found a conserved and previously uncharacterized ICE gene that is required for conjugation and replication of ICEBs1. Our results indicate that this gene, helP (formerly ydcP, encodes a helicase processivity factor that enables the host-encoded helicase PcrA to unwind the double-stranded ICEBs1 DNA. HelP was required for both conjugation and replication of ICEBs1, and HelP and NicK were the only ICEBs1 proteins needed for replication from ICEBs1 oriT. Using chromatin immunoprecipitation, we measured association of HelP, NicK, PcrA, and the host-encoded single-strand DNA binding protein Ssb with ICEBs1. We found that NicK was required for association of HelP and PcrA with ICEBs1 DNA. HelP was required for association of PcrA and Ssb with ICEBs1 regions distal, but not proximal, to oriT, indicating that PcrA needs HelP to progress beyond nicked oriT and unwind ICEBs1. In vitro, HelP directly stimulated the helicase activity of the PcrA homologue UvrD. Our findings demonstrate that HelP is a helicase processivity factor needed for efficient unwinding of ICEBs1 for conjugation and replication. Homologues of HelP and PcrA-type helicases are encoded on many known and putative ICEs. We propose that these factors are essential for ICE conjugation, replication, and genetic stability.
2011-07-21
... advance internal quality assurance. The awardee will work closely with designated NIC staff on all aspects... services, and (3) provide sufficient guidance for an organization to begin to strategize desired internal... technical assistance, additional funding, or enhancing internal quality assurance. Purpose: This methodology...
2011-07-27
...--Warden, Associate Warden, Jail Administrator or Health Services Administrator. The complexities of a dual... Instructional Theory Into Practice (ITIP) model. The occurrence of strategic partnerships within organizations... Considerations: Applications received under this announcement will be subject to a NIC review process consisting...
Avoiding the Oil Curse in Ghana
African Journals Online (AJOL)
chifaou.amzat
2013-09-28
Sep 28, 2013 ... The Newly Industrialising Countries (NICs) of East Asia, such as Ko- rea and Singapore .... source-rich countries tend to rely less on taxation by citizens and more on .... The role of TNCs in the oil-development nexus is a more.
Social Media Facebook Twitter YouTube Search Search For Go NWS All NOAA Weather Analysis & Forecasts of Commerce Ocean Prediction Center National Oceanic and Atmospheric Administration Analysis & Unified Surface Analysis Ocean Ocean Products Ice & Icebergs NIC Ice Products NAIS Iceberg Analysis
of Commerce Ocean Prediction Center National Oceanic and Atmospheric Administration Analysis & Unified Surface Analysis Ocean Ocean Products Ice & Icebergs NIC Ice Products NAIS Iceberg Analysis Social Media Facebook Twitter YouTube Search Search For Go NWS All NOAA NWS Marine Forecast Areas
Febriana, Sri Awalia; Soebono, Hardyanto; Coenraads, Pieter-Jan
Purpose Shoe manufacturing workers are exposed daily to an extensive range of potential physical and chemical occupational hazards. Shoe manufacturing in Indonesia is one of the industrial sectors that has shown sustained growth amongst the newly industrialized countries (NICs). In this study, we
75 FR 65510 - Agency Information Collection Activities: Proposed Collection; Comments Requested
2010-10-25
... of Information Collection Under Review: Permanent Provisions of the Brady Handgun Violence Prevention... collection. (2) Title of the Form/Collection: Permanent Provisions of the Brady Handgun Violence Prevention... the establishment of a national instant criminal background check system (NICS) which requires that a...
Directory of Open Access Journals (Sweden)
K. S. SIDDIQI
2004-09-01
Full Text Available Reaction of [M(ppn2]X2 (where M = Cu(II, Ni(II, Co(II and ppn = 1,3-diaminopropane with formaldehyde and ethylenediamine in methanol results in the ready formation of a 16-membered macrocyclic complex. The complexes were characterized by elemental anlysis, IR, EPR, electronic spectral data, magnetic moments and conductance measurements. The Cu(II, Ni(II and Co(III complexes are coordinated axially with both pendant groups of the hexadentate macrocycle. These pendant donors are attached to the macrocycle by a carbon chain. The electrical conductivities of the Cu(II and Ni(II chelates indicated them to be 1:2 electrolytes whilst those of Co(III is a 1:3 electrolyte in DMSO. The EPR spectrum of the copper complex exhibited G at 3.66, which indicates a considerable exchange interaction in the complex. Spectroscopic evidence suggests that in all of the complexes the metal ion is in an octahedral environment.
Léon Bardalès: Sa vie et son œuvre
Directory of Open Access Journals (Sweden)
Ilias Taxidis
2011-07-01
Full Text Available Cette étude comprend la présentation et l’édition critique de deux lettres et six poèmes de Léon Bardalès qui fut l’un des dignitaires impériaux byzantins de la fin du XIIIe et du début du XIVe siècle. Pour l’occasion, toutes les données concernant l’auteur et son activité politique et littéraire sont réévaluées conformément aux informations fournies par les lettres que Bardalès a reçues d’épistoliers connus de son époque, comme Maxime Planude, Nicéphore Choumnos et Nicéphore Grégoras. Dans l’édition, les erreurs et fautes d’inattention des éditeurs précédents sont corrigées, et un apparat des sources est ajouté.
Oblique Alfvén instabilities driven by compensated currents
Energy Technology Data Exchange (ETDEWEB)
Malovichko, P. [Main Astronomical Observatory, NASU, Kyiv (Ukraine); Voitenko, Y.; De Keyser, J., E-mail: voitenko@oma.be [Solar-Terrestrial Centre of Excellence, Space Physics Division, Belgian Institute for Space Aeronomy, Ringlaan-3-Avenue Circulaire, B-1180 Brussels (Belgium)
2014-01-10
Compensated-current systems created by energetic ion beams are widespread in space and astrophysical plasmas. The well-known examples are foreshock regions in the solar wind and around supernova remnants. We found a new oblique Alfvénic instability driven by compensated currents flowing along the background magnetic field. Because of the vastly different electron and ion gyroradii, oblique Alfvénic perturbations react differently on the currents carried by the hot ion beams and the return electron currents. Ultimately, this difference leads to a non-resonant aperiodic instability at perpendicular wavelengths close to the beam ion gyroradius. The instability growth rate increases with increasing beam current and temperature. In the solar wind upstream of Earth's bow shock, the instability growth time can drop below 10 proton cyclotron periods. Our results suggest that this instability can contribute to the turbulence and ion acceleration in space and astrophysical foreshocks.
Oblique Alfvén instabilities driven by compensated currents
International Nuclear Information System (INIS)
Malovichko, P.; Voitenko, Y.; De Keyser, J.
2014-01-01
Compensated-current systems created by energetic ion beams are widespread in space and astrophysical plasmas. The well-known examples are foreshock regions in the solar wind and around supernova remnants. We found a new oblique Alfvénic instability driven by compensated currents flowing along the background magnetic field. Because of the vastly different electron and ion gyroradii, oblique Alfvénic perturbations react differently on the currents carried by the hot ion beams and the return electron currents. Ultimately, this difference leads to a non-resonant aperiodic instability at perpendicular wavelengths close to the beam ion gyroradius. The instability growth rate increases with increasing beam current and temperature. In the solar wind upstream of Earth's bow shock, the instability growth time can drop below 10 proton cyclotron periods. Our results suggest that this instability can contribute to the turbulence and ion acceleration in space and astrophysical foreshocks.
Development of Network Interface Cards for TRIDAQ systems with the NaNet framework
International Nuclear Information System (INIS)
Ammendola, R.; Biagioni, A.; Cretaro, P.; Frezza, O.; Cicero, F. Lo; Lonardo, A.; Martinelli, M.; Paolucci, P.S.; Pastorelli, E.; Simula, F.; Valente, P.; Vicini, P.; Lorenzo, S. Di; Piandani, R.; Pontisso, L.; Sozzi, M.; Fiorini, M.; Neri, I.; Lamanna, G.; Rossetti, D.
2017-01-01
NaNet is a framework for the development of FPGA-based PCI Express (PCIe) Network Interface Cards (NICs) with real-time data transport architecture that can be effectively employed in TRIDAQ systems. Key features of the architecture are the flexibility in the configuration of the number and kind of the I/O channels, the hardware offloading of the network protocol stack, the stream processing capability, and the zero-copy CPU and GPU Remote Direct Memory Access (RDMA). Three NIC designs have been developed with the NaNet framework: NaNet-1 and NaNet-10 for the CERN NA62 low level trigger and NaNet 3 for the KM3NeT-IT underwater neutrino telescope DAQ system. We will focus our description on the NaNet-10 design, as it is the most complete of the three in terms of capabilities and integrated IPs of the framework.
Case study: a young male with auditory hallucinations in paranoid schizophrenia.
Kotowski, Abigail
2012-02-01
The purpose of this case study is to demonstrate use of the nursing process and the standardized nursing languages of NANDA International (NANDA-I), the Nursing Outcomes Classification (NOC), and the Nursing Interventions Classification (NIC) to assist a young male with paranoid schizophrenia to deal with auditory hallucinations. Data were obtained from the experience and expertise of the author and published literature. This case study demonstrates nurses' clinical decision making in providing care for an adolescent with mental illness. This case study provides the pertinent nursing diagnosis, patient outcomes, and nursing interventions for a young male with auditory hallucinations in paranoid schizophrenia. The use of NANDA-I, NOC, and NIC can provide the necessary framework for enhancing and improving the management of care with patients who experience auditory hallucinations in paranoid schizophrenia. © 2011, The Authors. International Journal of Nursing Terminologies and Classifications © 2011, NANDA International.
Tickle, Martin; Milsom, Keith M; Donaldson, Michael; Killough, Seamus; O'Neill, Ciaran; Crealey, Grainne; Sutton, Matthew; Noble, Solveig; Greer, Margaret; Worthington, Helen V
2011-10-10
Dental caries is a persistent public health problem with little change in the prevalence in young children over the last 20 years. Once a child contracts the disease it has a significant impact on their quality of life. There is good evidence from Cochrane reviews including trials that fluoride varnish and regular use of fluoride toothpaste can prevent caries. The Northern Ireland Caries Prevention in Practice Trial (NIC-PIP) trial will compare the costs and effects of a caries preventive package (fluoride varnish, toothpaste, toothbrush and standardised dental health education) with dental health education alone in young children. A randomised controlled trial on children initially aged 2 and 3 years old who are regular attenders at the primary dental care services in Northern Ireland. Children will be recruited and randomised in dental practices. Children will be randomised to the prevention package of both fluoride varnish (twice per year for three years), fluoride toothpaste (1,450 ppm F) (supplied twice per year), a toothbrush (supplied twice a year) or not; both test and control groups receive standardised dental health education delivered by the dentist twice per year. Randomisation will be conducted by the Belfast Trust Clinical Research Support Centre ([CRSC] a Clinical Trials Unit). 1200 participants will be recruited from approximately 40 dental practices. Children will be examined for caries by independent dental examiners at baseline and will be excluded if they have caries. The independent dental examiners will examine the children again at 3 years blinded to study group.The primary end-point is whether the child develops caries (cavitation into dentine) or not over the three years. One secondary outcome is the number of carious surfaces in the primary dentition in children who experience caries. Other secondary outcomes are episodes of pain, extraction of primary teeth, other adverse events and costs which will be obtained from parental
30 CFR 57.22208 - Auxiliary fans (I-A, II-A, III, and V-A mines).
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans (I-A, II-A, III, and V-A mines... fans (I-A, II-A, III, and V-A mines). (a) Auxiliary fans, except fans used in shops and other areas... applicable requirements of 30 CFR part 18, and be operated so that recirculation is minimized. Auxiliary fans...
French, Jarrod B.; Cen, Yana; Sauve, Anthony A.; Ealick, Steven E.
2010-01-01
Nicotinamidases are salvage enzymes that convert nicotinamide to nicotinic acid. These enzymes are essential for the recycling of nicotinamide into NAD+ in most prokaryotes, most single cell and multicellular eukaryotes, but not in mammals. The significance of these enzymes for nicotinamide salvage and for NAD+ homeostasis has increased interest in nicotinamidases as possible antibiotic targets. Nicotinamidases are also regulators of intracellular nicotinamide concentrations, thereby regulating signaling of downstream NAD+ consuming enzymes, such as the NAD+-dependent deacetylases (sirtuins). Here, we report several high resolution crystal structures of the nicotinamidase from Streptococcus pneumoniae (SpNic) in unliganded and ligand-bound forms. The structure of the C136S mutant in complex with nicotinamide provides details about substrate binding while a trapped nicotinoyl-thioester complexed with SpNic reveals the structure of the proposed thioester reaction intermediate. Examination of the active site of SpNic reveals several important features including a metal ion that coordinates the substrate and the catalytically relevant water molecule, and an oxyanion hole which both orients the substrate and offsets the negative charge that builds up during catalysis. Structures of this enzyme with bound nicotinaldehyde inhibitors elucidate the mechanism of inhibition and provide further details about the catalytic mechanism. In addition, we provide a biochemical analysis of the identity and role of the metal ion that orients the ligand in the active site and activates the water molecule responsible for hydrolysis of the substrate. These data provide structural evidence for several proposed reaction intermediates and allow for a more complete understanding of the catalytic mechanism of this enzyme. PMID:20853856
French, Jarrod B; Cen, Yana; Sauve, Anthony A; Ealick, Steven E
2010-10-12
Nicotinamidases are salvage enzymes that convert nicotinamide to nicotinic acid. These enzymes are essential for the recycling of nicotinamide into NAD(+) in most prokaryotes and most single-cell and multicellular eukaryotes, but not in mammals. The significance of these enzymes for nicotinamide salvage and for NAD(+) homeostasis has stimulated interest in nicotinamidases as possible antibiotic targets. Nicotinamidases are also regulators of intracellular nicotinamide concentrations, thereby regulating signaling of downstream NAD(+)-consuming enzymes, such as the NAD(+)-dependent deacetylases (sirtuins). Here, we report several high-resolution crystal structures of the nicotinamidase from Streptococcus pneumoniae (SpNic) in unliganded and ligand-bound forms. The structure of the C136S mutant in complex with nicotinamide provides details about substrate binding, while a trapped nicotinoyl thioester in a complex with SpNic reveals the structure of the proposed thioester reaction intermediate. Examination of the active site of SpNic reveals several important features, including a metal ion that coordinates the substrate and the catalytically relevant water molecule and an oxyanion hole that both orients the substrate and offsets the negative charge that builds up during catalysis. Structures of this enzyme with bound nicotinaldehyde inhibitors elucidate the mechanism of inhibition and provide further details about the catalytic mechanism. In addition, we provide a biochemical analysis of the identity and role of the metal ion that orients the ligand in the active site and activates the water molecule responsible for hydrolysis of the substrate. These data provide structural evidence of several proposed reaction intermediates and allow for a more complete understanding of the catalytic mechanism of this enzyme.
Mulheres submetidas à conização de colo uterino: análise dos resultados citológico e histopatológico
Directory of Open Access Journals (Sweden)
Cláudia Priscilla de Souza Amorim
2015-06-01
Full Text Available Objetivo: Relacionar os achados cito-histológicos em pacientes submetidas a procedimento excisional no colo uterino, avaliando as discrepâncias diagnósticas encontradas. Metodologia: Foram avaliadas 52 pacientes submetidas à conização cervical no ambulatório do Setor de Patologia do Trato Genital Inferior da Maternidade-Escola Assis Chateaubriand, atendidas entre janeiro de 2012 a dezembro 2013, retrospectivamente, por revisão de prontuário. Os diagnósticos citopatológicos foram confrontados com os achados colposcópicos e com os laudos histopatológicos para que se observe o nível de concordância. Resultados: A média de idade das pacientes avaliadas foi de 36,5 anos. A média de paridade foi de 3. Das 21 pacientes com anatomopatológico (AP de Cirurgia de Alta Frequência (CAF NIC 3, 3 tinham citologia com Atipias de Células Escamosas de Significado Indeterminado (ASC-US, 3 Lesão intraepitelial de baixo grau (LIEBG e 15 Lesão intraepitelial de alto grau (LIEAG em citologia previamente ao procedimento. As 11 pacientes com NIC 2 no AP do CAF, 1 tinha citologia prévia evidenciando ASC-US. Conclusão: Houve boa concordância entre os resultados citológicos e histológicos. Cerca de 20% das pacientes com NIC 2 ou 3 após tratamento excisional por CAF tinham citologia prévia indicando lesão cervical menor.
Neoplasia intraepitelial cervical en mujeres menores de 25 años
Directory of Open Access Journals (Sweden)
Martha María Chávez Valdivia
2012-03-01
Full Text Available Fundamento: aunque la incidencia de lesiones preinvasivas del cervix ha sido mayor en mujeres de la tercera a cuarta década de la vida, en los últimos años se ha encontrando un número no despreciable de mujeres menores de 25 años afectadas por este tipo de lesiones de bajo o alto grado. Objetivo: describir el comportamiento de las neoplasias intraepiteliales cervicales diagnosticadas en mujeres menores de 25 años de edad, y tratadas con radiocirugía. Métodos: estudio retrospectivo y descriptivo de 67 pacientes menores de 25 años de edad, con diagnóstico de neoplasia intraepitelial cervical y tratadas por el método de radiocirugía en el Hospital General de Cienfuegos. Se analizaron las variables: edad, tipo de NIC, grado de la NIC y presencia de VPH. Resultados: el grupo más afectado fue el de las mujeres de 21 a 25 años de edad, portador del 70,4 % de lesiones. El 86, 56 % de las lesiones fue de alto grado. Las lesiones estuvieron asociadas con elevada frecuencia (88,05 % a condiloma, evidencia histológica indirecta de la citotoxicidad por la infestación tisular del VPH. Conclusiones: La presencia de NIC en mujeres menores de 25 años de edad, se configura en nuestro medio como problema de salud. El presente estudio puede servir como sustrato para desarrollar investigaciones similares en varios lugares del país, con la finalidad de aportar evidencia global que conduzca al cambio.
Ishihara, Takayuki; Awata, Masaki; Iida, Osamu; Fujita, Masashi; Masuda, Masaharu; Okamoto, Shin; Nanto, Kiyonori; Kanda, Takashi; Tsujimura, Takuya; Uematsu, Masaaki; Mano, Toshiaki
2018-01-15
The ultrathin strut biodegradable polymer sirolimus-eluting stent (Orsiro, O-SES) exhibits satisfactory clinical outcomes. However, no report to date has documented the intravascular status of artery repair after O-SES implantation. We examined 5 O-SES placed in 4 patients (age 65 ± 12 years, male 75%) presenting with stable angina pectoris due to de novo lesions in native coronary arteries. Coronary angioscopy was performed immediately after percutaneous coronary intervention and 1 year later. Angioscopic images were analyzed to determine the following: (1) dominant grade of neointimal coverage (NIC) over the stent; (2) maximum yellow plaque grade; and (3) existence of thrombus. Yellow plaque grade was evaluated both immediately after stent implantation and at the time of follow-up observation. The other parameters were evaluated at the time of follow-up examination. NIC was graded as: grade 0, stent struts exposed; grade 1, struts bulging into the lumen, although covered; grade 2, struts embedded in the neointima, but translucent; grade 3, struts fully embedded and invisible. Yellow plaque severity was graded as: grade 0, white; grade 1, light yellow; grade 2, yellow; and grade 3, intensive yellow. Angioscopic findings at 1 year demonstrated the following: dominant NIC grade 1, grade 2, and grade 3 in 1, 2, and 2 stents, respectively; all stents were covered to some extent; focal thrombus adhesion was observed in only 1 stent. Yellow plaque grade did not change from immediately after stent implantation to follow-up. O-SES demonstrated satisfactory arterial repair 1 year after implantation.
Role of Turbulent Damping in Cosmic Ray Galactic Winds
Holguin, Francisco; Ruszkowski, Mateusz; Lazarian, Alex; Yang, H. Y. Karen
2018-06-01
Large-scale galactic winds driven by stellar feedback are one phenomenon that influences the dynamical and chemical evolution of a galaxy, pushing and redistributing material throughout the interstellar medium (ISM) and galactic halo. A detailed understanding of the exact physical mechanisms responsible for these winds is lacking. Non-thermal feedback from galactic cosmic rays (CR), high-energy charged particles accelerated in supernovae and young stars, can impact the efficiency in accelerating the wind. In the self-confinement model, CR stream along magnetic field lines at the Alfven speed due to scattering off self-excited Aflv{é}n waves. However, magneto-hydrodynamic (MHD) turbulence stirred up by stellar feedback dissipates these confining waves, allowing CR to be super Aflvenic. Previous simulations relying on a simplified model of transport have shown that super-Alfv{é}nic streaming of CRs can launch a stronger wind. We perform three-dimensional MHD simulations of a section of a galactic disk, including CR streaming dependent on the local environment, using a realistic model of turbulent dissipation of Alfven waves presented in Lazarian (2016). In this implementation, the CR streaming speed can be super Alfv{é}nic depending on local conditions. We compare results for Alfv{é}nic and locally determined streaming, and find that gas/CR distributions and instantaneous mass loading factor of the wind are different depending on the level of turbulence.Lazarian, A. “Damping of Alfven waves by turbulence and its consequences: from cosmic-ray streaming to launching winds.” ApJ. Vol. 833, Num. 2. (2016).
Jia, Xiaoyu; Gong, Dirong; Zhao, Junyi; Ren, Hongyun; Wang, Jiani; Zhang, Xian
2018-03-19
This paper describes the preparation of zwitterion-functionalized polymer microspheres (ZPMs) and their application to simultaneous enrichment of V(V), Cr(III), As(III), Sn(IV), Sb(III) and Hg(II) from environmental water samples. The ZPMs were prepared by emulsion copolymerization of ethyl methacrylate, 2-diethylaminoethyl methacrylate and triethylene glycol dimethyl acrylate followed by modification with 1,3-propanesultone. The components were analyzed by elemental analyses as well as Fourier transform infrared spectroscopy, and the structures were characterized by scanning electron microscopy and transmission electron microscopy. The ZPMs were packed into a mini-column for on-line solid-phase extraction (SPE) of the above metal ions. Following extraction with 40 mM NH 4 NO 3 and 0.5 M HNO 3 solution, the ions were quantified by ICP-MS. Under the optimized conditions, the enrichment factors (from a 40 mL sample) are up to 60 for the ions V(V), As(III), Sb(III) and Hg(II), and 55 for Cr(III) and Sn(IV). The detection limits are 1.2, 3.4, 1.0, 3.7, 2.1 and 1.6 ng L -1 for V(V), Cr(III), As(III), Sn(IV), Sb(III) and Hg(II), respectively, and the relative standard deviations (RSDs) are below 5.2%. The feasibility and accuracy of the method were validated by successfully analyzing six certified reference materials as well as lake, well and river waters. Graphical abstract Zwitterion-functionalized polymer microspheres (ZPMs) were prepared and packed into a mini-column for on-line solid-phase extraction (SPE) via pump 1. Then V(V), Cr(III), As(III), Sn(IV), Sb(III) and Hg(II) ions in environmental waters were eluted and submitted to ICP-MS via pump 2.
Directory of Open Access Journals (Sweden)
Rafael E. Pérez Castro
2011-06-01
Full Text Available AA cross sectional study and retrospective was performed in patients having cervical intraepithelial neoplasia (CIN, mainly in high grade lesions (CIN II, CIN III and C. In situ, which were treated with radiosurgery technique in the University General Hospital “Camilo Cienfuegos” Sancti Spiritus during the period may 2004 – may 2009 with the objective to evaluate the radiosurgery`s behaviour in the period mentioned before. The studied group was conformed by 550 patients having high grade lesions and low grade persistent lesions (NIC I with previous biopsy, a smaller group of 24 cases was formed by benign pathologies tributary of this procedure. High grade lesions were of major indications (73.1%. 69 cases were false negative (13.3%; since the second decade of life were presented high and low grade lesions of cervical pathology, a good correlation punch – cone byopsy was checked; edges of the surgical section behave properly, lower than what it is established in the international standard (6.7. The procedure had a great economic and social impact, because it is an ambulatory technique with few difficulties, low cost, and a fast integration patient – normal work.
Department of Defense In-House RDT and E Activities
1974-10-30
H01C CHAMfaERLKtVEKöER ROTATORtELECTRlC POST BALLISTOCAKDIOGKAPHCE V£ AND EXTREHELY LOW FREMJEN- p LB THRUST HORIZONTAL ACCEL- LB...AND RECOVERY SYSTEMS COANDA-TURBO JET ENGINE RUN-UP NOISE SUPPRESSION AV10NIC TESTING USING LARGE SCALE INTERGRATED CIRCUITS (LSI) ...FUNCTIONS
Indian Academy of Sciences (India)
Ni(C4H6 N2)4]Br2. HONG WANGa, BIN LUb, JINGXIANG ZHAO b and QINGHAI CAI b,*. aSchool of Chemical and Environmental Engineering, Harbin University of science and technology, Harbin 150080, P. R. China. bSchool of Chemistry ...
Geology of the USSR (Chapter IV).
1979-10-05
authiqg- nic formationsc - micioqrdin of pyrite, clusters of oxides of iron anI smallist 4rains of ca~oonCate, by the places of generatrices edqings...insiqnificant unconformity between Lias (in contemporary understanding) and Biddle Jurassic deposits and parallel occurrence on latter/last basalt integuments
2011-12-27
... as Part of County Government include (1) the jail's role in the local criminal justice system, (2... familiar with the current lesson plans, presentation slides, participant manual, and other training... curriculum review. Curriculum review meeting with NIC staff: After becoming familiar with the curriculum, the...
Professionalism in intercultural job interviews
DEFF Research Database (Denmark)
Jensen, Iben
2005-01-01
The article is a slightly revised manuscript from my keynote speech at the NIC conference 2003 in Göteborg, Sweden. The aim of the speech was to put forward research towards a critical intercultural multiperspectivism in order to understand professional intercultural communication in multicultural...
Directory of Open Access Journals (Sweden)
Cássia Raquel Teatin Juliato
2000-03-01
Full Text Available Objetivos: avaliar a utilização da conização por cirurgia de alta freqüência por alça (CAF na neoplasia intra-epitelial cervical (NIC, a importância do comprometimento das margens de ressecção e o seguimento das pacientes. Métodos: foram avaliadas 95 mulheres submetidas à CAF por NIC entre janeiro de 1996 e dezembro de 1997. Para análise estatística, utilizamos o coeficiente de concordância kappa e o teste de tendência de Cochran Armitage. Resultados: dos 63 casos submetidos à biópsia dirigida antes da conização, o cone por CAF apresentou lesões mais graves que a biópsia em 24 casos, sendo um caso microinvasor, e em 8 mulheres a biópsia eliminou a lesão. Entre as pacientes submetidas à conização com biópsia prévia compatível com cervicite ou NIC 1, 14/25 (56% apresentavam NIC 2 ou 3. Das 32 mulheres que não tinham biópsia prévia, 15 apresentavam NIC 2 ou 3, e quatro, carcinoma microinvasor no cone. Em relação às margens do cone, 25 casos (26% apresentaram margens endocervicais comprometidas e quanto maior o grau da lesão cervical maior a possibilidade de presença de lesão nas margens (p = 0,024. Dessas pacientes, 2 de 10 submetidas a novo procedimento apresentavam doença residual na peça cirúrgica. Entre as 70 pacientes com margens livres foram realizadas três conizações a frio e uma histerectomia e duas apresentavam doença residual na peça cirúrgica. Conclusões: a conização por CAF sem biópsia prévia depende da combinação entre o diagnóstico citológico e a experiência do colposcopista e, em princípio, deve ser reservada para os casos em que a colpocitologia e a colposcopia são concordantes e compatíveis com NIC 2 ou 3. Por outro lado, a ampliação cirúrgica pós-CAF no tratamento da NIC não é determinada exclusivamente pelo comprometimento das margens, mas sim pelo seguimento, excluindo-se os casos de microinvasão e lesões glandulares que se beneficiam com a avaliação histol
Energy Technology Data Exchange (ETDEWEB)
Jones, Adele M., E-mail: adele.jones1@unsw.edu.au; Kinsela, Andrew S.; Collins, Richard N.; Waite, T. David, E-mail: d.waite@unsw.edu.au
2016-12-15
Recent studies have demonstrated that the rate at which Fe(II)-Fe(III) oxyhydroxide systems catalyze the reduction of reducible contaminants, such as 4-chloronitrobenzene, is well correlated to their thermodynamic reduction potential. Here we confirm this effect in the presence of Fe(III) oxyhydroxide phases not previously assessed, namely ferrihydrite and nano-goethite, as well as Fe(III) oxyhydroxide phases previously examined. In addition, silicate is found to decrease the extent of Fe(II) sorption to the Fe(III) oxyhydroxide surface, increasing the reduction potential of the Fe(II)-Fe(III) oxyhydroxide suspension and, accordingly, decreasing the rate of 4-chloronitrobenzene reduction. A linear relationship between the reduction potential of the Fe(II)-Fe(III) oxyhydroxide suspensions and the reduction rate of 4-chloronitrobenzene (normalized to surface area and concentration of sorbed Fe(II)) was obtained in the presence and absence of silicate. However, when ferrihydrite was doped with Si (through co-precipitation) the reduction of 4-chloronitrobenzene was much slower than predicted from its reduction potential. The results obtained have significant implications to the likely effectiveness of naturally occurring contaminant degradation processes involving Fe(II) and Fe(III) oxyhydroxides in groundwater environments containing high concentrations of silicate, or other species which compete with Fe(II) for sorption sites.
Directory of Open Access Journals (Sweden)
André Luis Ferreira Santos
2004-07-01
Full Text Available OBJETIVOS: avaliar o desempenho da colpocitologia oncológica (CO e da Captura de Híbridos II (CHII para o diagnóstico de lesão cervical histológica significativa (NIC2/3 em mulheres encaminhadas com CO contendo atipias celulares de significado indeterminado (ASCUS ou lesão escamosa intra-epitelial de baixo grau (LSIL. MÉTODOS: estudo de corte transversal no qual foram incluídas 161 mulheres encaminhadas, entre agosto de 2000 e setembro de 2002, devido a CO com resultado de ASCUS ou LSIL. As mulheres responderam a questionário específico sobre características sociodemográficas e reprodutivas e foram submetidas a exame ginecológico com coleta de CO e CHII, sendo realizada colposcopia com eventual biópsia de áreas suspeitas. Foi aplicado o teste do qui-quadrado para as associações da idade, uso de condom, uso de anticoncepcional oral e tabagismo com os resultados da CHII. Foram calculados a sensibilidade, especificidade, valor preditivo positivo e valor preditivo negativo da CO e da CHII para detectar NIC2/3. Todos os cálculos foram realizados com intervalos de confiança estatística de 95%. RESULTADOS: sessenta e sete porcento das mulheres com menos de 30 anos de idade tiveram testes positivos para o HPV. A CO e CHII tiveram sensibilidade de 82% em detectar NIC2/3 quando considerados como positivos ASCUS, LSIL ou HSIL. Quando se consideram como positivas apenas as CO com HSIL, este exame apresenta acentuado ganho de especificidade (de 29 para 95% e valor preditivo positivo (de 12 para 50%, superando a CHII, porém com redução igualmente significativa de sua sensibilidade (de 82 para 41%. CONCLUSÕES: nossos resultados indicaram grande potencial da CHII para detectar mulheres com NIC2/3 entre as pacientes com ASCUS/LSIL na CO de encaminhamento.OBJECTIVE: to assess the ability of Pap smear and hybrid capture II (HCII to detect clinically significant cervical lesions (CIN2/3 in women referred to hospital due to atypical squamous
Phantasía logistikē en la configuración del deseo en Aristóteles
Directory of Open Access Journals (Sweden)
Claudia Carbonell
2013-01-01
Full Text Available En De Anima III 10, Aristóteles introduce la noción de phantasía logistikē como uno de los principios de la acción racional. A partir de la exposición de algunos textos del De Anima y de Ética a Nicómaco, se busca interpretar el lugar de aquel tipo de imaginación en el razonamiento práctico. Para ello, se presenta primero la doctrina aristotélica de los principios de la acción y la problemática de su articulación, y luego se discute el papel de la imaginación racional en la configuración del objeto del deseo.
International Nuclear Information System (INIS)
Aqeel Ashraf, M.; Jamil Maah, M.; Yusuf, I.
2012-01-01
Cr(III), Co(II), Ni(II), Cu(II) and Zn(II) salts of 2-(4-nitro phenylaminocarbonyl)benzoic acid were characterized by physical, analytical and spectroscopic studies and checked for their in-vitro antimicrobial activity against three bacterial strains, Mycobacterium smegmatis (Gram +ve), Escherichia coli (Gram -ve), Pseudomonas aeuroginosa (Gram -ve) and three fungal strains, Nigrospora oryzae, Aspergillus niger and Candida albicans. The antimicrobial activities of the metal complexes - were found to be greater than those of 2-(4-nitro phenylaminocarbonyl)benzoic acid alone.
Regulatory activity based risk model identifies survival of stage II and III colorectal carcinoma.
Liu, Gang; Dong, Chuanpeng; Wang, Xing; Hou, Guojun; Zheng, Yu; Xu, Huilin; Zhan, Xiaohui; Liu, Lei
2017-11-17
Clinical and pathological indicators are inadequate for prognosis of stage II and III colorectal carcinoma (CRC). In this study, we utilized the activity of regulatory factors, univariate Cox regression and random forest for variable selection and developed a multivariate Cox model to predict the overall survival of Stage II/III colorectal carcinoma in GSE39582 datasets (469 samples). Patients in low-risk group showed a significant longer overall survival and recurrence-free survival time than those in high-risk group. This finding was further validated in five other independent datasets (GSE14333, GSE17536, GSE17537, GSE33113, and GSE37892). Besides, associations between clinicopathological information and risk score were analyzed. A nomogram including risk score was plotted to facilitate the utilization of risk score. The risk score model is also demonstrated to be effective on predicting both overall and recurrence-free survival of chemotherapy received patients. After performing Gene Set Enrichment Analysis (GSEA) between high and low risk groups, we found that several cell-cell interaction KEGG pathways were identified. Funnel plot results showed that there was no publication bias in these datasets. In summary, by utilizing the regulatory activity in stage II and III colorectal carcinoma, the risk score successfully predicts the survival of 1021 stage II/III CRC patients in six independent datasets.
PHYSICAL CONDITIONS OF CORONAL PLASMA AT THE TRANSIT OF A SHOCK DRIVEN BY A CORONAL MASS EJECTION
Energy Technology Data Exchange (ETDEWEB)
Susino, R.; Bemporad, A.; Mancuso, S., E-mail: susino@oato.inaf.it [INAF–Turin Astrophysical Observatory, via Osservatorio 20, I-10025 Pino Torinese (Italy)
2015-10-20
We report here on the determination of plasma physical parameters across a shock driven by a coronal mass ejection using white light (WL) coronagraphic images and radio dynamic spectra (RDS). The event analyzed here is the spectacular eruption that occurred on 2011 June 7, a fast CME followed by the ejection of columns of chromospheric plasma, part of them falling back to the solar surface, associated with a M2.5 flare and a type-II radio burst. Images acquired by the Solar and Heliospheric Observatory/LASCO coronagraphs (C2 and C3) were employed to track the CME-driven shock in the corona between 2–12 R{sub ⊙} in an angular interval of about 110°. In this interval we derived two-dimensional (2D) maps of electron density, shock velocity, and shock compression ratio, and we measured the shock inclination angle with respect to the radial direction. Under plausible assumptions, these quantities were used to infer 2D maps of shock Mach number M{sub A} and strength of coronal magnetic fields at the shock's heights. We found that in the early phases (2–4 R{sub ⊙}) the whole shock surface is super-Alfvénic, while later on (i.e., higher up) it becomes super-Alfvénic only at the nose. This is in agreement with the location for the source of the observed type-II burst, as inferred from RDS combined with the shock kinematic and coronal densities derived from WL. For the first time, a coronal shock is used to derive a 2D map of the coronal magnetic field strength over intervals of 10 R{sub ⊙} altitude and ∼110° latitude.
Synthesis and characterisation of the Fe(II-III) hydroxy-formate green rust
International Nuclear Information System (INIS)
Refait, P.; Abdelmoula, M.; Genin, J.-M. R.; Jeannin, M.
2006-01-01
A new methodology was envisioned in order to prepare green rust compounds build on organic anions that could intervene in microbiologically influenced corrosion processes of iron and steel. The formate ion was chosen as an example. The formation of rust was simulated by the oxidation of aqueous suspensions of Fe(OH) 2 precipitated from Fe(II) lactate and sodium hydroxide, in the presence of sodium formate to promote the formation of the corresponding green rust. The evolution of the precipitate with time was followed by transmission Moessbauer spectroscopy at 15 K. It was observed that the initial hydroxide was transformed into a new GR compound. Its spectrum is composed of three quadrupole doublets, D 1 (δ = 1.28 mm s -1 , Δ = 2.75 mm s -1 ) and D 2 (δ = 1.28 mm s -1 , Δ 2.48 mm s -1 ) that correspond to Fe(II) and D 3 (δ = 0.49 mm s -1 , Δ = 0.37 mm s -1 ) that corresponds to Fe(III). The relative area of D 3 , close to the proportion of Fe(III) in the GR, was found at 28.5 ± 1.5% (∼2/7). Raman spectroscopy confirmed that the intermediate compound was a Fe(II-III) hydroxy-formate, GR(HCOO - ).
Energy Technology Data Exchange (ETDEWEB)
Nouni, K.; Hassouni, K.; Kebdani, T.; Elkacemi, H.; Benjaafer, N.; Elgueddari, B. [Institut national d' oncologie, Rabat (Morocco)
2010-10-15
Grade II and III meningiomas are rare tumours. They are not much studied and raise problems when taking them into care due to their aggressiveness and relapses. Based on 19 cases observed between 2000 and 2007, the authors report and discuss epidemiologic, clinic, and above all therapeutic and evolutional aspects. They state that radiotherapy is to be performed whatever the quality of the exeresis is, in order to reduce relapse risks. Short communication
African Journals Online (AJOL)
EliasN
economic development of the country and to improve the living standards of its ... enhancement of 'the role of the private sector' and foreign investment. ... incentives further include income tax exemption for expansion or upgrading, ...... transformation and development.90 Evans cites the East Asian NICs as examples.
28 CFR 25.1 - Purpose and authority.
2010-07-01
... Instant Criminal Background Check System § 25.1 Purpose and authority. The purpose of this subpart is to establish policies and procedures implementing the Brady Handgun Violence Prevention Act (Brady Act), Public... Instant Criminal Background Check System (NICS) to be contacted by any licensed importer, licensed...
Spicules Intensity Oscillations in SOT/HINODE Observations E ...
Indian Academy of Sciences (India)
2015-04-01
Apr 1, 2015 ... ence between oscillations at two certain heights, to find evidence for the .... or Alfvénic waves propagating inside their multi-component .... by four red color arrows (1, 2, 3 and 4) on panel (a), at a distance 35 pixels from each ...
2013-07-22
... leadership skill building, exposure to ethical and value based issues, self-awareness, strategic thinking... critical thinking through a variety of experiential activities and group sessions. This project will be a..., or design aspects proposed that are new to NIC and will enhance the project? Organizational (35%) Do...
de Barros, Alba Lúcia; Fakih, Flávio Trevisani; Michel, Jeanne Liliane
2002-01-01
This article reports the pathway used to build a prototype of a computer nurse's clinical decision making support system, using NANDA, NIC and NOC classifications, as an auxiliary tool in the insertion of nursing data in the computerized patient record of Hospital São Paulo/UNIFESP.
Energy Technology Data Exchange (ETDEWEB)
Betz, B; Schittenhelm, H J; Kemmler-Sack, S [Tuebingen Univ. (Germany, F.R.). Lehrstuhl fuer Anorganische Chemie 2
1982-01-01
Perovskites of type Ba/sub 8/Bsup(II)B/sub 2/sup(III)vacantU/sub 4/sup(VI)O/sub 24/ show polymorphic phase transformations of order disorder type. An 1:1 ordered orthorhombic HT form is transformed into a higher ordered LT modification with a fourfold cell content (four formula units Ba/sub 8/Bsup(II)B/sub 2/sup(III)vacantU/sub 4/O/sub 24/), compared to cubic 1:1 ordered perovskites A/sub 2/BMO/sub 6/. In the series Ba/sub 8/BaB/sub 2/sup(III)vacantW/sub 4/O/sub 24/ and Sr/sub 8/SrB/sub 2/sup(III)vacantW/sub 4/O/sub 24/ different ordering phenomena are observed. In comparison with 1:1 ordered cubic perovskites A/sub 2/BMO/sub 6/, the cell contains eight formula units A/sub 8/sup(II)Bsup(II) B/sub 2/sup(III)vacantW/sub 4/O/sub 2/4. The higher ordered cells with Usup(VI) and Wsup(VI) are face centered, which has its origin in an ordering of cationic vacancies.
Biosorption kinetics of Cd (II), Cr (III) and Pb (II) in aqueous solutions by olive stone
M. Calero; F. Hernáinz; G. Blázquez; M. A. Martín-Lara; G. Tenorio
2009-01-01
A by-product from olive oil production, olive stone, was investigated for the removal of Cd (II), Cr (III) and Pb (II) from aqueous solutions. The kinetics of biosorption are studied, analyzing the effect of the initial concentration of metal and temperature. Pseudo-first-order, pseudo-second-order, Elovich and intraparticle diffusion models have been used to represent the kinetics of the process and obtain the main kinetic parameters. The results show that the pseudo-second order model is th...
The ionospheric footprint of antiparallel merging regions on the dayside magnetopause
Directory of Open Access Journals (Sweden)
I. J. Coleman
2000-05-01
Full Text Available The antiparallel merging hypothesis states that reconnection takes place on the dayside magnetopause where the solar and geomagnetic fields are oppositely directed. With this criterion, we have mapped the predicted merging regions to the ionosphere using the Tsyganenko 96 magnetic field model, distinguishing between regions of sub-Alfvénic and super-Alfvénic magnetosheath flow, and identifying the day-night terminator. We present the resulting shape, width and latitude of the ionospheric dayside merging regions in both hemispheres, showing their dependence on the Earth's dipole tilt. The resulting seasonal variation of the longitudinal width is consistent with the conjugate electric fields in the northern and southern cusps, as measured by the SuperDARN HF radars, for example. We also find a seasonal shift in latitude similar to that observed in satellite cusp data.Key words: Ionosphere (ionosphere-magnetosphere interactions · Magnetospheric physics (magnetopause · cusp and boundary layers; magnetosphere-ionosphere interactions
Energy Technology Data Exchange (ETDEWEB)
Klein, Kristopher G.; Howes, Gregory G. [Department of Physics and Astronomy, University of Iowa, Iowa City, IA 52242 (United States); TenBarge, Jason M. [IREAP, University of Maryland, College Park, MD 20742 (United States); Podesta, John J., E-mail: kristopher-klein@uiowa.edu [Center for Space Plasma Physics, Space Science Institute, Boulder, CO 80301 (United States)
2014-04-20
Motivated by recent observations of distinct parallel and perpendicular signatures in magnetic helicity measurements segregated by wave period and angle between the local magnetic field and the solar wind velocity, this paper undertakes a comparison of three intervals of Ulysses data with synthetic time series generated from a physically motivated turbulence model. From these comparisons, it is hypothesized that the observed signatures result from a perpendicular cascade of Alfvénic fluctuations and a local, non-turbulent population of ion-cyclotron or whistler waves generated by temperature anisotropy instabilities. By constraining the model's free parameters through comparison to in situ data, it is found that, on average, ∼95% of the power near dissipative scales is contained in a perpendicular Alfvénic cascade and that the parallel fluctuations are propagating nearly unidirectionally. The effects of aliasing on magnetic helicity measurements are considered and shown to be significant near the Nyquist frequency.