The rice XA21 ectodomain fused to the Arabidopsis EFR cytoplasmic domain confers resistance to Xanthomonas oryzae pv. oryzae.

Science.gov (United States)

Thomas, Nicholas C; Oksenberg, Nir; Liu, Furong; Caddell, Daniel; Nalyvayko, Alina; Nguyen, Yen; Schwessinger, Benjamin; Ronald, Pamela C

2018-01-01

Rice ( Oryza sativa ) plants expressing the XA21 cell-surface receptor kinase are resistant to Xanthomonas oryzae pv. oryzae (Xoo) infection. We previously demonstrated that expressing a chimeric protein containing the ELONGATION FACTOR Tu RECEPTOR (EFR) ectodomain and the XA21 endodomain (EFR:XA21) in rice does not confer robust resistance to Xoo . To test if the XA21 ectodomain is required for Xoo resistance, we produced transgenic rice lines expressing a chimeric protein consisting of the XA21 ectodomain and EFR endodomain (XA21:EFR) and inoculated these lines with Xoo . We also tested if the XA21:EFR rice plants respond to a synthetic sulfated 21 amino acid derivative (RaxX21-sY) of the activator of XA21-mediated immunity, RaxX. We found that five independently transformed XA21:EFR rice lines displayed resistance to Xoo as measured by lesion length analysis, and showed that five lines share characteristic markers of the XA21 defense response (generation of reactive oxygen species and defense response gene expression) after treatment with RaxX21-sY. Our results indicate that expression of the XA21:EFR chimeric receptor in rice confers resistance to Xoo . These results suggest that the endodomain of the EFR and XA21 immune receptors are interchangeable and the XA21 ectodomain is the key determinant conferring robust resistance to Xoo .

Fine mapping of the rice bacterial blight resistance gene Xa-4 and its co-segregation marker

Institute of Scientific and Technical Information of China (English)

无

2000-01-01

An F2 population developed from the Xa-4 near isogenic lines,IR24 and IRBB4,was used for fine mapping of the rice bacterial blight resistance gene,Xa-4.Some restriction fragment length polymorphism (RFLP) markers on the high-density map constructed by Harushima et al.and the amplified DNA fragments homologous to the conserved domains of plant disease resistance (R) genes were used to construct the genetic linkage map around the gene Xa-4 by scoring susceptible individuals in the population.Xa-4 was mapped between the RFLP marker G181 and the polymerase chain reaction (PCR) marker M55.The R gene homologous fragment marker RS13 was found co-segregating with Xa-4 by analyzing all the plants in the population.This result opened an approach to map-based cloning of this gene,and marker RS13 can be applied to molecular marker-assisted selection of Xa-4 in rice breeding programs.

How useful is determination of anti-factor Xa activity to guide bridging therapy with enoxaparin? A pilot study.

Science.gov (United States)

Hammerstingl, Christoph; Omran, Heyder; Tripp, Christian; Poetzsch, Bernd

2009-02-01

Low-molecular-weight heparins (LMWH) are commonly used as peri-procedural bridging anticoagulants. The usefulness of measurement of anti-factor Xa activity (anti-Xa) to guide bridging therapy with LMWH is unknown. It was the objective of this study to determine levels of anti-Xa during standard bridging therapy with enoxaparin, and to examine predictors for residual anti-Xa. Consecutive patients receiving enoxaparin at a dosage of 1 mg/kg body weight/12 hours for temporary interruption of phenprocoumon were prospectively enrolled to the study. Blood-samples were obtained 14 hours after LMWH-application immediately pre- procedurally. Procedural details, clinical and demographic data were collected and subsequently analyzed. Seventy patients were included (age 75.2 +/- 10.8 years, Cr Cl 55.7 +/- 21.7ml/min, body mass index [BMI] 27.1 +/- 4.9). LMWH- therapy was for a mean of 4.2 +/- 1.6 days; overall anti-Xa was 0.58 +/- 0.32 U/ml. In 37 (52.8%) of patients anti-Xa was > or U/ml, including 10 (14.3%) patients with anti-Xa > 1U/ml. Linear regression analysis of single variables and logistic multivariable regression analysis failed to prove a correlation between anti-Xa and single or combined factors. No major bleeding, no thromboembolism and four (5.7%) minor haemorrhages were observed. When bridging OAC with therapeutic doses of enoxaparin a high percentage of patients undergo interventions with high residual anti-Xa. The levels of anti-Xa vary largely and are independent of single or combined clinical variables. Since the anti-Xa-related outcome of patients receiving bridging therapy with LMWH is not investigated, no firm recommendation on the usefulness of monitoring of anti-Xa can be given at this stage.

Identification of anthranilamide derivatives as potential factor Xa inhibitors: drug design, synthesis and biological evaluation.

Science.gov (United States)

Xing, Junhao; Yang, Lingyun; Li, Hui; Li, Qing; Zhao, Leilei; Wang, Xinning; Zhang, Yuan; Zhou, Muxing; Zhou, Jinpei; Zhang, Huibin

2015-05-05

The coagulation enzyme factor Xa (fXa) plays a crucial role in the blood coagulation cascade. In this study, three-dimensional fragment based drug design (FBDD) combined with structure-based pharmacophore (SBP) model and structural consensus docking were employed to identify novel fXa inhibitors. After a multi-stage virtual screening (VS) workflow, two hit compounds 3780 and 319 having persistent high performance were identified. Then, these two hit compounds and several analogs were synthesized and screened for in-vitro inhibition of fXa. The experimental data showed that most of the designed compounds displayed significant in vitro potency against fXa. Among them, compound 9b displayed the greatest in vitro potency against fXa with the IC50 value of 23 nM and excellent selectivity versus thrombin (IC50 = 40 μM). Moreover, the prolongation of the prothrombin time (PT) was measured for compound 9b to evaluate its in vitro anticoagulant activity. As a result, compound 9b exhibited pronounced anticoagulant activity with the 2 × PT value of 8.7 μM. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

Factor Xa generation by computational modeling: an additional discriminator to thrombin generation evaluation.

Directory of Open Access Journals (Sweden)

Kathleen E Brummel-Ziedins

Full Text Available Factor (fXa is a critical enzyme in blood coagulation that is responsible for the initiation and propagation of thrombin generation. Previously we have shown that analysis of computationally generated thrombin profiles is a tool to investigate hemostasis in various populations. In this study, we evaluate the potential of computationally derived time courses of fXa generation as another approach for investigating thrombotic risk. Utilizing the case (n = 473 and control (n = 426 population from the Leiden Thrombophilia Study and each individual's plasma protein factor composition for fII, fV, fVII, fVIII, fIX, fX, antithrombin and tissue factor pathway inhibitor, tissue factor-initiated total active fXa generation was assessed using a mathematical model. FXa generation was evaluated by the area under the curve (AUC, the maximum rate (MaxR and level (MaxL and the time to reach these, TMaxR and TMaxL, respectively. FXa generation was analyzed in the entire populations and in defined subgroups (by sex, age, body mass index, oral contraceptive use. The maximum rates and levels of fXa generation occur over a 10- to 12- fold range in both cases and controls. This variation is larger than that observed with thrombin (3-6 fold in the same population. The greatest risk association was obtained using either MaxR or MaxL of fXa generation; with an ∼2.2 fold increased risk for individuals exceeding the 90(th percentile. This risk was similar to that of thrombin generation(MaxR OR 2.6. Grouping defined by oral contraceptive (OC use in the control population showed the biggest differences in fXa generation; a >60% increase in the MaxR upon OC use. FXa generation can distinguish between a subset of individuals characterized by overlapping thrombin generation profiles. Analysis of fXa generation is a phenotypic characteristic which may prove to be a more sensitive discriminator than thrombin generation among all individuals.

Assessment of anti-factor Xa activity of heparin in binary parenteral nutrition admixtures for premature neonates.

Science.gov (United States)

Foinard, A; Perez, M; Barthélémy, C; Lannoy, D; Flamein, F; Storme, L; Tournoys, A; Décaudin, B; Odou, P

2015-07-01

An in vitro study was carried out to determine the anti-Xa activity of heparin in binary parenteral nutrition (BPN) admixtures for premature neonates in our neonatal intensive care unit (NICU) after a 24-hour infusion, as well as to assess drug interaction with a 50% glucose solution. Two types of bags were prepared: (1) BPN admixtures (composition defined in the NICU) including sodium heparin at 77 UI/mL and (2) bags containing only G50% with sodium heparin at 193 UI/mL. The anti-Xa activity of heparin was measured in bags at T0, after the 24-hour infusion and in eluates at the outlet of the infusion line after 24hours, using a validated chromogenic anti-Xa method. Comparisons of the mean concentration observed with the theoretical value for anti-Xa activity were performed with the Student t-test. Mean values of anti-Xa activity do not differ significantly from the values expected for all conditions. We found a slight variation in anti-Xa activity when infused over 24hours for both types of bags, with and without in-line filtration, showing that heparin remains stable during this infusion period in both BPN admixtures and G50%. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

Introduction of a rice blight resistance gene, Xa21, into five Chinese rice varieties through an Agrobacterium-mediated system

Institute of Scientific and Technical Information of China (English)

无

2000-01-01

A cloned gene, Xa21 was transferred into five widely-used Chinese rice varieties through an Agrobacterium-mediated system, and over 110 independent transgenic lines were obtained. PCR and Southern analysis of transgenic plants revealed the integration of the whole Xa21 gene into the host genomes. The integrated Xa21 gene was stably inherited, and segregated in a 3∶1 ratio in the selfed T1 generation when one copy of the gene was integrated in the transformants. Inoculation tests displayed that transgenic T0 plants and Xa21 PCR-positive T1 plants were highly resistant to bacterial blight disease. The selected Xa21 homozygous resistant transgenic lines with desirable qualities may be propagated as new varieties or utilized in hybrid rice breeding.

Introduction of a rice blight resistance gene, Xa21, into five Chinese rice varieties through an Agrobacterium -mediated system

Institute of Scientific and Technical Information of China (English)

翟文学; 李晓兵; 田文忠; 周永力; 潘学彪; 曹守云; 赵显峰; 赵彬; 章琦; 朱立煌

2000-01-01

A cloned gene, Xa21 was transferred into five widely-used Chinese rice varieties through an Agrobacterium-mediated system, and over 110 independent transgenic lines were obtained. PCR and Southern analysis of transgenic plants revealed the integration of the whole Xa21 gene into the host genomes. The integrated Xa21 gene was stably inherited, and segregated in a 3 : 1 ratio in the selfed T1 generation when one copy of the gene was integrated in the transfor-mants. Inoculation tests displayed that transgenic T0 plants and Xa21 PCR-positive T1 plants were highly resistant to bacterial blight disease. The selected Xa21 homozygous resistant transgenic lines with desirable qualities may be propagated as new varieties or utilized in hybrid rice breeding.

Role of Factor Xa Inhibitors in Cancer-Associated Thrombosis: Any New Data?

Directory of Open Access Journals (Sweden)

Ali Zalpour

2011-01-01

Full Text Available The association between cancer and venous thromboembolism (VTE has been well documented in the literature. Prevention and treatment of VTE in cancer patients is imperative. Typically, the mainstay regimen for VTE prevention and treatment has been anticoagulation therapy, unless contraindicated. This therapy consists of unfractionated heparin (UFH, low-molecular-weight heparin (LMWH, factor Xa inhibitor, or vitamin K antagonist (VKA. Current guidelines recommend LMWH over VKA for the treatment of VTE in cancer patients. Factor-specific anticoagulants have been proven safe and effective, and recently factor Xa inhibitors have emerged as a treatment alternative to heparins and VKA. Currently, three factor Xa inhibitors have been identified: fondaparinux (the only one approved so far by the US Food and Drug Administration, idraparinux (in clinical trials, and idrabiotaparinux (in clinical trials. This paper will examine the role of these agents, focusing on fondaparinux, for the prevention and treatment of VTE in cancer patients.

3D/3D registration of coronary CTA and biplane XA reconstructions for improved image guidance

Energy Technology Data Exchange (ETDEWEB)

Dibildox, Gerardo, E-mail: g.dibildox@erasmusmc.nl; Baka, Nora; Walsum, Theo van [Biomedical Imaging Group Rotterdam, Departments of Radiology and Medical Informatics, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands); Punt, Mark; Aben, Jean-Paul [Pie Medical Imaging, 6227 AJ Maastricht (Netherlands); Schultz, Carl [Department of Cardiology, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands); Niessen, Wiro [Quantitative Imaging Group, Faculty of Applied Sciences, Delft University of Technology, 2628 CJ Delft, The Netherlands and Biomedical Imaging Group Rotterdam, Departments of Radiology and Medical Informatics, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands)

2014-09-15

Purpose: The authors aim to improve image guidance during percutaneous coronary interventions of chronic total occlusions (CTO) by providing information obtained from computed tomography angiography (CTA) to the cardiac interventionist. To this end, the authors investigate a method to register a 3D CTA model to biplane reconstructions. Methods: The authors developed a method for registering preoperative coronary CTA with intraoperative biplane x-ray angiography (XA) images via 3D models of the coronary arteries. The models are extracted from the CTA and biplane XA images, and are temporally aligned based on CTA reconstruction phase and XA ECG signals. Rigid spatial alignment is achieved with a robust probabilistic point set registration approach using Gaussian mixture models (GMMs). This approach is extended by including orientation in the Gaussian mixtures and by weighting bifurcation points. The method is evaluated on retrospectively acquired coronary CTA datasets of 23 CTO patients for which biplane XA images are available. Results: The Gaussian mixture model approach achieved a median registration accuracy of 1.7 mm. The extended GMM approach including orientation was not significantly different (P > 0.1) but did improve robustness with regards to the initialization of the 3D models. Conclusions: The authors demonstrated that the GMM approach can effectively be applied to register CTA to biplane XA images for the purpose of improving image guidance in percutaneous coronary interventions.

Developing an Anti-Xa-Based Anticoagulation Protocol for Patients with Percutaneous Ventricular Assist Devices.

Science.gov (United States)

Sieg, Adam; Mardis, B Andrew; Mardis, Caitlin R; Huber, Michelle R; New, James P; Meadows, Holly B; Cook, Jennifer L; Toole, J Matthew; Uber, Walter E

2015-01-01

Because of the complexities associated with anticoagulation in temporary percutaneous ventricular assist device (pVAD) recipients, a lack of standardization exists in their management. This retrospective analysis evaluates current anticoagulation practices at a single center with the aim of identifying an optimal anticoagulation strategy and protocol. Patients were divided into two cohorts based on pVAD implanted (CentriMag (Thoratec; Pleasanton, CA) / TandemHeart (CardiacAssist; Pittsburgh, PA) or Impella (Abiomed, Danvers, MA)), with each group individually analyzed for bleeding and thrombotic complications. Patients in the CentriMag/TandemHeart cohort were subdivided based on the anticoagulation monitoring strategy (activated partial thromboplastin time (aPTT) or antifactor Xa unfractionated heparin (anti-Xa) values). In the CentriMag/TandemHeart cohort, there were five patients with anticoagulation titrated based on anti-Xa values; one patient developed a device thrombosis and a major bleed, whereas another patient experienced major bleeding. Eight patients received an Impella pVAD. Seven total major bleeds in three patients and no thrombotic events were detected. Based on distinct differences between the devices, anti-Xa values, and outcomes, two protocols were created to guide anticoagulation adjustments. However, anticoagulation in patients who require pVAD support is complex with constantly evolving anticoagulation goals. The ideal level of anticoagulation should be individually determined using several coagulation laboratory parameters in concert with hemodynamic changes in the patient's clinical status, the device, and the device cannulation.

Identification of bacterial blight resistance genes Xa4 in Pakistani ...

African Journals Online (AJOL)

SERVER

2008-03-04

Mar 4, 2008 ... Bacterial blight (BB) caused by Xanthomonas oryzae pv oryzae (Xoo) is a major biotic constraint in the irrigated rice belts. Genetic resistance is the most effective and economical control for bacterial blight. Molecular survey was conducted to identify the rice germplasm/lines for the presence of Xa4, a.

Comparative Transcriptome Profiling of Rice Near-Isogenic Line Carrying Xa23 under Infection of Xanthomonas oryzae pv. oryzae.

Science.gov (United States)

Tariq, Rezwan; Wang, Chunlian; Qin, Tengfei; Xu, Feifei; Tang, Yongchao; Gao, Ying; Ji, Zhiyuan; Zhao, Kaijun

2018-03-02

Bacterial blight, caused by Xanthomonas oryzae pv. oryzae ( Xoo ), is an overwhelming disease in rice-growing regions worldwide. Our previous studies revealed that the executor R gene Xa23 confers broad-spectrum disease resistance to all naturally occurring biotypes of Xoo . In this study, comparative transcriptomic profiling of two near-isogenic lines (NILs), CBB23 (harboring Xa23 ) and JG30 (without Xa23 ), before and after infection of the Xoo strain, PXO99 A , was done by RNA sequencing, to identify genes associated with the resistance. After high throughput sequencing, 1645 differentially expressed genes (DEGs) were identified between CBB23 and JG30 at different time points. Gene Ontlogy (GO) analysis categorized the DEGs into biological process, molecular function, and cellular component. KEGG analysis categorized the DEGs into different pathways, and phenylpropanoid biosynthesis was the most prominent pathway, followed by biosynthesis of plant hormones, flavonoid biosynthesis, and glycolysis/gluconeogenesis. Further analysis led to the identification of differentially expressed transcription factors (TFs) and different kinase responsive genes in CBB23, than that in JG30. Besides TFs and kinase responsive genes, DEGs related to ethylene, jasmonic acid, and secondary metabolites were also identified in both genotypes after PXO99 A infection. The data of DEGs are a precious resource for further clarifying the network of Xa23 -mediated resistance.

Oral direct thrombin inhibitors or oral factor Xa inhibitors for the treatment of deep vein thrombosis.

Science.gov (United States)

Robertson, Lindsay; Kesteven, Patrick; McCaslin, James E

2015-06-30

Deep vein thrombosis (DVT) is a condition in which a clot forms in the deep veins, most commonly of the leg. It occurs in approximately 1 in 1,000 people. If left untreated, the clot can travel up to the lungs and cause a potentially life-threatening pulmonary embolism (PE). Previously, a DVT was treated with the anticoagulants heparin and vitamin K antagonists. However, two forms of novel oral anticoagulants (NOACs) have been developed: oral direct thrombin inhibitors (DTI) and oral factor Xa inhibitors. The new drugs have characteristics that may be favourable over conventional treatment, including oral administration, a predictable effect, lack of frequent monitoring or re-dosing and few known drug interactions. To date, no Cochrane review has measured the effectiveness and safety of these drugs in the treatment of DVT. To assess the effectiveness of oral DTIs and oral factor Xa inhibitors for the treatment of DVT. The Cochrane Peripheral Vascular Diseases Group Trials Search Co-ordinator searched the Specialised Register (last searched January 2015) and the Cochrane Register of Studies (last searched January 2015). We searched clinical trials databases for details of ongoing or unpublished studies and the reference lists of relevant articles retrieved by electronic searches for additional citations. We included randomised controlled trials in which people with a DVT confirmed by standard imaging techniques, were allocated to receive an oral DTI or an oral factor Xa inhibitor for the treatment of DVT. Two review authors (LR, JM) independently extracted the data and assessed the risk of bias in the trials. Any disagreements were resolved by discussion with the third review author (PK). We performed meta-analyses when we considered heterogeneity low. The two primary outcomes were recurrent VTE and PE. Other outcomes included all-cause mortality and major bleeding. We calculated all outcomes using an odds ratio (OR) with a 95% confidence interval (CI). We included

L2₁ and XA Ordering Competition in Hafnium-Based Full-Heusler Alloys Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb).

Science.gov (United States)

Wang, Xiaotian; Cheng, Zhenxiang; Wang, Wenhong

2017-10-20

For theoretical designing of full-Heusler based spintroinc materials, people have long believed in the so-called Site Preference Rule (SPR). Very recently, according to the SPR, there are several studies on XA-type Hafnium-based Heusler alloys X₂YZ, i.e., Hf₂VAl, Hf₂CoZ (Z = Ga, In) and Hf₂CrZ (Z = Al, Ga, In). In this work, a series of Hf₂-based Heusler alloys, Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb), were selected as targets to study the site preferences of their atoms by first-principle calculations. It has been found that all of them are likely to exhibit the L2₁-type structure instead of the XA one. Furthermore, we reveal that the high values of spin-polarization of XA-type Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb) alloys have dropped dramatically when they form the L2₁-type structure. Also, we prove that the electronic, magnetic, and physics nature of these alloys are quite different, depending on the L2₁-type or XA-type structures.

Marker-Assisted Selection of Xa21 Conferring Resistance to Bacterial Leaf Blight in indica Rice Cultivar LT2

Institute of Scientific and Technical Information of China (English)

Hue Thi NGUYEN; Trung Nguyen DINH; Nakano TOSHITSUGU; Liet Van VU; Quang Hong VU; Tan Van MAI; Thu Thi NGUYEN; Lam Duc VU; Tung Thanh NGUYEN; Long Viet NGUYEN; Hien Thu Thi VU; Hue Thi NONG

2018-01-01

Bacterial leaf blight of rice (BLB), caused by Xanthomonas oryzae pv. oryzae, is one of the most destructive diseases in Asian rice fields. A high-quality rice variety, LT2, was used as the recipient parent. IRBB21, which carries the Xa21 gene, was used as the donor parent. The resistance gene Xa21 was introduced into LT2 by marker-assisted backcrossing. Three Xoo races were used to inoculate the improved lines following the clipping method. Eleven BC3F3lines carrying Xa21 were obtained based on molecular markers and agronomic performance. The 11 lines were then inoculated with the three Xoo races. All the 11 improved lines showed better resistance to BLB than the recipient parent LT2. Based on the level of resistance to BLB and their agronomic performance, five lines (BC3F35.1.5.1, BC3F35.1.5.12, BC3F38.5.6.44, BC3F3 9.5.4.1 and BC3F39.5.4.23) were selected as the most promising for commercial release. These improved lines could contribute to rice production in terms of food security.

Marker-Assisted Selection of Xa21 Conferring Resistance to Bacterial Leaf Blight in indica Rice Cultivar LT2

Directory of Open Access Journals (Sweden)

Hue Thi Nguyen

2018-01-01

Full Text Available Bacterial leaf blight of rice (BLB, caused by Xanthomonas oryzae pv. oryzae, is one of the most destructive diseases in Asian rice fields. A high-quality rice variety, LT2, was used as the recipient parent. IRBB21, which carries the Xa21 gene, was used as the donor parent. The resistance gene Xa21 was introduced into LT2 by marker-assisted backcrossing. Three Xoo races were used to inoculate the improved lines following the clipping method. Eleven BC3F3 lines carrying Xa21 were obtained based on molecular markers and agronomic performance. The 11 lines were then inoculated with the three Xoo races. All the 11 improved lines showed better resistance to BLB than the recipient parent LT2. Based on the level of resistance to BLB and their agronomic performance, five lines (BC3F3 5.1.5.1, BC3F3 5.1.5.12, BC3F3 8.5.6.44, BC3F3 9.5.4.1 and BC3F3 9.5.4.23 were selected as the most promising for commercial release. These improved lines could contribute to rice production in terms of food security.

RNA-Seq analysis reveals insight into enhanced rice Xa7-mediated bacterial blight resistance at high temperature.

Directory of Open Access Journals (Sweden)

Stephen P Cohen

Full Text Available Plant disease is a major challenge to agriculture worldwide, and it is exacerbated by abiotic environmental factors. During some plant-pathogen interactions, heat stress allows pathogens to overcome host resistance, a phenomenon which could severely impact crop productivity considering the global warming trends associated with climate change. Despite the importance of this phenomenon, little is known about the underlying molecular mechanisms. To better understand host plant responses during simultaneous heat and pathogen stress, we conducted a transcriptomics experiment for rice plants (cultivar IRBB61 containing Xa7, a bacterial blight disease resistance (R gene, that were infected with Xanthomonas oryzae, the bacterial blight pathogen of rice, during high temperature stress. Xa7-mediated resistance is unusual relative to resistance mediated by other R genes in that it functions better at high temperatures. Using RNA-Seq technology, we identified 8,499 differentially expressed genes as temperature responsive in rice cultivar IRBB61 experiencing susceptible and resistant interactions across three time points. Notably, genes in the plant hormone abscisic acid biosynthesis and response pathways were up-regulated by high temperature in both mock-treated plants and plants experiencing a susceptible interaction and were suppressed by high temperature in plants exhibiting Xa7-mediated resistance. Genes responsive to salicylic acid, an important plant hormone for disease resistance, were down-regulated by high temperature during both the susceptible and resistant interactions, suggesting that enhanced Xa7-mediated resistance at high temperature is not dependent on salicylic acid signaling. A DNA sequence motif similar to known abscisic acid-responsive cis-regulatory elements was identified in the promoter region upstream of genes up-regulated in susceptible but down-regulated in resistant interactions. The results of our study suggest that the plant

Oral direct thrombin inhibitors or oral factor Xa inhibitors for the treatment of pulmonary embolism.

Science.gov (United States)

Robertson, Lindsay; Kesteven, Patrick; McCaslin, James E

2015-12-04

Pulmonary embolism is a potentially life-threatening condition in which a clot can travel from the deep veins, most commonly in the leg, up to the lungs. Previously, a pulmonary embolism was treated with the anticoagulants heparin and vitamin K antagonists. Recently, however, two forms of direct oral anticoagulants (DOACs) have been developed: oral direct thrombin inhibitors (DTI) and oral factor Xa inhibitors. The new drugs have characteristics that may be favourable over conventional treatment, including oral administration, a predictable effect, lack of frequent monitoring or re-dosing and few known drug interactions. To date, no Cochrane review has measured the effectiveness and safety of these drugs in the long-term treatment (minimum duration of three months) of pulmonary embolism. To assess the effectiveness of oral DTIs and oral factor Xa inhibitors for the long-term treatment of pulmonary embolism. The Cochrane Vascular Trials Search Co-ordinator searched the Specialised Register (last searched January 2015) and the Cochrane Register of Studies (last searched January 2015). Clinical trials databases were also searched for details of ongoing or unpublished studies. We searched the reference lists of relevant articles retrieved by electronic searches for additional citations. We included randomised controlled trials in which patients with a pulmonary embolism confirmed by standard imaging techniques were allocated to receive an oral DTI or an oral factor Xa inhibitor for the long-term (minimum duration three months) treatment of pulmonary embolism. Two review authors (LR, JM) independently extracted the data and assessed the risk of bias in the trials. Any disagreements were resolved by discussion with the third author (PK). We used meta-analyses when we considered heterogeneity low. The two primary outcomes were recurrent venous thromboembolism and pulmonary embolism. Other outcomes included all-cause mortality and major bleeding. We calculated all outcomes

Transgenic expression of the rice Xa21 pattern-recognition receptor in banana (Musa sp.) confers resistance to Xanthomonas campestris pv. musacearum.

Science.gov (United States)

Tripathi, Jaindra N; Lorenzen, Jim; Bahar, Ofir; Ronald, Pamela; Tripathi, Leena

2014-08-01

Banana Xanthomonas wilt (BXW), caused by the bacterium Xanthomonas campestris pv. musacearum (Xcm), is the most devastating disease of banana in east and central Africa. The spread of BXW threatens the livelihood of millions of African farmers who depend on banana for food security and income. There are no commercial chemicals, biocontrol agents or resistant cultivars available to control BXW. Here, we take advantage of the robust resistance conferred by the rice pattern-recognition receptor (PRR), XA21, to the rice pathogen Xanthomonas oryzae pv. oryzae (Xoo). We identified a set of genes required for activation of Xa21-mediated immunity (rax) that were conserved in both Xoo and Xcm. Based on the conservation, we hypothesized that intergeneric transfer of Xa21 would confer resistance to Xcm. We evaluated 25 transgenic lines of the banana cultivar 'Gonja manjaya' (AAB) using a rapid bioassay and 12 transgenic lines in the glasshouse for resistance against Xcm. About 50% of the transgenic lines showed complete resistance to Xcm in both assays. In contrast, all of the nontransgenic control plants showed severe symptoms that progressed to complete wilting. These results indicate that the constitutive expression of the rice Xa21 gene in banana results in enhanced resistance against Xcm. Furthermore, this work demonstrates the feasibility of PRR gene transfer between monocotyledonous species and provides a valuable new tool for controlling the BXW pandemic of banana, a staple food for 100 million people in east Africa. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

78 FR 24677 - Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY

Science.gov (United States)

2013-04-26

... Final Rule This rule establishes a temporary safety zone on the navigable waters of the East River, in... Fireworks, Pier 34, East River, NY. (a) Regulated Area. The following area is a temporary safety zone: all... 1625-AA00 Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY AGENCY: Coast...

A ΩXaV motif in the Rift Valley fever virus NSs protein is essential for degrading p62, forming nuclear filaments and virulence.

Science.gov (United States)

Cyr, Normand; de la Fuente, Cynthia; Lecoq, Lauriane; Guendel, Irene; Chabot, Philippe R; Kehn-Hall, Kylene; Omichinski, James G

2015-05-12

Rift Valley fever virus (RVFV) is a single-stranded RNA virus capable of inducing fatal hemorrhagic fever in humans. A key component of RVFV virulence is its ability to form nuclear filaments through interactions between the viral nonstructural protein NSs and the host general transcription factor TFIIH. Here, we identify an interaction between a ΩXaV motif in NSs and the p62 subunit of TFIIH. This motif in NSs is similar to ΩXaV motifs found in nucleotide excision repair (NER) factors and transcription factors known to interact with p62. Structural and biophysical studies demonstrate that NSs binds to p62 in a similar manner as these other factors. Functional studies in RVFV-infected cells show that the ΩXaV motif is required for both nuclear filament formation and degradation of p62. Consistent with the fact that the RVFV can be distinguished from other Bunyaviridae-family viruses due to its ability to form nuclear filaments in infected cells, the motif is absent in the NSs proteins of other Bunyaviridae-family viruses. Taken together, our studies demonstrate that p62 binding to NSs through the ΩXaV motif is essential for degrading p62, forming nuclear filaments and enhancing RVFV virulence. In addition, these results show how the RVFV incorporates a simple motif into the NSs protein that enables it to functionally mimic host cell proteins that bind the p62 subunit of TFIIH.

XaNSoNS: GPU-accelerated simulator of diffraction patterns of nanoparticles

Directory of Open Access Journals (Sweden)

V.S. Neverov

2017-01-01

Full Text Available XaNSoNS is an open source software with GPU support, which simulates X-ray and neutron 1D (or 2D diffraction patterns and pair-distribution functions (PDF for amorphous or crystalline nanoparticles (up to ∼107 atoms of heterogeneous structural content. Among the multiple parameters of the structure the user may specify atomic displacements, site occupancies, molecular displacements and molecular rotations. The software uses general equations nonspecific to crystalline structures to calculate the scattering intensity. It supports four major standards of parallel computing: MPI, OpenMP, Nvidia CUDA and OpenCL, enabling it to run on various architectures, from CPU-based HPCs to consumer-level GPUs.

XaNSoNS: GPU-accelerated simulator of diffraction patterns of nanoparticles

Science.gov (United States)

Neverov, V. S.

XaNSoNS is an open source software with GPU support, which simulates X-ray and neutron 1D (or 2D) diffraction patterns and pair-distribution functions (PDF) for amorphous or crystalline nanoparticles (up to ∼107 atoms) of heterogeneous structural content. Among the multiple parameters of the structure the user may specify atomic displacements, site occupancies, molecular displacements and molecular rotations. The software uses general equations nonspecific to crystalline structures to calculate the scattering intensity. It supports four major standards of parallel computing: MPI, OpenMP, Nvidia CUDA and OpenCL, enabling it to run on various architectures, from CPU-based HPCs to consumer-level GPUs.

Analysis of nucleotide diversity among alleles of the major bacterial blight resistance gene Xa27 in cultivars of rice (Oryza sativa) and its wild relatives.

Science.gov (United States)

Bimolata, Waikhom; Kumar, Anirudh; Sundaram, Raman Meenakshi; Laha, Gouri Shankar; Qureshi, Insaf Ahmed; Reddy, Gajjala Ashok; Ghazi, Irfan Ahmad

2013-08-01

Xa27 is one of the important R-genes, effective against bacterial blight disease of rice caused by Xanthomonas oryzae pv. oryzae (Xoo). Using natural population of Oryza, we analyzed the sequence variation in the functionally important domains of Xa27 across the Oryza species. DNA sequences of Xa27 alleles from 27 rice accessions revealed higher nucleotide diversity among the reported R-genes of rice. Sequence polymorphism analysis revealed synonymous and non-synonymous mutations in addition to a number of InDels in non-coding regions of the gene. High sequence variation was observed in the promoter region including the 5'UTR with 'π' value 0.00916 and 'θ w ' = 0.01785. Comparative analysis of the identified Xa27 alleles with that of IRBB27 and IR24 indicated the operation of both positive selection (Ka/Ks > 1) and neutral selection (Ka/Ks ≈ 0). The genetic distances of alleles of the gene from Oryza nivara were nearer to IRBB27 as compared to IR24. We also found the presence of conserved and null UPT (upregulated by transcriptional activator) box in the isolated alleles. Considerable amino acid polymorphism was localized in the trans-membrane domain for which the functional significance is yet to be elucidated. However, the absence of functional UPT box in all the alleles except IRBB27 suggests the maintenance of single resistant allele throughout the natural population.

Daboxin P, a Major Phospholipase A2 Enzyme from the Indian Daboia russelii russelii Venom Targets Factor X and Factor Xa for Its Anticoagulant Activity.

Directory of Open Access Journals (Sweden)

Maitreyee Sharma

Full Text Available In the present study a major protein has been purified from the venom of Indian Daboia russelii russelii using gel filtration, ion exchange and Rp-HPLC techniques. The purified protein, named daboxin P accounts for ~24% of the total protein of the crude venom and has a molecular mass of 13.597 kDa. It exhibits strong anticoagulant and phospholipase A2 activity but is devoid of any cytotoxic effect on the tested normal or cancerous cell lines. Its primary structure was deduced by N-terminal sequencing and chemical cleavage using Edman degradation and tandem mass spectrometry. It is composed of 121 amino acids with 14 cysteine residues and catalytically active His48 -Asp49 pair. The secondary structure of daboxin P constitutes 42.73% of α-helix and 12.36% of β-sheet. It is found to be stable at acidic (pH 3.0 and neutral pH (pH 7.0 and has a Tm value of 71.59 ± 0.46°C. Daboxin P exhibits anticoagulant effect under in-vitro and in-vivo conditions. It does not inhibit the catalytic activity of the serine proteases but inhibits the activation of factor X to factor Xa by the tenase complexes both in the presence and absence of phospholipids. It also inhibits the tenase complexes when active site residue (His48 was alkylated suggesting its non-enzymatic mode of anticoagulant activity. Moreover, it also inhibits prothrombinase complex when pre-incubated with factor Xa prior to factor Va addition. Fluorescence emission spectroscopy and affinity chromatography suggest the probable interaction of daboxin P with factor X and factor Xa. Molecular docking analysis reveals the interaction of the Ca+2 binding loop; helix C; anticoagulant region and C-terminal region of daboxin P with the heavy chain of factor Xa. This is the first report of a phospholipase A2 enzyme from Indian viper venom which targets both factor X and factor Xa for its anticoagulant activity.

Identification of potent orally active factor Xa inhibitors based on conjugation strategy and application of predictable fragment recommender system.

Science.gov (United States)

Ishihara, Tsukasa; Koga, Yuji; Iwatsuki, Yoshiyuki; Hirayama, Fukushi

2015-01-15

Anticoagulant agents have emerged as a promising class of therapeutic drugs for the treatment and prevention of arterial and venous thrombosis. We investigated a series of novel orally active factor Xa inhibitors designed using our previously reported conjugation strategy to boost oral anticoagulant effect. Structural optimization of anthranilamide derivative 3 as a lead compound with installation of phenolic hydroxyl group and extensive exploration of the P1 binding element led to the identification of 5-chloro-N-(5-chloro-2-pyridyl)-3-hydroxy-2-{[4-(4-methyl-1,4-diazepan-1-yl)benzoyl]amino}benzamide (33, AS1468240) as a potent factor Xa inhibitor with significant oral anticoagulant activity. We also reported a newly developed Free-Wilson-like fragment recommender system based on the integration of R-group decomposition with collaborative filtering for the structural optimization process. Copyright © 2014 Elsevier Ltd. All rights reserved.

First Steps in the Direction of Synthetic, Allosteric, Direct Inhibitors of Thrombin and Factor Xa

OpenAIRE

Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R.

2009-01-01

Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and iii) the mechanism of...

Assessment of anti-factor Xa activity of enoxaparin for venous thromboembolism prophylaxis in morbidly obese surgical patients

Directory of Open Access Journals (Sweden)

Nouf Al Otaib

2017-01-01

Conclusions: Weight-based enoxaparin dose led to the anticipated peak anti-Xa levels (0.2–0.6 IU/mL in most of the morbidly obese study patients undergoing surgery without any evidence of major side effects. The weight-based dosing of enoxaparin was also effective in preventing VTE in all patients. Although these results are promising, further comparative trials are needed in the setting of morbidly obese surgical patients.

Alboserpin, a Factor Xa Inhibitor from the Mosquito Vector of Yellow Fever, Binds Heparin and Membrane Phospholipids and Exhibits Antithrombotic Activity

Czech Academy of Sciences Publication Activity Database

Calvo, E.; Mizurini, D.M.; Sa-Nunes, A.; Ribeiro, J.M.C.; Andersen, J. F.; Mans, B.J.; Monteiro, R.Q.; Kotsyfakis, Michalis; Francischetti, I.M.B.

2011-01-01

Roč. 286, č. 32 (2011), 27998-28010 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z60220518 Keywords : serpin * mosquito * Aedes albopictus * phospholipids * Factor Xa * heparin * binding affinity * coagulation * thrombus * bleeding Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.773, year: 2011

First steps in the direction of synthetic, allosteric, direct inhibitors of thrombin and factor Xa.

Science.gov (United States)

Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R

2009-08-01

Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that (i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; (ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and (iii) the mechanism of inhibition is allosteric. The molecules represent the first allosteric small molecule inhibitors of the two enzymes.

First Steps in the Direction of Synthetic, Allosteric, Direct Inhibitors of Thrombin and Factor Xa

Science.gov (United States)

Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R.

2009-01-01

Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and iii) the mechanism of inhibition is allosteric. The molecules represent the first allosteric small molecule inhibitors of the two enzymes. PMID:19540113

Practices and developments in spent fuel burnup credit applications. Proceedings of a technical committee meeting

Energy Technology Data Exchange (ETDEWEB)

NONE

2003-10-01

The International Atomic Energy Agency convened a technical committee Meeting on Requirements, Practices and Developments in Burnup Credit (BUC) Applications in Madrid, Spain, from 22 to 26 April 2002. The purpose of this meeting was to explore the progress and status of international activities related to the BUC applications for spent nuclear fuel. This meeting was the third major meeting on the uses of BUC for spent fuel management systems held since the IAEA began to monitor the uses of BUC in spent fuel management systems in 1997. The first major meeting was an Advisory Group meeting (AGM), which was held in Vienna, in October 1997. The second major meeting was a technical committee meeting (TCM), which was held in Vienna, in July 2000. Several consultants meetings were held since 1997 to advise and assist the IAEA in planning and conducting its BUC activities. The proceedings of the 1997 AGM were published as IAEA-TECDOC-1013, and the proceedings of the 2000 TCM as IAEA-TECDOC-1241. BUC for wet and dry storage systems, spent fuel transport, reprocessing and final disposal is needed in many Member States to allow for increased enrichment, and to increase storage capacities, cask capacities and dissolver capacities avoiding the need for extensive modifications. The use of BUC is a necessity for spent fuel disposal.

RUBY-1: a randomized, double-blind, placebo-controlled trial of the safety and tolerability of the novel oral factor Xa inhibitor darexaban (YM150) following acute coronary syndrome

DEFF Research Database (Denmark)

Steg, Ph Gabriel; Mehta, Shamir R; Jukema, J Wouter

2011-01-01

To establish the safety, tolerability and most promising regimen of darexaban (YM150), a novel, oral, direct factor Xa inhibitor, for prevention of ischaemic events in acute coronary syndrome (ACS)....

Knockdown of long non-coding RNA Taurine Up-Regulated 1 inhibited doxorubicin resistance of bladder urothelial carcinoma via Wnt/β-catenin pathway.

Science.gov (United States)

Xie, Dalong; Zhang, Hui; Hu, Xuanhao; Shang, Chao

2017-10-24

In genitourinary system, bladder cancer (BC) is the most common and lethal malignant tumor, which most common type is bladder urothelial carcinoma (BUC). Long non-coding RNA (lncRNA) Taurine Up-Regulated 1 (TUG1) gene is high-expressed in several malignant tumors, including BC. In this study, over-expression of TUG1 was found in BUC tissues and cell line resistant to doxorubicin (Dox). Knockdown of TUG1 inhibited the Dox resistance and promoted the cytotoxicity induced by Dox in T24/Dox cells. TUG1 knockdown also depressed the Wnt/β-catenin pathway, and the activation the Wnt/β-catenin pathway partly reversed the inhibitory effects of TUG1 knockdown on Dox resistance in T24/Dox cells. In conclusion, up-regulation of lncRNA TUG1 was related with the poor response of BUC patients to Dox chemotherapy, knockdown of TUG1 inhibited the Dox resistance of BUC cells via Wnt/β-catenin pathway. These findings might assist in the discovery of novel potential diagnostic and therapeutic target for BUC, thereby improve the effects of clinical treatment in patients.

Treatment of proximal deep vein thrombosis with a novel synthetic compound (SR90107A/ORG31540) with pure anti-factor Xa activity - A phase II evaluation

NARCIS (Netherlands)

Buller, HR; Cariou, R; Gallus, A; Gent, M; Ginsberg, J; Prins, MH; Lensing, A; Levi, M; Nurmohammed, N; Hirsh, J; Roberts, R; ten Cate, JW; Decousus, H; Mismetti, P; Buchmuller, A; Charlet, [No Value; Viallon, A; van der Meer, J; Meinardi, [No Value; Meijer, K; Piovella, F; Barone, M; Beltrametti, C; Serafini, S; Kraaijenhagen, RA; Koopman, MMW; Jagt, HHT; Muller, MBR; Kooy, MV; Nauta, S; Gallus, AS; Coghlan, D; Rich, C; Prandoni, P; Scudeller, A; Scarano, L; Girolami, A; Baker, R; Tan, E; Cooney, J; Eikelboom, J; Ninet, J; Dolmazon, C; Madoux, MHG; Coppere, B; Nenci, GG; Agnelli, G; Falcinelli, F; Morini, M; d'Angelo, A

2000-01-01

Background-Patients with venous thromboembolism require initial treatment with an immediate-acting anticoagulant, low-molecular-weight heparin. We evaluated a novel synthetic factor Xa inhibitor (SR90107a/ORG31540) as an alternative treatment. Methods and Results-A randomized-parallel-group, phase

Determination of rivaroxaban in patient’s plasma samples by anti-Xa chromogenic test associated to High Performance Liquid Chromatography tandem Mass Spectrometry (HPLC-MS/MS)

Science.gov (United States)

Derogis, Priscilla Bento Matos; Sanches, Livia Rentas; de Aranda, Valdir Fernandes; Colombini, Marjorie Paris; Mangueira, Cristóvão Luis Pitangueira; Katz, Marcelo; Faulhaber, Adriana Caschera Leme; Mendes, Claudio Ernesto Albers; Ferreira, Carlos Eduardo dos Santos; França, Carolina Nunes; Guerra, João Carlos de Campos

2017-01-01

Rivaroxaban is an oral direct factor Xa inhibitor, therapeutically indicated in the treatment of thromboembolic diseases. As other new oral anticoagulants, routine monitoring of rivaroxaban is not necessary, but important in some clinical circumstances. In our study a high-performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS) method was validated to measure rivaroxaban plasmatic concentration. Our method used a simple sample preparation, protein precipitation, and a fast chromatographic run. It was developed a precise and accurate method, with a linear range from 2 to 500 ng/mL, and a lower limit of quantification of 4 pg on column. The new method was compared to a reference method (anti-factor Xa activity) and both presented a good correlation (r = 0.98, p highly correlated and should be used as clinical tools for drug monitoring. The method was applied successfully in a group of 49 real-life patients, which allowed an accurate determination of rivaroxaban in peak and trough levels. PMID:28170419

Análise e identificação das antocianinas de couve rôxa (Brassica spp.)

OpenAIRE

Lopes, Dulce; Jesus, Benvinda; Cabrita, Luís

2004-01-01

A couve rôxa é uma espécie comestível com uma composição em antocianinas rica e complexa. Sabe-se que contem antocianinas poliglicosiladas, aciladas com um ou mesmo dois grupos acilo aromáticos, nomeadamente com ácidos coumárico e caféico. Este padrão de acilação é particularmente interessante, porque confere estabilidade às antocianinas e aumenta o seu potencial de utilização em aplicações famacêuticas, alimentares e cosméticas. Este estudo tem por objectivo determinar a...

Determination of rivaroxaban in patient's plasma samples by anti-Xa chromogenic test associated to High Performance Liquid Chromatography tandem Mass Spectrometry (HPLC-MS/MS).

Science.gov (United States)

Derogis, Priscilla Bento Matos; Sanches, Livia Rentas; de Aranda, Valdir Fernandes; Colombini, Marjorie Paris; Mangueira, Cristóvão Luis Pitangueira; Katz, Marcelo; Faulhaber, Adriana Caschera Leme; Mendes, Claudio Ernesto Albers; Ferreira, Carlos Eduardo Dos Santos; França, Carolina Nunes; Guerra, João Carlos de Campos

2017-01-01

Rivaroxaban is an oral direct factor Xa inhibitor, therapeutically indicated in the treatment of thromboembolic diseases. As other new oral anticoagulants, routine monitoring of rivaroxaban is not necessary, but important in some clinical circumstances. In our study a high-performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS) method was validated to measure rivaroxaban plasmatic concentration. Our method used a simple sample preparation, protein precipitation, and a fast chromatographic run. It was developed a precise and accurate method, with a linear range from 2 to 500 ng/mL, and a lower limit of quantification of 4 pg on column. The new method was compared to a reference method (anti-factor Xa activity) and both presented a good correlation (r = 0.98, p plasma samples for rivaroxaban measurement by HPLC-MS/MS without interferences. The chromogenic and HPLC-MS/MS methods were highly correlated and should be used as clinical tools for drug monitoring. The method was applied successfully in a group of 49 real-life patients, which allowed an accurate determination of rivaroxaban in peak and trough levels.

Three two-dimensional coordination polymers constructed from transition metals and 2,3-norbornanedicarboxylic acid: Hydrothermal synthesis, crystal structures and photocatalytic properties

Science.gov (United States)

Zhang, Jia; Wang, Chong-Chen

2017-02-01

Three novel coordination polymers based on transition metals like Co(II), Cu(II) and Mn(II), namely [Co2(bpy)2(nbda)2(H2O)2]·2H2O (denoted as BUC-1), [Cu2(bpy)2(nbda)2(H2O)2]·2H2O (BUC-2), [Mn2(bpy)2(nbda)2(H2O)2]·2H2O (BUC-3), (where bpy = 4,4‧-bipyridine, H2nbda = 2,3-norbornanedicarboxylic acid, BUC = Beijing University of Civil Engineering and Architecture), were synthesized under hydrothermal conditions, and characterized by CNH elemental analyses (EA), Fourier Transform infrared spectroscopy (FTIR), and single crystal X-ray diffraction (SCXRD). BUC 1-3 were isostructural and crystallized in the monoclinic space group C2/c, in which the corresponding metal atoms were linked by typical bidentate bpy ligands into two adjacent 1D [M1(bpy)]n2n+ and [M2(bpy)]n2n+ (M = Co(II), Cu(II), Mn(II)), further joined by versatile nbda2- ligands into 2D [M2(bpy)2(nbda)2]n sheets. Finally, three-dimensional supramolecular frameworks were constructed with the aid of the intermolecular hydrogen bonding interactions. BUC 1-3 exhibited different photocatalytic degradation ability to decompose methylene blue (MB) and methyl orange (MO) under UV light irradiation. Additionally, a possible photocatalytic mechanism HOMO-LUMO was proposed and discussed, which was further confirmed by radicals trapping experiments using isopropanol as radical scavenger.

Chronic arsenic exposure increases TGFalpha concentration in bladder urothelial cells of Mexican populations environmentally exposed to inorganic arsenic

International Nuclear Information System (INIS)

Valenzuela, Olga L.; Germolec, Dori R.; Borja-Aburto, Victor H.; Contreras-Ruiz, Jose; Garcia-Vargas, Gonzalo G.; Razo, Luz M. del

2007-01-01

Inorganic arsenic (iAs) is a well-established carcinogen and human exposure has been associated with a variety of cancers including those of skin, lung, and bladder. High expression of transforming growth factor alpha (TGF-α) has associated with local relapses in early stages of urinary bladder cancer. iAs exposures are at least in part determined by the rate of formation and composition of iAs metabolites (MAs III , MAs V , DMAs III , DMAs V ). This study examines the relationship between TGF-α concentration in exfoliated bladder urothelial cells (BUC) separated from urine and urinary arsenic species in 72 resident women (18-51 years old) from areas exposed to different concentrations of iAs in drinking water (2-378 ppb) in central Mexico. Urinary arsenic species, including trivalent methylated metabolites were measured by hydride generation atomic absorption spectrometry method. The concentration of TGF-α in BUC was measured using an ELISA assay. Results show a statistically significant positive correlation between TGF-α concentration in BUC and each of the six arsenic species present in urine. The multivariate linear regression analyses show that the increment of TGF-α levels in BUC was importantly associated with the presence of arsenic species after adjusting by age, and presence of urinary infection. People from areas with high arsenic exposure had a significantly higher TGF-α concentration in BUC than people from areas of low arsenic exposure (128.8 vs. 64.4 pg/mg protein; p < 0.05). Notably, exfoliated cells isolated from individuals with skin lesions contained significantly greater amount of TGF-α than cells from individuals without skin lesions: 157.7 vs. 64.9 pg/mg protein (p = 0.003). These results suggest that TGF-α in exfoliated BUC may serve as a susceptibility marker of adverse health effects on epithelial tissue in arsenic-endemic areas

Rivaroxaban-once daily, oral, direct factor Xa inhibition compared with vitamin K antagonism for prevention of stroke and Embolism Trial in Atrial Fibrillation: rationale and design of the ROCKET AF study

DEFF Research Database (Denmark)

NN, NN

2010-01-01

BACKGROUND: Atrial fibrillation (AF), the most common significant cardiac arrhythmia, increases the risk of stroke, particularly in the elderly. Warfarin is effective in reducing stroke risk but is burdensome to patients and is difficult to control. Rivaroxaban is an oral direct factor Xa inhibit...

Contemporary developments in the discovery of selective factor Xa inhibitors: A review.

Science.gov (United States)

Patel, Nirav R; Patel, Dushyant V; Murumkar, Prashant R; Yadav, Mange Ram

2016-10-04

Thrombosis is a leading cause of death in cardiovascular diseases such as myocardial infarction (MI), unstable angina and acute coronary syndrome (ACS) in the industrialized world. Venous thromboembolism is observed in about 1 million people every year in United States causing significant morbidity and mortality. Conventional antithrombotic therapy has been reported to have several disadvantages and limitations like inconvenience in oral administration, bleeding risks (heparin analogs), narrow therapeutic window and undesirable interactions with food and drugs (vitamin K antagonist-warfarin). The unmet medical demand for orally active safe anticoagulants has generated widespread interest among the medicinal chemists engaged in this field. To modulate blood coagulation, various enzymes involved in the coagulation process have received great attention as potential targets by various research groups for the development of oral anticoagulants. Among these enzymes, factor Xa (FXa) has remained the centre of attention in the last decade. Intensive research efforts have been made by various research groups for the development of small, safe and orally bioavailable FXa inhibitors. This review is an attempt to compile the research work of various researchers in the direction of development of FXa inhibitors reported since 2010 onward. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

BUC implementation in Slovakia

International Nuclear Information System (INIS)

Chrapciak, V.; Vaclav, J.

2009-01-01

Improved calculation methods allow one to take credit for the reactivity reduction associated with fuel burnup. This means reducing the analysis conservatism while maintaining an adequate criticality safety margin. Application of burnup credit requires knowledge of the reactivity state of the irradiated fuel for which application of burnup credit is taken. The isotopic inventory and reactivity has to be calculated with validated codes. We use in Slovakia Gd2 fuel with maximal enrichment of fuel pins 4.4%. Our transport and storage basket KZ-48 with boron steel is licensed for fresh fuel with enrichment 4.4%. In near future (2011 or 2012) we will use a new fuel with maximal enrichment of fuel pins 4.9%. For this fuel we plan to use existing KZ-48 with application of burnup credit application. In cooperation with Slovak Nuclear Regulatory Authority we have started several years ago process of application of burnup credit implementation in Slovakia for WWER-440 reactors. We have already prepared methodology according IAEA methodology. We have validated computational systems (SCALE 5.1 already, SCALE 6 in progress). Slovak Nuclear Regulatory Authority will prepare regulation about application of burnup credit application in Slovakia. Last item is preparation of safety reports (for transport and storage) for the new fuel with average enrichment 4.87% in basket KZ-48 with application of burnup credit application. (Authors)

Overexpression of high mobility group box 1 contributes to progressive clinicopathological features and poor prognosis of human bladder urothelial carcinoma

Directory of Open Access Journals (Sweden)

Huang CK

2018-04-01

Full Text Available Changkun Huang,* Zhichao Huang,* Xiaokun Zhao, Yinhuai Wang, Hongqing Zhao, Zhaohui Zhong, Lang Wang Department of Urology, The Second Xiangya Hospital, Central South University, Changsha, Hunan, People’s Republic of China *These authors contributed equally to this work Background: High mobility group box 1 (HMGB1, a versatile protein with intranuclear and extracellular functions, plays an important role in a variety of human cancers. However, the clinical/prognostic significance of HMGB1 expression in human bladder urothelial carcinoma (BUC remains unclear. The aim of this study was to investigate the HMGB1 expression in human BUC with regard to its clinical and prognostic significance.Patients and methods: HMGB1 mRNA and protein expressions in tumor and paired normal bladder tissues were detected in 20 BUC cases by quantitative real-time polymerase chain reaction (qRT-PCR and Western blot. HMGB1 protein expression in 165 primary BUC tissues was evaluated by immunohistochemistry (IHC, and its correlations with clinicopathological characteristics and prognosis were also analyzed. Student’s t-test, χ2 test, Kaplan–Meier plots, and Cox proportional hazard regression model were performed to analyze the data. Results: By using qRT-PCR and Western blot, the upregulated expression of HMGB1 mRNA and protein was detected in BUC, compared with paired normal tissue (P<0.05. By using IHC, high HMGB1 expression was examined in 84 of 165 (51.0% BUC cases. High HMGB1 expression was significantly correlated with poorer differentiation and higher T and N classification (all P<0.05. Univariate analysis showed that high HMGB1 expression was significantly associated with a shortened patients’ overall survival (OS and disease-free survival (DFS; both P<0.001. In different subgroups of BUC patients, HMGB1 expression was a prognostic factor in patients with different histological grades or T classification (all P<0.05, pN− (both P<0.001 for OS and DFS, and

Trivial topological phase of CaAgP and the topological nodal-line transition in CaAg (P1 -xA sx)

Science.gov (United States)

Xu, N.; Qian, Y. T.; Wu, Q. S.; Autès, G.; Matt, C. E.; Lv, B. Q.; Yao, M. Y.; Strocov, V. N.; Pomjakushina, E.; Conder, K.; Plumb, N. C.; Radovic, M.; Yazyev, O. V.; Qian, T.; Ding, H.; Mesot, J.; Shi, M.

2018-04-01

By performing angle-resolved photoemission spectroscopy and first-principles calculations, we address the topological phase of CaAgP and investigate the topological phase transition in CaAg (P1 -xA sx) . We reveal that in CaAgP, the bulk band gap and surface states with a large bandwidth are topologically trivial, in agreement with hybrid density functional theory calculations. The calculations also indicate that application of "negative" hydrostatic pressure can transform trivial semiconducting CaAgP into an ideal topological nodal-line semimetal phase. The topological transition can be realized by partial isovalent P/As substitution at x =0.38 .

Cleavage of spike protein of SARS coronavirus by protease factor Xa is associated with viral infectivity

International Nuclear Information System (INIS)

Du, Lanying; Kao, Richard Y.; Zhou, Yusen; He, Yuxian; Zhao, Guangyu; Wong, Charlotte; Jiang, Shibo; Yuen, Kwok-Yung; Jin, Dong-Yan; Zheng, Bo-Jian

2007-01-01

The spike (S) protein of SARS coronavirus (SARS-CoV) has been known to recognize and bind to host receptors, whose conformational changes then facilitate fusion between the viral envelope and host cell membrane, leading to viral entry into target cells. However, other functions of SARS-CoV S protein such as proteolytic cleavage and its implications to viral infection are incompletely understood. In this study, we demonstrated that the infection of SARS-CoV and a pseudovirus bearing the S protein of SARS-CoV was inhibited by a protease inhibitor Ben-HCl. Also, the protease Factor Xa, a target of Ben-HCl abundantly expressed in infected cells, was able to cleave the recombinant and pseudoviral S protein into S1 and S2 subunits, and the cleavage was inhibited by Ben-HCl. Furthermore, this cleavage correlated with the infectivity of the pseudovirus. Taken together, our study suggests a plausible mechanism by which SARS-CoV cleaves its S protein to facilitate viral infection

Bioassay-directed fractionation of a blood coagulation factor Xa inhibitor, betulinic acid from Lycopus lucidus

Directory of Open Access Journals (Sweden)

Tan Yin-Feng

2018-03-01

Full Text Available Thrombosis is a major cause of morbidity and mortality worldwide and plays a pivotal role in the pathogenesis of several cardiovascular disorders, including acute coronary syndrome, unstable angina, myocardial infarction, sudden cardiac death, peripheral arterial occlusion, ischemic stroke, deep-vein thrombosis, and pulmonary embolism. Anticoagulants, antiplatelet agents, and fibrinolytics can reduce the risks of these clinical events. Especially, the blood coagulation factor Xa (FXa inhibitor is a proven anticoagulant. Promoting blood circulation, using traditional Chinese medicine (TCM, for the treatment of these diseases has been safely used for thousands of years in clinical practice. Therefore, highly safe and effective anticoagulant ingredients, including FXa inhibitors, could be found in TCM for activating the blood circulation. One FXa inhibitor, a pentacyclic triterpene (compound 1, betulinic acid characterized by IR, MS and NMR analyses, was isolated from the ethyl acetate fraction of Lycopus lucidus by bioassay-directed fractionation. Compound 1 exhibited an inhibitory effect on FXa with IC50 25.05 μmol/L and reduced the thrombus weight in an animal model at 25-100 mg/kg. These results indicate that betulinic acid could be the potential for anticoagulant therapy.

Identification of key pathways and genes influencing prognosis in bladder urothelial carcinoma

Directory of Open Access Journals (Sweden)

Ning X

2017-03-01

Full Text Available Xin Ning, Yaoliang Deng Department of Urology, The First Affiliated Hospital of Guangxi Medical University, Nanning, Guangxi Province, People’s Republic of China Background: Genomic profiling can be used to identify the predictive effect of genomic subsets for determining prognosis in bladder urothelial carcinoma (BUC after radical cystectomy. This study aimed to investigate potential gene and pathway markers associated with prognosis in BUC.Methods: A microarray dataset of BUC was obtained from The Cancer Genome Atlas database. Differentially expressed genes (DEGs were identified by DESeq of the R platform. Kaplan–Meier analysis was applied for prognostic markers. Key pathways and genes were identified using bioinformatics tools, such as gene set enrichment analysis, gene ontology, the Kyoto Encyclopedia of Genes and Genomes, gene multiple association network integration algorithm (GeneMANIA, Search Tool for the Retrieval of Interacting Genes/Proteins, and Molecular Complex Detection.Results: A comparative gene set enrichment analysis of tumor and adjacent normal tissues suggested BUC tumorigenesis resulted mainly from enrichment of cell cycle and DNA damage and repair-related biological processes and pathways, including TP53 and mitotic recombination. Two hundred and fifty-six genes were identified as potential prognosis-related DEGs. Gene ontology and Kyoto Encyclopedia of Genes and Genomes analyses showed that the potential prognosis-related DEGs were enriched in angiogenesis, including the cyclic adenosine monophosphate biosynthetic process, cyclic guanosine monophosphate-protein kinase G, mitogen-activated protein kinase, Rap1, and phosphoinositide-3-kinase-AKT signaling pathway. Nine hub genes, TAGLN, ACTA2, MYH11, CALD1, MYLK, GEM, PRELP, TPM2, and OGN, were identified from the intersection of protein–protein interaction and GeneMANIA networks. Module analysis of protein–protein interaction and GeneMANIA networks mainly showed

Tranexamic Acid Failed to Reverse the Anticoagulant Effect and Bleeding by an Oral Direct Factor Xa Inhibitor Edoxaban.

Science.gov (United States)

Honda, Yuko; Furugohri, Taketoshi; Morishima, Yoshiyuki

2018-01-01

Agents to reverse the anticoagulant effect of edoxaban, an oral direct factor Xa inhibitor, would be desirable in emergency situations. The aim of this study is to determine the effect of tranexamic acid, an antifibrinolytic agent, on the anticoagulant activity and bleeding by edoxaban in rats. A supratherapeutic dose of edoxaban (3 mg/kg) was intravenously administered to rats. Three minutes after dosing, tranexamic acid (100 mg/kg) was given intravenously. Bleeding was induced by making an incision with a blade on the planta 8 min after edoxaban injection and bleeding time was measured. Prothrombin time (PT) and clot lysis were examined. A supratherapeutic dose of edoxaban significantly prolonged PT and bleeding time. Tranexamic acid did not affect PT or bleeding time prolonged by edoxaban, although tranexamic acid significantly inhibited clot lysis in rat plasma. An antifibrinolytic agent tranexamic acid failed to reverse the anticoagulant effect and bleeding by edoxaban in rats. © 2017 S. Karger AG, Basel.

Thrombin and factor Xa link the coagulation system with liver fibrosis.

Science.gov (United States)

Dhar, Ameet; Sadiq, Fouzia; Anstee, Quentin M; Levene, Adam P; Goldin, Robert D; Thursz, Mark R

2018-05-08

Thrombin activates hepatic stellate cells via protease-activated receptor-1. The role of Factor Xa (FXa) in hepatic fibrosis has not been elucidated. We aimed to evaluate the impact of FXa and thrombin in vitro on stellate cells and their respective inhibition in vivo using a rodent model of hepatic fibrosis. HSC-LX2 cells were incubated with FXa and/or thrombin in cell culture, stained for αSMA and relative gene expression and gel contraction calculated. C57BL/6 J mice were administered thioacetamide (TAA) for 8 weeks with Rivaroxaban (n = 15) or Dabigatran (n = 15). Control animals received TAA alone (n = 15). Fibrosis was scored and quantified using digital image analysis and hepatic tissue hydroxyproline estimated. Stellate cells treated with FXa and thrombin demonstrated upregulation of procollagen, TGF-beta, αSMA and significant cell contraction (43.48%+/- 4.12) compared to culturing with FXa or thrombin alone (26.90%+/- 8.90, p = 0.02; 13.1%+/- 9.84, p < 0.001). Mean fibrosis score, percentage area of fibrosis and hepatic hydroxyproline content (2.46 vs 4.08, p = 0.008; 2.02% vs 3.76%, p = 0.012; 276.0 vs 651.3, p = 0.0001) were significantly reduced in mice treated with the FXa inhibitor compared to control mice. FXa inhibition was significantly more effective than thrombin inhibition in reducing percentage area of fibrosis and hepatic hydroxyproline content (2.02% vs 3.70%,p = 0.031; 276.0 vs 413.1,p = 0.001). FXa promotes stellate cell contractility and activation. Early inhibition of coagulation using a FXa inhibitor significantly reduces TAA induced murine liver fibrosis and may be a viable treatment for liver fibrosis in patients.

Agent-based modelling of shifting cultivation field patterns, Vietnam

DEFF Research Database (Denmark)

Jepsen, Martin Rudbeck; Leisz, S.; Rasmussen, K.

2006-01-01

Shifting cultivation in the Nghe An Province of Vietnam's Northern Mountain Region produces a characteristic land-cover pattern of small and larger fields. The pattern is the result of farmers cultivating either individually or in spatially clustered groups. Using spatially explicit agent...

French fission products experiments performed in Cadarache and Valduc. Results comparison

International Nuclear Information System (INIS)

Anno, Jacques; Barreau, Anne; Hudelot, Jean Pascal; Girault, Emmanuel; Fouillaud, Patrick; Toubon, Herve

2003-01-01

Cofunded by Cogema, two complementary experimental programmes on burn up credit (BUC) related to fission products (FPs) are performed by CEA and IRSN at Cadarache and Valduc. After shortly recalling the main characteristics of each experiment, a first comparison of some results is presented, especially the energy range in which most part of cross section absorption are qualified. Both experiments exhibit great quality and accurate results, giving a high degree of confidence to the whole experimental French process of qualification devoted to BUC. (author)

Burnup Credit of French PWR-MOx fuels: methodology and associated conservatisms with the JEFF-3.1.1 evaluation

International Nuclear Information System (INIS)

Chambon, A.

2013-01-01

Considering spent fuel management (storage, transport and reprocessing), the approach using 'fresh fuel assumption' in criticality-safety studies results in a significant conservatism in the calculated value of the system reactivity. The concept of Burnup Credit (BUC) consists in considering the reduction of the spent fuel reactivity due to its burnup. A careful BUC methodology, developed by CEA in association with AREVA-NC was recently validated and written up for PWR-UOx fuels. However, 22 of 58 French reactors use MOx fuel, so more and more irradiated MOx fuels have to be stored and transported. As a result, why industrial partners are interested in this concept is because taking into account this BUC concept would enable for example a load increase in several fuel cycle devices. Recent publications and discussions within the French BUC Working Group highlight the current interest of the BUC concept in PWR-MOx spent fuel industrial applications. In this case of PWR-MOx fuel, studies show in particular that the 15 FPs selected thanks to their properties (absorbing, stable, non-gaseous) are responsible for more than a half of the total reactivity credit and 80% of the FPs credit. That is why, in order to get a conservative and physically realistic value of the application k eff and meet the Upper Safety Limit constraint, calculation biases on these 15 FPs inventory and individual reactivity worth should be considered in a criticality-safety approach. In this context, thanks to an exhaustive literature study, PWR-MOx fuels particularities have been identified and by following a rigorous approach, a validated and physically representative BUC methodology, adapted to this type of fuel has been proposed, allowing to take fission products into account and to determine the biases related to considered isotopes inventory and to reactivity worth. This approach consists of the following studies: - isotopic correction factors determination to guarantee the criticality

Advances in applications of burnup credit to enhance spent fuel transportation, storage, reprocessing and disposition. Proceedings of a technical meeting

International Nuclear Information System (INIS)

2007-05-01

Given a trend towards higher burnup power reactor fuel, the IAEA began an active programme in burnup credit (BUC) with major meetings in 1997 (IAEA-TECDOC-1013), 2000 (IAEA-TECDOC-1241) and 2002 (IAEA-TECDOC-1378) exploring worldwide interest in using BUC in spent fuel management systems. This publication contains the proceedings of the IAEA's 4th major BUC meeting, held in London. Sixty participants from 18 countries addressed calculation methodology, validation and criticality, safety criteria, procedural compliance with safety criteria, benefits of BUC applications, and regulatory aspects in BUC. This meeting encouraged the IAEA to continue its activities on burnup credit including dissemination of related information, given the number of Member States having to deal with increased spent fuel quantities and extended durations. A 5th major meeting on burnup credit is planned 2008. Burnup credit is a concept that takes credit for the reduced reactivity of fuel discharged from the reactor to improve loading density of irradiated fuel assemblies in storage, transportation, and disposal applications, relative to the assumption of fresh fuel nuclide inventories in loading calculations. This report has described a general four phase approach to be considered in burnup credit implementation. Much if not all of the background research and data acquisition necessary for successful burnup credit development in preparation for licensing has been completed. Many fuel types, facilities, and analysis methods are encompassed in the public knowledge base, such that in many cases this guidance will provide a means for rapid development of a burnup credit program. For newer assembly designs, higher enrichment fuels, and more extensive nuclide credit, additional research and development may be necessary, but even this work can build on the foundation that has been established to date. Those, it is hoped that this report will serve as a starting point with sufficient reference to

Novel direct factor Xa inhibitory compounds from Tenebrio molitor with anti-platelet aggregation activity.

Science.gov (United States)

Lee, Wonhwa; Kim, Mi-Ae; Park, InWha; Hwang, Jae Sam; Na, MinKyun; Bae, Jong-Sup

2017-11-01

Tenebrio molitor is an edible insect that has antimicrobial, anticancer, and antihypertensive effects. The aim of this study was to identify the unreported bioactive compounds from T. molitor larvae with inhibitory activities against factor Xa (FXa) and platelet aggregation. Isolated compounds were evaluated for their anti-FXa and anti-platelet aggregation properties by monitoring clotting time, platelet aggregation, FXa activity, and thrombus formation. A diketopiperazine (1, cyclo( L -Pro- L -Tyr)) and a phenylethanoid (2, N-acetyltyramine) were isolated and inhibited the catalytic activity of FXa in a mixed inhibition model and inhibited platelet aggregation induced by adenosine diphosphate (ADP) and U46619. They inhibited ADP- and U46619-induced phosphorylation of myristoylated alanine-rich C kinase substrate (MARCKS) and the expression of P-selectin and PAC-1 in platelets. They also improved the production of nitric oxide and inhibited the oversecretion of endothelin-1 compared to that of the ADP- or U46619-treated group. In an animal model of arterial and pulmonary thrombosis, the isolated compounds showed enhanced antithrombotic effects. They also elicited anticoagulant effects in mice. Compounds 1-2 inhibited ADP-, collagen-, or U46619-induced platelet aggregation and showed similar anti-thrombotic efficacy to rivaroxaban, a positive control. Therefore, 1-2 could serve as candidates and provide scaffolds for the development of new anti-FXa and anti-platelet drugs. Copyright © 2017 Elsevier Ltd. All rights reserved.

The Factor of Structure and Mechanical Properties in the Production of Critical Fixing Hardware 38XA

Directory of Open Access Journals (Sweden)

G.V. Pachurin

2016-09-01

Full Text Available Fixing hardware made of carbon, high-carbon, and alloyed wires is one of the widespread critical parts in mechanical engineering. The characteristics of fixtures and fasteners and their performance figures are assessed at all stages of steel-making operation, from the choice of burden stock for metal smelting to the method of preparing calibrated rolled metal parts and upsetting end products. Material used for producing long high-duty bolts must be both sufficiently strong and ductile, have homogeneous mechanical properties and chemistry, and no inner or surface defects. When manufacturing fasteners, hot-rolled metal is often plastically deformed by drafting before cold upsetting, and all unacceptable defects are removed by the expensive procedure of lathe-turning. Moreover, this technology of metal processing entails losses of up to 5.5 % in chips. This paper suggests a resource-efficient and environmentally friendlier fabrication method for calibrated rolled metal items made of steel 38XA, 9.65 mm diameter, for cold die-forging of high-duty bolts used in automotive engines, which helps spare expensive lathe-machining processes. Moreover, rolled steel produced using this technology is characterized by high resistance to plastic deformation when cold, which leads to increase n wear-resistance of tools in cold die-forging of bolts.

A practical approach to burn-up credit use in package design approval for PWR uranium oxide spent fuel assemblies

International Nuclear Information System (INIS)

Kroger, H.; Reiche, I.

2009-01-01

TN International has applied for a license for the TN 24 E transport and storage cask with the German competent authority using a new Burn-up Credit (BUC) approach for PWR uranium oxide fuel assemblies based on actinides and six selected fission products. In order to enable the use of BUC for fission products, various experimental data have to be provided for the two important aspects of the criticality calculation. Firstly, post-irradiation examination (PIE) experiments for the verification of the calculated fission product concentrations have to be provided for each selected fission product. These data are then used to validate the depletion calculations. Secondly, experimental data for the criticality calculations in the form of critical benchmark experiments have to be provided. The submitted data will be investigated for their applicability to the TN 24 E transport and storage cask. Since the application is limited to six fission products only, the conservatism of the BUC approach can be further justified, as the reduction in reactivity from the remaining fission products (about 190) is not taken credit for. (authors)

Needs of reliable nuclear data and covariance matrices for Burnup Credit in JEFF-3 library

International Nuclear Information System (INIS)

Chambon, A.; Santamarina, A.; Riffard, C.; Lavaud, F.; Lecarpentier, D.

2013-01-01

Burnup Credit (BUC) is the concept which consists in taking into account credit for the reduction of nuclear spent fuel reactivity due to its burnup. In the case of PWR-MOx spent fuel, studies pointed out that the contribution of the 15 most absorbing, stable and non-volatile fission products selected to the credit is as important as the one of the actinides. In order to get a 'best estimate' value of the keff, biases of their inventory calculation and individual reactivity worth should be considered in criticality safety studies. This paper enhances the most penalizing bias towards criticality and highlights possible improvements of nuclear data for the 15 fission products (FPs) of PWR-MOx BUC. Concerning the fuel inventory, trends in function of the burnup can be derived from experimental validation of the DARWIN-2.3 package (using the JEFF- 3.1.1/SHEM library). Thanks to the BUC oscillation programme of separated FPs in the MINERVE reactor and fully validated scheme PIMS, calculation over experiment ratios can be accurately transposed to tendencies on the FPs integral cross sections. (authors)

Transporting existing VSC-24 canisters using a risk-based licensing approach

Energy Technology Data Exchange (ETDEWEB)

Srinivasan, R.; Sisley, S.E.; Hopf, J.E. [BNFL Fuel Solutions, Campbell, CA (United States)

2004-07-01

The eventual disposition of the spent fuel assemblies loaded in canisters and casks currently designed and licensed only for on-site storage is an industry-wide issue. The canister-specific BUC evaluation approach developed by BFS can be used to license many of these storage canisters and casks for transportation. This will allow these storage canisters and casks to be transported intact to a long-term storage facility or repository, thereby minimizing fuel handling operations, impact on plant operations, and occupational exposure, as well as total infrastructure costs. Application of the proposed canister-specific BUC analysis approach to a preliminary evaluation of the 58 loaded MSBs demonstrates the benefits of this approach. The results of this preliminary evaluation show that a more rigorous analysis based on the known characteristics of the loaded spent fuel, rather than the design-basis fuel parameters, produces significantly lower maximum keff values and can be used to qualify many of the existing loaded storage canisters for transportation. Transportation certification for storage canisters having more reactive spent fuel payloads may require reliance on BUC approaches that are more aggressive than current NRC guidelines allow. Credit may be required for fission- product isotopes that do not have sufficient chemical assay data for benchmarking. In addition, reduced criticality safety margins may be required. For these more-aggressive BUC approaches, a risk assessment should be provided to support the NRC-approval basis. The risk assessment should evaluate the possibility and consequences of an accidental criticality event based upon inaccuracies in the characterization of the spent-fuel payloads.

Transporting existing VSC-24 canisters using a risk-based licensing approach

International Nuclear Information System (INIS)

Srinivasan, R.; Sisley, S.E.; Hopf, J.E.

2004-01-01

The eventual disposition of the spent fuel assemblies loaded in canisters and casks currently designed and licensed only for on-site storage is an industry-wide issue. The canister-specific BUC evaluation approach developed by BFS can be used to license many of these storage canisters and casks for transportation. This will allow these storage canisters and casks to be transported intact to a long-term storage facility or repository, thereby minimizing fuel handling operations, impact on plant operations, and occupational exposure, as well as total infrastructure costs. Application of the proposed canister-specific BUC analysis approach to a preliminary evaluation of the 58 loaded MSBs demonstrates the benefits of this approach. The results of this preliminary evaluation show that a more rigorous analysis based on the known characteristics of the loaded spent fuel, rather than the design-basis fuel parameters, produces significantly lower maximum keff values and can be used to qualify many of the existing loaded storage canisters for transportation. Transportation certification for storage canisters having more reactive spent fuel payloads may require reliance on BUC approaches that are more aggressive than current NRC guidelines allow. Credit may be required for fission- product isotopes that do not have sufficient chemical assay data for benchmarking. In addition, reduced criticality safety margins may be required. For these more-aggressive BUC approaches, a risk assessment should be provided to support the NRC-approval basis. The risk assessment should evaluate the possibility and consequences of an accidental criticality event based upon inaccuracies in the characterization of the spent-fuel payloads

Low-temperature magnetic ordering in the perovskites Pr 1-xA xCoO 3 (A=Ca, Sr)

Science.gov (United States)

Deac, Iosif G.; Tetean, Romulus; Balasz, Istvan; Burzo, Emil

2010-05-01

The magnetic and electrical properties of polycrystalline Pr 1-xA xCoO 3 cobaltites with A=Ca, Sr and 0≤ x≤0.5 were studied in the temperature range 4 K≤ T≤1000 K and field up to 7 T. The X-ray analyses show the presence of only one phase having monoclinic or orthorhombic symmetry. The magnetic measurements indicate that the Ca-doped samples have at low temperatures, similar properties to the frustrated magnetic materials. PrCoO 3 is a paramagnetic insulator in the range from 4 to 1000 K. The Sr-doped cobaltites exhibit two phase transitions: a paramagnetic-ferromagnetic (or magnetic phase separated state) phase transition at about 240 K and a second one at about 100 K. The magnetic measurements suggest the presence of magnetic clusters and a change in the nature of magnetic coupling between Co ions at low temperatures. A semiconducting type behavior and high negative magnetoresistance was found for the Ca-doped samples, while the Sr-doped ones were metallic and with negligible magnetoresistance. The results are analyzed in the frame of a phase separation scenario in the presence of the spin-state transitions of Co ions.

The Effect of Teaching Critical Thinking on Al-Buraimi University College students’ Writing Skills: A Case Study

Directory of Open Access Journals (Sweden)

Yahia Ashour Mohammed AlKhoudary

2015-11-01

Full Text Available This study explores the role of writing in developing students’ critical thinking. It also sheds light on traditional writing assignments which fail to help students develop their comprehension of course content and evaluate their writing products critically. Moreover, this probe is to discover learners and teachers’ attitude towards the role of critical thinking in promoting the writing skills at AlBuraimi University College (BUC. The result of this study focuses on the effect of integrating critical thinking on learners’ performance. The procedure of this investigation is based on a combination of qualitative, quantitative (1 one hundred students who are taking writing course are selected randomly and divided into two groups; (2 pre- and posttests conducted to both groups; (3 twenty teachers were selected randomly (10 males and 10 females; questionnaires are administered to EFL teachers at BUC. The findings of this study illustrate that students who write critically are mostly motivated and their performance is affected positively. It also reveals that there are significant differences in posttest scores between treatment and controlled group. Moreover, teachers’ response to questionnaire supports the idea of integrating critical thinking in teaching the writing skills at BUC. Thus, is recommended that teachers should use thinking skills to enhance students’ writing performance and creativity.

Pathotype profile of Xanthomonas oryzae pv. oryzae isolates from North Sumatera

Science.gov (United States)

Noer, Z.; Hasanuddin; Lisnawita; Suryanto, D.

2018-02-01

The Bacterial blight disease caused by Xanthomonas oryzae pv. oryzae (Xoo) is one of the most important diseases and has caused crop failure in rice crops. This pathogen infects the leaves in all plant growth phases. The purpose of this study is to investigation 10 Xoo isolates pathotype obtained from North Sumatra based on their interactions with 10 near-isogenic rice lines (NIL) of IRRI. The results showed that there are 6 pathotypes of virulence in North Sumatra, they are; pathotype I with incompatible interaction to all Xa genes, pathotype II with compatible interaction to Xa1 and Xa3 genes, while it has incompatible interaction to other genes, pathotype III with compatible interaction to Xa1, Xa5, Xa7, Xa8, Xa10 and Xa11 genes, but it has incompatible interaction to other genes, pathotype IV with compatible interaction to all Xa genes, pathotype V with compatible interaction to Xa1 gene and incompatible interaction to other genes, and pathotype VI with compatible interaction to Xa3 gene and incompatible interaction to other genes. Based on the resistant genes in each individual Xa2, Xa4, and Xa21 genes are the combination of Xa genes which are most suitable for use in the development of rice cultivars in North Sumatra.

Biodegradation of organ chlorine pesticides in contaminated soil collected from Yen Tap, Cam Khe, Phu Tho

International Nuclear Information System (INIS)

Nguyen Thuy Binh; Nguyen Van Toan; Pham Thi Thai; Dinh Thi Thu Hang

2007-01-01

Biodegradation of POPs contaminant in soil collected from Phu Tho province and Nghe An province had carried out. The process comprises treating soil, which contains anaerobic and aerobic microbes capable of transforming lindane and DDT into harmless material and being under anaerobic and aerobic steps. Significant biodegradation of POPs contaminants occurred in there tests. But some of toxic organic compounds remained. (author)

Anticoagulant effects of inhaled unfractionated heparin in the dog as determined by partial thromboplastin time and factor Xa activity.

Science.gov (United States)

Manion, Jill S; Thomason, John M; Langston, Vernon C; Claude, Andrew K; Brooks, Marjory B; Mackin, Andrew J; Lunsford, Kari V

2016-01-01

To evaluate the anticoagulant effects of inhaled heparin in dogs. This study was conducted in 3 phases. In phase 1, bronchoalveolar lavage fluid (BALf) was collected to generate an in vitro calibration curve to relate heparin concentration to the activated partial thromboplastin time (aPTT). In phase 2, heparin was administered via nebulization to determine the threshold dose needed to prolong systemic aPTT. In phase 3, the local anticoagulant activity of inhaled heparin was determined by measurement of BALf anti-Xa activity and aPTT. University teaching hospital. Six healthy intact female Walker Hounds were used in this study. Two dogs were used for each phase. Inhaled unfractionated sodium heparin was administered in doses ranging from 50,000 to 200,000 IU. In vitro addition of heparin to BALf caused a prolongation in aPTT. Inhaled heparin at doses as high as 200,000 IU failed to prolong systemic aPTT, and a threshold dose could not be determined. No significant local anticoagulant effects were detected. Even at doses higher than those known to be effective in people, inhaled heparin appears to have no detectable local or systemic anticoagulant effects in dogs with the current delivery method. © Veterinary Emergency and Critical Care Society 2015.

The Role of RaxST, a Prokaryotic Sulfotransferase, and RaxABC, a Putative Type I Secretion System, in Activation of the Rice XA21-Mediated Immune Response

Directory of Open Access Journals (Sweden)

Pamela C. Ronald

2014-01-01

Full Text Available Tyrosine sulfation is an important posttranslational modification that determines the outcome of serious diseases in plants and animals. We have recently demonstrated that the plant pathogen Xanthomonas oryzae pv. oryzae (Xoo carries a functional sulfotransferase (RaxST. raxST is required for activation of rice Xa21-mediated immunity indicating the critical, but unknown, function of raxST in mediating the Xoo/rice interaction. The raxST gene resides in the same operon (raxSTAB as components of a predicted type I secretion and processing system (RaxA and RaxB. These observations suggest a model where RaxST sulfates a molecule that contains a leader peptide, which is cleaved by the peptidase domain of the RaxB protein and secreted outside the bacterial cell by the RaxABC T1SS.

Computational investigation of potential dosing schedules for a switch of medication from warfarin to rivaroxaban-an oral, direct Factor Xa inhibitor.

Science.gov (United States)

Burghaus, Rolf; Coboeken, Katrin; Gaub, Thomas; Niederalt, Christoph; Sensse, Anke; Siegmund, Hans-Ulrich; Weiss, Wolfgang; Mueck, Wolfgang; Tanigawa, Takahiko; Lippert, Jörg

2014-01-01

The long-lasting anticoagulant effect of vitamin K antagonists can be problematic in cases of adverse drug reactions or when patients are switched to another anticoagulant therapy. The objective of this study was to examine in silico the anticoagulant effect of rivaroxaban, an oral, direct Factor Xa inhibitor, combined with the residual effect of discontinued warfarin. Our simulations were based on the recommended anticoagulant dosing regimen for stroke prevention in patients with atrial fibrillation. The effects of the combination of discontinued warfarin plus rivaroxaban were simulated using an extended version of a previously validated blood coagulation computer model. A strong synergistic effect of the two distinct mechanisms of action was observed in the first 2-3 days after warfarin discontinuation; thereafter, the effect was close to additive. Nomograms for the introduction of rivaroxaban therapy after warfarin discontinuation were derived for Caucasian and Japanese patients using safety and efficacy criteria described previously, together with the coagulation model. The findings of our study provide a mechanistic pharmacologic rationale for dosing schedules during the therapy switch from warfarin to rivaroxaban and support the switching strategies as outlined in the Summary of Product Characteristics and Prescribing Information for rivaroxaban.

Computational investigation of potential dosing schedules for a switch of medication from warfarin to rivaroxaban—an oral, direct Factor Xa inhibitor

Science.gov (United States)

Burghaus, Rolf; Coboeken, Katrin; Gaub, Thomas; Niederalt, Christoph; Sensse, Anke; Siegmund, Hans-Ulrich; Weiss, Wolfgang; Mueck, Wolfgang; Tanigawa, Takahiko; Lippert, Jörg

2014-01-01

The long-lasting anticoagulant effect of vitamin K antagonists can be problematic in cases of adverse drug reactions or when patients are switched to another anticoagulant therapy. The objective of this study was to examine in silico the anticoagulant effect of rivaroxaban, an oral, direct Factor Xa inhibitor, combined with the residual effect of discontinued warfarin. Our simulations were based on the recommended anticoagulant dosing regimen for stroke prevention in patients with atrial fibrillation. The effects of the combination of discontinued warfarin plus rivaroxaban were simulated using an extended version of a previously validated blood coagulation computer model. A strong synergistic effect of the two distinct mechanisms of action was observed in the first 2–3 days after warfarin discontinuation; thereafter, the effect was close to additive. Nomograms for the introduction of rivaroxaban therapy after warfarin discontinuation were derived for Caucasian and Japanese patients using safety and efficacy criteria described previously, together with the coagulation model. The findings of our study provide a mechanistic pharmacologic rationale for dosing schedules during the therapy switch from warfarin to rivaroxaban and support the switching strategies as outlined in the Summary of Product Characteristics and Prescribing Information for rivaroxaban. PMID:25426077

Data of evolutionary structure change: 1BUCA-3MDEA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1BUCA-3MDEA 1BUC 3MDE A A -MDFNLTDIQQDFLKLAHDFGEKKLAPTVTERDHKGIYD...ENVLTGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRALDEATKYALERKTFGKLLAEHQGISFLLADMAMKVELARLSYQRAAWEIDSGRRNTYYASIAKAYAADIANQ...> A 3MDEA RSDPDPKAPAS...E A 3MDEA IEANT-LGQVP 2 3MDE A 3MDEA

The Impact of Operating Parameters and Correlated Parameters for Extended BWR Burnup Credit

Energy Technology Data Exchange (ETDEWEB)

Ade, Brian J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Marshall, William B. J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ilas, Germina [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Betzler, Benjamin R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Bowman, Stephen M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

2017-06-01

Applicants for certificates of compliance for spent nuclear fuel (SNF) transportation and dry storage systems perform analyses to demonstrate that these systems are adequately subcritical per the requirements of Title 10 of the Code of Federal Regulations (10 CFR) Parts 71 and 72. For pressurized water reactor (PWR) SNF, these analyses may credit the reduction in assembly reactivity caused by depletion of fissile nuclides and buildup of neutron-absorbing nuclides during power operation. This credit for reactivity reduction during depletion is commonly referred to as burnup credit (BUC). US Nuclear Regulatory Commission (NRC) staff review BUC analyses according to the guidance in the Division of Spent Fuel Storage and Transportation Interim Staff Guidance (ISG) 8, Revision 3, Burnup Credit in the Criticality Safety Analyses of PWR Spent Fuel in Transportation and Storage Casks.

Data of evolutionary structure change: 1BUCB-3MDEA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1BUCB-3MDEA 1BUC 3MDE B A -MDFNLTDIQQDFLKLAHDFGEKKLAPTVTERDHKGIYD...ENVLTGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRALDEATKYALERKTFGKLLAEHQGISFLLADMAMKVELARLSYQRAAWEIDSGRRNTYYASIAKAYAADIANQ...pdbID> A 3MDEA RSDPDP...in> 3MDE A 3MDEA IEANT-LGQVPA 3MDEA AEKKG-DEYII

Modeling the reduction of gross lithium erosion observed under high-flux deuterium bombardment

NARCIS (Netherlands)

Abrams, T.; Jaworski, M. A.; Kaita, R.; Nichols, J. H.; Stotler, D. P.; De Temmerman, G.; van den Berg, M. A.; van der Meiden, H. J.; Morgan, T. W.

2015-01-01

Abstract Both thin (<1&#xa0;μm) and thick (∼500&#xa0;μm) lithium films under high-flux deuterium and neon plasma bombardment were studied in the linear plasma device Magnum-PSI at ion fluxes >1024&#xa0;m−2&#xa0;s−1 and surface temperatures <700&#xa0;°C.

Deuterium-induced nanostructure formation on tungsten exposed to high-flux plasma

NARCIS (Netherlands)

Xu, H.Y.; De Temmerman, G.; Luo, G. N.; Jia, Y. Z.; Yuan, Y.; Fu, B. Q.; Godfrey, A.; Liu, W.

2015-01-01

Surface topography of polycrystalline tungsten (W) have been examined after exposure to a low-energy (38&#xa0;eV/D), high-flux (∼1.1–1.5&#xa0;×&#xa0;1024&#xa0;m−2&#xa0;s−1) deuterium plasma in the Pilot-PSI linear plasma device. The methods used were scanning electron microscopy

Anticoagulant activity in salivary glands of the insect vector Culicoides variipennis sonorensis by an inhibitor of factor Xa.

Science.gov (United States)

Pérez de León, A A; Valenzuela, J G; Tabachnick, W J

1998-02-01

Blood feeding by the insect vector Culicoides variipennis sonorensis involves laceration of superficial host tissues, an injury that would be expected to trigger the coagulation cascade. Accordingly, the salivary glands of C.v. sonorensis were examined for the presence of an antihemostatic that prevents blood coagulation. Assays using salivary gland extracts showed a delay in the recalcification time of plasma devoid of platelets, indicating the presence of anticoagulant activity. Retardation in the formation of a fibrin clot was also observed after the addition of tissue factor to plasma that was preincubated with salivary gland extracts. Similarly, an inhibitory effect by salivary gland extracts was detected in assays that included factors of the intrinsic pathway. Inhibition of the catalytic activity of purified factor Xa toward its chromogenic substrate suggested that it was the target of the salivary anticoagulant of C.v. sonorensis. This was corroborated by the coincidence of anticoagulant and anti-FXa activities obtained by reverse-phase HPLC. The depletion of anti-FXa activity from salivary glands during blood feeding suggests that the FXa inhibitor functions as anticoagulant. Molecular sieving HPLC yielded an apparent molecular mass of 28 kDa for the salivary FXa inhibitor of C.v. sonorensis. Preventing the formation of thrombin through the inhibition of FXa likely facilitates blood feeding by maintaining the pool of blood fluid at the feeding site. The salivary FXa inhibitor of C.v. sonorensis could impair the network of host-defense mechanisms in the skin microenvironment by avoiding blood coagulation at the site of feeding.

Nucleotide diversity analysis of three major bacterial blight resistance genes in rice.

Directory of Open Access Journals (Sweden)

Waikhom Bimolata

Full Text Available Nucleotide sequence polymorphisms among R gene alleles influence the process of co-evolutionary interaction between host and pathogen by shaping the response of host plants towards invading pathogens. Here, we present the DNA sequence polymorphisms and diversities present among natural alleles of three rice bacterial blight resistance genes, Xa21, Xa26 and xa5. The diversity was examined across different wild relatives and cultivars of Oryza species. Functional significance of selected alleles was evaluated through semi-quantitative reverse transcription polymerase chain reaction and real time PCR. The greatest nucleotide diversity and singleton variable sites (SVS were present in Xa26 (π = 0.01958; SVS = 182 followed by xa5 and Xa21 alleles. The highest frequency of single nucleotide polymorphisms were observed in Xa21 alleles and least in xa5. Transition bias was observed in all the genes and 'G' to 'A' transitions were more favored than other form of transitions. Neutrality tests failed to show the presence of selection at these loci, though negative Tajima's D values indicate the presence of a rare form of polymorphisms. At the interspecies level, O. nivara exhibited more diversity than O. sativa. We have also identified two nearly identical resistant alleles of xa5 and two sequentially identical alleles of Xa21. The alleles of xa5 showed basal levels of expression while Xa21 alleles were functionally not expressed.

Reduction of Tat-interacting Protein 30 Expression Could be a Prognostic Marker in Bladder Urothelial Cancer

Directory of Open Access Journals (Sweden)

Ye-Ping Li

2018-01-01

Conclusions: TIP30 expression was associated with clinical tumor stage in BUC, suggesting that it might play an important role in disease progression. Furthermore, TIP30 might predict postoperative OS. Thus, its evaluation might be useful for predicting prognosis.

Free vibration of elastically supported thin cylinders including gyroscopic effects

CSIR Research Space (South Africa)

Loveday, PW

1998-10-29

Full Text Available [ The equations D[R[ 747723 JSV 106:2 "Issue# MS 1560 VIBRATION OF THIN CYLINDERS 442 required for this procedure\\ including the gyroscopic terms\\ are included in Appendix A[ The displacement functions can then be written as follows] W"x# C0 cosh a0xa C1 sinh a0... xa C2 cos g1xa C3 sin g1xa epx:a0C4 cos qxa C5 sin qxa 1 e px:a0C6 cos qxa C7 sin qxa 1 "6a# V"x# A0C0 cosh a0xa A0C1 sinh a0xa A2C2 cos g1xa A2C3 sin g1xa epx:a$"A4C4 A5C5# cos qxa "A4C5 A5C4# sin qxa % e px:a$"A4C6 A5C7# cos...

Backup control airstart performance on a digital electronic engine control-equipped F100-engine

Science.gov (United States)

Johnson, J. B.

1984-01-01

The air start capability of a backup control (BUC) was tested for a digital electronic engine control (DEEC) equipped F100 engine, which was installed in an F-15 aircraft. Two air start schedules were tested. Using the group 1 start schedule, based on a 40 sec timer, an air speed of 300 knots was required to ensure successful 40 and 25% BUC mode spooldown airstarts. If core rotor speed (N2) was less than 40% a stall would occur when the start bleed closed, 40 sec after initiation of the air start. All jet fuel starter (JFS) assisted air starts were successful with the group 1 start schedule. For the group 2 schedule, the time between pressurization and start bleed closure ranged between 50 sec and 72 sec. Idle rps was lower than the desired 65% for air starts at higher altitudes and lower air speeds.

Activated factor X signaling via protease-activated receptor 2 suppresses pro-inflammatory cytokine production from LPS-stimulated myeloid cells.

LENUS (Irish Health Repository)

Gleeson, Eimear M

2013-07-19

Vitamin K-dependent proteases generated in response to vascular injury and infection enable fibrin clot formation, but also trigger distinct immuno-regulatory signaling pathways on myeloid cells. Factor Xa, a protease crucial for blood coagulation, also induces protease-activated receptor-dependent cell signaling. Factor Xa can bind both monocytes and macrophages, but whether factor Xa-dependent signaling stimulates or suppresses myeloid cell cytokine production in response to Toll-like receptor activation is not known. In this study, exposure to factor Xa significantly impaired pro-inflammatory cytokine production from lipopolysaccharide-treated peripheral blood mononuclear cells, THP-1 monocytic cells and murine macrophages. Furthermore, factor Xa inhibited nuclear factor-kappa B activation in THP-1 reporter cells, requiring phosphatidylinositide 3-kinase activity for its anti-inflammatory effect. Active-site blockade, γ-carboxyglutamic acid domain truncation and a peptide mimic of the factor Xa inter-epidermal growth factor-like region prevented factor Xa inhibition of lipopolysaccharide-induced tumour necrosis factor-α release. In addition, factor Xa anti-inflammatory activity was markedly attenuated by the presence of an antagonist of protease-activated receptor 2, but not protease-activated receptor 1. The key role of protease-activated receptor 2 in eliciting factor Xa-dependent anti-inflammatory signaling on macrophages was further underscored by the inability of factor Xa to mediate inhibition of tumour necrosis factor-α and interleukin-6 release from murine bone marrow-derived protease-activated receptor 2-deficient macrophages. We also show for the first time that, in addition to protease-activated receptor 2, factor Xa requires a receptor-associated protein-sensitive low-density lipoprotein receptor to inhibit lipopolysaccharide-induced cytokine production. Collectively, this study supports a novel function for factor Xa as an endogenous, receptor

Xanthium italicum, Xanthium strumarium and Arctium lappa as new hosts for Diaporthe helianthi.

Science.gov (United States)

Vrandecic, Karolina; Jurkovic, Drazenka; Riccioni, Luca; Cosic, Jasenka; Duvnjak, Tomislav

2010-07-01

Sunflower (Helianthus annuus) stem canker caused by Diaporthe helianthi is one of the most important sunflower diseases in Croatia. Until recently, sunflower was the only known host for D. helianthi. In our research carried out in the area of Eastern Croatia, isolates of Diaporthe/Phomospis were collected from Xanthium italicum, X. strumarium and Arctium lappa. Using morphological, cultural and molecular ITS rDNA data, isolates from these weeds were identified as D. helianthi. The following isolates were used in the pathogenicity test: one isolate originated from sunflower (Su5/04), three from X. italicum (Xa2, Xa3 and Xa5), two from X. strumarium (Xa9 and Xa12), one from Xanthium sp. (Xa13) and one from A. lappa (Ar3). According to the results, it was determined that isolate Xa5 (originated from X. italicum) was the most pathogenic to sunflower stems. The average length of the lesion was 11.3 cm. The lowest level of pathogenicity was found in Xa9 (isolated from X. strumarium). The length of the lesion was 0.1 cm.

The effects of blood feeding and exogenous supply of tryptophan on the quantities of xanthurenic acid in the salivary glands of Anopheles stephensi (Diptera: Culicidae).

Science.gov (United States)

Okech, Bernard; Arai, Meiji; Matsuoka, Hiroyuki

2006-03-24

Xanthurenic acid (XA), produced as a byproduct during the biosynthesis of insect eye pigment (ommochromes), is a strong inducer of Plasmodium gametogenesis at very low concentrations. In previous studies, it was shown that XA is present in Anopheles stephensi (Diptera: Culicidae) mosquito salivary glands and that during blood feeding the mosquitoes ingested their own saliva into the midgut. Considering these two facts together, it is therefore likely that XA is discharged with saliva during blood feeding and is swallowed into the midgut where it exerts its effect on Plasmodium gametocytes. However, the quantities of XA in the salivary glands and midgut are unknown. In this study, we used high performance liquid chromatography with electrochemical detection to detect and quantify XA in the salivary glands and midgut. Based on the results of this study, we found 0.28+/-0.05 ng of XA in the salivary glands of the mosquitoes, accounting for 10% of the total XA content in the mosquito whole body. The amounts of XA in the salivary glands reduced to 0.13+/-0.06 ng after mosquitoes ingested a blood meal. Approximately 0.05+/-0.01 ng of XA was detected in the midgut of nonblood fed An. stephensi mosquitoes. By adding synthetic tryptophan as a source of XA into larval rearing water (2 mM) or in sugar meals (10 mM), we evaluated whether XA levels in the mosquito (salivary glands, midgut, and whole body) were boosted and the subsequent effect on infectivity of Plasmodium berghei in the treated mosquito groups. A female specific increase in XA content was observed in the whole body and in the midgut of mosquito groups where tryptophan was added either in the larval water or sugar meals. However, XA in the salivary glands was not affected by tryptophan addition to larval water, and surprisingly it reduced when tryptophan was added to sugar meals. The P. berghei oocyst loads in the mosquito midguts were lower in mosquitoes fed tryptophan treated sugar meals than in mosquitoes

Functional Marker Assisted Improvement of Stable Cytoplasmic Male Sterile Lines of Rice for Bacterial Blight Resistance

Directory of Open Access Journals (Sweden)

Jegadeesan Ramalingam

2017-06-01

Full Text Available Bacterial blight (BB, caused by Xanthomonas oryzae pv.oryzae is one among the major diseases in rice, which in severe condition cause losses up to 60% in total yield. Marker assisted pyramiding of three broad spectrum BB resistance genes (xa5, xa13, and Xa21 in prominent rice varieties is the most economical and effective strategy for the management of the BB disease. We report here the pyramiding of three genes (xa5, xa13, and Xa21 in maintainer lines (CO 2B, CO 23B, and CO 24B of three promising wild abortive cytoplasmic male sterile lines (CO 2A, CO 23A, and CO 24A through functional markers assisted back cross breeding. IRBB60 with xa5, xa13, and Xa21 genes is used as a donor parent. BC2F1 and BC2F2 generations from a cross of CO 2B, CO 23B, and CO 24B with IRBB60 were evaluated for bacterial blight and non-fertility restoration. In BC2F1, plants with all three resistance genes (xa5, xa13, and Xa21 and high parent genome recovery was identified. In BC2F2, plants with all resistance genes and without fertility restorer (Rf3 and Rf4 were selected. Based on agronomic traits, BB resistance and maintenance of sterility, two plants each in CO 2B × IRBB60, CO 24B × IRBB60 and one plant in CO 23B × IRBB60 combinations were identified. The identified lines were crossed with respective male sterile lines for conversion of improved B line into CMS line through back-crossing, in addition to selfing. The plants with high recurrent genome and phenotypically similar to parental lines and sterile are being used for the hybrid rice development program. Currently, using these lines (improved CMS line, test crosses were made to develop new rice hybrids. Hybrids combinations viz., CO 23A × AD08009R and CO 24A × IET20898R were found to be stable at different locations with high yield. The R line used in this study has been introgressed with xa5, xa13, and Xa21 genes in a separate breeding program. These new hybrids with resistance against bacterial blight

76 FR 32989 - Request for Certification of Compliance-Rural Industrialization Loan and Grant Program

Science.gov (United States)

2011-06-07

... real estate and construction of a new location of Buc-ee's (gas station and convenience store), which...: 447110 (gasoline stations with convenience stores). DATES: All interested parties may submit comments in... Department of Agriculture to make or guarantee loans or grants to finance industrial and business activities...

Burn-up credit applications for UO2 and MOX fuel assemblies in AREVA/COGEMA

International Nuclear Information System (INIS)

Toubon, H.; Riffard, C.; Batifol, M.; Pelletier, S.

2003-01-01

For the last seven years, AREVA/COGEMA has been implementing the second phase of its burn-up credit program (the incorporation of fission products). Since the early nineties, major actinides have been taken into account in criticality analyses first for reprocessing applications, then for transport and storage of fuel assemblies Next year (2004) COGEMA will take into account the six main fission products (Rh103, Cs133, Nd143, Sm149, Sm152 and Gd155) that make up 50% of the anti-reactivity of all fission products. The experimental program will soon be finished. The new burn-up credit methodology is in progress. After a brief overview of BUC R and D program and COGEMA's application of the BUC, this paper will focus on the new burn-up measurement for UO2 and MOX fuel assemblies. It details the measurement instrumentation and the measurement experiments on MOX fuels performed at La Hague in January 2003. (author)

Prolonged Cerebral Circulation Time Is the Best Parameter for Predicting Vasospasm during Initial CT Perfusion in Subarachnoid Hemorrhagic Patients.

Directory of Open Access Journals (Sweden)

Chun Fu Lin

Full Text Available We sought to imitate angiographic cerebral circulation time (CCT and create a similar index from baseline CT perfusion (CTP to better predict vasospasm in patients with subarachnoid hemorrhage (SAH.Forty-one SAH patients with available DSA and CTP were retrospectively included. The vasospasm group was comprised of patients with deterioration in conscious functioning and newly developed luminal narrowing; remaining cases were classified as the control group. The angiography CCT (XA-CCT was defined as the difference in TTP (time to peak between the selected arterial ROIs and the superior sagittal sinus (SSS. Four arterial ROIs were selected to generate four corresponding XA-CCTs: the right and left anterior cerebral arteries (XA-CCTRA2 and XA-CCTLA2 and right- and left-middle cerebral arteries (XA-CCTRM2 and XA-CCTLM2. The CCTs from CTP (CT-CCT were defined as the differences in TTP from the corresponding arterial ROIs and the SSS. Correlations of the different CCTs were calculated and diagnostic accuracy in predicting vasospasm was evaluated.Intra-class correlations ranged from 0.96 to 0.98. The correlations of XA-CCTRA2, XA-CCTRM2, XA-CCTLA2, and XA-CCTLM2 with the corresponding CT-CCTs were 0.64, 0.65, 0.53, and 0.68, respectively. All CCTs were significantly prolonged in the vasospasm group (5.8-6.4 s except for XA-CCTLA2. CT-CCTA2 of 5.62 was the optimal cut-off value for detecting vasospasm with a sensitivity of 84.2% and specificity 82.4.CT-CCTs can be used to interpret cerebral flow without deconvolution algorithms, and outperform both MTT and TTP in predicting vasospasm risk. This finding may help facilitate management of patients with SAH.

Cost-effectiveness of counselling, graded-exercise and usual care for chronic fatigue: evidence from a randomised trial in primary care

Directory of Open Access Journals (Sweden)

Sabes-Figuera Ramon

2012-08-01

Full Text Available Abstract Background Fatigue is common and has been shown to result in high economic costs to society. The aim of this study is to compare the cost-effectiveness of two active therapies, graded-exercise (GET and counselling (COUN with usual care plus a self-help booklet (BUC for people presenting with chronic fatigue. Methods A randomised controlled trial was conducted with participants consulting for fatigue of over three months’ duration recruited from 31 general practices in South East England and allocated to one of three arms. Outcomes and use of services were assessed at 6-month follow-up. The main outcome measure used in the economic evaluation was clinically significant improvements in fatigue, measured using the Chalder fatigue scale. Cost-effectiveness was assessed using the net-benefit approach and cost-effectiveness acceptability curves. Results Full economic and outcome data at six months were available for 163 participants; GET = 51, COUN = 58 and BUC = 54. Those receiving the active therapies (GET and COUN had more contacts with care professionals and therefore higher costs, these differences being statistically significant. COUN was more expensive and less effective than the other two therapies. The incremental cost-effectiveness ratio of GET compared to BUC was equal to £987 per unit of clinically significant improvement. However, there was much uncertainty around this result. Conclusion This study does not provide a clear recommendation about which therapeutic option to adopt, based on efficiency, for patients with chronic fatigue. It suggests that COUN is not cost-effective, but it is unclear whether GET represents value for money compared to BUC. Clinical Trial Registration number at ISRCTN register: 72136156

Bone scintigraphy on chronic hemodialyzed patients

International Nuclear Information System (INIS)

Koizumi, Yoshiko

1990-01-01

Patients with renal osteodystrophy (ROD) are classified into four types (secondary hyperparathyroidism: HPT, osteomalasia, ectopic calcification and normal bone scintigram type) according to findings of whole body bone scintigrams. Markedly high accumulations of Tc-99m-MDP are seen in the skull, especially in patients with HPT. For a quantitative evaluation of bone mineral dynamics, factor analysis (FA) was performed on bone scintigraphy in 36 patients with ROD and in 17 controls. Four were examined before and after parathyroidectomy (PTX). In the early phase (20 min) of bone scintigraphy, the bone factor was clearly extracted by FA. Two original parameters were calculated, one is bone radionuclide (RN) uptake count (BUC), the product of the total RN uptake count of the head and the contribution ratio, the other is bone RN uptake count ratio (BUR) derived by the time activity curve (physiological component of bone) of FA. Bone factor shown by FA is significantly different among patients with HPT, osteomalasia and controls. The value of BUC in patients with HPT is high compared to findings in the controls. The results of FA of ROD correlate well with planar images of bone scintigrams and with data on bone minerals, measured by quantitative methods such as single photon absorptiometry, CT attenuation number of the frontal bone, RN activity ratio ([frontal bone]/[brain]), using SPECT of bone scan. In the cases of PTX, the value of BUC was improved compared to preoperative data. FA of bone scintigraphy is a sensitive and useful method for quantitative evaluation of bone mineral dynamics and to assess the therapeutic effects in ROD. (author)

Xanthomonas oryzae pv. oryzae TALE proteins recruit OsTFIIAγ1 to compensate for the absence of OsTFIIAγ5 in bacterial blight in rice.

Science.gov (United States)

Ma, Wenxiu; Zou, Lifang; Ji, Zhiyuan; Xu, Xiameng; Xu, Zhengyin; Yang, Yangyang; Alfano, James R; Chen, Gongyou

2018-04-28

Xanthomonas oryzae pv. oryzae (Xoo), causal agent of bacterial blight (BB) of rice, uses transcription activator-like effectors (TALEs) to interact with the basal transcription factor gama subunit OsTFIIAγ5 (Xa5) and activates transcription of host genes. However, how OsTFIIAγ1, the other OsTFIIAγ protein, functions in the presence of TALEs remains unclear. In this study, we show that OsTFIIAγ1 plays a compensatory role in the absence of Xa5. The expression of OsTFIIAγ1, which is activated by TALE PthXo7, increased the expression of host genes targeted by avirulent and virulent TALEs. Defective OsTFIIAγ1 rice lines showed reduced expression of the TALE-targeted susceptibility (S) genes, OsSWEET11 and OsSWEET14, which resulted in increased BB resistance. Selected TALEs (PthXo1, AvrXa7, and AvrXa27) were evaluated for interactions with OsTFIIAγ1, Xa5 and xa5 (naturally-occurring mutant form of Xa5) using biomolecular fluorescence complementation (BiFC) and microscale thermophoresis (MST). BiFC and MST demonstrated that the three TALEs bind Xa5 and OsTFIIAγ1 with a stronger affinity than xa5. These results provide insight into the complex roles of OsTFIIAγ1 and OsTFIIAγ5 in TALE-mediated host gene transcription. This article is protected by copyright. All rights reserved. © 2018 BSPP and John Wiley & Sons Ltd.

Malaria infectivity of xanthurenic acid-deficient anopheline mosquitoes produced by TALEN-mediated targeted mutagenesis.

Science.gov (United States)

Yamamoto, Daisuke S; Sumitani, Megumi; Hatakeyama, Masatsugu; Matsuoka, Hiroyuki

2018-02-01

Anopheline mosquitoes are major vectors of malaria parasites. When the gametocytes of the malaria parasite are transferred from a vertebrate to mosquitoes, they differentiate into gametes, and are fertilized in the midguts of mosquitoes. Xanthurenic acid (XA), a waste product of the ommochrome synthesis pathway, has been shown to induce exflagellation during microgametogenesis in vitro; however, it currently remains unclear whether endogenous XA affects the infectivity of anopheline mosquitoes to malaria parasites in vivo due to the lack of appropriate experimental systems such as a XA-deficient line. In the present study, we produced a XA-deficient line in Anopheles stephensi using transcription activator-like effector nuclease (TALEN)-mediated gene targeting (knockout) of the kynurenine 3-monooxygenase (kmo) gene, which encodes an enzyme that participates in the ommochrome synthesis pathway. The knockout of kmo resulted in the absence of XA, and oocyst formation was inhibited in the midguts of these XA-deficient mosquitoes, which, in turn, reduced sporozoite numbers in their salivary glands. These results suggest that endogenous XA stimulates exflagellation, and enhances the infectivity of anopheline mosquitoes to malaria parasites in vivo. The XA-deficient line of the anopheline mosquito provides a useful system for analyzing and understanding the associated factors of malaria gametogenesis in the mosquito midgut.

Vasorelaxing Action of the Kynurenine Metabolite, Xanthurenic Acid: The Missing Link in Endotoxin-Induced Hypotension?

Directory of Open Access Journals (Sweden)

Carmine Vecchione

2017-05-01

Full Text Available The kynurenine pathway of tryptophan metabolism is activated by pro-inflammatory cytokines. L-kynurenine, an upstream metabolite of the pathway, acts as a putative endothelium-derived relaxing factor, and has been hypothesized to play a causative role in the pathophysiology of inflammation-induced hypotension. Here, we show that xanthurenic acid (XA, the transamination product of 3-hydroxykynurenine, is more efficacious than L-kynurenine in causing relaxation of a resistance artery, but fails to relax pre-contracted aortic rings. In the mesenteric artery, XA enhanced activating phosphorylation of endothelial nitric oxide synthase (NOS, and the relaxing action of XA was abrogated by pharmacological inhibition of NOS and endothelial-derived hyperpolarizing factor. Systemic injection of XA reduced blood pressure in mice, and serum levels of XA increased by several fold in response to a pulse with the endotoxin, lipopolysaccharide (LPS. LPS-induced hypotension in mice was prevented by pre-treatment with the kynurenine monooxygenase (KMO inhibitor, Ro-618048, which lowered serum levels of XA but enhanced serum levels of L-kynurenine. UPF 648, another KMO inhibitor, could also abrogate LPS-induced hypotension. Our data identify XA as a novel vasoactive compound and suggest that formation of XA is a key event in the pathophysiology of inflammation-induced hypotension.

Metabolite profiles of rice cultivars containing bacterial blight-resistant genes are distinctive from susceptible rice

Institute of Scientific and Technical Information of China (English)

Jiao Wu; Haichuan Yu; Haofu Dai; Wenli Mei; Xin Huang; Shuifang Zhu; Ming Peng

2012-01-01

The metabolic changes of bacterial blight-resistant line C418/Xa23 generated by molecular marker-assisted selection (n =12),transgenic variety C418-Xa21 generated by using the Agrobacterium-mediated system (n =12),and progenitor cultivar C418 (n =12) were monitored using gas chromatography/mass spectrometry.The validation,discrimination,and establishment of correlative relationships between metabolite signals were performed by cluster analysis,principal component analysis,and partial least squares-discriminant analysis.Significant and unintended changes were observed in 154 components in C418/Xa23 and 48 components in C418-Xa21 compared with C418 (P ＜ 0.05,Fold change ＞ 2.0).The most significant decreases detected (P＜ 0.001) in both C418/Xa23 and C418-Xa21 were in three amino acids: glycine,tyrosine,and alanine,and four identified metabolites: malic acid,ferulic acid,succinic acid,and glycerol.Linoleic acid was increased specifically in C418/Xa23 which was derived from traditional breeding.This line,possessing a distinctive metabolite profile as a positive control,shows more differences vs.the parental than the transgenic line.Only succinic acid that falls outside the boundaries of natural variability between the two non-transgenic varieties C418 and C418/Xa23 should be further investigated with respect to safety or nutritional impact.

(Biodegradable Ionomeric Polyurethanes Based on Xanthan: Synthesis, Properties, and Structure

Directory of Open Access Journals (Sweden)

T. V. Travinskaya

2017-01-01

Full Text Available New (biodegradable environmentally friendly film-forming ionomeric polyurethanes (IPU based on renewable biotechnological polysaccharide xanthan (Xa have been obtained. The influence of the component composition on the colloidal-chemical and physic-mechanical properties of IPU/Xa and based films, as well as the change of their properties under the influence of environmental factors, have been studied. The results of IR-, PMS-, DMA-, and X-ray scattering study indicate that incorporation of Xa into the polyurethane chain initiates the formation of a new polymer structure different from the structure of the pure IPU (matrix: an amorphous polymer-polymer microdomain has occurred as a result of the chemical interaction of Xa and IPU. It predetermines the degradation of the IPU/Xa films as a whole, unlike the mixed polymer systems, and plays a key role in the improvement of material performance. The results of acid, alkaline hydrolysis, and incubation into the soil indicate the increase of the intensity of degradation processes occurring in the IPU/Xa in comparison with the pure IPU. It has been shown that the introduction of Xa not only imparts the biodegradability property to polyurethane, but also improves the mechanical properties.

Avaliação comparativa das propriedades de xantanas produzidas pelo patovar pruni e clairana com xantana comercial para predição de uso Comparative evaluation of xanthans properties produced by pathovar pruni and clairana with commercial xanthan to predict their uses

Directory of Open Access Journals (Sweden)

Patrícia D. Oliveira

2013-01-01

Full Text Available O presente trabalho teve como objetivo determinar a adequabilidade de três amostras de biopolímero xantana (Xa 06, Xa 82 e Xa 106 e uma clairana como viscosificantes de fluidos de perfuração de poços de petróleo, comparando com uma amostra de xantana comercial, Xanvis®. Foram realizadas análises reológicas, determinados os conteúdos de acetil, piruvato e íons Na+ K+ e Ca2+, e avaliada a capacidade viscosificante segundo norma específica da Petrobras. Os conteúdos de grupos acetil e piruvato para as xantanas e clairana diferiram significativamente entre si, mas foram compatíveis com valores preconizados ou citados na literatura concernente. Com relação ao conteúdo de íons, a xantana comercial apresentou quantidade de cálcio superior, as amostras Xa 06, Xa 82 e Xa 106 tiveram maior teor de potássio e a clairana maior teor de sódio. A viscosidade e a viscoelasticidade da amostra de xantana comercial foram superiores às demais amostras analisadas. Na análise como viscosificante para fluidos de perfuração as amostras de xantana comercial e Xa 106 atingiram os requisitos estabelecidos para os parâmetros n, K e força gel da norma Petrobras N-2605. Com a interpretação conjunta dos resultados obtidos pode-se inferir que apenas as xantanas Xanvis® e Xa 106 apresentam características adequadas à utilização como viscosificante em fluido de perfuração de petróleo. As demais amostras possuem características reológicas adequadas à utilização como espessantes ou estabilizantes em outros segmentos industriais, como em alimentos, tintas e cosméticos.The aim of this study was to determine the suitability of three xanthans (Xa 06, Xa 82 and Xa 106 and a clairana biopolymer for use as drilling fluid thickeners and comparing them against a commercial sample, Xanvis®. Rheological analyses were performed to determine the acetyl, pyruvate and Na+ K+ and Ca2+ ion content and their thickening ability, according to Petrobras

Comparative evaluation of direct thrombin and factor Xa inhibitors with antiplatelet agents under flow and static conditions: an in vitro flow chamber model.

Directory of Open Access Journals (Sweden)

Kazuya Hosokawa

Full Text Available Dabigatran and rivaroxaban are novel oral anticoagulants that specifically inhibit thrombin and factor Xa, respectively. The aim of this study is to elucidate antithrombotic properties of these anticoagulant agents under arterial and venous shear conditions. Whole blood samples treated with dabigatran or rivaroxaban at 250, 500, and 1000 nM, with/without aspirin and AR-C66096, a P2Y12 antagonist, were perfused over a microchip coated with collagen and tissue thromboplastin at shear rates of 240 and 600 s(-1. Fibrin-rich platelet thrombus formation was quantified by monitoring flow pressure changes. Dabigatran at higher concentrations (500 and 1000 nM potently inhibited thrombus formation at both shear rates, whereas 1000 nM of rivaroxaban delayed, but did not completely inhibit, thrombus formation. Dual antiplatelet agents weakly suppressed thrombus formation at both shear rates, but intensified the anticoagulant effects of dabigatran and rivaroxaban. The anticoagulant effects of dabigatran and rivaroxaban were also evaluated under static conditions using thrombin generation (TG assay. In platelet-poor plasma, dabigatran at 250 and 500 nM efficiently prolonged the lag time (LT and moderately reduce peak height (PH of TG, whereas rivaroxaban at 250 nM efficiently prolonged LT and reduced PH of TG. In platelet-rich plasma, however, both anticoagulants efficiently delayed LT and reduced PH of TG. Our results suggest that dabigatran and rivaroxaban may exert distinct antithrombotic effects under flow conditions, particularly in combination with dual antiplatelet therapy.

Assessment of genetic diversity and population structure of Vietnamese indigenous cattle populations by microsatellites

DEFF Research Database (Denmark)

Pham, Lan Doan; Do, Duy Ngoc; Binh, Nguyen Trong

2013-01-01

Cattle play a very important role in agriculture and food security in Vietnam. A high level of cattle diversity exists and serves different needs of Vietnamese cattle keepers but has not yet been molecularly characterized. This study evaluates the genetic diversity and structure of Vietnamese...... geographic distances. Structure analysis indicated five homogeneous clusters. The Brahman, Lang Son, Ha Giang and U Dau Riu cattle were assigned to independent clusters while Nghe An, Thanh Hoa and Phu Yen cattle were grouped in a single cluster. We conclude that Vietnamese indigenous cattle have high levels...

Abnormal X : autosome ratio, but normal X chromosome inactivation in human triploid cultures

Directory of Open Access Journals (Sweden)

Norwood Thomas H

2006-07-01

Full Text Available Abstract Background X chromosome inactivation (XCI is that aspect of mammalian dosage compensation that brings about equivalence of X-linked gene expression between females and males by inactivating one of the two X chromosomes (Xi in normal female cells, leaving them with a single active X (Xa as in male cells. In cells with more than two X's, but a diploid autosomal complement, all X's but one, Xa, are inactivated. This phenomenon is commonly thought to suggest 1 that normal development requires a ratio of one Xa per diploid autosomal set, and 2 that an early event in XCI is the marking of one X to be active, with remaining X's becoming inactivated by default. Results Triploids provide a test of these ideas because the ratio of one Xa per diploid autosomal set cannot be achieved, yet this abnormal ratio should not necessarily affect the one-Xa choice mechanism for XCI. Previous studies of XCI patterns in murine triploids support the single-Xa model, but human triploids mostly have two-Xa cells, whether they are XXX or XXY. The XCI patterns we observe in fibroblast cultures from different XXX human triploids suggest that the two-Xa pattern of XCI is selected for, and may have resulted from rare segregation errors or Xi reactivation. Conclusion The initial X inactivation pattern in human triploids, therefore, is likely to resemble the pattern that predominates in murine triploids, i.e., a single Xa, with the remaining X's inactive. Furthermore, our studies of XIST RNA accumulation and promoter methylation suggest that the basic features of XCI are normal in triploids despite the abnormal X:autosome ratio.

Pathways to Adolescent Substance Use among Sexually Abused Girls.

Science.gov (United States)

Bailey, Jennifer A.; McCloskey, Laura Ann

2005-01-01

This study examined the link between childhood sexual abuse and adolescent substance use among girls, and evaluated depressive self-concept and behavioral under-control (BUC) as pathways to substance use for sexually abused girls. Participants (n = 150) were drawn from a longitudinal study of the impact of domestic violence on the lives of women…

Influence of tungsten microstructure and ion flux on deuterium plasma-induced surface modifications and deuterium retention

NARCIS (Netherlands)

Buzi, L.; De Temmerman, G.; Unterberg, B.; M. Reinhart,; Dittmar, T.; Matveev, D.; Linsmeier, C.; Breuer, U.; Kreter, A.; Van Oost, G.

2015-01-01

The influence of surface temperature, particle flux density and material microstructure on the surface morphology and deuterium retention was studied by exposing tungsten targets (20&#xa0;μm and 40&#xa0;μm grain size) to deuterium plasma at the same particle fluence (1026&#xa0;m−2) and

Sp. Radicis-Lycopersici Using Mixture of Vegetable and Posidonia oceanica Compost

Directory of Open Access Journals (Sweden)

S. Kouki

2012-01-01

Full Text Available A compost of vegetable waste and Posidonia oceanica mixture (70 : 30% vol : vol was tested in vitro and in vivo for its efficacy against Fusarium oxysporum f.sp radicis-lycopersici (Forl, the causal agent of Fusarium wilt of Tomato (Lycopersicon esculentum cv. chourouk.The incorporation of non-sterilized VPC in the culture medium showed potent antifungal activity against Forl and complete inhibition of mycelium growth was observed for all the tested compost rates (0.5, 1, 2, 4, 6, 8, 10, 15 and 20%. However, only the highest rates (15 and 20% of a sterilized suspension of VPC were effective in preventing mycelial growth. Nine indigenous bacterial strains isolated from VPC exhibited antagonism against Forl. Based on 16S rDNA sequence analysis, the isolates were assigned to Bacillus sphaericus (B12 and BS2, Pseudomonas putida PPS7 and Burkholderia gladioli BuC16. Under green house condition, seed inoculation by B12, BS2, PP7 and BuC16 strains protected significantly tomato against Fusarium oxysporum f.sp radicis-lycopersici (Forl attacks.

Hepatoprotective Effects of Chinese Medicine Herbs Decoction on Liver Cirrhosis in Rats

Directory of Open Access Journals (Sweden)

Nor Aziyah Mat-Rahim

2017-01-01

Full Text Available Hepatoprotective and curative activities of aqueous extract of decoction containing 10 Chinese medicinal herbs (HPE-XA-08 were evaluated in Sprague–Dawley albino rats with liver damage induced by thioacetamide (TAA. These activities were assessed by investigating the liver enzymes level and also histopathology investigation. Increases in alkaline phosphatase (ALP and gamma-glutamyl transferase (GGT levels were observed in rats with cirrhotic liver. No significant alterations of the liver enzymes were observed following treatment with HPE-XA-08. Histopathology examination of rats treated with HPE-XA-08 at 250 mg/kg body weight, however, exhibited moderate liver protective effects. Reduced extracellular matrix (ECM proteins within the hepatocytes were noted in comparison to the cirrhotic liver. The curative effects of HPE-XA-08 were observed with marked decrease in the level of ALP (more than 3x and level of GGT (more than 2x in cirrhotic rat treated with 600 mg/kg body weight HPE-XA-08 in comparison to cirrhotic rat treated with just water diluent. Reversion of cirrhotic liver to normal liver condition in rats treated with HPE-XA-08 was observed. Results from the present study suggest that HPE-XA-08 treatment assisted in the protection from liver cirrhosis and improved the recovery of cirrhotic liver.

Cross System Extensions (CSE) experience

International Nuclear Information System (INIS)

Johnston, T.Y.

1990-08-01

Cross System Extension (CSE) provides VM/XA systems with the ability to share minidisks and spool in loosely coupled environment. CSE will also cooperate with the VM/HPO Inter System Facility (ISF) in sharing minidisks between VM/XA and VM/HPO to XA, reliability of CSE, and some operational considerations when running with it

Evidence for a saturable mechanism of disappearance of standard heparin in rabbits

International Nuclear Information System (INIS)

Boneu, B.; Caranobe, C.; Gabaig, A.M.; Dupouy, D.; Sie, P.; Buchanan, M.R.; Hirsh, J.

1987-01-01

This work demonstrates that after bolus intravenous injection standard heparin (SH) disappearance results from the combination of a saturable and a non saturable mechanism. Pharmacokinetics and pharmacodynamics of SH were studied by measuring the disappearance of increasing doses (5 - 500 anti-factor Xa U/kg) of 125 I-heparin and of its biological effects. CPM curves allowed the determination of the half lives of heparin according to the dose injected. The half lives were clearly dose dependent and reached a plateau over 100 anti-factor Xa U/kg. The complex curve which describes the amount of heparin cleared per time unit after any given dose has been resolved into its two components reflecting a saturable and a non saturable mechanism of disappearance. For the doses less than 100 anti-factor Xa U/kg the saturable mechanism was preeminent and the anti-factor Xa activity disappearance followed an exponential pattern; for the doses less than 100 anti-factor Xa U/kg the contribution of the non saturable mechanism becomes more important and the anti-factor Xa activity disappearance followed a concave-convex pattern. Further experiments showed that the heparin half life shortened as the circulating anti-factor Xa activity decreased; this phenomenon may explain the concave-convex pattern of the curve of the anticoagulant effect observed after injection of large doses of SH

Alternative dosing of prophylactic enoxaparin in the trauma patient: is more the answer?

Science.gov (United States)

Kopelman, Tammy R; O'Neill, Patrick J; Pieri, Paola G; Salomone, Jeffrey P; Hall, Scott T; Quan, Asia; Wells, Jordan R; Pressman, Melissa S

2013-12-01

Inadequate anti-factor Xa levels and increased venous thromboembolic events occur in trauma patients receiving standard prophylactic enoxaparin dosing. The aim of this study was to test the hypothesis that higher dosing (40 mg twice daily) would improve peak anti-Xa levels and decrease venous thromboembolism. A retrospective review was performed of trauma patients who received prophylactic enoxaparin and peak anti-Xa levels over 27 months. Patients were divided on the basis of dose: group A received 30 mg twice daily, and group B received 40 mg twice daily. Demographics and rates of venous thromboembolism were compared between dose groups and patients with inadequate or adequate anti-Xa levels. One hundred twenty-four patients were included, 90 in group A and 34 in group B. Demographics were similar, except that patients in group B had a higher mean body weight. Despite this, only 9% of group B patients had inadequate anti-Xa levels, compared with 33% of those in group A (P = .01). Imaging studies were available in 69 patients and revealed 8 venous thromboembolic events (P = NS, group A vs group B) with significantly more venous thromboembolic events occurring in patients with low anti-Xa levels (P = .02). Although higher dosing of enoxaparin led to improved anti-Xa levels, this did not equate to a statistical decrease in venous thromboembolism. Copyright © 2013 Elsevier Inc. All rights reserved.

Overexpression of Rice Auxilin-Like Protein, XB21, Induces Necrotic Lesions, up-Regulates Endocytosis-Related Genes, and Confers Enhanced Resistance to Xanthomonas oryzae pv. oryzae.

Science.gov (United States)

Park, Chang-Jin; Wei, Tong; Sharma, Rita; Ronald, Pamela C

2017-12-01

The rice immune receptor XA21 confers resistance to the bacterial pathogen, Xanthomonas oryzae pv. oryzae (Xoo). To elucidate the mechanism of XA21-mediated immunity, we previously performed a yeast two-hybrid screening for XA21 interactors and identified XA21 binding protein 21 (XB21). Here, we report that XB21 is an auxilin-like protein predicted to function in clathrin-mediated endocytosis. We demonstrate an XA21/XB21 in vivo interaction using co-immunoprecipitation in rice. Overexpression of XB21 in rice variety Kitaake and a Kitaake transgenic line expressing XA21 confers a necrotic lesion phenotype and enhances resistance to Xoo. RNA sequencing reveals that XB21 overexpression results in the differential expression of 8735 genes (4939 genes up- and 3846 genes down-regulated) (≥2-folds, FDR ≤0.01). The up-regulated genes include those predicted to be involved in 'cell death' and 'vesicle-mediated transport'. These results indicate that XB21 plays a role in the plant immune response and in regulation of cell death. The up-regulation of genes controlling 'vesicle-mediated transport' in XB21 overexpression lines is consistent with a functional role for XB21 as an auxilin.

Cytological diagnosis of xanthogranulomatous appendicitis

Directory of Open Access Journals (Sweden)

Rajni Kaushik

2017-01-01

Full Text Available Xanthogranulomatous reaction can occur in any organ but the most common sites are kidney and gallbladder. Xanthogranulomatous appendicitis (XA is a rare clinical entity. There are a few case reports of XA diagnosed on histopathology but none on cytology. Here we report a case of a 47-year-old lady who presented with acute abdomen and was found to have a mass lesion in the right iliac fossa. She was diagnosed with XA intraoperatively on imprint cytology that was subsequently confirmed on histopathological examination. Due to the rarity of XA itself and the use of imprint cytology for intraoperative diagnosis the case is being presented.

Los antípodas de la Bucólica VI

Directory of Open Access Journals (Sweden)

Rubén Florio

1989-12-01

Full Text Available This paper tries to prove the subtle relationship between the prologue and the epilogue in Virgil’s Sixth Bucolic. Each of those parts —in different but complementary ways— manifests leading ideas of Virgil’s poetical ideology, and the spirit of a traditional artistic conception.

Bounding approach in BUC implementation in pool at WWER-440

International Nuclear Information System (INIS)

Havluj, F.

2006-01-01

As new fuel designs (with higher enrichment) are introduced, spent fuel storage facilities might not fulfill criticality safety criteria when using fresh fuel approach to the criticality analyses. Since optimum moderation conditions evaluation even in wet storage systems is required by some regulatory bodies, any credit for soluble boron cannot be taken. Thus, the only suitable way to prove subcriticality of the given spent fuel system with higher enriched/burnt fuel is burnup credit implementation. This paper outlines burnup credit implementation methodology as demonstrated on criticality evaluation of WWER-440 reactor pool at NPP Dukovany. Operational history effects, isotopic set choice, as well as computational issues (SCALE 4.4a was used both for depletion and criticality calculations) are discussed, maintaining strictly conservative approach. Bounding approach in operational history treatment was carefully examined. Criticality evaluation using selection of (as expected) conservative values of operational parameters (specific power, fuel and moderator temperatures, boron content in moderator,..) was compared to criticality evaluation of real fuel assemblies from the NPP database. Therefore, bounding approach was justified and it was shown that it is not excessively conservative. Presented methodology can be applied on any similar spent fuel facility. Suggestions for future research are noted (mainly end-effect evaluation and consideration of profiled fuel) and urgent need of validation of depletion codes for WWER systems is emphasized (Authors)

Effect of MCM09, an active site-directed inhibitor of factor Xa, on B16-BL6 melanoma lung colonies in mice.

Science.gov (United States)

Rossi, C; Hess, S; Eckl, R W; di Lena, A; Bruno, A; Thomas, O; Poggi, A

2006-03-01

Treatment with anticoagulant drugs has shown potential inhibitory effect on tumor invasion, although the relationship with clotting inhibition was not clear. The aim of our study was to evaluate the potential antitumor activity of MCM09, a newly developed, active site-directed, small molecule inhibitor of factor Xa (FXa) [WO0216312], and to relate the findings to anticlotting potency. MCM09 (0.1-10 mg kg(-1)) or heparin (H; 10 mg kg(-1)) was injected intravenously (i.v.), with 5 x 10(4) B16-BL6 melanoma cells, in C57BL/6 mice. Mice were killed after 18 days, to count lung colonies. Ex vivo anticoagulant activity was measured by activated partial thromboplastin time (APTT) on mouse plasma. MCM09, a selective inhibitor of FXa (IC-50 = 2.4 nm against human FXa), inhibited in a dose-dependent manner B16-BL6 melanoma lung colonies in mice. Mean lung metastasis number was 20.9 +/- 4.8 in controls (n = 10), 1.2 +/- 0.4 in mice treated with H, 10 mg kg(-1) i.v. (P < 0.01), 0.9 +/- 0.3, 9.2 +/- 2.2 and 15.5 +/- 2.6 in mice treated with MCM09, at 10 (P < 0.01), 1 (P < 0.05) and 0.1 mg kg(-1) i.v. (ns), respectively. MCM09 (10 mg kg(-1) i.v.) significantly prolonged APTT (57.1 +/- 10.2 s) 30 min after i.v. injection when compared with controls (25.3 +/- 1.6 s; P < 0.05). Lung colonies were 74.2-72.6% reduced by MCM09 (10 mg kg(-1)) given 60 or 120 min before cells, but not by MCM09 given 60 min thereafter, suggesting a direct cell interaction as a mechanism underlying antitumor activity.

Extreme Apprenticeship – Emphasising conceptual understanding in undergraduate mathematics

OpenAIRE

Rämö , Johanna; Oinonen , Lotta; Vikberg , Thomas

2015-01-01

International audience; Extreme Apprenticeship (XA) is an educational method that has been used in teaching undergraduate mathematics in the University of Helsinki. In this paper, we analyse the course assignments and exam questions of a certain lecture course that has recently been reformed to an XA-based course. The results show that the XA method has made it possible to move the emphasis from rote learning towards understanding the concepts behind the procedures.

Assessment of the effects of dalteparin on coagulation variables and determination of a treatment schedule for use in cats.

Science.gov (United States)

Schönig, Jette C; Mischke, Reinhard H

2016-07-01

OBJECTIVE To determine a treatment protocol for SC administration of dalteparin to cats on the basis of currently available detailed pharmacokinetic data and to assess the effect of SC administration of dalteparin to cats on coagulation variables such as activated partial thromboplastin time (aPTT), thrombin time, and results for thromboelastometry, compared with effects on anti-activated coagulation factor X (anti-Xa) activity. ANIMALS 6 healthy domestic shorthair cats. PROCEDURES Cats received 14 injections of dalteparin (75 anti-Xa U/kg, SC) at 6-hour intervals. Blood samples were collected before and 2 hours after the first and second injections on days 1, 2, and 4. Anti-Xa activity was measured by use of a chromogenic substrate assay, aPTT and thrombin time were measured by use of an automated coagulometer, and viscoelastic measurements were obtained with thromboelastrometry. RESULTS 2 hours after the second injection, the target peak anti-Xa activity range of 0.5 to 1.0 U/mL was achieved in all cats, whereas median trough values remained below this range. Peak anti-Xa activity had only minimal effects on coagulation variables; the maximum median ratio for aPTT (in relationship to the value before the first dalteparin injection) was 1.23. CONCLUSIONS AND CLINICAL RELEVANCE Results of this study indicated that this treatment protocol resulted in reproducible anti-Xa activity in cats that was mostly within the targeted peak range of anti-Xa activity recommended for humans. Treatment in accordance with this protocol may not require routine coagulation monitoring of cats, but this must be confirmed in feline patients.

Upregulation of biotransformation genes in gills of oyster Crassostrea brasiliana exposed in situ to urban effluents, Florianópolis Bay, Southern Brazil.

Science.gov (United States)

Pessatti, Tomás B; Lüchmann, Karim H; Flores-Nunes, Fabrício; Mattos, Jacó J; Sasaki, Sílvio T; Taniguchi, Satie; Bícego, Márcia C; Dias Bainy, Afonso Celso

2016-09-01

The release of untreated sanitary sewage, combined with unplanned urban growth, are major factors contributing to degradation of coastal ecosystems in developing countries, including Brazil. Sanitary sewage is a complex mixture of chemicals that can negatively affect aquatic organisms. The use of molecular biomarkers can help to understand and to monitor the biological effects elicited by contaminants. The aim of this study was to evaluate changes in transcript levels of genes related to xenobiotic biotransformation in the gills of oysters Crassostrea brasiliana transplanted and kept for 24h at three areas potentially contaminated by sanitary sewage (Bücheller river, BUC; Biguaçu river, BIG; and Ratones island, RAT), one farming area (Sambaqui beach, SAM) and at one reference site (Forte beach, FOR) in the North Bay of Santa Catarina Island (Florianópolis, Brazil). Transcript levels of four cytochrome P450 isoforms (CYP2AU1, CYP3A-like, CYP356A1-like and CYP20A1-like), three glutathione S-transferase (GST alpha-like, GST pi-like and GST microsomal 3-like) and one sulfotransferase gene (SULT-like) were evaluated by means of quantitative reverse transcription PCR (qRT-PCR). Chemical analysis of the sediment from each site were performed and revealed the presence of aliphatic and polycyclic aromatic hydrocarbons, linear alkylbenzenes and fecal sterols in the contaminated areas (BUC and BIG). Water quality analysis showed that these sites had the highest levels of fecal coliforms and other parameters evidencing the presence of urban sewage discharges. Among the results for gene transcription, CYP2AU1 and SULT-like levels were upregulated by 20 and 50-fold, respectively, in the oysters kept for 24h at the most contaminated site (BUC), suggesting a role of these genes in the detoxification of organic pollutants. These data reinforce that gills possibly have an important role in xenobiotic metabolism and highlight the use of C. brasiliana as a sentinel for monitoring

Characterization of a human coagulation factor Xa-binding site on Viperidae snake venom phospholipases A2 by affinity binding studies and molecular bioinformatics

Directory of Open Access Journals (Sweden)

Gowda Veerabasappa T

2007-12-01

Full Text Available Abstract Background The snake venom group IIA secreted phospholipases A2 (SVPLA2, present in the Viperidae snake family exhibit a wide range of toxic and pharmacological effects. They exert their different functions by catalyzing the hydrolysis of phospholipids (PL at the membrane/water interface and by highly specific direct binding to: (i presynaptic membrane-bound or intracellular receptors; (ii natural PLA2-inhibitors from snake serum; and (iii coagulation factors present in human blood. Results Using surface plasmon resonance (SPR protein-protein interaction measurements and an in vitro biological test of inhibition of prothrombinase activity, we identify a number of Viperidae venom SVPLA2s that inhibit blood coagulation through direct binding to human blood coagulation factor Xa (FXa via a non-catalytic, PL-independent mechanism. We classify the SVPLA2s in four groups, depending on the strength of their binding. Molecular electrostatic potentials calculated at the surface of 3D homology-modeling models show a correlation with inhibition of prothrombinase activity. In addition, molecular docking simulations between SVPLA2 and FXa guided by the experimental data identify the potential FXa binding site on the SVPLA2s. This site is composed of the following regions: helices A and B, the Ca2+ loop, the helix C-β-wing loop, and the C-terminal fragment. Some of the SVPLA2 binding site residues belong also to the interfacial binding site (IBS. The interface in FXa involves both, the light and heavy chains. Conclusion We have experimentally identified several strong FXa-binding SVPLA2s that disrupt the function of the coagulation cascade by interacting with FXa by the non-catalytic PL-independent mechanism. By theoretical methods we mapped the interaction sites on both, the SVPLA2s and FXa. Our findings may lead to the design of novel, non-competitive FXa inhibitors.

Integrated Production of Xylonic Acid and Bioethanol from Acid-Catalyzed Steam-Exploded Corn Stover.

Science.gov (United States)

Zhu, Junjun; Rong, Yayun; Yang, Jinlong; Zhou, Xin; Xu, Yong; Zhang, Lingling; Chen, Jiahui; Yong, Qiang; Yu, Shiyuan

2015-07-01

High-efficiency xylose utilization is one of the restrictive factors of bioethanol industrialization. However, xylonic acid (XA) as a new bio-based platform chemical can be produced by oxidation of xylose with microbial. So, an applicable technology of XA bioconversion was integrated into the process of bioethanol production. After corn stover was pretreated with acid-catalyzed steam-explosion, solid and liquid fractions were obtained. The liquid fraction, also named as acid-catalyzed steam-exploded corn stover (ASC) prehydrolyzate (mainly containing xylose), was catalyzed with Gluconobacter oxydans NL71 to prepare XA. After 72 h of bioconversion of concentrated ASC prehydrolyzate (containing 55.0 g/L of xylose), the XA concentration reached a peak value of 54.97 g/L, the sugar utilization ratio and XA yield were 94.08 and 95.45 %, respectively. The solid fraction was hydrolyzed to produce glucose with cellulase and then fermented with Saccharomyces cerevisiae NL22 to produce ethanol. After 18 h of fermentation of concentrated enzymatic hydrolyzate (containing 86.22 g/L of glucose), the ethanol concentration reached its highest value of 41.48 g/L, the sugar utilization ratio and ethanol yield were 98.72 and 95.25 %, respectively. The mass balance showed that 1 t ethanol and 1.3 t XA were produced from 7.8 t oven dry corn stover.

Phosphatidylserine and Phosphatidylethanolamine Bind to Protein Z Cooperatively and with Equal Affinity.

Directory of Open Access Journals (Sweden)

Tanusree Sengupta

Full Text Available Protein Z (PZ is an anticoagulant that binds with high affinity to Protein Z-dependent protease inhibitor (ZPI and accelerates the rate of ZPI-mediated inhibition of factor Xa (fXa by more than 1000-fold in the presence of Ca2+ and phospholipids. PZ promotion of the ZPI-fXa interaction results from the anchoring of the Gla domain of PZ onto phospholipid surfaces and positioning the bound ZPI in close proximity to the Gla-anchored fXa, forming a ternary complex of PZ/ZPI/fXa. Although interaction of PZ with phospholipid membrane appears to be absolutely crucial for its cofactor activity, little is known about the binding of different phospholipids to PZ. The present study was conceived to understand the interaction of different phospholipids with PZ. Experiments with both soluble lipids and model membranes revealed that PZ binds to phosphatidylserine (PS and phosphatidylethanolamine (PE with equal affinity (Kd~48 μM; further, PS and PE bound to PZ synergistically. Equilibrium dialysis experiments revealed two lipid-binding sites for both PS and PE. PZ binds with weaker affinity to other phospholipids, e.g., phosphatidic acid, phosphatidylglycerol, phosphatidylcholine and binding of these lipids is not synergistic with respect to PS. Both PS and PE -containing membranes supported the formation of a fXa-PZ complex. PZ protection of fXa from antithrombin inhibition were also shown to be comparable in presence of both PS: PC and PE: PC membranes. These findings are particularly important and intriguing since they suggest a special affinity of PZ, in vivo, towards activated platelets, the primary membrane involved in blood coagulation process.

Home treatment of patients with low-risk pulmonary embolism with the oral factor Xa inhibitor rivaroxaban. Rationale and design of the HoT-PE Trial.

Science.gov (United States)

Barco, Stefano; Lankeit, Mareike; Binder, Harald; Schellong, Sebastian; Christ, Michael; Beyer-Westendorf, Jan; Duerschmied, Daniel; Bauersachs, Rupert; Empen, Klaus; Held, Matthias; Schwaiblmair, Martin; Fonseca, Cândida; Jiménez, David; Becattini, Cecilia; Quitzau, Kurt; Konstantinides, Stavros

2016-07-04

Pulmonary embolism (PE) is a potentially life-threatening acute cardiovascular syndrome. However, more than 95 % of patients are haemodynamically stable at presentation, and among them are patients at truly low risk who may qualify for immediate or early discharge. The Home Treatment of Pulmonary Embolism (HoT-PE) study is a prospective international multicentre single-arm phase 4 management (cohort) trial aiming to determine whether home treatment of acute low-risk PE with the oral factor Xa inhibitor rivaroxaban is feasible, effective, and safe. Patients with confirmed PE, who have no right ventricular dysfunction or free floating thrombi in the right atrium or ventricle, are eligible if they meet none of the exclusion criteria indicating haemodynamic instability, serious comorbidity or any condition mandating hospitalisation, or a familial/social environment unable to support home treatment. The first dose of rivaroxaban is given in hospital, and patients are discharged within 48 hours of presentation. Rivaroxaban is taken for at least three months. The primary outcome is symptomatic recurrent venous thromboembolism or PE-related death within three months of enrolment. Secondary outcomes include quality of life and patient satisfaction, and health care resource utilisation compared to existing data on standard-duration hospital treatment. HoT-PE is planned to analyse 1,050 enrolled patients, providing 80 % power to reject the null hypothesis that the recurrence rate of venous thromboembolism is >3 % with α≤0.05. If the hypothesis of HoT-PE is confirmed, early discharge and out-of-hospital treatment may become an attractive, potentially cost-saving option for a significant proportion of patients with acute PE.

Analgesic effects of an ethanol extract of the fruits of Xylopia aethiopica (Dunal A. Rich (Annonaceae and the major constituent, xylopic acid in murine models

Directory of Open Access Journals (Sweden)

Eric Woode

2012-01-01

Full Text Available Background: Fruit extracts of Xylopia aethiopica are used traditionally in the management of pain disorders including rheumatism, headache, colic pain, and neuralgia. Little pharmacological data exists in scientific literature of the effect of the fruit extract and its major diterpene, xylopic acid, on pain. The present study evaluated the analgesic properties of the ethanol extract of X. aethiopica (XAE and xylopic acid (XA, in murine models. Materials and Methods: XAE and XA were assessed in chemical (acetic acid-induced abdominal writhing and formalin tests, thermal (Tail-flick and Hargreaves thermal hyperalgesia tests, and mechanical (Randall-Selitto paw pressure test pain models. Results: XAE and XA exhibited significant analgesic activity in all the pain models used. XAE (30-300 mg kg -1 , p.o. and XA (10-100 mg kg -1 , p.o. inhibited acetic acid-induced visceral nociception, formalin- induced paw pain (both neurogenic and inflammatory, thermal pain as well as carrageenan-induced mechanical and thermal hyperalgesia in animals. Morphine (1-10 mg kg -1 , i.p. and diclofenac (1-10 mg kg -1 , i.p., used as controls, exhibited similar anti-nociceptive activities. XAE and XA did not induce tolerance to their respective anti-nociceptive effects in the formalin test after chronic administration. Morphine tolerance did not also cross-generalize to the analgesic effects of XAE or XA. Conclusions: These findings establish the analgesic properties of the ethanol fruit extract of X. aethiopica and its major diterpene, xylopic acid.

Rivaroxaban in patients with a recent acute coronary syndrome

DEFF Research Database (Denmark)

Mega, Jessica L; Braunwald, Eugene; Wiviott, Stephen D

2012-01-01

Acute coronary syndromes arise from coronary atherosclerosis with superimposed thrombosis. Since factor Xa plays a central role in thrombosis, the inhibition of factor Xa with low-dose rivaroxaban might improve cardiovascular outcomes in patients with a recent acute coronary syndrome....

Apixaban versus enoxaparin for thromboprophylaxis after hip replacement

DEFF Research Database (Denmark)

Lassen, Michael Rud; Gallus, Alexander; Raskob, Gary E

2010-01-01

There are various regimens for thromboprophylaxis after hip replacement. Low-molecular-weight heparins such as enoxaparin predominantly inhibit factor Xa but also inhibit thrombin to some degree. Orally active, specific factor Xa inhibitors such as apixaban may provide effective thromboprophylaxis...

Edoxaban versus Warfarin for the Treatment of Symptomatic Venous Thromboembolism

DEFF Research Database (Denmark)

Büller, Harry R; Décousus, Hervé; Grosso, Michael A

2013-01-01

Whether the oral factor Xa inhibitor edoxaban can be an alternative to warfarin in patients with venous thromboembolism is unclear.......Whether the oral factor Xa inhibitor edoxaban can be an alternative to warfarin in patients with venous thromboembolism is unclear....

On the mild solutions of higher-order differential equations in Banach spaces

Directory of Open Access Journals (Sweden)

Nguyen Thanh Lan

2003-01-01

Full Text Available For the higher-order abstract differential equation u(n(t=Au(t+f(t, t∈ℝ, we give a new definition of mild solutions. We then characterize the regular admissibility of a translation-invariant subspace ℳ of BUC(ℝ,E with respect to the above-mentioned equation in terms of solvability of the operator equation AX−Xn=C. As applications, periodicity and almost periodicity of mild solutions are also proved.

Comparative physical mapping of rice BAC clones linked to resistance genes Glh,Bph-3 and xa-5 in Oryza sativa L.and O.granulata Nees et Am.ex Watt.

Institute of Scientific and Technical Information of China (English)

XIONG Zhiyong; TAN Guangxuan; YOU Aiqing; HE Guangyuan; SHE Chaowen; LI Lijia; SONG Yunchun

2004-01-01

Oryza granulata Nees et Arn. ex Watt. is one of the three wild relatives of rice, which are the most valuable for study and utilization in China. In this study, the homology and physical locations of three rice resistance genes, Glh,Bph-3 and xa-5 are comparatively analyzed between O. sativa and O. granulata by Southern blotting and fluorescence in situ hybridization (FISH). The results of Southern blotting indicate that there exist homologous sequences of the tested RFLP markers in O. granulata. By using three bacterial artificial chromosome (BAC) clones scanned by the tested RFLP as probes, FISH signals are detected on both mitotic and pachytene chromosomes in O. sativa and O. granulata.Dual-color FISH demonstrates that two of the three BAC clones (14E16 and 38J9) are located on the short arm of the same chromosome pair in O. granulata. Additionally, colinearity is shown for the two clones between O. sativa and O.granulata. Another BAC clone 44B4 is located on the end of the short arm of other chromosome pair in these two species.Although the phylogenetic relationship between O. sativa and O. granulata is the most distinct in Oryza and these two species have evidently different biological features and ecological habits, the relative lengths and arm ratios of the detected chromosomes and the relative positions of the tested clone signals on chromosomes in O. granulata are quite similar to those in O. sativa.

Helium effects on tungsten surface morphology and deuterium retention

NARCIS (Netherlands)

Ueda, Y.; H. Y. Peng,; H. T. Lee,; N. Ohno,; S. Kajita,; Yoshida, N.; Doerner, R.; De Temmerman, G.; V. Alimov,; G. Wright,

2013-01-01

Recent experimental results on tungsten surface morphology, especially nano-structure (fuzz), induced by helium plasma exposure at temperatures between 1000&#xa0;K and 2000&#xa0;K are reviewed. This structure was firstly reported in 2006. In this review, most of experimental results reported

A new peptide (Ruviprase) purified from the venom of Daboia russelii russelii shows potent anticoagulant activity via non-enzymatic inhibition of thrombin and factor Xa.

Science.gov (United States)

Thakur, Rupamoni; Kumar, Ashok; Bose, Biplab; Panda, Dulal; Saikia, Debashree; Chattopadhyay, Pronobesh; Mukherjee, Ashis K

2014-10-01

Compounds showing dual inhibition of thrombin and factor Xa (FXa) are the subject of great interest owing to their broader specificity for effective anticoagulation therapy against cardiovascular disorders. This is the first report on the functional characterization and assessment of therapeutic potential of a 4423.6 Da inhibitory peptide (Ruviprase) purified from Daboia russelii russelii venom. The secondary structure of Ruviprase is composed of α-helices (61.9%) and random coils (38.1%). The partial N-terminal sequence (E(1)-V(2)-X(3)-W(4)-W(5)-W(6)-A(7)-Q(8)-L(9)-S(10)) of Ruviprase demonstrated significant similarity (80.0%) with an internal sequence of apoptosis-stimulating protein reported from the venom of Ophiophagus hannah and Python bivittatus; albeit Ruviprase did not show sequence similarity with existing thrombin/FXa inhibitors, suggesting its uniqueness. Ruviprase demonstrated a potent in vitro anticoagulant property and inhibited both thrombin and FXa following slow binding kinetics. Ruviprase inhibited thrombin by binding to its active site via an uncompetitive mechanism with a Ki value and dissociation constant (KD) of 0.42 μM and 0.46 μM, respectively. Conversely, Ruviprase demonstrated mixed inhibition (Ki = 0.16 μM) of FXa towards its physiological substrate prothrombin. Furthermore, the biological properties of Ruviprase could not be neutralized by commercial polyvalent or monovalent antivenom. Ruviprase at a dose of 2.0 mg/kg was non-toxic and showed potent in vivo anticoagulant activity after 6 h of intraperitoneal treatment in mice. Because of the potent anticoagulant property as well as non-toxic nature of Ruviprase, the possible application of the peptide as an antithrombotic agent for combating thrombosis-associated ailments appears promising. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

Assessment of Heparin Anticoagulation Measured Using i-STAT and Hemochron Activated Clotting Time.

Science.gov (United States)

Maslow, Andrew; Chambers, Alison; Cheves, Tracey; Sweeney, Joseph

2018-01-31

Adequate anticoagulation, measured using activated clotting time (ACT), is important during vascular and cardiac surgeries. Unfractionated heparin is the most common anticoagulant used. The purpose of this analysis was to compare the i-STAT ACT (iACT) to the Hemochron ACT (hACT), both of which were then compared to anti-factor Xa (anti-Xa) assay, a representation of heparin level and activity. Prospective study. Tertiary care cardiovascular center. Eleven consecutive elective adult cardiac surgical patients. Prior to cardiopulmonary bypass, ACTs were measured using i-STAT and Hemochron technologies and compared to each other and to anti-Xa assay prior to and during a cumulative administration of heparin. Data were compared using bias analyses. Heparin (300 U/kg) was administered in quarterly doses. Coagulation labs were collected prior to and 3 minutes after each quarterly dose of heparin. The baseline ACTs for i-STAT and Hemochron were 147 and 142 seconds, respectively. A significant association was found between iACT and hACT (p = 0.002). The iACT measurements underestimated hACT at ACT levels >180 seconds or anti-Xa levels >0.75 U/mL. No significant difference was found between ACT data at anti-Xa levels 0.75 U/mL. Copyright © 2018 Elsevier Inc. All rights reserved.

The impact of founder events on chromosomal variability in multiply mating species

DEFF Research Database (Denmark)

Pool, John E; Nielsen, Rasmus

2008-01-01

size reductions and recent bottlenecks leading to decreased X/A diversity ratios. Here we use theory and simulation to investigate a separate demographic effect-that of founder events involving multiply mated females-and find that it leads to much stronger reductions in X/A diversity ratios than...

A novel protease activity assay using a protease-responsive chaperone protein

International Nuclear Information System (INIS)

Sao, Kentaro; Murata, Masaharu; Fujisaki, Yuri; Umezaki, Kaori; Mori, Takeshi; Niidome, Takuro; Katayama, Yoshiki; Hashizume, Makoto

2009-01-01

Protease activity assays are important for elucidating protease function and for developing new therapeutic agents. In this study, a novel turbidimetric method for determining the protease activity using a protease-responsive chaperone protein is described. For this purpose, a recombinant small heat-shock protein (sHSP) with an introduced Factor Xa protease recognition site was synthesized in bacteria. This recombinant mutant, FXa-HSP, exhibited chaperone-like activity at high temperatures in cell lysates. However, the chaperone-like activity of FXa-HSP decreased dramatically following treatment with Factor Xa. Protein precipitation was subsequently observed in the cell lysates. The reaction was Factor Xa concentration-dependent and was quantitatively suppressed by a specific inhibitor for Factor Xa. Protein aggregation was detected by a simple method based on turbidimetry. The results clearly demonstrate that this assay is an effective, easy-to-use method for determining protease activities without the requirement of labeling procedures and the use of radioisotopes.

A novel protease activity assay using a protease-responsive chaperone protein

Energy Technology Data Exchange (ETDEWEB)

Sao, Kentaro [Graduate School of Systems Life Sciences, Kyushu University, 744 Motooka Nishi-ku, Fukuoka 819-0395 (Japan); Murata, Masaharu, E-mail: m-murata@dem.med.kyushu-u.ac.jp [Department of Advanced Medical Initiatives, Faculty of Medical Science, Kyushu University, 3-1-1 Maidashi, Higashi-ku Fukuoka 812-8582 (Japan); Fujisaki, Yuri; Umezaki, Kaori [Department of Advanced Medical Initiatives, Faculty of Medical Science, Kyushu University, 3-1-1 Maidashi, Higashi-ku Fukuoka 812-8582 (Japan); Mori, Takeshi; Niidome, Takuro; Katayama, Yoshiki [Graduate School of Systems Life Sciences, Kyushu University, 744 Motooka Nishi-ku, Fukuoka 819-0395 (Japan); Department of Applied Chemistry, Faculty of Engineering, Kyushu University, Nishi-ku Fukuoka 819-0395 (Japan); Center for Future Chemistry, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Hashizume, Makoto [Department of Advanced Medical Initiatives, Faculty of Medical Science, Kyushu University, 3-1-1 Maidashi, Higashi-ku Fukuoka 812-8582 (Japan)

2009-06-05

Protease activity assays are important for elucidating protease function and for developing new therapeutic agents. In this study, a novel turbidimetric method for determining the protease activity using a protease-responsive chaperone protein is described. For this purpose, a recombinant small heat-shock protein (sHSP) with an introduced Factor Xa protease recognition site was synthesized in bacteria. This recombinant mutant, FXa-HSP, exhibited chaperone-like activity at high temperatures in cell lysates. However, the chaperone-like activity of FXa-HSP decreased dramatically following treatment with Factor Xa. Protein precipitation was subsequently observed in the cell lysates. The reaction was Factor Xa concentration-dependent and was quantitatively suppressed by a specific inhibitor for Factor Xa. Protein aggregation was detected by a simple method based on turbidimetry. The results clearly demonstrate that this assay is an effective, easy-to-use method for determining protease activities without the requirement of labeling procedures and the use of radioisotopes.

Simultaneous and Sequential Feature Negative Discriminations: Elemental Learning and Occasion Setting in Human Pavlovian Conditioning

Science.gov (United States)

Baeyens, Frank; Vervliet, Bram; Vansteenwegen, Debora; Beckers, Tom; Hermans, Dirk; Eelen, Paul

2004-01-01

Using a conditioned suppression task, we investigated simultaneous (XA-/A+) vs. sequential (X [right arrow] A-/A+) Feature Negative (FN) discrimination learning in humans. We expected the simultaneous discrimination to result in X (or alternatively the XA configuration) becoming an inhibitor acting directly on the US, and the sequential…

African Journal of Biotechnology - Vol 11, No 33 (2012)

African Journals Online (AJOL)

Introgression of bacterial blight (BB) resistance genes Xa7 and Xa21 into popular restorer line and their hybrids by molecular marker-assisted backcross (MABC) selection scheme ... Concentration of selected heavy metals in water of the Juru River, Penang, Malaysia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

Cavalieri Integration - CSIR Technical report

CSIR Research Space (South Africa)

Grobler, TL

2011-10-01

Full Text Available ] is called a translational function. Two examples of trans- lational functions are shown in Figure 4.A and Figure 4.B, and Figure 4.C presents an example of a linear function a(y) which is not translational with respect to f(x). y f(x) xa b a(y) A. y... f(x) xa b a(y) B. y f(x) xa b a(y) C. Figure 4. Examples of translational, and non-translational functions. De nition 3.2 (Cavalieri region R). Let R be any region (in R2) bounded by a nonnegative function f(x) (which is continuous...

Cavalieri integration

CSIR Research Space (South Africa)

Ackermann, ER

2012-09-01

Full Text Available ; b] is called a translational function. Two examples of translational functions are shown in Figure 4.A and Figure 4.B, and Figure 4.C presents an example of a linear function a(y) which is not translational with respect to f(x). y f(x) xa b a...(y) A. y f(x) xa b a(y) B. y f(x) xa b a(y) C. Figure 4: Examples of translational, and non-translational functions. De nition 3.2 (Cavalieri region R). Let R be any region (in R2) bounded by a nonnegative function f(x) (which is continuous...

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

... backcross derived line possessing Xa21 + Pi2 and another possessing Xa33 were intercrossed to stack the target resistance genes into the genetic background of RPHR-1005. At ICF4, 10 promising lines possessing three resistance genes in homozygous condition along with fine-grain type, complete fertility restoration, ...

Paris saponin-induced autophagy promotes breast cancer cell apoptosis via the Akt/mTOR signaling pathway.

Science.gov (United States)

Xie, Zhan-Zhi; Li, Man-Mei; Deng, Peng-Fei; Wang, Sheng; Wang, Lei; Lu, Xue-Ping; Hu, Liu-Bing; Chen, Zui; Jie, Hui-Yang; Wang, Yi-Fei; Liu, Xiao-Xiao; Liu, Zhong

2017-02-25

Paris saponins possess anticancer, anti-inflammatory, and antiviral effects. However, the anticancer effect of Paris saponins has not been well elucidated and the mechanisms underlying the potential function of Paris saponins in cancer therapy are needed to be further identify. In this study, we report that saponin compounds isolated from Paris polyphylla exhibited antitumor activity against breast cancer cell lines, MCF-7 and MDA-MB-231. Paris saponin XA-2 induced apoptosis in both cell lines, as evidenced by the activation of caspases and cleavage of Poly (ADP-ribose) polymerase. The ability of XA-2 to induce autophagy was confirmed by acridine orange staining, accumulation of autophagosome-bound Long chain 3 (LC3)-II, and measurement of autophagic flux. XA-2-induced autophagy was observed to promote apoptosis by the combined treatment of breast cancer cell lines with XA-2 and autophagy inhibitors 3-methyladenine and bafilomycin A1, respectively. Moreover, we report a decrease in the levels of Akt/mTOR signaling pathway proteins, such as the phosphorylated forms of Akt, mTOR, P70S6K, and eukaryotic translation initiation factor 4E-binding protein 1 (4EBP1). Taken together, these results provide important insights explaining the anticancer activity of Paris saponins and the potential development of XA-2 as a new therapeutic agent. Copyright © 2017 Elsevier B.V. All rights reserved.

Characterization of a disease susceptibility locus for exploring an efficient way to improve rice resistance against bacterial blight

Institute of Scientific and Technical Information of China (English)

Qi Cheng; Weihua Mao; Wenya Xie; Qinsong Liu; Jianbo Cao; Meng Yuan; Qinglu Zhang; Xianghua Li; Shiping Wang

2017-01-01

Bacterial blight caused by Xanthomonas oryzae pv.oryzae (Xoo) is the most harmful bacterial disease of rice worldwide.Previously,we characterized major disease resistance (MR) gene xa25,which confers race-specific resistance to Xoo strain PXO339.The xa25 is a recessive allele of the SWEET13 locus,but SWEET13's interaction with PXO339 and how efficiently using this locus for rice breeding still need to be defined.Here we show that the SWEET13 allele from rice Zhenshan 97 is a susceptibility gene to PXO339.Using this allele's promoter to regulate xa25 resulted in disease,suggesting that the promoter is a key determinant in SWEET13 caused disease in Zhanshan 97 after PXO339 infection.PXO339 transcriptionally induces SWEET13 to cause disease.Partial suppressing SWEET13 expression leads to a high level of resistance to PXO339.Thus,the transcriptionally suppressed SWEET13 functions as xa25 in resistance to PXO339.Hybrid rice is widely grown in many countries.However,recessive MR genes have not been efficiently used for disease resistance breeding in hybrid rice production for both parents of the hybrid have to carry the same recessive gene.However,the suppressed SWEET13 functions dominantly,which will have advantage to improve the resistance of hybrid rice to xa25-incomptible Xoo.

An ultrasensitive electrochemical sensor for simultaneous determination of xanthine, hypoxanthine and uric acid based on Co doped CeO{sub 2} nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Lavanya, N. [Department of Bioelectronics and Biosensors, Alagappa University, Karaikudi 630003, Tamilnadu (India); Sekar, C., E-mail: Sekar2025@gmail.com [Department of Bioelectronics and Biosensors, Alagappa University, Karaikudi 630003, Tamilnadu (India); Murugan, R.; Ravi, G. [Department of Physics, Alagappa University, Karaikudi 630003, Tamilnadu (India)

2016-08-01

A novel electrochemical sensor has been fabricated using Co doped CeO{sub 2} nanoparticles for selective and simultaneous determination of xanthine (XA), hypoxanthine (HXA) and uric acid (UA) in a phosphate buffer solution (PBS, pH 5.0) for the first time. The Co-CeO{sub 2} NPs have been prepared by microwave irradiation method and characterized by Powder XRD, Raman spectroscopy, HRTEM and VSM measurements. The electrochemical behaviours of XA, HXA and UA at the Co-CeO{sub 2} NPs modified glassy carbon electrode (GCE) were studied by cyclic voltammetry and square wave voltammetry methods. The modified electrode exhibited remarkably well-separated anodic peaks corresponding to the oxidation of XA, HXA and UA over the concentration range of 0.1–1000, 1–600 and 1–2200 μM with detection limits of 0.096, 0.36, and 0.12 μM (S/N = 3), respectively. For simultaneous detection by synchronous change of the concentrations of XA, HXA and UA, the linear responses were in the range of 1–400 μM each with the detection limits of 0.47, 0.26, and 0.43 μM (S/N = 3), respectively. The fabricated sensor was further applied to the detection of XA, HXA and UA in human urine samples with good selectivity and high reproducibility. - Highlights: • A novel electrochemical sensor has been fabricated for simultaneous determination of purine metabolites xanthine, hypoxanthine, and uric acid based on Co doped CeO{sub 2} nanoparticles. • The Co-CeO{sub 2} modified glassy carbon electrode exhibited wide linear range towards the detection of XA, HXA and UA than ever reported in the literature. • The fabricated sensor was successfully applied for the analysis of human urine samples with satisfactory results.

Strategy Of Attrition: Why General Westmoreland Failed In 1967

Science.gov (United States)

2016-05-26

assault on South Vietnamese regulars at Xa Tan Hung resulted in...with forty-six wounded. To complicate the situation, civilian casualties continued to mass. During the attack at Xa Tan Hung, the Viet Cong wounded...Ronald H. Advice And Support: The Early. Years, 1941-1960. Washington, DC: Center of Military History,1985. Taleb, Nassim Nicholas . Antifragile: Things

Abscisic acid, xanthoxin and violaxanthin in the caps of gravistimulated maize roots

Science.gov (United States)

Feldman, L. J.; Arroyave, N. J.; Sun, P. S.

1985-01-01

The occurrence and distribution of abscisic acid (ABA), xanthoxin (Xa) and the carotenoid violaxanthin (Va) were investigated in root tips of maize (Zea mays L. cv. Merit). In roots grown in the dark, Va and ABA were present in relatively high amounts in the root cap and in low amounts in the adjacent terminal 1.5 mm of the root. Xanthoxin was present in equal concentrations in both regions. In roots exposed to light, the ABA distribution was reversed, with relatively low levels in the root cap and high levels in the adjacent 1.5-mm segment. Light also caused a decrease in Va in both regions of the root and an increase in Xa, especially in the cap. In the maize cultivar used for this work, light is necessary for gravitropic curving. This response occurs within the same time frame as the light-induced ABA redistribution as well as the changes in the levels of Va and Xa. These data are consistent with a role for ABA in root gravitropism and support the proposal that Xa may arise from the turnover of Va.

On the regularity of mild solutions to complete higher order differential equations on Banach spaces

Directory of Open Access Journals (Sweden)

Nezam Iraniparast

2015-09-01

Full Text Available For the complete higher order differential equation u(n(t=Σk=0n-1Aku(k(t+f(t, t∈ R (* on a Banach space E, we give a new definition of mild solutions of (*. We then characterize the regular admissibility of a translation invariant subspace al M of BUC(R, E with respect to (* in terms of solvability of the operator equation Σj=0n-1AjXal Dj-Xal Dn = C. As application, almost periodicity of mild solutions of (* is proved.

Tactical Radar Technology Study. Volume II.

Science.gov (United States)

1980-03-01

0026 UNCLASSIFIED RADC-TR-D-4 8V OL-2 NL -AD A084885 -I " r N oS14t Rosen F Leo Canie OdK ArFm - Bucs Now@ Yo NUY344 80 5, 27 2 17 - --- ?TrM*A B. BRHLM... collectively meet the requirements for the dree separate functions. When one considers the ATR operational requirement for long-range surveillance in... collective network. The ability to alleviate the demands placed upon the resources of individual sensors, will be directly related to the efficiency with

A cidade e as serras de Eça de Queiroz, o "esse adorável Virgílio": del bucolismo a la palingenesia = A cidade e as serras de Eça de Queiroz, ou "esse adorável Virgílio": do bucolismo à palingenesia = Eça de Queiroz’s A cidade e as serras , or "esse adorável Virgílio": between bucolism and palingenesy

Directory of Open Access Journals (Sweden)

Jurado, Francisco García

2014-01-01

Full Text Available A novela A cidade e as Serras de Eça de Queiroz, assim como seu texto anterior, o conto “Civilização” estão escritos a partir de varias características importantes da primeira Bucólica de Virgilio. Esta presença virgiliana se deve, em grande parte, à reação contraria ao decadentismo defendido por J. K. Huysmans e o desejo de regeneração, assim como a leitura sobre Virgilio que o pensador social P. J. Proudhon havía realizado

Simulating Ru L ₃ -Edge X-ray Absorption Spectroscopy with Time-Dependent Density Functional Theory: Model Complexes and Electron Localization in Mixed-Valence Metal Dimers

Energy Technology Data Exchange (ETDEWEB)

Van Kuiken, Benjamin E.; Valiev, Marat; Daifuku, Stephanie L.; Bannan, Caitlin; Strader, Matthew L.; Cho, Hana; Huse, Nils; Schoenlein, Robert W.; Govind, Niranjan; Khalil, Munira

2013-05-30

Ruthenium L3-edge X-ray absorption (XA) spectroscopy probes unoccupied 4d orbitals of the metal atom and is increasingly being used to investigate the local electronic structure in ground and excited electronic states of Ru complexes. The simultaneous development of computational tools for simulating Ru L3-edge spectra is crucial for interpreting the spectral features at a molecular level. This study demonstrates that time-dependent density functional theory (TDDFT) is a viable and predictive tool for simulating ruthenium L3-edge XA spectroscopy. We systematically investigate the effects of exchange correlation functional and implicit and explicit solvent interactions on a series of RuII and RuIII complexes in their ground and electronic excited states. The TDDFT simulations reproduce all of the experimentally observed features in Ru L3-edge XA spectra within the experimental resolution (0.4 eV). Our simulations identify ligand-specific charge transfer features in complicated Ru L3-edge spectra of [Ru(CN)6]4- and RuII polypyridyl complexes illustrating the advantage of using TDDFT in complex systems. We conclude that the B3LYP functional most accurately predicts the transition energies of charge transfer features in these systems. We use our TDDFT approach to simulate experimental Ru L3-edge XA spectra of transition metal mixed-valence dimers of the form [(NC)5MII-CN-RuIII(NH3)5] (where M = Fe or Ru) dissolved in water. Our study determines the spectral signatures of electron delocalization in Ru L3-edge XA spectra. We find that the inclusion of explicit solvent molecules is necessary for reproducing the spectral features and the experimentally determined valencies in these mixed-valence complexes. This study validates the use of TDDFT for simulating Ru 2p excitations using popular quantum chemistry codes and providing a powerful interpretive tool for equilibrium and ultrafast Ru L3-edge XA spectroscopy.

Transcriptomic Analysis and the Expression of Disease-Resistant Genes in Oryza meyeriana under Native Condition.

Directory of Open Access Journals (Sweden)

Bin He

Full Text Available Oryza meyeriana (O. meyeriana, with a GG genome type (2n = 24, accumulated plentiful excellent characteristics with respect to resistance to many diseases such as rice shade and blast, even immunity to bacterial blight. It is very important to know if the diseases-resistant genes exist and express in this wild rice under native conditions. However, limited genomic or transcriptomic data of O. meyeriana are currently available. In this study, we present the first comprehensive characterization of the O. meyeriana transcriptome using RNA-seq and obtained 185,323 contigs with an average length of 1,692 bp and an N50 of 2,391 bp. Through differential expression analysis, it was found that there were most tissue-specifically expressed genes in roots, and next to stems and leaves. By similarity search against protein databases, 146,450 had at least a significant alignment to existed gene models. Comparison with the Oryza sativa (japonica-type Nipponbare and indica-type 93-11 genomes revealed that 13% of the O. meyeriana contigs had not been detected in O. sativa. Many diseases-resistant genes, such as bacterial blight resistant, blast resistant, rust resistant, fusarium resistant, cyst nematode resistant and downy mildew gene, were mined from the transcriptomic database. There are two kinds of rice bacterial blight-resistant genes (Xa1 and Xa26 differentially or specifically expressed in O. meyeriana. The 4 Xa1 contigs were all only expressed in root, while three of Xa26 contigs have the highest expression level in leaves, two of Xa26 contigs have the highest expression profile in stems and one of Xa26 contigs was expressed dominantly in roots. The transcriptomic database of O. meyeriana has been constructed and many diseases-resistant genes were found to express under native condition, which provides a foundation for future discovery of a number of novel genes and provides a basis for studying the molecular mechanisms associated with disease

Simulating Ru L3-edge X-ray absorption spectroscopy with time-dependent density functional theory: model complexes and electron localization in mixed-valence metal dimers.

Science.gov (United States)

Van Kuiken, Benjamin E; Valiev, Marat; Daifuku, Stephanie L; Bannan, Caitlin; Strader, Matthew L; Cho, Hana; Huse, Nils; Schoenlein, Robert W; Govind, Niranjan; Khalil, Munira

2013-05-30

Ruthenium L3-edge X-ray absorption (XA) spectroscopy probes unoccupied 4d orbitals of the metal atom and is increasingly being used to investigate the local electronic structure in ground and excited electronic states of Ru complexes. The simultaneous development of computational tools for simulating Ru L3-edge spectra is crucial for interpreting the spectral features at a molecular level. This study demonstrates that time-dependent density functional theory (TDDFT) is a viable and predictive tool for simulating ruthenium L3-edge XA spectroscopy. We systematically investigate the effects of exchange correlation functional and implicit and explicit solvent interactions on a series of Ru(II) and Ru(III) complexes in their ground and electronic excited states. The TDDFT simulations reproduce all of the experimentally observed features in Ru L3-edge XA spectra within the experimental resolution (0.4 eV). Our simulations identify ligand-specific charge transfer features in complicated Ru L3-edge spectra of [Ru(CN)6](4-) and Ru(II) polypyridyl complexes illustrating the advantage of using TDDFT in complex systems. We conclude that the B3LYP functional most accurately predicts the transition energies of charge transfer features in these systems. We use our TDDFT approach to simulate experimental Ru L3-edge XA spectra of transition metal mixed-valence dimers of the form [(NC)5M(II)-CN-Ru(III)(NH3)5](-) (where M = Fe or Ru) dissolved in water. Our study determines the spectral signatures of electron delocalization in Ru L3-edge XA spectra. We find that the inclusion of explicit solvent molecules is necessary for reproducing the spectral features and the experimentally determined valencies in these mixed-valence complexes. This study validates the use of TDDFT for simulating Ru 2p excitations using popular quantum chemistry codes and providing a powerful interpretive tool for equilibrium and ultrafast Ru L3-edge XA spectroscopy.

SIRT1 genetic variants associate with the metabolic response of Caucasians to a controlled lifestyle intervention – the TULIP Study

Directory of Open Access Journals (Sweden)

Stefan Norbert

2008-11-01

Full Text Available Abstract Background Sirtuin1 (SIRT1 regulates gene expression in distinct metabolic pathways and mediates beneficial effects of caloric restriction in animal models. In humans, SIRT1 genetic variants associate with fasting energy expenditure. To investigate the relevance of SIRT1 for human metabolism and caloric restriction, we analyzed SIRT1 genetic variants in respect to the outcome of a controlled lifestyle intervention in Caucasians at risk for type 2 diabetes. Methods A total of 1013 non-diabetic Caucasians from the Tuebingen Family Study (TUEF were genotyped for four tagging SIRT1 SNPs (rs730821, rs12413112, rs7069102, rs2273773 for cross-sectional association analyses with prediabetic traits. SNPs that associated with basal energy expenditure in the TUEF cohort were additionally analyzed in 196 individuals who underwent a controlled lifestyle intervention (Tuebingen Lifestyle Intervention Program; TULIP. Multivariate regressions analyses with adjustment for relevant covariates were performed to detect associations of SIRT1 variants with the changes in anthropometrics, weight, body fat or metabolic characteristics (blood glucose, insulin sensitivity, insulin secretion and liver fat, measured by magnetic resonance techniques after the 9-month follow-up test in the TULIP study. Results Minor allele (X/A carriers of rs12413112 (G/A had a significantly lower basal energy expenditure (p = 0.04 and an increased respiratory quotient (p = 0.02. This group (rs12413112: X/A was resistant against lifestyle-induced improvement of fasting plasma glucose (GG: -2.01%, X/A: 0.53%; p = 0.04, had less increase in insulin sensitivity (GG: 17.3%, X/A: 9.6%; p = 0.05 and an attenuated decline in liver fat (GG: -38.4%, X/A: -7.5%; p = 0.01. Conclusion SIRT1 plays a role for the individual lifestyle intervention response, possibly owing to decreased basal energy expenditure and a lower lipid-oxidation rate in rs12413112 X/A allele carriers. SIRT1 genetic

Monitoring low molecular weight heparins at therapeutic levels: dose-responses of, and correlations and differences between aPTT, anti-factor Xa and thrombin generation assays.

Directory of Open Access Journals (Sweden)

Owain Thomas

Full Text Available Low molecular weight heparins (LMWH's are used to prevent and treat thrombosis. Tests for monitoring LMWH's include anti-factor Xa (anti-FXa, activated partial thromboplastin time (aPTT and thrombin generation. Anti-FXa is the current gold standard despite LMWH's varying affinities for FXa and thrombin.To examine the effects of two different LMWH's on the results of 4 different aPTT-tests, anti-FXa activity and thrombin generation and to assess the tests' concordance.Enoxaparin and tinzaparin were added ex-vivo in concentrations of 0.0, 0.5, 1.0 and 1.5 anti-FXa international units (IU/mL, to blood from 10 volunteers. aPTT was measured using two whole blood methods (Free oscillation rheometry (FOR and Hemochron Jr (HCJ and an optical plasma method using two different reagents (ActinFSL and PTT-Automat. Anti-FXa activity was quantified using a chromogenic assay. Thrombin generation (Endogenous Thrombin Potential, ETP was measured on a Ceveron Alpha instrument using the TGA RB and more tissue-factor rich TGA RC reagents.Methods' mean aPTT at 1.0 IU/mL LMWH varied between 54s (SD 11 and 69s (SD 14 for enoxaparin and between 101s (SD 21 and 140s (SD 28 for tinzaparin. ActinFSL gave significantly shorter aPTT results. aPTT and anti-FXa generally correlated well. ETP as measured with the TGA RC reagent but not the TGA RB reagent showed an inverse exponential relationship to the concentration of LMWH. The HCJ-aPTT results had the weakest correlation to anti-FXa and thrombin generation (Rs0.62-0.87, whereas the other aPTT methods had similar correlation coefficients (Rs0.80-0.92.aPTT displays a linear dose-response to LMWH. There is variation between aPTT assays. Tinzaparin increases aPTT and decreases thrombin generation more than enoxaparin at any given level of anti-FXa activity, casting doubt on anti-FXa's present gold standard status. Thrombin generation with tissue factor-rich activator is a promising method for monitoring LMWH's.

Determination of enoxaparin with rotational thrombelastometry using the prothrombinase-induced clotting time reagent.

Science.gov (United States)

Schaden, Eva; Schober, Andreas; Hacker, Stefan; Spiss, Christian; Chiari, Astrid; Kozek-Langenecker, Sibylle

2010-04-01

Drug monitoring of low molecular weight heparin is generally not recommended, but could be reasonable in critically ill patients, whose risk for bleeding or thrombosis shows a high interpatient variability. Anti-Xa assays are not available around the clock even in central hospitals, whereas rotational thrombelastometry (ROTEM) becomes increasingly used at the bedside. Prothrombinase-induced clotting time (PiCT) reagent allows determination of factor Xa-inhibition in plasma. The aim of our study was to evaluate enoxaparin determination in whole blood with the ROTEM using specific test modifications, including PiCT. After ethics committee's approval, citrated whole blood obtained from overall 16 healthy volunteers was incubated with enoxaparin at 16 different anti-Xa concentrations. Main endpoint was the clotting time (CT) in ROTEM representing initial activation of clot formation. CT was determined in the new PiCT-ROTEM test, in a low-tissue factor-activated modification (LowTF-ROTEM) as well as in the commercially available heparin-sensitive ROTEM assays (HEPTEM and INTEM). In the absence of enoxaparin, CT values were 168.6 +/- 6.1 s (PiCT-ROTEM), 247.3 +/- 18.6 s (LowTF-ROTEM), and -6.2 +/- 7.9 s (INTEM-HEPTEM). A linear dependency (P anti-Xa concentration and CT was found for PiCT-ROTEM, LowTF-ROTEM, and for INTEM-HEPTEM with correlation coefficients of 0.93 for PiCT-ROTEM, 0.94 for LowTF-ROTEM, and 0.81 for INTEM-HEPTEM. This in-vitro experiment demonstrates a strong correlation between enoxaparin anti-Xa concentrations and specific ROTEM tests. These promising assays should be further evaluated for monitoring anticoagulation in high-risk patients in clinical studies.

Oral heparin results in the appearance of heparin fragments in the plasma of rats

International Nuclear Information System (INIS)

Larsen, A.K.; Lund, D.P.; Langer, R.; Folkman, J.

1986-01-01

We have previously shown that angiogenesis inhibition and tumor regression can be accomplished by combinations of heparin or heparin fragments with cortisone. Oral heparin was also effective in combination with cortisone. We now show that a single oral dose of [ 35 S]heparin or [ 3 H]heparin (15,000 units/kg) results in continuous release of radioactive material into the bloodstream for at least 12 hr. This is associated with the presence of anti-factor Xa activity at a level of approximately equal to 0.1 unit/ml. The radioactive material is identified as oligo-, di-, and monosaccharides by its behavior in chromatographic systems, its possession of anti-factor Xa activity, and the effect of treatment with bacterial heparinase. The heparin fragments are extensively metabolized to fragments without anti-factor Xa activity that are readily subject to urinary excretion

Searching Online Chemical Data Repositories via the ChemAgora Portal.

Science.gov (United States)

Zanzi, Antonella; Wittwehr, Clemens

2017-12-26

ChemAgora, a web application designed and developed in the context of the "Data Infrastructure for Chemical Safety Assessment" (diXa) project, provides search capabilities to chemical data from resources available online, enabling users to cross-reference their search results with both regulatory chemical information and public chemical databases. ChemAgora, through an on-the-fly search, informs whether a chemical is known or not in each of the external data sources and provides clikable links leading to the third-party web site pages containing the information. The original purpose of the ChemAgora application was to correlate studies stored in the diXa data warehouse with available chemical data. Since the end of the diXa project, ChemAgora has evolved into an independent portal, currently accessible directly through the ChemAgora home page, with improved search capabilities of online data sources.

A narrativa comunicando espacialidades: mídias sociais e as mudanças no discurso sobre o território amazônico

OpenAIRE

Santos, Renata Nazaré Machado Tárrio dos

2014-01-01

Os discursos midiáticos sobre a Amazônia seguiram, na história brasileira, um mesmo padrão baseado no estereótipo primitivo e bucólico construído desde o descobrimento do país, alicerçado na literatura e mantido pelas mídias tradicionais. No entanto, o espaço amazônico sofreu transformações, recaindo numa Amazônia urbana e desenvolvida, embora ainda não reconhecida como tal. Isso ocorre justamente pela força que a narrativa estereotipada construiu durante a história. Sucede que...

Tissue factor-dependent activation of tritium-labeled factor IX and factor X in human plasma

International Nuclear Information System (INIS)

Morrison, S.A.; Jesty, J.

1984-01-01

A comparism was made of the tissue factor-dependent activation of tritium-labeled factor IX and factor X in a human plasma system and a study was made of the role of proteases known to stimulate factor VII activity. Plasma was defibrinated by heating and depleted of its factors IX and X by passing it through antibody columns. Addition of human brain thromboplastin, Ca2+, and purified 3H-labeled factor X to the plasma resulted, after a short lag, in burst-like activation of the factor X, measured as the release of radiolabeled activation peptide. The progress of activation was slowed by both heparin and a specific inhibitor of factor Xa but factor X activation could not be completely abolished by such inhibitors. In the case of 3H-factor IX activation, the rate also increased for approximately 3 min after addition of thromboplastin, but was not subsequently curtailed. A survey of proteases implicated as activators of factor VII in other settings showed that both factor Xa and factor IXa could accelerate the activation of factor IX. However, factor Xa was unique in obliterating activation when present at concentrations greater than approximately 1 nM. Heparin inhibited the tissue factor-dependent activation of factor IX almost completely, apparently through the effect of antithrombin on the feedback reactions of factors Xa and IXa on factor VII. These results suggest that a very tight, biphasic control of factor VII activity exists in human plasma, which is modulated mainly by factor Xa. At saturation of factor VIIa/tissue factor, factor IX activation was significantly more rapid than was previously found in bovine plasma under similar conditions. The activation of factor X at saturation was slightly more rapid than in bovine plasma, despite the presence of heparin

Use of Enoxaparin in Obese Adolescents During Bariatric Surgery--a Pilot Study.

Science.gov (United States)

Mushtaq, Alvina; Vaughns, Janelle D; Ziesenitz, Victoria C; Nadler, Evan P; van den Anker, John N

2015-10-01

Obese patients have a higher risk of venous thromboembolism when immobilized due to surgery. The objective of this study was to assess anti-factor Xa activity in adolescent bariatric surgical patients receiving prophylactic enoxaparin. Four morbidly obese adolescents undergoing laparoscopic sleeve gastrectomy were enrolled. Enoxaparin was administered (40 mg subcutaneous (SC) if BMI ≤50 kg/m(2) or 60 mg SC if BMI >50 kg/m(2)) for prevention of venous thromboembolism every 12 h starting after induction of anesthesia until discharge. Plasma anti-factor Xa activity was assessed over 12 h after the first dose and used as a surrogate marker for enoxaparin levels. Non-compartmental analysis of anti-factor Xa activity levels was performed and compared with previously published studies. Patients recruited were 16 to 18 years of age with a mean BMI of 52.6 ± 5.8 kg/m(2) (>99th BMI percentile). Peak anti-factor Xa activity ranged from 0.20 to 0.23 IU/mL in our study population, compared to 0.38 to 0.53 IU/mL in the cited lean comparator groups. Our current dosing practice of 40 mg SC for individuals with a BMI ≤50 kg/m(2) and 60 mg for individuals with a BMI ≥50 kg/m(2) resulted in anti-factor Xa activity that was sufficient for adequate thromboprophylaxis in adolescent bariatric surgical patients. Our data also demonstrates lower drug exposures in the obese when compared to lean patients. Therefore, randomized controlled efficacy and safety studies are urgently needed to guide the use of low-molecular-weight heparins in the pediatric and adolescent obese population.

The fear of awful smell: risk perceptions among farmers in Vietnam using wastewater and human excreta in agriculture

DEFF Research Database (Denmark)

Knudsen, Line G; Phuc, Pham D; Hiep, Nguyen T

2008-01-01

Vietnamese farmers' health-risk awareness, knowledge, and practices related to their use of wastewater and human excreta was investigated in an anthropological study by a multidisciplinary team in peri-urban Hanoi and Nghe An Province. Farmers identified health risks associated with their use...... of excreta and wastewater, but they viewed these as unavoidable risks related to production. They perceived the health risks as different for the use of wastewater and human feces. They perceived health risks from wastewater as non-serious because it remained on the skin and only caused skin problems......, but they considered health risks from non-composted smelly feces serious because it entered the body through 'polluted' air. Most farmers were more aware of threats to health from 'dirt' entering the domestic environment than of the health risks during their work. The concept of 'dirt' should be separated from...

Incorporation of Bacterial Blight Resistance Genes Into Lowland Rice Cultivar Through Marker-Assisted Backcross Breeding.

Science.gov (United States)

Pradhan, Sharat Kumar; Nayak, Deepak Kumar; Pandit, Elssa; Behera, Lambodar; Anandan, Annamalai; Mukherjee, Arup Kumar; Lenka, Srikanta; Barik, Durga Prasad

2016-07-01

Bacterial blight (BB) of rice caused by Xanthomonas oryzae pv. oryzae is a major disease of rice in many rice growing countries. Pyramided lines carrying two BB resistance gene combinations (Xa21+xa13 and Xa21+xa5) were developed in a lowland cultivar Jalmagna background through backcross breeding by integrating molecular markers. In each backcross generation, markers closely linked to the disease resistance genes were used to select plants possessing the target genes. Background selection was continued in those plants carrying resistant genes until BC(3) generation. Plants having the maximum contribution from the recurrent parent genome were selected in each generation and hybridized with the recipient parent. The BB-pyramided line having the maximum recipient parent genome recovery of 95% was selected among BC3F1 plants and selfed to isolate homozygous BC(3)F(2) plants with different combinations of BB resistance genes. Twenty pyramided lines with two resistance gene combinations exhibited high levels of tolerance against the BB pathogen. In order to confirm the resistance, the pyramided lines were inoculated with different X. oryzae pv. oryzae strains of Odisha for bioassay. The genotypes with combination of two BB resistance genes conferred high levels of resistance to the predominant X. oryzae pv. oryzae isolates prevalent in the region. The pyramided lines showed similarity with the recipient parent with respect to major agro-morphologic traits.

Disappearance of a low molecular weight heparin fraction (CY 216) differs from standard heparin in rabbits

International Nuclear Information System (INIS)

Boneu, B.; Buchanan, M.R.; Caranobe, C.; Gabaig, A.M.; Dupouy, D.; Sie, P.; Hirsh, J.

1987-01-01

In previous studies, we have reported that standard heparin (SH) was cleared by two mechanisms, a saturable mechanism which predominated at low doses (less than 100 anti-factor Xa U/kg) and a non-saturable mechanism which predominated at higher doses, when the first mechanism became saturated. In this study, we examined the importance of these two mechanisms in the disappearance of a low molecular weight heparin fraction (LMWH) (CY 216), by comparing the pharmacokinetics and the pharmacodynamics of a wide range of doses of SH and CY 216 (1.5 to 500 anti-factor Xa U/kg). Pharmacokinetics was measured as the disappearance of 125 I-radiolabelled SH or CY 216. Pharmacodynamics was measured as the disappearance of the anti-factor Xa activity of SH and CY 216. We found that the saturable mechanism contributed little to the disappearance of CY 216 and that it was cleared predominantly by the non-saturable mechanism at all doses tested. Thus, at low doses (less than 100 anti-factor Xa U/kg), SH was cleared more rapidly than CY 216, whereas at higher doses, CY 216 was cleared more rapidly than SH. We conclude that the mechanism of disappearance of LMWH's differ significantly from those of SH, and that this difference may explain the apparent prolonged anticoagulant activity of LMWH's within the therapeutic range doses

Normal Female Germ Cell Differentiation Requires the Female X Chromosome to Autosome Ratio and Expression of Sex-Lethal in DROSOPHILA MELANOGASTER

OpenAIRE

Schüpbach, Trudi

1985-01-01

In somatic cells of Drosophila, the ratio of X chromosomes to autosomes (X:A ratio) determines sex and dosage compensation. The present paper addresses the question of whether germ cells also use the X:A ratio for sex determination and dosage compensation. Triploid female embryos were generated which, through the loss of an unstable ring-X chromosome, contained some germ cells of 2X;3A constitution in their ovaries. Such germ cells were shown to differentiate along one of two alternative pat...

The Xanthomonas Ax21 protein is processed by the general secretory system and is secreted in association with outer membrane vesicles

Directory of Open Access Journals (Sweden)

Ofir Bahar

2014-01-01

Full Text Available Pattern recognition receptors (PRRs play an important role in detecting invading pathogens and mounting a robust defense response to restrict infection. In rice, one of the best characterized PRRs is XA21, a leucine rich repeat receptor-like kinase that confers broad-spectrum resistance to multiple strains of the bacterial pathogen Xanthomonas oryzae pv. oryzae (Xoo. In 2009 we reported that an Xoo protein, called Ax21, is secreted by a type I-secretion system and that it serves to activate XA21-mediated immunity. This report has recently been retracted. Here we present data that corrects our previous model. We first show that Ax21 secretion does not depend on the predicted type I secretion system and that it is processed by the general secretion (Sec system. We further show that Ax21 is an outer membrane protein, secreted in association with outer membrane vesicles. Finally, we provide data showing that ax21 knockout strains do not overcome XA21-mediated immunity.

Potential Impact of the REDD+ Program on Poverty Reduction in Nghe An Province, Vietnam

Directory of Open Access Journals (Sweden)

Nguyen Dinh Tien

2017-10-01

Full Text Available The REDD+ program provides a mechanism for providing financial rewards to forest owners and users who contribute to the reduction of carbon emissions from deforestation and forest degradation. This paper determines the potential impact of the REDD+ program on poverty reduction by comparing income and poverty rate between two household groups that were willing to participate in this study, but that will not participate in the REDD+. The results showed that carbon payment from forests is a significant contributor to the increase in household income of poor people. The average income of households participating in the program is VND 20.68 million in contrast to those not participating whose average income is VND 14.72 million. Results showed that the REDD+ program intervention helped reduce the poverty rate in the two communes by 6.40% (from 39.4% to 33%. The paper recommends that the REDD+ program should facilitate the distribution of land titles to provide security of tenure for individual households that are participating in the program. While the program can contribute to poverty reduction, the program payments can increase income inequality and conflicts between those involved and those not involved in the program and legal ownership of the lands. In addition, a comprehensive research study on the impact of the program on forest conservation and poverty reduction is necessary. Stakeholders of the program should recognize and acknowledge the trade-offs between conservation and economic development or poverty reduction. A comprehensive trade-off analysis of program implementation and a business-as-usual option of commodity production is needed, which could reveal the indirect economic, political, and social costs and benefits of the program.

Apixaban or enoxaparin for thromboprophylaxis after knee replacement

DEFF Research Database (Denmark)

Lassen, Michael Rud; Raskob, Gary E; Gallus, Alexander

2009-01-01

BACKGROUND: The optimal strategy for thromboprophylaxis after major joint replacement has not been established. Low-molecular-weight heparins such as enoxaparin predominantly target factor Xa but to some extent also inhibit thrombin. Apixaban, a specific factor Xa inhibitor, may provide effective...... (P=0.03). CONCLUSIONS: As compared with enoxaparin for efficacy of thromboprophylaxis after knee replacement, apixaban did not meet the prespecified statistical criteria for noninferiority, but its use was associated with lower rates of clinically relevant bleeding and it had a similar adverse...

Ultrahigh-efficiency apodized grating coupler using fully etched photonic crystals

DEFF Research Database (Denmark)

Ding, Yunhong; Ou, Haiyan; Peucheret, Christophe

2013-01-01

We present an efficient method to design apodized grating couplers with Gaussian output profiles for efficient coupling between standard single mode fibers and silicon chips. An apodized grating coupler using fully etched photonic crystal holes on the silicon-on-insulator platform is designed......, and fabricated in a single step of lithography and etching. An ultralow coupling loss of x2212;1.74x2009;x2009;dB (67% coupling efficiency) with a 3xA0;dB bandwidth of 60xA0;nm is experimentally measured....

Case report

African Journals Online (AJOL)

abp

21 sept. 2017 ... XA avait aux deux yeux, une AV à 8/10 et XB, une AV de 3/10 améliorée au trou sténopéïque à 7/10 en faveur d'une amétropie. XA présentait un ptosis bilatéral qui remontait à l'âge de 2 ans avec une action du releveur de la paupière supérieure (RPS) à 7 mm et XB, un ptosis bilatéral remontant à l'âge de ...

Finsler-Geometric Continuum Dynamics and Shock Compression

Science.gov (United States)

2018-01-01

version of Finsler theory is newly applied to shock compression of this ceramic. An order parameter is linked simultaneously to densification and...set of algebraic equations that may be solved simultaneously (albeit, not in closed form) for the shock stress, order param- eter, entropy, and shock...δxa ⊗ dX A = ∂ϕ a(X, D, t) ∂X A δ δxa ⊗ dX A = ∂x(X, D, t) ∂X , FaA = ∂Aϕa = ∂Axa . (2.28) The inverse tangent mapping from spatial to referential

Molecular mimicry modulates plant host responses to pathogens.

Science.gov (United States)

Ronald, Pamela; Joe, Anna

2018-01-25

Pathogens often secrete molecules that mimic those present in the plant host. Recent studies indicate that some of these molecules mimic plant hormones required for development and immunity. This Viewpoint reviews the literature on microbial molecules produced by plant pathogens that functionally mimic molecules present in the plant host. This article includes examples from nematodes, bacteria and fungi with emphasis on RaxX, a microbial protein produced by the bacterial pathogen Xanthomonas oryzae pv. oryzae. RaxX mimics a plant peptide hormone, PSY (plant peptide containing sulphated tyrosine). The rice immune receptor XA21 detects sulphated RaxX but not the endogenous peptide PSY. Studies of the RaxX/XA21 system have provided insight into both host and pathogen biology and offered a framework for future work directed at understanding how XA21 and the PSY receptor(s) can be differentially activated by RaxX and endogenous PSY peptides. © The Author 2017. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Gametogenesis in malaria parasites is mediated by the cGMP-dependent protein kinase.

Directory of Open Access Journals (Sweden)

Louisa McRobert

2008-06-01

Full Text Available Malaria parasite transmission requires differentiation of male and female gametocytes into gametes within a mosquito following a blood meal. A mosquito-derived molecule, xanthurenic acid (XA, can trigger gametogenesis, but the signalling events controlling this process in the human malaria parasite Plasmodium falciparum remain unknown. A role for cGMP was revealed by our observation that zaprinast (an inhibitor of phosphodiesterases that hydrolyse cGMP stimulates gametogenesis in the absence of XA. Using cGMP-dependent protein kinase (PKG inhibitors in conjunction with transgenic parasites expressing an inhibitor-insensitive mutant PKG enzyme, we demonstrate that PKG is essential for XA- and zaprinast-induced gametogenesis. Furthermore, we show that intracellular calcium (Ca2+ is required for differentiation and acts downstream of or in parallel with PKG activation. This work defines a key role for PKG in gametogenesis, elucidates the hierarchy of signalling events governing this process in P. falciparum, and demonstrates the feasibility of selective inhibition of a crucial regulator of the malaria parasite life cycle.

Evaluation of the coagulometer STA R Max® (Stago) for routine coagulation parameters.

Science.gov (United States)

Brulé, Justine; Sinegre, Thomas; Pereira, Bruno; Berger, Marc G; Serre-Sapin, Anne-Françoise; Lebreton, Aurélien

2018-04-01

The STA R Max ® is a fully automated multiparameter coagulometer using clotting (viscosity-based detection system), chromogenic and immunologic assays. STA R Max ® is equipped with an innovative software (STA Coag Expert ® ) designed to assist laboratory in accreditation. The aim of this study was to evaluate its performances for the certification according to ISO 15189 quality standard in the haemostasis unit of our university hospital. The following tests were evaluated: prothrombin time (PT), activated partial thromboplastin time (aPTT), kaolin cephalin clotting time (KCCT), fibrinogen, anti-Xa assay and D-dimers. In normal and pathological range, the intra-assay coefficients of variation (CV) for PT, aPTT, KCCT and fibrinogen were below 4.0%. Intra-assay CV was of 4.0% for the anti-Xa assay and intra-assay CV was of 7.9% for D-dimers. Inter-assay CV were below 5.0% for PT, aPPT, KCCT and fibrinogen, 14.9% for anti-Xa assay and 8.6% for D-dimers. The interlaboratory comparisons were below 8.7% for PT, aPPT and KCCT, 5.0% for fibrinogen and 15.5% for anti-Xa assay. All results were acceptable according to suitable CV established by GFHT and the provider. The concordance between all coagulometers was excellent, with correlation coefficient close to 1 (0.99 for all parameters except for aPPT which was 0.98) calculated thanks to an intra-class correlation study. In conclusion, the STA R Max ® analyser is suitable for haemostasis laboratories and facilitates certification of a laboratory.

Guidance of Autonomous Aerospace Vehicles for Vertical Soft Landing using Nonlinear Control Theory

Science.gov (United States)

2015-08-11

desired plant (1.4) i.e. goal is to ensure that X → Xd as t →∞. 4 Distribution Code A: Approved for public release, distribution is unlimited 1.1 Philosophy...system to follow Ẋd = fd ( Xd ) (1.4) where Xd ∈ℜn represents the desire state vector. In the actual plant model (1.3) the term d(X ) is unknown, the...Kτ(Xest −Xa) (1.6) 2. Xa → Xd as t →∞: This process is accomplished through control synthesis using online adaptation of DI controller. 1.1.1 Control

MELHORAMENTO GENÉTICO DO TRIGO: XXXII. AVALIAÇÃO DE NOVOS GENÓTIPOS DERIVADOS DO 'IAC 24' QUANTO ÀS CARACTERÍSTICAS AGRONÔMICAS E À QUALIDADE TECNOLÓGICA

Directory of Open Access Journals (Sweden)

FELÍCIO JOÃO CARLOS

1998-01-01

Full Text Available Avaliaram-se 29 genótipos de trigo provenientes de cruzamentos entre o cultivar IAC 24 e fontes comprovadas de resistência a Puccinia recondita e características específicas para panificação, mais o cultivar IAC 24 (controle, mediante experimentos semeados em diferentes regiões tritícolas paulistas no período 1993-95. Analisaram-se as características seguintes: produtividade de grãos, resistência à ferrugem-da-folha, à tolerância ao alumínio tóxico e às qualidades industriais para pão. Considerando a produtividade, destacou-se, no Vale do Paranapanema, o genótipo no 24 (CM H. 74A-630/SX//CNO79/3/IAC 24; na região de Capão Bonito, o no 26 (Yaco "S"/IAC -24 e, em Mococa, com irrigação por aspersão, o no 23 (CM 6530/IAC-24. A resistência ao agente causal da ferrugem-da-folha foi transferida para os genótipos por meio dos cruzamentos envolvendo Yaco "S" e Agent/6*SKA//AGA/4/TI71. Seis genótipos entre os avaliados revelaram-se muito sensíveis ao Al3+ Os trigos duros apresentaram maior rendimento de extração de farinha, comparados aos moles. Considerando os diferentes parâmetros avaliados para qualidade tecnológica, destacaram-se os genótipos no 16 (IAS58/IAS55//ALD/3/IAC5/4/ALD/IAS58/8.1034.A//ALD/5/CNR/6/BUC"S"/7/IAC24 e no 12 (MRNG/4/NAD/FOR//PCN/3/BLT/MES/5/PAT2195*2/ZP"S"/6/ALD/EMU//CHAT/7/VEE/8/IAC24, com base no estudo da divergência genética por componentes principais.

Progress report - Physics and Health Sciences - Physics Section - 1986 July 01 - December 31

International Nuclear Information System (INIS)

1987-02-01

This progress report of the Physics section of Chalk River Nuclear Laboratories highlights work on major equipment: 1) Tandem Accelerator Superconducting Cyclotron (TASCC), 2) Isotope Separator On Line (ISOL), 3) Spectrometer Array for Particles Produced in Heavy Ion Reactions (SAPPHIRE), and 4) The Double Neutron Spectrometer for neutron scattering (DUALSPEC). Theoretical physics work includes fractal theory, non-topological soliton model of the nucleons, meson currents in relativistic shell model theories and supergravity. Progress of the Sudbury Neutrino Observatory (SNO) and the National Fusion Program (NFP) is discussed. Two commercial aspects are included; the formation of Shar-Buc Enterprises, the first spin-off business of the Research Company and the Applied Neutron Diffraction for Industry (ANDI), a major commercial activity

The probability to initiate X chromosome inactivation is determined by the X to autosomal ratio and X chromosome specific allelic properties.

Directory of Open Access Journals (Sweden)

Kim Monkhorst

Full Text Available In female mammalian cells, random X chromosome inactivation (XCI equalizes the dosage of X-encoded gene products to that in male cells. XCI is a stochastic process, in which each X chromosome has a probability to be inactivated. To obtain more insight in the factors setting up this probability, we studied the role of the X to autosome (X ratio A ratio in initiation of XCI, and have used the experimental data in a computer simulation model to study the cellular population dynamics of XCI.To obtain more insight in the role of the XratioA ratio in initiation of XCI, we generated triploid mouse ES cells by fusion of haploid round spermatids with diploid female and male ES cells. These fusion experiments resulted in only XXY triploid ES cells. XYY and XXX ES lines were absent, suggesting cell death related either to insufficient X-chromosomal gene dosage (XYY or to inheritance of an epigenetically modified X chromosome (XXX. Analysis of active (Xa and inactive (Xi X chromosomes in the obtained triploid XXY lines indicated that the initiation frequency of XCI is low, resulting in a mixed population of XaXiY and XaXaY cells, in which the XaXiY cells have a small proliferative advantage. This result, and findings on XCI in diploid and tetraploid ES cell lines with different X ratio A ratios, provides evidence that the X ratio A ratio determines the probability for a given X chromosome to be inactivated. Furthermore, we found that the kinetics of the XCI process can be simulated using a probability for an X chromosome to be inactivated that is proportional to the X ratio A ratio. These simulation studies re-emphasize our hypothesis that the probability is a function of the concentration of an X-encoded activator of XCI, and of X chromosome specific allelic properties determining the threshold for this activator.The present findings reveal that the probability for an X chromosome to be inactivated is proportional to the X ratio A ratio. This finding

Association of prothrombin complex concentrate administration and hematoma enlargement in non-vitamin K antagonist oral anticoagulant-related intracerebral hemorrhage.

Science.gov (United States)

Gerner, Stefan T; Kuramatsu, Joji B; Sembill, Jochen A; Sprügel, Maximilian I; Endres, Matthias; Haeusler, Karl Georg; Vajkoczy, Peter; Ringleb, Peter A; Purrucker, Jan; Rizos, Timolaos; Erbguth, Frank; Schellinger, Peter D; Fink, Gereon R; Stetefeld, Henning; Schneider, Hauke; Neugebauer, Hermann; Röther, Joachim; Claßen, Joseph; Michalski, Dominik; Dörfler, Arnd; Schwab, Stefan; Huttner, Hagen B

2018-01-01

To investigate parameters associated with hematoma enlargement in non-vitamin K antagonist oral anticoagulant (NOAC)-related intracerebral hemorrhage (ICH). This retrospective cohort study includes individual patient data for 190 patients with NOAC-associated ICH over a 5-year period (2011-2015) at 19 departments of neurology across Germany. Primary outcome was the association of prothrombin complex concentrate (PCC) administration with hematoma enlargement. Subanalyses were calculated for blood pressure management and its association with the primary outcome. Secondary outcomes include associations with in-hospital mortality and functional outcome at 3 months assessed using the modified Rankin Scale. The study population for analysis of primary and secondary outcomes consisted of 146 NOAC-ICH patients with available follow-up imaging. Hematoma enlargement occurred in 49/146 (33.6%) patients with NOAC-related ICH. Parameters associated with hematoma enlargement were blood pressure ≥ 160mmHg within 4 hours and-in the case of factor Xa inhibitor ICH-anti-Xa levels on admission. PCC administration prior to follow-up imaging was not significantly associated with a reduced rate of hematoma enlargement either in overall NOAC-related ICH or in patients with factor Xa inhibitor intake (NOAC: risk ratio [RR] = 1.150, 95% confidence interval [CI] = 0.632-2.090; factor Xa inhibitor: RR = 1.057, 95% CI = 0.565-1.977), regardless of PCC dosage given or time interval until imaging or treatment. Systolic blood pressure levels < 160mmHg within 4 hours after admission were significantly associated with a reduction in the proportion of patients with hematoma enlargement (RR = 0.598, 95% CI = 0.365-0.978). PCC administration had no effect on mortality and functional outcome either at discharge or at 3 months. In contrast to blood pressure control, PCC administration was not associated with a reduced rate of hematoma enlargement in NOAC-related ICH

Interaction of blood coagulation factor Va with phospholipid vesicles examined by using lipophilic photoreagents

International Nuclear Information System (INIS)

Krieg, U.C.; Isaacs, B.S.; Yemul, S.S.; Esmon, C.T.; Bayley, H.; Johnson, A.E.

1987-01-01

Two different lipophilic photoreagents, [ 3 H]adamantane diazirine and 3-(trifluoromethyl)-3-(m-[ 125 I]iodophenyl)diazirine (TID), have been utilized to examine the interactions of blood coagulation factor Va with calcium, prothrombin, factor Xa, and, in particular, phospholipid vesicles. With each of these structurally dissimilar reagents, the extent of photolabeling of factor Va was greater when the protein was bound to a membrane surface than when it was free in solution. Specifically, the covalent photoreaction with Vl, the smaller subunit of factor Va, was 2-fold higher in the presence of phosphatidylcholine/phosphatidylserine (PC/PS, 3:1) vesicles, to which factor Va binds, than in the presence of 100% PC vesicles, to which the protein does not bind. However, the magnitude of the PC/PS-dependent photolabeling was much less than has been observed previously with integral membrane proteins. It therefore appears that the binding of factor Va to the membrane surface exposes Vl to the lipid core of the bilayer, but that only a small portion of the Vl polypeptide is exposed to, or embedded in, the bilayer core. Addition of either prothrombin or active-site-blocked factor Xa to PC/PS-bound factor Va had little effect on the photolabeling of Vl with TID, but reduced substantially the covalent labeling of Vh, the larger subunit of factor Va. This indicates that prothrombin and factor Xa each cover nonpolar surfaces on Vh when the macromolecules associate on the PC/PS surface. It therefore seems likely that the formation of the prothrombinase complex involves a direct interaction between Vh and factor Xa and between Vh and prothrombin.(ABSTRACT TRUNCATED AT 250 WORDS)

DynaGuard: Armoring Canary-Based Protections against Brute-Force Attacks

Science.gov (United States)

2015-12-11

format of the canary check or a function’s prologue and epilogue. Finally, due to the small number of canary-protected frames that (on average) are...sje ng 462 .lib qua ntu m 464 .h2 64r ef 471 .om net pp 473 .as tar 483 .xa lan cbm k Apa che Ng inx Pos tgre SQ L SQ Lite My SQ L Sl ow do w n (n...k 456 .hm me r 458 .sje ng 462 .lib qua ntu m 464 .h2 64r ef 471 .om net pp 473 .as tar 483 .xa lan cbm k Apa che Ng inx

1st review of the status of national air quality: 1994-2004

CSIR Research Space (South Africa)

Taviv, I

2006-10-01

Full Text Available od (WC ) Se ttle rs (KZ N) We ntw or th (KZ N) Wa ter va l (M P) Ta ble Vie w (WC ) Mo the rw ell (EC ) Le itru m (FS ) Ale xa ndr a (GA U) Ora nge Fa rm (GA U) Kh aye lits ha (WC ) Ne...) La ng ve rw ac ht (MP ) Le itru m (FS ) Ale xa nd ra (GA U) At hlo ne (WC ) Bu cc leu ch (GA U) Cit y D ee p(G AU ) Ne wt ow n (GA U) No rth er n Wo rks (GA U) O 3 ( p p b ) Average...

Laboratory Assessment of the Anticoagulant Activity of Direct Oral Anticoagulants: A Systematic Review.

Science.gov (United States)

Samuelson, Bethany T; Cuker, Adam; Siegal, Deborah M; Crowther, Mark; Garcia, David A

2017-01-01

Direct oral anticoagulants (DOACs) are the treatment of choice for most patients with atrial fibrillation and/or noncancer-associated venous thromboembolic disease. Although routine monitoring of these agents is not required, assessment of anticoagulant effect may be desirable in special situations. The objective of this review was to summarize systematically evidence regarding laboratory assessment of the anticoagulant effects of dabigatran, rivaroxaban, apixaban, and edoxaban. PubMed, Embase, and Web of Science were searched for studies reporting relationships between drug levels and coagulation assay results. We identified 109 eligible studies: 35 for dabigatran, 50 for rivaroxaban, 11 for apixaban, and 13 for edoxaban. The performance of standard anticoagulation tests varied across DOACs and reagents; most assays, showed insufficient correlation to provide a reliable assessment of DOAC effects. Dilute thrombin time (TT) assays demonstrated linear correlation (r 2  = 0.67-0.99) across a range of expected concentrations of dabigatran, as did ecarin-based assays. Calibrated anti-Xa assays demonstrated linear correlation (r 2  = 0.78-1.00) across a wide range of concentrations for rivaroxaban, apixaban, and edoxaban. An ideal test, offering both accuracy and precision for measurement of any DOAC is not widely available. We recommend a dilute TT or ecarin-based assay for assessment of the anticoagulant effect of dabigatran and anti-Xa assays with drug-specific calibrators for direct Xa inhibitors. In the absence of these tests, TT or APTT is recommended over PT/INR for assessment of dabigatran, and PT/INR is recommended over APTT for detection of factor Xa inhibitors. Time since last dose, the presence or absence of drug interactions, and renal and hepatic function should impact clinical estimates of anticoagulant effect in a patient for whom laboratory test results are not available. Copyright © 2016 American College of Chest Physicians. Published by Elsevier

Report: Ozone Transport Commission Incurred Costs Under EPA Assistance Agreements XA98379901, OT83098301, XA97318101, and OT83264901

Science.gov (United States)

Report #2007-4-00068, July 31, 2007. We questioned $2,723,706 of the $9,042,706 in reported outlays because the recipient claimed unallowable outlays for contractual services, indirect costs, and in-kind costs.

Polysaccharide rich fractions from barks of Ximenia americana inhibit peripheral inflammatory nociception in mice Antinociceptive effect of Ximenia americana polysaccharide rich fractions

Directory of Open Access Journals (Sweden)

Kaira E.S. da Silva-Leite

Full Text Available Abstract Ximenia americana L., Olacaceae, barks are utilized in folk medicine as analgesic and anti-inflammatory. The objective was to evaluate the toxicity and antinociceptive effect of polysaccharides rich fractions from X. americana barks. The fractions were obtained by extraction with NaOH, followed by precipitation with ethanol and fractionation by ion exchange chromatography. They were administered i.v. or p.o. before nociception tests (writhing, formalin, carragenan-induced hypernociception, hot plate, or during 14 days for toxicity assay. The total polysaccharides fraction (TPL-Xa: 8.1% yield presented 43% carbohydrate (21% uronic acid and resulted in two main fractions after chromatography (FI: 12%, FII: 22% yield. FII showed better homogeneity/purity, content of 44% carbohydrate, including 39% uronic acid, arabinose and galactose as major monosaccharides, and infrared spectra with peaks in carbohydrate range for COO- groups of uronic acid. TPL-Xa (10 mg/kg and FII (0.1 and 1 mg/kg presented inhibitory effect in behavior tests that evaluate nociception induced by chemical and mechanical, but not thermal stimuli. TPL-Xa did not alter parameters of systemic toxicity. In conclusion, polysaccharides rich fractions of X. americana barks inhibit peripheral inflammatory nociception, being well tolerated by animals.

TAL effectors and the executor R genes.

Science.gov (United States)

Zhang, Junli; Yin, Zhongchao; White, Frank

2015-01-01

Transcription activator-like (TAL) effectors are bacterial type III secretion proteins that function as transcription factors in plants during Xanthomonas/plant interactions, conditioning either host susceptibility and/or host resistance. Three types of TAL effector associated resistance (R) genes have been characterized-recessive, dominant non-transcriptional, and dominant TAL effector-dependent transcriptional based resistance. Here, we discuss the last type of R genes, whose functions are dependent on direct TAL effector binding to discrete effector binding elements in the promoters. Only five of the so-called executor R genes have been cloned, and commonalities are not clear. We have placed the protein products in two groups for conceptual purposes. Group 1 consists solely of the protein from pepper, BS3, which is predicted to have catalytic function on the basis of homology to a large conserved protein family. Group 2 consists of BS4C-R, XA27, XA10, and XA23, all of which are relatively short proteins from pepper or rice with multiple potential transmembrane domains. Group 2 members have low sequence similarity to proteins of unknown function in closely related species. Firm predictions await further experimentation on these interesting new members to the R gene repertoire, which have potential broad application in new strategies for disease resistance.

TAL effectors and the executor R genes

Directory of Open Access Journals (Sweden)

Junli eZhang

2015-08-01

Full Text Available Transcription activation-like (TAL effectors are bacterial type III secretion proteins that function as transcription factors in plants during Xanthomonas/plant interactions, conditioning either host susceptibility and/or host resistance. Three types of TAL effector associated resistance (R genes have been characterized - recessive, dominant non-transcriptional and dominant TAL effector-dependent transcriptional based resistance. Here, we discuss the last type of R genes, whose functions are dependent on direct TAL effector binding to discrete effector binding elements in the promoters. Only five of the so-called executor R genes have been cloned, and commonalities are not clear. We have placed the protein products in two groups for conceptual purposes. Group 1 consists solely of the protein from pepper, BS3, which is predicted to have catalytic function on the basis of homology to a large conserved protein family. Group 2 consists of BS4C-R, XA27, XA10, and XA23, all of which are relatively short proteins from pepper or rice with multiple potential transmembrane domains. Group 2 members have low sequence similarity to proteins of unknown function in closely related species. Firm predictions await further experimentation on these interesting new members to the R gene repertoire, which have potential broad application in new strategies for disease resistance.

Russian aluminum-lithium alloys for advanced reusable spacecraft

International Nuclear Information System (INIS)

Charette, Ray O.; Leonard, Bruce G.; Bozich, William F.; Deamer, David A.

1998-01-01

Cryotanks that are cost-affordable, robust, fuel-compatible, and lighter weight than current aluminum design are needed to support next-generation launch system performance and operability goals. The Boeing (McDonnell Douglas Aerospace-MDA) and NASA's Delta Clipper-Experimental Program (DC-XA) flight demonstrator test bed vehicle provided the opportunity for technology transfer of Russia's extensive experience base with weight-efficient, highly weldable aluminum-lithium (Al-Li) alloys for cryogenic tank usage. As part of NASA's overall reusable launch vehicle (RLV) program to help provide technology and operations data for use in advanced RLVs, MDA contracted with the Russian Academy of Sciences (RAS/IMASH) for design, test, and delivery of 1460 Al-Li alloy liquid oxygen (LO 2 ) cryotanks: one for development, one for ground tests, and one for DC-XA flight tests. This paper describes the development of Al-Li 1460 alloy for reusable LO 2 tanks, including alloy composition tailoring, mechanical properties database, forming, welding, chemical milling, dissimilar metal joining, corrosion protection, completed tanks proof, and qualification testing. Mechanical properties of the parent and welded materials exceeded expectations, particularly the fracture toughness, which promise excellent reuse potential. The LO 2 cryotank was successfully demonstrated in DC-XA flight tests

Properties of aqueous nitrate and nitrite from x-ray absorption spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Smith, Jacob W.; Lam, Royce K.; Saykally, Richard J., E-mail: saykally@berkeley.edu [Department of Chemistry, University of California, Berkeley, California 94720 (United States); Chemical Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Shih, Orion [National Synchrotron Radiation Research Center, Hsinchu 30076, Taiwan (China); Rizzuto, Anthony M. [Department of Chemistry, University of California, Berkeley, California 94720 (United States); Prendergast, David [The Molecular Foundry, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)

2015-08-28

Nitrate and nitrite ions are of considerable interest, both for their widespread use in commercial and research contexts and because of their central role in the global nitrogen cycle. The chemistry of atmospheric aerosols, wherein nitrate is abundant, has been found to depend on the interfacial behavior of ionic species. The interfacial behavior of ions is determined largely by their hydration properties; consequently, the study of the hydration and interfacial behavior of nitrate and nitrite comprises a significant field of study. In this work, we describe the study of aqueous solutions of sodium nitrate and nitrite via X-ray absorption spectroscopy (XAS), interpreted in light of first-principles density functional theory electronic structure calculations. Experimental and calculated spectra of the nitrogen K-edge XA spectra of bulk solutions exhibit a large 3.7 eV shift between the XA spectra of nitrate and nitrite resulting from greater stabilization of the nitrogen 1s energy level in nitrate. A similar shift is not observed in the oxygen K-edge XA spectra of NO{sub 3}{sup −} and NO{sub 2}{sup −}. The hydration properties of nitrate and nitrite are found to be similar, with both anions exhibiting a similar propensity towards ion pairing.

Hartree-fock-slater method for materials science the DV-X alpha method for design and characterization of materials

CERN Document Server

Adachi, H; Kawai, J

2006-01-01

Molecular-orbital calculations for materials design such as alloys, ceramics, and coordination compounds are now possible for experimentalists. Molecuar-orbital calculations for the interpretation of chemical effect of spectra are also possible for experimentalists. The most suitable molecular-orbital calculation method for these purpose is the DV-Xa method, which is robust in such a way that the calculation converges to a result even if the structure of the molecule or solid is impossible in the pressure and temperature ranges on earth. This book specially addresses the methods to design novel materials and to predict the spectralline shape of unknown materials using the DV-Xa molecular-orbital method, but is also useful for those who want to calculate electronic structures of materials using any kind of method.

76 FR 59064 - Fisheries of the Exclusive Economic Zone Off Alaska; Shallow-Water Species by Vessels Using Trawl...

Science.gov (United States)

2011-09-23

.... 101126522-0640-02] RIN 0648-XA722 Fisheries of the Exclusive Economic Zone Off Alaska; Shallow- Water... closure. SUMMARY: NMFS is opening directed fishing for shallow-water species by [[Page 59065

Evaluation of water stress and groundwater storage using a global hydrological model

Science.gov (United States)

Shiojiri, D.; Tanaka, K.; Tanaka, S.

2017-12-01

United Nations reported the number of people will reach 9.7 billion in 2050, and this rapid growth of population will increase water use. To prevent global water shortage, it is important to identify the problematic areas in order to maintain water resources sustainability. Moreover, groundwater availability is decreasing in some areas due to excessive groundwater extraction compared to the groundwater recharge capacity. The development of a hydrological model that can simulate the current status of the world's water resources represents an important tool to achieve sustainable water resources management. In this study, a global hydrological simulation is conducted at a 20km spatial resolution using the land surface model SiBUC, which is coupled to the river routing model HydroBEAM. In the river routing model, we evaluate water stress by comparing the excess of water demand with the river water demand. Areas with high water stress are seen in United States, India, and east part of China; however, for the case of Africa the overall water stress is zero. This could be because rain-fed agriculture is the norm in Africa and thus irrigation water demand is low, which affects water stress index. Sustainability of groundwater resources is also evaluated in the river routing model by setting a virtual groundwater tank. When the amount of groundwater withdrawal constantly exceeds groundwater recharge, the volume in the tank falls below zero and the area is regarded as unsustainable in terms of groundwater usage. Such areas are mostly seen in central United States, northeast China, the region between northwest India and Pakistan. In the simulation with SiBUC, the amount of groundwater recharge is assumed as the proportion of water that flows from the second to the third soil layer. This proportion will be estimated by comparing monthly variations of terrestrial water storage (TWS) derived from the observations of the GRACE satellite with the simulated TWS variations. From

[Juvenile myasthenia gravis in sub-Saharan Africa: a case study of two consanguine sisters born from consanguinity in Togo].

Science.gov (United States)

Maneh, Nidain; Apetse, Kossivi; Diatewa, Bénédicte Marèbe; Domingo, Sidik Abou-Bakr; Agba, Aidé Isabelle; Ayena, Koffi Didier; Balogou, Koffi Agnon; Balo, Komi Patrice

2017-01-01

Myasthenia gravis is a rare acquired autoimmune pathology causing neuromuscular transmission impairment. Juvenile onset of myasthenia gravis is often characterized by ocular involvement. We report two cases of ocular juvenile myasthenia gravis (JMG) in two siblings. They were two young girls, XA and XB, aged 11 and 9 years, of Malian origin, residing in Togo, born from first-degree of consanguinity presenting to Ophthalmology due to progressive decrease in visual acuity. XA showed visual acuity 8/10 on both eyes while XB showed improvement in visual acuity from 3/10 to 7/10 using a pinhole occluder, suggesting ametropia. XA had a 2-year history of bilateral ptosis lifting the upper eyelid of 7 mm, while XB had a 3-year history of bilateral ptosis with no lifting of the upper eyelid. Ice pack test was strongly positive in both patients. They had Cogan's lid twitch with paresis of the oculomotor nerve without diplopia. The dosage of acetylcholine receptor autoantibodies was normal. The diagnosis of JMG associated with ametropia was suspected. Ametropia was corrected by glasses and a specific treatment with pyridostigmine was initiated, but both patients were lost to follow-up. Autoimmune myasthenia gravis with inaugural ophthalmologic manifestation is rare but it can occur among children living in sub-Saharan Africa. Studies should be conducted to establish the features of this disease.

Coutilization of D-Glucose, D-Xylose, and L-Arabinose in Saccharomyces cerevisiae by Coexpressing the Metabolic Pathways and Evolutionary Engineering

Directory of Open Access Journals (Sweden)

Chengqiang Wang

2017-01-01

Full Text Available Efficient and cost-effective fuel ethanol production from lignocellulosic materials requires simultaneous cofermentation of all hydrolyzed sugars, mainly including D-glucose, D-xylose, and L-arabinose. Saccharomyces cerevisiae is a traditional D-glucose fermenting strain and could utilize D-xylose and L-arabinose after introducing the initial metabolic pathways. The efficiency and simultaneous coutilization of the two pentoses and D-glucose for ethanol production in S. cerevisiae still need to be optimized. Previously, we constructed an L-arabinose-utilizing S. cerevisiae BSW3AP. In this study, we further introduced the XI and XR-XDH metabolic pathways of D-xylose into BSW3AP to obtain D-glucose, D-xylose, and L-arabinose cofermenting strain. Benefits of evolutionary engineering: the resulting strain BSW4XA3 displayed a simultaneous coutilization of D-xylose and L-arabinose with similar consumption rates, and the D-glucose metabolic capacity was not decreased. After 120 h of fermentation on mixed D-glucose, D-xylose, and L-arabinose, BSW4XA3 consumed 24% more amounts of pentoses and the ethanol yield of mixed sugars was increased by 30% than that of BSW3AP. The resulting strain BSW4XA3 was a useful chassis for further enhancing the coutilization efficiency of mixed sugars for bioethanol production.

Apixaban

Science.gov (United States)

... medications called factor Xa inhibitors. It works by blocking the action of a certain natural substance that ... rash chest pain or tightness swelling of the face or tongue trouble breathing wheezing feeling dizzy or ...

Tribimaximal neutrino mixing from A4 replication

International Nuclear Information System (INIS)

Carone, Christopher D.; Lebed, Richard F.

2011-01-01

Motivated by dimensional deconstruction, we propose a model of tribimaximal neutrino mixing based on A 4 xA 4 symmetry. In this model, the two triplet symmetry-breaking fields of conventional A 4 models are taken to transform under different A 4 group factors, but are not distinguished by any other quantum numbers. An additional bi-triplet flavor field breaks A 4 xA 4 to its diagonal subgroup. If the bi-triplet transforms under an additional Z 3 symmetry, we show that one can construct a general, renormalizable superpotential that yields the desired pattern of symmetry breaking. We identify the features that this model has in common with a deconstructed 5D theory in which A 4 is a subgroup of a continuous gauged flavor symmetry in the bulk.

Swift BAT Thermal Recovery After Loop Heat Pipe #0 Secondary Heater Controller Failure in October 2015

Science.gov (United States)

Choi, Michael K.

2016-01-01

The Swift BAT LHP #0 primary heater controller failed on March 31, 2010. It has been disabled. On October 31, 2015, the secondary heater controller of this LHP failed. On November 1, 2015, the LHP #0 CC temperature increased to as 18.6 C, despite that the secondary heater controller set point was 8.8 C. It caused the average DM XA1 temperature to increase to 25.9 C, which was 5 C warmer than nominal. As a result, the detectors became noisy. To solve this problem, the LHP #1 secondary heater controller set point was decreased in 0.5 C decrements to 2.2 C. The set-point decrease restored the average DM XA1 temperature to a nominal value of 19.7 C on November 21.

Dgroup: DG01195 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available man serum albumin (JP17) ... D02796 ... Albumin iodinated I 131 serum (USAN) ... ATC code: V09XA03 Radioactive diagnostic... agents for Cardiovascular system, Radioactive diagnostic agents for blood volume determination ...

Employed Mothers: Combining Work and Parenthood = Nguoi Me Giua Hai Trong Trach: Gia Dinh Va Nghe Nghiep.

Science.gov (United States)

Cudaback, Dorothea; Sagert, Janis

This bilingual booklet is intended to help female Vietnamese refugees learn to combine the tasks of work and motherhood. Included in the booklet are Vietnamese and English translations of a discussion of the effects of a working mother on her family, suggestions for employed mothers, and guidelines for learning about and selecting from available…

Drug: D10849 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available D10849 Mixture ... Drug Methoxy polyethylene glycol - epoetin beta mixt; Mircera (TN...) Polyethylene glycol monomethyl ester [DR:D05554], Epoetin beta [DR:D03232] ... ATC code: B03XA03 ... PubChem: 319902649 ...

Trial design: Rivaroxaban for the prevention of major cardiovascular events after transcatheter aortic valve replacement: Rationale and design of the GALILEO study

NARCIS (Netherlands)

Windecker, Stephan; Tijssen, Jan; Giustino, Gennaro; Guimarães, Ana H. C.; Mehran, Roxana; Valgimigli, Marco; Vranckx, Pascal; Welsh, Robert C.; Baber, Usman; van Es, Gerrit-Anne; Wildgoose, Peter; Volkl, Albert A.; Zazula, Ana; Thomitzek, Karen; Hemmrich, Melanie; Dangas, George D.

2017-01-01

Optimal antithrombotic treatment after transcatheter aortic valve replacement (TAVR) is unknown and determined empirically. The direct factor Xa inhibitor rivaroxaban may potentially reduce TAVR-related thrombotic complications and premature valve failure. GALILEO is an international, randomized,

Comparison of transgenic plant production for bacterial blight ...

African Journals Online (AJOL)

USER

2010-03-29

Mar 29, 2010 ... DR - 82 with calli exposed to 300 µM acetosyringone for 2 min. ... provided by the Xa 21 gene. Key words: Transformation efficiency, selection, regeneration, resistance evaluation. ...... Shrawat AK, Becker D, Lorz H (2006).

Inhibition of PAI-1 release from human endothelial cells by Angelica keiskei Koidzumi (Ashitaba chalcones is structure-dependent

Directory of Open Access Journals (Sweden)

Naoki Ohkura

2015-12-01

Full Text Available Angelica keiskei Koidzumi (Ashitaba is a traditional herbal medicine and it is also regarded in Japan as a health food that might have antithrombotic properties. Ashitaba exudate suppresses lipopolysaccharide (LPS-induced plasma plasminogen activator inhibitor 1 (PAI-1, a risk factor for thrombotic diseases in mice. Xanthoangelol (XA and 4-hydroxyderricin (4-HD comprise > 95% of total chalcones from Ashitaba exudates that also contain trace amounts of other chalcone subtypes. The present study aimed to determine the effects of Ashitaba chalcones including xanthoangelols B (XB, D (XD, E (XE, F (XF and XA as well as 4-HD on PAI-1 levels in the medium of stimulated human EA.hy926 endothelial cells. Xanthoangelol (10 and #61549;M inhibited PAI-1 production at a rate of 77.1%, whereas the inhibition rates of XB, XD, XE and 4-HD were not significant. Xanthoangelol F was highly cytotoxic and thus its ability to inhibit PAI-1 production could not be evaluated. The side hydrocarbon chain of XA played an important role in the excretion of inhibitory activity. Small modifications of the hydrocarbon chain or small functional groups on the A ring measurably influenced the inhibitory activity of xanthoangelols. These findings warrant future research towards an understanding of the mechanism of antithrombotic action of Ashitaba as herbal medicine or antithrombotic health food. [J Intercult Ethnopharmacol 2015; 4(4.000: 355-357

Thrombin induces epithelial-mesenchymal transition and collagen production by retinal pigment epithelial cells via autocrine PDGF-receptor signaling.

Science.gov (United States)

Bastiaans, Jeroen; van Meurs, Jan C; van Holten-Neelen, Conny; Nagtzaam, Nicole M A; van Hagen, P Martin; Chambers, Rachel C; Hooijkaas, Herbert; Dik, Willem A

2013-12-19

De-differentiation of RPE cells into mesenchymal cells (epithelial-mesenchymal transition; EMT) and associated collagen production contributes to development of proliferative vitreoretinopathy (PVR). In patients with PVR, intraocular coagulation cascade activation occurs and may play an important initiating role. Therefore, we examined the effect of the coagulation proteins factor Xa and thrombin on EMT and collagen production by RPE cells. Retinal pigment epithelial cells were stimulated with factor Xa or thrombin and the effect on zonula occludens (ZO)-1, α-smooth muscle actin (α-SMA), collagen, and platelet-derived growth factor (PDGF)-B were determined by real-time quantitative-polymerase chain reaction (RQ-PCR), immunofluorescence microscopy, and HPLC and ELISA for collagen and PDGF-BB in culture supernatants, respectively. PDGF-receptor activation was determined by phosphorylation analysis and inhibition studies using the PDGF-receptor tyrosine kinase inhibitor AG1296. Thrombin reduced ZO-1 gene expression (P production of α-SMA and collagen increased. In contrast to thrombin, factor Xa hardly stimulated EMT by RPE. Thrombin clearly induced PDGF-BB production and PDGF-Rβ chain phosphorylation in RPE. Moreover, AG1296 significantly blocked the effect of thrombin on EMT and collagen production. Our findings demonstrate that thrombin is a potent inducer of EMT by RPE via autocrine activation of PDGF-receptor signaling. Coagulation cascade-induced EMT of RPE may thus contribute to the formation of fibrotic retinal membranes in PVR and should be considered as treatment target in PVR.

Monitoring of unfractionated heparin with rotational thrombelastometry using the prothrombinase-induced clotting time reagent (PiCT®).

Science.gov (United States)

Schaden, E; Jilch, S; Hacker, S; Schober, A; Kozek-Langenecker, S

2012-12-24

To achieve sufficient and safe anticoagulation with unfractionated heparin (UFH) a close and reliable drug monitoring is necessary. In general, the activated partial thromboplastin time (APTT) is used for this purpose. In acute phase response, however, the APTT test procedure might be unreliable e.g. with false low results in the presence of elevated factor VIII. In this so called heparin resistance, measurement of anti-Xa activity is recommended over APTT to avoid potentially harmful dose escalation. A combination of anti-Xa measurement and global hemostatic testing with ROTEM® employing the anti-Xa sensitive PiCT® reagent showed high correlation with enoxaparin levels. This test modification could also be suitable for monitoring UFH. Aim of the study was to evaluate the correlation between PiCT®-ROTEM® and levels of UFH. In this in-vitro study blood samples from healthy volunteers were spiked with UFH and subjected to different ROTEM® tests. There was a linear correlation between UFH level and clotting time (CT) in the PiCT®-ROTEM® test with an excellent correlation coefficient of 0.92. Additional endpoints showed similar results (PiCT®-ROTEM® MaxVel r = -0.85 and PiCT®-ROTEM® t_MaxVel r = 0.88). As a point-of-care applicable tool ROTEM® is immediately at hand. If further clinical studies confirm sensitivity in heparin resistance, PiCT®-ROTEM® could permit rapid UFH dose adjustments especially required in critical illness with acute phase response. Copyright © 2012 Elsevier B.V. All rights reserved.

Drug: D08251 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available D08251 Drug Nandrolone laurate; Nandrolone dodecanoate; Laurabolin [veterinary] (T...14AB01 S01XA11 Chemical group: DG00142 ... Estren derivative veterinary medicine NR3C4 (AR) [HSA:367] [KO:K085

76 FR 25308 - Marine Mammals

Science.gov (United States)

2011-05-04

...-XA165 Marine Mammals AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric... Jennifer Burns, Ph.D., University of Alaska Anchorage, Biology Department, 3101 Science Circle, Anchorage, AK, has been issued a permit to conduct [[Page 25309

On the revision of action laws: an algorithmic approach

CSIR Research Space (South Africa)

Varzinczak, JJ

2009-07-01

Full Text Available that buying can be executed whenever the agent has a token. The set of executability laws of a domain is denoted by X . Given a, Ea (resp. Xa) will denote the set of only those effect (resp. executability) laws about a. Action Theories T = S ∪ E ∪ X...(pi ∧ ϕA) → ⊥ then if T |=Kn(pi∧ϕA) → 〈a〉> and S ′, E ′,X 6|=Kn¬(pi∧ϕA) then Xa′:= {(ϕi∧ pi∧ϕA) → 〈a〉> : ϕi → 〈a〉> ∈ Xa} /* preserve executability law in state not removed */ else E ′:= E ′ ∪ {(pi ∧ ϕA) → [a]⊥} T?ϕ:= S ′ ∪ E ′ ∪ X ′ 4.2 Revising a...

76 FR 49735 - Endangered and Threatened Species; Take of Anadromous Fish

Science.gov (United States)

2011-08-11

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA631 Endangered and Threatened Species; Take of Anadromous Fish AGENCY: National Marine Fisheries Service (NMFS.... Therese Conant, Acting Chief, Endangered Species Division, Office of Protected Resources, National Marine...

76 FR 4551 - Hawaii Crustacean Fisheries; 2011 Northwestern Hawaiian Islands Lobster Harvest Guideline

Science.gov (United States)

2011-01-26

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 665 RIN 0648-XA159 Hawaii Crustacean Fisheries; 2011 Northwestern Hawaiian Islands Lobster Harvest Guideline AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric Administration (NOAA), Commerce...

Dgroup: DG00137 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available DG00137 Chemical ... DGroup Calcium chloride ... C08130 ... Calcium chloride anhydrous D02256 ... Calcium... chloride (USP); Calcium chloride hydrate (JP17) ... ATC code: A12AA07 B05XA07 G04BA03 Calcium supplement ...

76 FR 26253 - Marine Fisheries Advisory Committee Meeting

Science.gov (United States)

2011-05-06

...; National Ocean Policy, coastal and marine spatial planning, ocean energy and climate change adaptation... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA412 Marine Fisheries Advisory Committee Meeting AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and...

76 FR 5338 - Endangered and Threatened Species; Take of Anadromous Fish

Science.gov (United States)

2011-01-31

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA183 Endangered and Threatened Species; Take of Anadromous Fish AGENCY: National Marine Fisheries Service (NMFS... regulations (50 CFR parts 222-226) governing listed fish and wildlife permits. [[Page 5339

76 FR 6401 - Endangered and Threatened Species; Take of Anadromous Fish

Science.gov (United States)

2011-02-04

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA110 Endangered and Threatened Species; Take of Anadromous Fish AGENCY: National Marine Fisheries Service (NMFS... and the Washington Department of Fish and Wildlife submitted to NMFS, pursuant to the protective...

76 FR 65700 - Atlantic Highly Migratory Species; Advisory Panel for Atlantic Highly Migratory Species Southeast...

Science.gov (United States)

2011-10-24

.... Virgin Islands and Puerto Rico, and each of the constituent interstate commissions: the Atlantic States... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA776 Atlantic Highly Migratory Species; Advisory Panel for Atlantic Highly Migratory Species Southeast Data, Assessment...

Incisors as digging tools in molerats (Bathyergidae)

African Journals Online (AJOL)

1998-03-26

Xa and Vb) at which the upper and lower incisors (lines a- ..... JARVIS. JU.M., BENNETT. N.C. 1991. Introducing the Alriean mole-rats (family Bathyergidae). In: The biology of the naked mole-rat: 66 - 96. (Eds) Sherman. R. W ..

77 FR 5775 - Caribbean Fishery Management Council; Public Meeting

Science.gov (United States)

2012-02-06

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN: 0648-XA981 Caribbean... Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of public meeting. SUMMARY: The... --Bulletin/Newsletter --Social Network Pages --Streaming of Council Meetings --Other Business The meeting is...

76 FR 9553 - Mid-Atlantic Fishery Management Council; Public Meeting

Science.gov (United States)

2011-02-18

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA226 Mid-Atlantic... Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of public meeting. SUMMARY: The Social and Economic Sub-Committee of the Mid-Atlantic Fishery Management Council's (Council) Scientific...

76 FR 16620 - Mid-Atlantic Fishery Management Council (MAFMC); Meeting

Science.gov (United States)

2011-03-24

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA316 Mid-Atlantic... Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of public meeting. SUMMARY: The Social and Economic Sub-Committee of the Mid-Atlantic Fishery Management Council's (Council) Scientific...

77 FR 1671 - Endangered Species; File No. 16194

Science.gov (United States)

2012-01-11

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA925 Endangered... olivacea), leatherback (Dermochelys coriacea), and unidentified hardshell sea turtles for the purposes of..., leatherback, Kemp's ridley, olive ridley, and unidentified hardshell sea turtles had been submitted by the...

77 FR 8776 - Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2012 Atlantic Bluefish...

Science.gov (United States)

2012-02-15

.... 120201086-2085-01] RIN 0648-XA904 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2012 Atlantic Bluefish Specifications AGENCY: National Marine Fisheries Service (NMFS), National... comments. SUMMARY: NMFS proposes specifications for the 2012 Atlantic bluefish fishery, including an annual...

Edoxaban versus warfarin for the treatment of symptomatic venous thromboembolism

NARCIS (Netherlands)

Büller, Harry R; Décousus, Hervé; Grosso, Michael A; Mercuri, Michele; Middeldorp, Saskia; Prins, Martin H; Raskob, Gary E; Schellong, Sebastian M; Schwocho, Lee; Segers, Annelise; Shi, Minggao; Verhamme, Peter; Wells, Phil; Kamphuisen, P.W.

2013-01-01

BACKGROUND: Whether the oral factor Xa inhibitor edoxaban can be an alternative to warfarin in patients with venous thromboembolism is unclear. METHODS: In a randomized, double-blind, noninferiority study, we randomly assigned patients with acute venous thromboembolism, who had initially received

Estudo parcial da validação do Atlas do Rorschach Sistema Compreensivo em amostra de pacientes psiquiátricos de São Paulo Estudio parcial de la validación del Atlas del Rorschach Sistema Comprensivo en muestra de pacientes psiquiátricos de São Paulo Partial validation study of the Rorschach Comprehensive System atlas on a sample of psychiatric patients of São Paulo

Directory of Open Access Journals (Sweden)

Thaís Cristina Marques

2012-12-01

Full Text Available Este trabalho é parte do estudo de validação do atlas de localização e da lista de qualidade formal brasileiros do Rorschach Sistema Compreensivo em amostra de pacientes psiquiátricos da cidade de São Paulo, comparando as variáveis X+%, XA%, WDA%, X-% e Xu% dos pacientes com os valores encontrados na amostra normativa brasileira. Foram avaliados 45 pacientes, e os instrumentos de seleção foram a entrevista clínica estruturada para diagnóstico do DSM-IV (SCID-I e a Escala das Síndromes Positiva e Negativa (PANSS. 23 pacientes preencheram critério pela SCID-I para transtornos psicóticos e, destes, 19 foram considerados psicóticos pela PANSS. Todos os protocolos foram classificados segundo as classificações norte-americanas e brasileiras. Foi realizada ANOVA, comparando amostras normativas e o grupo de pacientes. As variáveis XA% e X-% mostraram-se sensíveis para detectar as nuances perceptivas entre as pessoas. As áreas de localização e lista de qualidade formal brasileiras se mostraram válidas para discriminar graus de comprometimento perceptivo.Este trabajo es parte del estudio de validación del atlas de localización y de la lista de calidad formal brasileña del Rorschach Sistema Comprensivo en muestra de pacientes psiquiátricos de la ciudad de São Paulo-Brasil, comparando las variables X+%, XA%, WDA%, X-% y Xu% de los pacientes con los valores encontrados en la muestra normativa brasileña. Fueron evaluados 45 pacientes, los instrumentos de selección fueron la Entrevista clínica estructurada para diagnóstico del DSM-IV (SCID-I y la Escala de las Síndromes Positiva y Negativa (PANSS. 23 pacientes lograron criterio por la SCID-I para trastornos psicóticos y de estos 19 fueron considerados psicóticos por la PANSS. Todos los protocolos fueron clasificados según las clasificaciones norteamericanas y brasileñas. Fue realizada ANOVA, comparando muestras normativas y el grupo de pacientes. Las variables XA% y X-% se

Radionuclides concentration in marine environmental samples along the coast of Vietnam

International Nuclear Information System (INIS)

Nguyen Trong Ngo; Nguyen Thanh Binh; Nguyen Van Phuc; Le Nhu Sieu; Truong Y; Mai Thi Huong; Nguyen Thi Linh; Nguyen Mong Sinh; Phan Son Hai; Le Ngoc Chung; Dang Duc Nhan; Nguyen Quang Long; Nguyen Hao Quang; Tran Tuyet Mai

2009-01-01

Studies on radioactivity inventories in environmental samples are necessary as they will serve as baseline data for assessing any environmental impact usage of nuclear-based activities. Approximately 700 data on 238 U, 232 Th, 226 Ra, 90 Sr, 137 Cs, 239,240 Pu activity concentrations in 150 samples i.e. sea water, sediment, fish, mollusc, crustaceans, oyster and weeds samples collected from 7 various locations in Vietnam (Hai Phong, Nghe An, Khanh Hoa, Ninh Thuan, Binh Thuan, Vung Tau, Tien Giang) throughout 1999-2008 are summarised and presented in this paper. Generally, the levels of artificial radionuclides in the studied marine environmental samples are lower as compared to other Asia-Pacific countries while naturally occurred radionuclides activity concentrations obtained were found to be in accordance with respective data from other studies within Pacific region. The radionuclides bioaccumulation factors studied in Red laver and oyster were mostly found to be high; therefore, further reinvestigation should be done for these biota that will be used as bio-fingerprint indicators in monitoring the marine environment from nuclear-based pollutions. The data set obtained from this study is available to the Asia-Pacific Marine Radioactivity Database. (author)

Chirality of weakly bound complexes: The potential energy surfaces for the hydrogen-peroxide−noble-gas interactions

Energy Technology Data Exchange (ETDEWEB)

Roncaratti, L. F., E-mail: lz@fis.unb.br; Leal, L. A.; Silva, G. M. de [Instituto de Física, Universidade de Brasília, 70910 Brasília (Brazil); Pirani, F. [Dipartimento di Chimica, Biologia e Biotecnologie, Università di Perugia, 06123 Perugia (Italy); Aquilanti, V. [Dipartimento di Chimica, Biologia e Biotecnologie, Università di Perugia, 06123 Perugia (Italy); Instituto de Física, Universidade Federal da Bahia, 40210 Salvador (Brazil); Gargano, R. [Instituto de Física, Universidade de Brasília, 70910 Brasília (Brazil); Departments of Chemistry and Physics, University of Florida, Quantum Theory Project, Gainesville, Florida 32611 (United States)

2014-10-07

We consider the analytical representation of the potential energy surfaces of relevance for the intermolecular dynamics of weakly bound complexes of chiral molecules. In this paper we study the H{sub 2}O{sub 2}−Ng (Ng=He, Ne, Ar, Kr, and Xe) systems providing the radial and the angular dependence of the potential energy surface on the relative position of the Ng atom. We accomplish this by introducing an analytical representation which is able to fit the ab initio energies of these complexes in a wide range of geometries. Our analysis sheds light on the role that the enantiomeric forms and the symmetry of the H{sub 2}O{sub 2} molecule play on the resulting barriers and equilibrium geometries. The proposed theoretical framework is useful to study the dynamics of the H{sub 2}O{sub 2} molecule, or other systems involving O–O and S–S bonds, interacting by non-covalent forces with atoms or molecules and to understand how the relative orientation of the O–H bonds changes along collisional events that may lead to a hydrogen bond formation or even to selectivity in chemical reactions.

Identification of Bacterial Plant Pathogens Using Multilocus Polymerase Chain Reaction/Electrospray Ionization-Mass Spectrometry

Science.gov (United States)

2008-01-01

pathogens also have been detected and identified by numerous nucleic acid-based techniques, including Southern blot hybridization and direct nucleotide...Xanthomonas axonopodis pv. vitians FB-1309; ATCC19320 Lettuce ; USA 1 Xanthomonas axonopodis sp. alfalfae XA129; Med. 2 Alfalfa; Sudan 1 Xanthomonas

76 FR 5339 - Endangered and Threatened Species; Take of Anadromous Fish

Science.gov (United States)

2011-01-31

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA182 Endangered and Threatened Species; Take of Anadromous Fish AGENCY: National Marine Fisheries Service (NMFS... are issued in accordance with and are subject to the ESA and NMFS regulations governing listed fish...

78 FR 36550 - Proposed Data Collections Submitted for Public Comment and Recommendations

Science.gov (United States)

2013-06-18

... barriers to program implementation, solutions to those barriers, and documentation of client health... DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Disease Control and Prevention [60Day-13-13XA... prescription filling patterns and timing of refills, checking for medication interactions, patient education...

76 FR 56742 - Mid-Atlantic Fishery Management Council; Workshop

Science.gov (United States)

2011-09-14

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA700 Mid-Atlantic... and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of a workshop. SUMMARY: The Eight..., economic and social perspectives. DATES: The workshop will be held Tuesday, October 4 through Thursday...

76 FR 71939 - New England Fishery Management Council; Public Meeting

Science.gov (United States)

2011-11-21

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA837 New England... Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice; public meeting. SUMMARY: The New... Scientific and Statistical Committee (SSC) will discuss the 2012 SSC calendar and tasks, social science...

77 FR 2961 - Mid-Atlantic Fishery Management Council (MAFMC); Public Meeting

Science.gov (United States)

2012-01-20

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA943 Mid-Atlantic...), National Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notice of a public meeting... with the Council's Social and Economic Sub-committee of the Scientific and Statistical Committee (SSC...

New oral anticoagulant-induced bleeding: clinical presentation and management

NARCIS (Netherlands)

Levy, Jerrold H.; Levi, Marcel

2014-01-01

Bleeding is a significant complication of anticoagulant therapy. With the emergence of new oral anticoagulants (NOACs; ie, direct factor IIa or Xa inhibitors), this risk is further compounded by the lack of validated reversal strategies for these agents. Emerging postmarketing evidence suggests that

76 FR 78242 - Endangered and Threatened Species; Take of Anadromous Fish

Science.gov (United States)

2011-12-16

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA866 Endangered and Threatened Species; Take of Anadromous Fish AGENCY: National Marine Fisheries Service (NMFS... Endangered Species Act (ESA) and to help guide management and conservation efforts. The application may be...

75 FR 71670 - Endangered Species; File No. 15606

Science.gov (United States)

2010-11-24

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA054 Endangered... (Lepidochelys kempii), loggerhead (Caretta caretta), and hawksbill (Eretmochelys imbricata) sea turtles for... INFORMATION: The subject permit is requested under the authority of the Endangered Species Act of 1973, as...

76 FR 22877 - Endangered Species; File No. 15566

Science.gov (United States)

2011-04-25

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA387 Endangered...), leatherback (Dermochelys coriacea), and hawksbill (Eretmochelys imbricata) sea turtles for purposes of... Federal Register (75 FR 67682) that a request for a scientific research permit to take sea turtles had...

76 FR 33245 - Endangered Species; File No. 15135

Science.gov (United States)

2011-06-08

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA466 Endangered..., 132 Conch Court, Emerald Isle, NC 28594, has been issued a permit to take threatened and endangered sea turtles for purposes scientific research. ADDRESSES: The permit and related documents are...

76 FR 20324 - Endangered Species; File No. 15606

Science.gov (United States)

2011-04-12

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA354 Endangered...), loggerhead (Caretta caretta), and hawksbill (Eretmochelys imbricata) sea turtles for purposes of scientific..., loggerhead, and hawksbill sea turtles had been submitted by the above-named individual. The requested permit...

77 FR 25100 - Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2012 Atlantic Bluefish...

Science.gov (United States)

2012-04-27

.... 120201086-2418-02] RIN 0648-XA904 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2012 Atlantic Bluefish Specifications AGENCY: National Marine Fisheries Service (NMFS), National... specifications for the 2012 Atlantic bluefish fishery, including an annual catch limit, total allowable landings...

Protein C inhibitor acts as a procoagulant by inhibiting the thrombomodulin-induced activation of protein C in human plasma

NARCIS (Netherlands)

Elisen, M. G.; von dem Borne, P. A.; Bouma, B. N.; Meijers, J. C.

1998-01-01

Protein C inhibitor (PCI), which was originally identified as an inhibitor of activated protein C, also efficiently inhibits coagulation factors such as factor Xa and thrombin. Recently it was found, using purified proteins, that the anticoagulant thrombin-thrombomodulin complex was also inhibited

Universal, class-specific and drug-specific reversal agents for the new oral anticoagulants.

Science.gov (United States)

Ansell, Jack E

2016-02-01

Although there is controversy about the absolute need for a reversal agent for the new direct oral anticoagulants (DOACs), the absence of such an agent is a barrier to more widespread use of these agents. For the management of major life-threatening bleeding with the DOACs, most authorities recommend the use of four factor prothrombin complex concentrates, although the evidence to support their use in terms of improving outcomes is meager. At the present time, there are three antidotes in development and poised to enter the market. Idarucizumab is a drug-specific antidote targeted to reverse the direct thrombin inhibitor, dabigatran. Andexanet alfa is a class-specific antidote targeted to reverse the oral direct factor Xa inhibitors as well as the indirect inhibitor, enoxaparin. Ciraparantag is a universal antidote targeted to reverse the direct thrombin and factor Xa inhibitors as well as the indirect inhibitor, enoxaparin.

Long-term outcome of FFR-guided PCI for stable coronary artery disease in daily clinical practice

DEFF Research Database (Denmark)

De Backer, Ole; Biasco, Luigi; Lønborg, Jacob

2016-01-01

AIMS: Our aim was to investigate the strength of fractional flow reserve (FFR)-guided percutaneous coronary intervention (PCI) for stable coronary artery disease (CAD) in daily practice. METHODS AND RESULTS: For this study, 3,512 patients with stable CAD and at least one 50-89% coronary stenosis...... were identified; those patients thought to require PCI (n=1,716) were selected. Of these, 962 (56%) were treated based on angiography (XA) alone, whereas 754 patients (44%) had an FFR-guided treatment. In the latter group, 321 patients (43%) were reallocated to another treatment, predominantly medical...... treatment. After propensity score matching, the number of indicated lesions was 957 in the XA-guided group and 947 in the FFR-guided group. FFR guidance resulted in PCI deferral in 462 lesions (48.8%). In a seven-day landmark analysis, the rate of periprocedural myocardial infarction (MI) was less than half...

76 FR 41764 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Coral and Coral Reefs off the...

Science.gov (United States)

2011-07-15

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration [RIN 0648-XA491] Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Coral and Coral Reefs off the Southern Atlantic... sanctuaries, special management zones, or artificial reefs without additional authorization. A report on the...

77 FR 2037 - Marine Mammals; Photography Permit File No. 17032

Science.gov (United States)

2012-01-13

... filmmaker hopes to document the behavior of marine animals in the presence of a gray whale carcass. Filming... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA929 Marine Mammals; Photography Permit File No. 17032 AGENCY: National Marine Fisheries Service (NMFS), National...

77 FR 24470 - Marine Mammals; Photography Permit File No. 17032

Science.gov (United States)

2012-04-24

... behavior of marine animals in the presence of a gray whale carcass. Filming will occur between April and... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA929 Marine Mammals; Photography Permit File No. 17032 AGENCY: National Marine Fisheries Service (NMFS), National...

77 FR 2037 - Endangered and Threatened Species; Take of Anadromous Fish

Science.gov (United States)

2012-01-13

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA928 Endangered and Threatened Species; Take of Anadromous Fish AGENCY: National Marine Fisheries Service (NMFS... advises the public that a direct take permit has been issued to the Washington Department of Fish and...

Apixaban versus enoxaparin for thromboprophylaxis after knee replacement (ADVANCE-2): a randomised double-blind trial

DEFF Research Database (Denmark)

Lassen, Michael Rud; Raskob, Gary E; Gallus, Alexander

2010-01-01

BACKGROUND: Low-molecular-weight heparins such as enoxaparin are preferred for prevention of venous thromboembolism after major joint replacement. Apixaban, an orally active factor Xa inhibitor, might be as effective, have lower bleeding risk, and be easier to use than is enoxaparin. We assessed ...

76 FR 53343 - Atlantic Highly Migratory Species; Commercial Porbeagle Shark Fishery Closure

Science.gov (United States)

2011-08-26

...-XA658 Atlantic Highly Migratory Species; Commercial Porbeagle Shark Fishery Closure AGENCY: National...: Temporary rule; fishery closure. SUMMARY: NMFS is closing the commercial fishery for porbeagle sharks. This... available quota. DATES: The commercial porbeagle shark fishery is closed effective 11:30 p.m. local time...

75 FR 74004 - Atlantic Highly Migratory Species; Advisory Panel

Science.gov (United States)

2010-11-30

... Atlantic Regional Fishery Management Councils, each of the 18 constituent states, both the U.S. Virgin... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA059 Atlantic... nominations for the Advisory Panel (AP) for Atlantic Highly Migratory Species (HMS) Southeast Data, Assessment...

76 FR 57958 - Fisheries of the South Atlantic and Gulf of Mexico; South Atlantic Fishery Management Council...

Science.gov (United States)

2011-09-19

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN: 0648-XA708 Fisheries...), Commerce. ACTION: Notice of public meetings. SUMMARY: The South Atlantic Fishery Management Council (SAFMC...-pane reviews social and economic information and reports its findings to the SSC. The SEP will discuss...

76 FR 61284 - Accountability Measures and Reduced Season for the South Atlantic Recreational Sector of Golden...

Science.gov (United States)

2011-10-04

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 622 [Docket No. 0907271173-0629-03] RIN 0648-XA701 Accountability Measures and Reduced Season for the South Atlantic.... SUMMARY: NMFS implements accountability measures (AMs) for the recreational sector of golden tilefish in...

Edoxaban versus warfarin in patients with atrial fibrillation

NARCIS (Netherlands)

Giugliano, R.P.; Ruff, C.T.; Braunwald, E.; Murphy, S.A.; Wiviott, S.D.; Halperin, J.L.; Waldo, A.L.; Ezekowitz, M.D.; Weitz, J.I.; Spinar, J.; Ruzyllo, W.; Ruda, M.; Koretsune, Y.; Betcher, J.; Shi, M.; Grip, L.T.; Patel, S.P.; Patel, I.; Hanyok, J.J.; Mercuri, M.; Antman, E.M.; Verheugt, F.W.A.; et al.,

2013-01-01

BACKGROUND: Edoxaban is a direct oral factor Xa inhibitor with proven antithrombotic effects. The long-term efficacy and safety of edoxaban as compared with warfarin in patients with atrial fibrillation is not known. METHODS: We conducted a randomized, double-blind, double-dummy trial comparing two

Edoxaban versus Warfarin in Patients with Atrial Fibrillation

NARCIS (Netherlands)

Giugliano, Robert P.; Ruff, Christian T.; Braunwald, Eugene; Murphy, Sabina A.; Wiviott, Stephen D.; Halperin, Jonathan L.; Waldo, Albert L.; Ezekowitz, Michael D.; Weitz, Jeffrey I.; Špinar, Jindřich; Ruzyllo, Witold; Ruda, Mikhail; Koretsune, Yukihiro; Betcher, Joshua; Shi, Minggao; Grip, Laura T.; Patel, Shirali P.; Patel, Indravadan; Hanyok, James J.; Mercuri, Michele; Antman, Elliott M.; Braunwald, E.; Antman, E. M.; Giugliano, R. P.; Ruff, C. T.; Morin, S. E.; Hoffman, E. B.; Murphy, S. A.; Deenadayalu, N.; Grip, L.; Mercuri, M.; Lanz, H.; Patel, I.; Curt, V.; Duggal, A.; Hanyok, J.; Davé, J.; Morgan, D.; Choi, Y.; Shi, M.; Jin, J.; Xie, J.; Crerand, W.; Kappelhof, J.; Maxwell, W.; Zhang, X.; Zhang, Z.; de Groot, J. [=Joris R.; de Vos, R.; Hoekstra, J.

2013-01-01

BackgroundEdoxaban is a direct oral factor Xa inhibitor with proven antithrombotic effects. The long-term efficacy and safety of edoxaban as compared with warfarin in patients with atrial fibrillation is not known. MethodsWe conducted a randomized, double-blind, double-dummy trial comparing two

77 FR 24686 - Endangered Species; File No. 15634

Science.gov (United States)

2012-04-25

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA714 Endangered... Ballance, Ph.D.] has been issued a permit to take leatherback sea turtles (Dermochelys coriacea) for... permit to take leatherback sea turtles had been submitted by the above-named organization. The requested...

77 FR 1062 - Endangered Species; File No. 16146

Science.gov (United States)

2012-01-09

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA900 Endangered... (Eretmochelys imbricata) sea turtles for the purposes of scientific research. ADDRESSES: The permit and related... take loggerhead, green, and hawksbill sea turtles had been submitted by the above-named individual. The...

76 FR 37327 - Endangered Species; File No. 16253

Science.gov (United States)

2011-06-27

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA518 Endangered... loggerhead (Caretta caretta) sea turtles for scientific research. DATES: Written, telefaxed, or e-mail... INFORMATION: The subject permit is requested under the authority of the Endangered Species Act of 1973, as...

76 FR 19052 - Endangered Species; File No. 14344

Science.gov (United States)

2011-04-06

...-named organization. The requested permit has been issued under the authority of the Endangered Species..., importing, and exporting of endangered and threatened species (50 CFR parts 222-226). The permit authorizes... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA340 Endangered...

76 FR 51945 - Endangered Species; File No. 16548

Science.gov (United States)

2011-08-19

.... SUPPLEMENTARY INFORMATION: The subject permit is requested under the authority of the Endangered Species Act of... exporting of endangered and threatened species (50 CFR parts 222-226). The Springfield Science Museum is... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA648 Endangered...

76 FR 45230 - Endangered Species; File No. 15802

Science.gov (United States)

2011-07-28

... INFORMATION: The subject permit is requested under the authority of the Endangered Species Act of 1973, as... of endangered and threatened species (50 CFR 222-226). The applicant proposes to monitor smalltooth... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA603 Endangered...

77 FR 30261 - Endangered Species; File No. 16306

Science.gov (United States)

2012-05-22

..., importing, and exporting of endangered and threatened species (50 CFR parts 222-226). The Maine Department... to the disadvantage of such endangered or threatened species, and (3) is consistent with the purposes... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA712 Endangered...

Apixaban with antiplatelet therapy after acute coronary syndrome

NARCIS (Netherlands)

Alexander, J.H.; Lopes, R.D.; James, S.; Kilaru, R.; He, Y.; Mohan, P.; Bhatt, D.L.; Goodman, S.; Verheugt, F.W.A.; Flather, M.; Huber, K.; Liaw, D.; Husted, S.E.; Lopez-Sendon, J.; De Caterina, R.; Jansky, P.; Darius, H.; Vinereanu, D.; Cornel, J.H.; Cools, F.; Atar, D.; Leiva-Pons, J.L.; Keltai, M.; Ogawa, H.; Pais, P.; Parkhomenko, A.; Ruzyllo, W.; Diaz, R.; White, H.; Ruda, M.; Geraldes, M.; Lawrence, J.; Harrington, R.A.; Wallentin, L.

2011-01-01

BACKGROUND: Apixaban, an oral, direct factor Xa inhibitor, may reduce the risk of recurrent ischemic events when added to antiplatelet therapy after an acute coronary syndrome. METHODS: We conducted a randomized, double-blind, placebo-controlled clinical trial comparing apixaban, at a dose of 5 mg

77 FR 47356 - North Pacific Fishery Management Council; Essential Fish Habitat Amendments

Science.gov (United States)

2012-08-08

...-XA500 North Pacific Fishery Management Council; Essential Fish Habitat Amendments AGENCY: National... Pacific Fishery Management Council submitted the following essential fish habitat (EFH) amendments to NMFS... Scallop Fishery off Alaska; and Amendment 1 to the FMP for Fish Resources of the Arctic Management Area...

76 FR 18416 - Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries

Science.gov (United States)

2011-04-04

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 635 [Docket No. 100317152-0176-01] RIN 0648-XA327 Atlantic Highly Migratory Species; Atlantic Bluefin Tuna Fisheries AGENCY... ability to attract customers. In addition, recent Large Pelagics Survey estimates indicate that charter...

77 FR 25145 - Marine Mammals; File No. 978-1857

Science.gov (United States)

2012-04-27

... mammals at the Hawaii Institute of Marine Biology through May 31, 2012. The minor amendment (No. 978-1857... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA37 Marine Mammals; File No. 978-1857 AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and...

76 FR 28422 - Marine Mammals; File No. 16053

Science.gov (United States)

2011-05-17

... Paul E. Nachtigall, PhD, Marine Mammal Research Program Hawaii Institute of Marine Biology, P.O. Box... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA384 Marine Mammals; File No. 16053 AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric...

Sex determining signal in Drosophila melanogaster

Indian Academy of Sciences (India)

Administrator

Addition of almost any segment of the X chromosome pro- duced a shift towards ... It is now well established that the X/A signal acts to set the functional state ... tionally related because a defect in one of them can be partly. COMMENTARY ON ...

Oral Rivaroxaban for the Treatment of Symptomatic Pulmonary Embolism

NARCIS (Netherlands)

Büller, Harry R.; Prins, Martin H.; Lensin, Anthonie W. A.; Decousus, Hervé; Jacobson, Barry F.; Minar, Erich; Chlumsky, Jaromir; Verhamme, Peter; Wells, Phil; Agnelli, Giancarlo; Cohen, Alexander; Berkowitz, Scott D.; Bounameaux, Henri; Davidson, Bruce L.; Misselwitz, Frank; Gallus, Alex S.; Raskob, Gary E.; Schellong, Sebastian; Segers, Annelise; Berkowitz, Scott; Gallus, Alexander; Lensing, Anthonie W. A.; Haskell, Lloyd; Raskob, Gary; Bauersachs, Rupert; van Bellen, Bonno; Boda, Zoltán; Borris, Lars; Brenner, Benjamin; Brighton, Tim; Davidson, Bruce; Decousus, Herve; Eriksson, Henry; Jacobson, Barry; Kakkar, Ajay; Kwong, Yok-Lam; Lee, Lai Heng; Meijer, Karina; van der Meer, Jan; Monreal, Manuel; Piovella, Franco; Sandset, Per Morten; Smith, Mark; Tomkowski, Witold; Wang, Yuqi; Brandjes, Dees; Mac Gillavry, Melvin; Otten, Hans-Martin; Carlsson, Anders; Kamphuisen, P.

2012-01-01

BACKGROUND A fixed-dose regimen of rivaroxaban, an oral factor Xa inhibitor, has been shown to be as effective as standard anticoagulant therapy for the treatment of deep-vein thrombosis, without the need for laboratory monitoring. This approach may also simplify the treatment of pulmonary embolism.

Sen char nsory, acteris pequ physi stics o i (Cary coche of Gree ...

African Journals Online (AJOL)

SAM

purchase in. 1), 1% pequ .... xa Postal 66, s II da UFG, .... the exposure of consumers to high risks of contamination by a ... After the addition of the culture, the milk was kept at 42°C in .... and Robinson (1999), who studied the behavior of starter.

African Journal of Biotechnology - Vol 8, No 21 (2009)

African Journals Online (AJOL)

Analyses of karyotypes and comparative physical locations of the resistance gene, Xa-5, between Oryza sativa and Oryza,/i> officinalis · EMAIL FREE FULL .... Phytochemical constituents and effects of aqueous root-bark extract of Ficus sycomorus L. (Moracaea) on muscular relaxation, anaesthetic and sleeping time on ...

77 FR 32572 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Coral and Coral Reefs Off the...

Science.gov (United States)

2012-06-01

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA935 Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Coral and Coral Reefs Off the Southern Atlantic... conditions, various species of reef fish, crabs, and lobsters in Federal waters off South Carolina and North...

76 FR 17434 - Receipt of Application for an Endangered Species Act Incidental Take Permit

Science.gov (United States)

2011-03-29

... Atmospheric Administration RIN 0648-XA020 Receipt of Application for an Endangered Species Act Incidental Take..., the Services) for incidental take permits (ITPs) under the Endangered Species Act of 1973, as amended...) and implementing regulations prohibit the taking of animal species listed as endangered or threatened...

77 FR 35355 - User Fee Schedule for Trade Promotion Services

Science.gov (United States)

2012-06-13

...-XA17 User Fee Schedule for Trade Promotion Services AGENCY: U.S. & Foreign Commercial Service... promotion services under the current fee structure. ITA provides a wide range of trade promotion information... these more intensive trade promotion services. The fee revenue is expected to continue to contribute to...

Apixaban versus warfarin in patients with atrial fibrillation

NARCIS (Netherlands)

Granger, C.B.; Alexander, J.H.; McMurray, J.J.; Lopes, R.D.; Hylek, E.M.; Hanna, M.; Al-Khalidi, H.R.; Ansell, J.; Atar, D.; Avezum, A.; Bahit, M.C.; Diaz, R.; Easton, J.D.; Ezekowitz, J.A.; Flaker, G.; Garcia, D.; Geraldes, M.; Gersh, B.J.; Golitsyn, S.; Goto, S.; Hermosillo, A.G.; Hohnloser, S.H.; Horowitz, J.; Mohan, P.; Jansky, P.; Lewis, B.S.; Lopez-Sendon, J.L.; Pais, P.; Parkhomenko, A.; Verheugt, F.W.A.; Zhu, J.; Wallentin, L.

2011-01-01

BACKGROUND: Vitamin K antagonists are highly effective in preventing stroke in patients with atrial fibrillation but have several limitations. Apixaban is a novel oral direct factor Xa inhibitor that has been shown to reduce the risk of stroke in a similar population in comparison with aspirin.

76 FR 71515 - Endangered Species; File No. 16174

Science.gov (United States)

2011-11-18

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA826 Endangered... issued a permit to take green sea turtles (Chelonia mydas) for the purposes of scientific research... request for a scientific research permit to take green sea turtles had been submitted by the above-named...

75 FR 67682 - Endangered Species; File No. 15566

Science.gov (United States)

2010-11-03

... permit is requested under the authority of the Endangered Species Act of 1973, as amended (ESA; 16 U.S.C... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA013 Endangered Species; File No. 15566 AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric...

75 FR 78974 - Endangered Species

Science.gov (United States)

2010-12-17

...-XA086 Endangered Species AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and... the Endangered Species Act of 1973, as amended (16 U.S.C. 1531 et seq.) and the regulations governing the taking, importing, and exporting of endangered and threatened species (50 CFR 222-226). Permit...

76 FR 40699 - Endangered Species; File No. 16229

Science.gov (United States)

2011-07-11

.... SUPPLEMENTARY INFORMATION: The subject permit is requested under the authority of the Endangered Species Act of... exporting of endangered and threatened species (50 CFR 222-226). The North Carolina Zoo [File No. 16229] is... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA516 Endangered...

75 FR 82295 - Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; Quota Transfer

Science.gov (United States)

2010-12-30

.... 100204079-0199-02] RIN 0648-XA084 Fisheries of the Northeastern United States; Atlantic Bluefish Fishery... the Commonwealth of Virginia is transferring commercial bluefish quota to the State of North Carolina... INFORMATION: Regulations governing the Atlantic bluefish fishery are found at 50 CFR part 648. The regulations...

76 FR 74009 - Fisheries of the Northeastern United States; Bluefish Fishery; Quota Transfer

Science.gov (United States)

2011-11-30

.... 101228634-1149-02] RIN 0648-XA825 Fisheries of the Northeastern United States; Bluefish Fishery; Quota... a portion of its 2011 commercial bluefish quota to New York State. By this action, NMFS adjusts the... Specialist, (978) 281-9224. SUPPLEMENTARY INFORMATION: Regulations governing the bluefish fishery are found...

77 FR 2512 - Marine Mammals

Science.gov (United States)

2012-01-18

...-XA905 Marine Mammals AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric... Dorian Houser, Ph.D., National Marine Mammal Foundation, 2240 Shelter Island Drive, 200, San Diego, CA... subject permit is requested under the authority of the Marine Mammal Protection Act of 1972, as amended...

76 FR 47527 - Retrospective Regulatory Review Under E.O. 13563

Science.gov (United States)

2011-08-05

... DEPARTMENT OF COMMERCE Bureau of Industry and Security 15 CFR Chapter VII [Docket No. 110711380-1379-01] RIN 0694-XA37 Retrospective Regulatory Review Under E.O. 13563 AGENCY: Bureau of Industry and Security, Commerce. ACTION: Notice of inquiry. SUMMARY: The Bureau of Industry and Security (BIS...

77 FR 66564 - North Pacific Fishery Management Council; Essential Fish Habitat Amendments

Science.gov (United States)

2012-11-06

...-XA500 North Pacific Fishery Management Council; Essential Fish Habitat Amendments AGENCY: National... Scallop Fishery off Alaska (Scallop FMP); and Amendment 1 to the FMP for Fish Resources of the Arctic Management Area (Arctic FMP). These amendments update the existing essential fish habitat (EFH) provisions in...

Drug: D01016 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available ne glycerin [DR:D04412], Dental iodine glycerin [DR:D04880], Elemenmic (TN), Iodine...ssified ... DG02017 ... Potassium Same as: C08219 Therapeutic category: 3221 ATC code: R05CA02 S01XA04 V03AB21 ... Component of Compound iodi

76 FR 55276 - Fisheries of the Economic Exclusive Zone Off Alaska; Shallow-Water Species Fishery by Vessels...

Science.gov (United States)

2011-09-07

.... 101126522-0640-02] RIN 0648-XA680 Fisheries of the Economic Exclusive Zone Off Alaska; Shallow- Water...; closure. SUMMARY: NMFS is prohibiting directed fishing for species that comprise the shallow-water species... fourth seasonal apportionment of the Pacific halibut bycatch allowance specified for the shallow-water...

76 FR 39794 - Fisheries of the Economic Exclusive Zone Off Alaska; Shallow-Water Species Fishery by Catcher...

Science.gov (United States)

2011-07-07

.... 101126522-0640-02] RIN 0648-XA539 Fisheries of the Economic Exclusive Zone Off Alaska; Shallow- Water...; closure. SUMMARY: NMFS is prohibiting directed fishing for species that comprise the shallow-water species... species catch (PSC) sideboard limit specified for the shallow-water species fishery for catcher/processors...

System 800xA - a control system for the next generation of power plants; System 800xA - Das Leitsystem der naechsten Kraftwerksgeneration

Energy Technology Data Exchange (ETDEWEB)

Bruns, H. [ABB AG, Mannheim (Germany); Lauxtermann, S. [ABB AG, Minden (Germany)

2006-07-01

The system 800 x A developed by ABB is a power plant control system that is capable of combining the latest technologies in this field with best-practice solutions and integrating the I and C equipment already installed in a plant. System 800 x A offers plant owners a future-oriented integration platform for process control and sub-station control systems on the basis of the new IEC 61850 standard. Through optimised integration and networking of information in combination with direct and context-sensitive information access, decision-taking processes and the analysis of disturbances are speeded up considerably. Consistent data structures, ranging from field data to plant management data, and a simplified system configuration can reliably lower the system operating costs and increase operational reliability for a long time. This consistent technology can integrate turbine automation, unit automation, and all sorts of control functions and thus create single-source automation solutions that are highly harmonised and easy to handle. (orig.)

Methods of etching a substrate

International Nuclear Information System (INIS)

Cosmo, J.J.; Gambino, R.J.; Harper, J.M.E.

1979-01-01

The invention relates to a method of etching a substrate. The substrate is located opposite a target electrode in a vacuum chamber, and the surface of the target electrode is bombarded with energetic particles of atomic dimensions. The target electrode is an intermetallic composition (compound, alloy or finely divided homogeneous mixture) of two metals A and B such that upon bombardment the electrode emits negative ions of metal B which have sufficient energy to produce etching of the substrate. Many target materials are exemplified. Typically the metal A has an electronegativity XA and metal B has an electronegativity XB such that Xb - Xa is greater than about 2.55 electron volts, with the exception of combinations of metals having a fractional ionicity Q less than about 0.314. The source of the energetic particles may be an ionised gas in the vacuum chamber. The apparatus and its mode of operation are described in detail. (U.K.)

Cysteine-dependent immune regulation by TRX and MIF/GIF family proteins.

Science.gov (United States)

Kondo, Norihiko; Ishii, Yasuyuki; Son, Aoi; Sakakura-Nishiyama, Junko; Kwon, Yong-Won; Tanito, Masaki; Nishinaka, Yumiko; Matsuo, Yoshiyuki; Nakayama, Toshinori; Taniguchi, Masaru; Yodoi, Junji

2004-03-29

Thioredoxin (TRX) superfamily proteins that contain a conserved redox-active site -Cys-Xa.a.-Xa.a.-Cys- includes proinflammatory cytokine, macrophage migration inhibiting factor (MIF) and the immune regulatory cytokine, glycosylation inhibiting factor (GIF) in which Cys-60 is cysteinylated. In this report, we have analyzed the functional interaction between TRX and MIF/GIF. The stable Jurkat T cell line transfected with human TRX gene (TRX-transfectant) was highly resistant to hydrogen peroxide-induced apoptosis, but not the cell line transfected with vector (mock-transfectant). The expression level of MIF/GIF protein of TRX-transfectant was lower than that of mock-transfectant. Conversely, the expression level of intracellular TRX protein in CD4(+)-T cells derived from MIF -/- mice were significantly higher than that from background BALB/c mice. These findings collectively suggest that oxidative stress-induced apoptosis on T lymphocytes might be protected by the reciprocal regulation of TRX and MIF/GIF expression.

Purification method for recombinant proteins based on a fusion between the target protein and the C-terminus of calmodulin

Science.gov (United States)

Schauer-Vukasinovic, Vesna; Deo, Sapna K.; Daunert, Sylvia

2002-01-01

Calmodulin (CaM) was used as an affinity tail to facilitate the purification of the green fluorescent protein (GFP), which was used as a model target protein. The protein GFP was fused to the C-terminus of CaM, and a factor Xa cleavage site was introduced between the two proteins. A CaM-GFP fusion protein was expressed in E. coli and purified on a phenothiazine-derivatized silica column. CaM binds to the phenothiazine on the column in a Ca(2+)-dependent fashion and it was, therefore, used as an affinity tail for the purification of GFP. The fusion protein bound to the affinity column was then subjected to a proteolytic digestion with factor Xa. Pure GFP was eluted with a Ca(2+)-containing buffer, while CaM was eluted later with a buffer containing the Ca(2+)-chelating agent EGTA. The purity of the isolated GFP was verified by SDS-PAGE, and the fluorescence properties of the purified GFP were characterized.

Methods of etching a substrate

Energy Technology Data Exchange (ETDEWEB)

Cosmo, J J; Gambino, R J; Harper, J M.E.

1979-05-16

The invention relates to a method of etching a substrate. The substrate is located opposite a target electrode in a vacuum chamber, and the surface of the target electrode is bombarded with energetic particles of atomic dimensions. The target electrode is an intermetallic composition (compound, alloy or finely divided homogeneous mixture) of two metals A and B such that upon bombardment the electrode emits negative ions of metal B which have sufficient energy to produce etching of the substrate. Many target materials are exemplified. Typically the metal A has an electronegativity XA and metal B has an electronegativity XB such that Xb - Xa is greater than about 2.55 electron volts, with the exception of combinations of metals having a fractional ionicity Q less than about 0.314. The source of the energetic particles may be an ionised gas in the vacuum chamber. The apparatus and its mode of operation are described in detail.

Low-molecular-weight heparins: pharmacologic profile and product differentiation.

Science.gov (United States)

Fareed, J; Jeske, W; Hoppensteadt, D; Clarizio, R; Walenga, J M

1998-09-10

The interchangeability of low-molecular-weight heparins (LMWHs) has been the subject of discussion since these products were first introduced for the prophylaxis of deep vein thrombosis. Experimental evidence now exists to show that LMWHs differ from each other in a number of characteristics. Products have been differentiated on the basis of molecular weight and biologic properties, but only limited information derived from the clinical setting is available. Potency has been described on the basis of anti-Factor Xa activity, but at equivalent anti-Xa activities, the anti-Factor IIa activity of different products shows marked variations. At the relatively small doses used for the management of postsurgical deep vein thrombosis, the effect of these interproduct differences may be relatively minor, but as LMWHs are developed for therapeutic use at much higher doses, such differences may become clinically important. Variations in safety and efficacy reported in clinical trials of LMWHs may reflect the known differences in their molecular composition and pharmacologic properties.

Evaluation of the current practices of noise-induced hearing loss (NIHL) awareness training in the South African mining industry

CSIR Research Space (South Africa)

Edwards, AL

2015-01-01

Full Text Available e of h ow w or ke rs a re e du ca te d on th e S pe ci fi c e xa m pl e E ffe ct s of n oi se o n he ar in g, p er m an en ce o f N IH L, u nd er st an di ng th e re su lts o f a nn ua l s ur ve ill an ce , u nd er st an di ng... h ow to h az ar d of n oi se to h ea rin g he al th . pr ot ec t h ea rin g. S ee a ns w er s to Q ue st io n 23 to o. 8 P le as e gi ve a n ex am pl e of h ow w or ke rs a re m ot iv at ed to S pe ci fi c e xa m pl...

Isotopic orientational order in acetyl salicylic acid

International Nuclear Information System (INIS)

Schiebel, P.; Prandl, W.

1999-01-01

Complete text of publication follows. Isotopically mixed methyl groups CD x H 3-x with zero averaged deuteron/hydrogen scattering length 0 = = xa D + (3 - x)a H (a D = 0.667 x 10 -12 ; a H = -0.374 x 10 -12 ) are expected to be invisible in a neutron diffraction experiment. Indeed, in aspirin-CD x H 3-x with an experimentally determined = -0.03 x 10 -12 cm at room temperature only three very week minima have been found. At 10 K, however, one positive and two negative extrema are visible: unique evidence for orientational isotopic order. From a combination of 1-d-Fourier and algebraic methods has been deconvoluted and the orientational distribution function f(φ) has been derived which has three equivalent maxima/minima at 300 K and loses this 3φ periodicity at 10 K. f(φ) is the basis for the determination of the hindrance potential with cos(φ) as the leading term. (author)

Patrón tromboelastográfico en pacientes anticoagulados con rivaroxabán por fibrilación auricular

Directory of Open Access Journals (Sweden)

Susana Pacheco Jaramillo

2016-11-01

Conclusión: El patrón tromboelastográfico obtenido en la mayoría de pacientes del estudio se caracterizó por un tiempo de reacción alto y un índice de coagulación bajo, posiblemente debido al efecto del inhibidor del factor Xa.

Gas-phase infrared spectrum of the anionic GFP-chromophore

NARCIS (Netherlands)

Almasian, M.; Grzetic, J.; G. Berden,; Bakker, B.; Buma, W. J.; Oomens, J.

2012-01-01

The gas-phase IR spectrum of the anionic chromophore of the green fluorescent protein (p-hydroxy-benzylidene-2,3-dimethylimidazolidinone, HBDI) is recorded in the 800–1800&#xa0;cm−1 frequency range using the free electron laser FELIX in combination with an electrospray ionization (ESI) Fourier

Ramjets and Ramrockets for Military Applications

Science.gov (United States)

1982-03-01

or auni)from multiple platforms and other operational considerations e-posed in recent XA1(o/nf~ studies should not invalidate the above claim. of...thereby obviating the need for any evaporation time. To ascertain the degree of pre- wix , carbon dioxide (selected because of its denasity similarit7

Simukunin from the Salivary Glands of the Black Fly Simulium vittatum Inhibits Enzymes That Regulate Clotting and Inflammatory Responses

Czech Academy of Sciences Publication Activity Database

Tsujimoto, H.; Kotsyfakis, Michalis; Francischetti, I.M.B.; Eum, J. H.; Strand, M. R.; Champagne, D. E.

2012-01-01

Roč. 7, č. 2 (2012), e29964 E-ISSN 1932-6203 Institutional research plan: CEZ:AV0Z60220518 Keywords : Simulium vittatum * Kunitz-family protein * elastase * cathepsin G * Factor Xa * coagulation * inflammation * serine proteases * BPTI-like inhibitor * Simukunin Subject RIV: EC - Immunology Impact factor: 3.730, year: 2012

76 FR 58471 - Endangered Species; File No. 15634

Science.gov (United States)

2011-09-21

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA714 Endangered..., [Responsible Party: Lisa Ballance, Ph.D.], has applied in due form for a permit to take leatherback sea turtles.... SUPPLEMENTARY INFORMATION: The subject permit is requested under the authority of the Endangered Species Act of...

77 FR 2513 - Draft Environmental Impact Statement for Effects of Oil and Gas Activities in the Arctic Ocean

Science.gov (United States)

2012-01-18

... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA934 Draft Environmental Impact Statement for Effects of Oil and Gas Activities in the Arctic Ocean AGENCY: National Marine... Environmental Impact Statement (DEIS) for the Effects of Oil and Gas Activities in the Arctic Ocean.'' Based on...

77 FR 17460 - Multistakeholder Process To Develop Consumer Data Privacy Codes of Conduct

Science.gov (United States)

2012-03-26

..., 2012, NTIA requested public comments on (1) which consumer data privacy issues should be the focus of.... 120214135-2203-02] RIN 0660-XA27 Multistakeholder Process To Develop Consumer Data Privacy Codes of Conduct... request for public comments on the multistakeholder process to develop consumer data privacy codes of...

76 FR 77781 - Endangered Species; File No. 15802

Science.gov (United States)

2011-12-14

.... SUPPLEMENTARY INFORMATION: The subject permit is requested under the authority of the Endangered Species Act of... exporting of endangered and threatened species (50 CFR 222-226). On July 28, 2011 (76 FR 45230), notice was... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA603 Endangered...

76 FR 48146 - Endangered Species; File No. 1551

Science.gov (United States)

2011-08-08

... subject modification to Permit No. 1551- 02 is requested under the authority of the Endangered Species Act... exporting of endangered and threatened species (50 CFR 222-226). Permit No. 1551, issued on July 24, 2008... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA620 Endangered...

78 FR 38013 - Endangered Species; File No. 15661

Science.gov (United States)

2013-06-25

... authority of the Endangered Species Act of 1973, as amended (16 U.S.C. 1531 et seq.) and the regulations governing the taking, importing, and exporting of endangered and threatened species (50 CFR 222-226). Permit... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA425 Endangered...

76 FR 18725 - Endangered Species; File No. 16174

Science.gov (United States)

2011-04-05

... the authority of the Endangered Species Act of 1973, as amended (ESA; 16 U.S.C. 1531 et seq.) and the regulations governing the taking, importing, and exporting of endangered and threatened species (50 CFR 222... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA348 Endangered...

76 FR 45781 - Endangered Species; File No. 15552

Science.gov (United States)

2011-08-01

... Endangered Species Act of 1973, as amended (ESA; 16 U.S.C. 1531 et seq.) and the regulations governing the taking, importing, and exporting of endangered and threatened species (50 CFR parts 222-226). The five... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA601 Endangered...

76 FR 58471 - Endangered Species; File No. 16306

Science.gov (United States)

2011-09-21

... requested under the authority of the Endangered Species Act of 1973, as amended (ESA; 16 U.S.C. 1531 et seq... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA712 Endangered Species; File No. 16306 AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric...

75 FR 32372 - Information Privacy and Innovation in the Internet Economy

Science.gov (United States)

2010-06-08

.... 100402174-0238-02] RIN 0660-XA12 Information Privacy and Innovation in the Internet Economy AGENCY: National... Internet economy.\\1\\ In addition, the Department announced the formation of a Commerce-wide Internet Policy... Internet Economy, Launches Internet Policy Task Force, Department of Commerce Press Release (April 21, 2010...

76 FR 72643 - Western Pacific Pelagic Fisheries; Closure of the Hawaii Shallow-Set Pelagic Longline Fishery Due...

Science.gov (United States)

2011-11-25

.... 080225267-91393-03] RIN 0648-XA370 Western Pacific Pelagic Fisheries; Closure of the Hawaii Shallow- Set...: Temporary rule; fishery closure. SUMMARY: NMFS closes the shallow-set pelagic longline fishery north of the Equator for all vessels registered under the Hawaii longline limited access program. The shallow-set...

76 FR 57679 - Fisheries of the Exclusive Economic Zone Off Alaska; Shallow-Water Species by Vessels Using Trawl...

Science.gov (United States)

2011-09-16

.... 101126522-0640-02] RIN 0648-XA704 Fisheries of the Exclusive Economic Zone Off Alaska; Shallow- Water... closure. SUMMARY: NMFS is opening directed fishing for shallow-water species by vessels using trawl gear... apportionment of the 2011 Pacific halibut bycatch allowance specified for the trawl shallow-water species...

The role of autolysis loop in determining the specificity of coagulation proteases.

Science.gov (United States)

Yang, L; Manithody, C; Rezaie, A R

2007-08-01

We recently demonstrated that the substitution of the autolysis loop (residues 143 to 154 in the chymotrypsin numbering system) of activated protein C (APC) with the corresponding loop of factor Xa (fXa) renders the APC mutant (APC/fX143-154) susceptible to inhibition by antithrombin (AT) in the presence of pentasaccharide. Our recent results further indicated, that in addition to an improvement in the reactivity of APC/fX143-154 with AT, both the amidolytic and anti-factor Va activities of the mutant APC have also been significantly increased. Since the autolysis loop of APC is five residues longer than the autolysis loop of fXa, it could not be ascertained whether this loop in the mutant APC specifically interacts with the activated conformation of AT or if a shorter autolysis loop is responsible for a global improvement in the catalytic activity of the mutant protease. To answer this question, we prepared another APC mutant in which the autolysis loop of the protease was replaced with the corresponding loop of trypsin (APC/Tryp143-154). Unlike an approximately 500-fold improvement in the reactivity of APC/fX143-154 with AT in the presence of pentasaccharide, the reactivity of APC/Tryp143-154 with the serpin was improved approximately 10-fold. These results suggest that both the length and structure of residues of the autolysis loop are critical for the specificity of the coagulation protease interaction with AT. Further factor Va inactivation studies with the APC mutants revealed a similar role for the autolysis loop of APC in the interaction with its natural substrate.

The role of autolysis loop in determining the specificity of coagulation proteases

Directory of Open Access Journals (Sweden)

L. Yang

2007-08-01

Full Text Available We recently demonstrated that the substitution of the autolysis loop (residues 143 to 154 in the chymotrypsin numbering system of activated protein C (APC with the corresponding loop of factor Xa (fXa renders the APC mutant (APC/fX143-154 susceptible to inhibition by antithrombin (AT in the presence of pentasaccharide. Our recent results further indicated, that in addition to an improvement in the reactivity of APC/fX143-154 with AT, both the amidolytic and anti-factor Va activities of the mutant APC have also been significantly increased. Since the autolysis loop of APC is five residues longer than the autolysis loop of fXa, it could not be ascertained whether this loop in the mutant APC specifically interacts with the activated conformation of AT or if a shorter autolysis loop is responsible for a global improvement in the catalytic activity of the mutant protease. To answer this question, we prepared another APC mutant in which the autolysis loop of the protease was replaced with the corresponding loop of trypsin (APC/Tryp143-154. Unlike an ~500-fold improvement in the reactivity of APC/fX143-154 with AT in the presence of pentasaccharide, the reactivity of APC/Tryp143-154 with the serpin was improved ~10-fold. These results suggest that both the length and structure of residues of the autolysis loop are critical for the specificity of the coagulation protease interaction with AT. Further factor Va inactivation studies with the APC mutants revealed a similar role for the autolysis loop of APC in the interaction with its natural substrate.

Karakterisasi Morfometrik dan Jarak Genetik Rumpun-Rumpun Kelinci di Jawa Barat (MORPHOMETRIC CHARACTERIZATION AND GENETIC DISTANCE OF RABBIT BREEDS IN WEST JAVA

Directory of Open Access Journals (Sweden)

Rudi Dedi Iskandar

2017-01-01

Full Text Available The objectives of this study were to assess morphometric characteristics, breeds relationship andvariables that distinguished among breeds of rabbits raised in West Java. This research used 419 rabbitsconsisted of Angora (AG, Dutch (DT, Flemish Giant (FG, Lop (LP, Netherland Dwarf (ND, Composite(PX, Rex (RX, Satin (ST, Reza (XA and New Zealand White (ZW. Head length (PK, head width (LK, earlength (PTL, ear width (LTL, chest width (LD, chest depth (DD, chest circumference (LKD, body length(PB , hips width (LP, length of the scapula bone (PS, humerus length (PH, radius-ulna length (PRU,femur length (PF and tibia length (PT were observed. Data were analyzed with analysis of variance,discriminant and canonical analysis using SAS program ver. 9.1.3 and MEGA5 program to get theconstruction of phenogram tree. FG and ST rabbits were generally larger in size and shape than the otherrabbits breeds, while ND rabbit had the smallest morphological size than other rabbits breeds, except forLK, LD and DD. Results of discriminant analysis showed that LP, RX, ND and XA had a high similarityvalue, otherwise DT, FG, ST, PX, AG and ZW had no the value. The closest genetic distance matrix valueindicated by PX-ZW breeds (1,53 and the farthest genetic distance indicated by FG-ND breeds (6,62.Phenogram tree construction showed that the breeds rabbits divided into five clusters, namely cluster ND,DT; ST clusters; FG cluster; cluster LP, PX, ZW and cluster AG, XA, RX. Phenotypic size that had stronginfluence on the differentiation of rabbit breeds were PTL, LTL, PRU, PH and PF on the canonical 1 alsoPT and PS on canonical 2.

Histones Differentially Modulate the Anticoagulant and Profibrinolytic Activities of Heparin, Heparin Derivatives, and Dabigatran.

Science.gov (United States)

Ammollo, Concetta Tiziana; Semeraro, Nicola; Carratù, Maria Rosaria; Colucci, Mario; Semeraro, Fabrizio

2016-02-01

The antithrombin activity of unfractionated heparin (UFH) is offset by extracellular histones, which, along with DNA, represent a novel mediator of thrombosis and a structural component of thrombi. Here, we systematically evaluated the effect of histones, DNA, and histone-DNA complexes on the anticoagulant and profibrinolytic activities of UFH, its derivatives enoxaparin and fondaparinux, and the direct thrombin inhibitor dabigatran. Thrombin generation was assessed by calibrated automated thrombinography, inhibition of factor Xa and thrombin by synthetic substrates, tissue plasminogen activator-mediated clot lysis by turbidimetry, and thrombin-activatable fibrinolysis inhibitor (TAFI) activation by a functional assay. Histones alone delayed coagulation and slightly stimulated fibrinolysis. The anticoagulant activity of UFH and enoxaparin was markedly inhibited by histones, whereas that of fondaparinux was enhanced. Histones neutralized both the anti-Xa and anti-IIa activities of UFH and preferentially blocked the anti-IIa activity of enoxaparin. The anti-Xa activity of fondaparinux was not influenced by histones when analyzed by chromogenic substrates, but was potentiated in a plasma prothrombinase assay. Histones inhibited the profibrinolytic activity of UFH and enoxaparin and enhanced that of fondaparinux by acting on the modulation of TAFI activation by anticoagulants. Histone H1 was mainly responsible for these effects. Histone-DNA complexes, as well as intact neutrophil extracellular traps, impaired the activities of UFH, enoxaparin, and fondaparinux. Dabigatran was not noticeably affected by histones and/or DNA, whatever the assay performed. In conclusion, histones and DNA present in the forming clot may variably influence the antithrombotic activities of anticoagulants, suggesting a potential therapeutic advantage of dabigatran and fondaparinux over heparins. Copyright © 2016 by The American Society for Pharmacology and Experimental Therapeutics.

78 FR 20317 - Application for Final Commitment for a Long-Term Loan or Financial Guarantee in Excess of $100...

Science.gov (United States)

2013-04-04

... supplying information that competitors could use to compete with companies in the United States. DATES... or Financial Guarantee in Excess of $100 Million: AP087223XX and AP087223XA AGENCY: Export-Import...''), that Ex-Im Bank has received an application for final commitment for a long-term loan or financial...

76 FR 56167 - Marine Mammals; Pinniped Removal Authority

Science.gov (United States)

2011-09-12

... problem interactions. See http://www.nwr.noaa.gov/Marine-Mammals/Seals-and-Sea-Lions/Sec-120-Authority.cfm... to the pinniped predation problem at Bonneville Dam and is not a na[iuml]ve animal that can be driven... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA681 Marine...

75 FR 70714 - Global Free Flow of Information on the Internet

Science.gov (United States)

2010-11-18

.... 100921457-0561-02] RIN 0660-XA20 Global Free Flow of Information on the Internet AGENCY: National... of comment period. SUMMARY: The Department of Commerce's Internet Policy Task Force announces that... on the global free flow of information on the Internet has been reopened and will extend until 5 p.m...

76 FR 77780 - Endangered Species; File No. 10022

Science.gov (United States)

2011-12-14

... been granted under the authority of the Endangered Species Act of 1973, as amended (ESA; 16 U.S.C. 1531... endangered or threatened species, and (3) is consistent with the purposes and policies set forth in section 2... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA867 Endangered...

The Dramaturgy of Fact: The Testament of History in Two Anti-War Plays.

Science.gov (United States)

Shafer, George

1978-01-01

The dramaturgical dimensions of the "theater of fact" as found in two anti-war plays, "Discourse on Viet Nam" by Peter Weiss and "Xa: A Vietnam Primer" by the ProVisional Theatre are examined. In these plays the author finds that Vietnamese history becomes rhetorical testament in arguments against United States…

Technical Training: Technical Training Seminar

CERN Multimedia

2004-01-01

TECHNICAL TRAINING Monique Duval tel. 74924 technical.training@cern.ch Monday 9 February 2004 From 10:00 to 12:00 - IT Auditorium - bldg. 31, 3rd floor ANSOFT High-Frequency Seminar David Prestaux, Application Engineer, ANSOFT F-78535 BUC, France This Technical Training seminar will present two Ansoft application products: Ansoft HFSS and Ansoft Designer. Ansoft HFSS makes use of the Finite Element Method (FEM) to calculate field solutions from first principles. It can accurately predict all high-frequency behaviours such as dispersion, mode conversion, and losses due to materials and radiation. Ansoft Designer is a suite of design tools to fully integrate high-frequency, physics-based electromagnetic simulations into a seamless system-level simulation environment. Ansoft Designer uses a simple interface to give complete control over every design task, by a method allowing multiple solvers, Solver on Demand. • Introduction • Overview of the Ansoft Total solution • Ansoft HFSS 9...

CRITERIOS PARA LA SELECCIÓN DE ESPECIES HERBÁCEAS ORNAMENTALES PARA SU USO EN PAISAJISMO

Directory of Open Access Journals (Sweden)

Sebastiana Guadalupe Ramírez-Hernández

2012-01-01

realizó una recolecta de especies herbáceas silvestres, atractiva por sus características de follaje y flores, en ocho municipios del centro de Veracruz (Huatusco, Tepatlaxco, Coscomatepec, Paso del Macho, Amatlán de los Reyes, Cuitláhuac, Tezonapa y Zongolica en áreas con vegetación poco perturbada. La colecta comprendió un total de 18 especies pertenecientes a 10 familias y 16 géneros, y sin uso actual en el diseño de áreas verdes. Se elaboró un instrumento de valoración del potencial ornamental de las especies, basado en ocho criterios de calificación de sus características morfológico-ecológicas. Cinco de las especies recolectadas fueron calificadas como de alto potencial ornamental. Las especies más sobresalientes fueron: Ruellia coerulea Morong, Cosmos sulphureus, Zinnia elegans L., Salvia coccinea Buc´hoz ex Etl. y Lantana camara L.

Computation of the modified Bessel function of the third kind of imaginary orders: uniform Airy-type asymptotic expansion

NARCIS (Netherlands)

A. Gil (Amparo); J. Segura (Javier); N.M. Temme (Nico)

2002-01-01

textabstractThe use of a uniform Airy-type asymptotic expansion for the computation of the modified Bessel functions of the third kind of imaginary orders ($K_{ia}(x)$) near the transition point $x=a$, is discussed. In [2], an algorithm for the evaluation of $K_{ia}(x)$ was presented, which made use

76 FR 55276 - Fisheries of the Exclusive Economic Zone Off Alaska; Octopus in the Bering Sea and Aleutian Islands

Science.gov (United States)

2011-09-07

.... 101126521-0640-02] RIN 0648-XA683 Fisheries of the Exclusive Economic Zone Off Alaska; Octopus in the Bering... retention of octopus in the Bering Sea and Aleutian Islands (BSAI). This action is necessary because the 2011 total allowable catch of octopus in the BSAI has been reached. DATES: Effective 1200 hrs, Alaska...

Reflection and Non-Reflection of Particle Wavepackets

Science.gov (United States)

Cox, Timothy; Lekner, John

2008-01-01

Exact closed-form solutions of the time-dependent Schrodinger equation are obtained, describing the propagation of wavepackets in the neighbourhood of a potential. Examples given include zero reflection, total reflection and partial reflection of the wavepacket, for the sech[superscript 2]x/a, 1/x[superscript 2] and delta(x) potentials,…

76 FR 66042 - Endangered Species; File No. 1551

Science.gov (United States)

2011-10-25

... granted under the authority of the Endangered Species Act of 1973, as amended (ESA; 16 U.S.C. 1531 et seq... endangered or threatened species, and (3) is consistent with the purposes and policies set forth in section 2... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA785 Endangered...

76 FR 59924 - Fisheries of the Exclusive Economic Zone Off Alaska; Sharks in the Bering Sea and Aleutian...

Science.gov (United States)

2011-09-28

.... 101126521-0640-2] RIN 0648-XA733 Fisheries of the Exclusive Economic Zone Off Alaska; Sharks in the Bering... prohibiting retention of sharks in the Bering Sea and Aleutian Islands management area (BSAI). This action is necessary because the 2011 total allowable catch (TAC) of sharks in the BSAI has been reached. DATES...

Potential energy surfaces for alkali plus noble gas pairs: a systematic comparison

Science.gov (United States)

Blank, L. Aaron; Kedziora, Gary S.; Weeks, David E.

2010-02-01

Optically Pumped Alkali Lasers (OPAL) involve interactions of alkali atoms with a buffer gas typically consisting of a noble gas together with C2H4. Line broadening mechanisms are of particular interest because they can be used to match a broad optical pumping source with relatively narrow alkali absorption spectra. To better understand the line broadening processes at work in OPAL systems we focus on the noble gas collisional partners. A matrix of potential energy surfaces (PES) has been generated at the multi-configurational self consistent field (MCSCF) level for M + Ng, where M=Li, Na, K, Rb, Cs and Ng=He, Ne, Ar. The PES include the X2Σ ground state surface and the A2II, B2Σ excited state surfaces. In addition to the MCSCF surfaces, PES for Li+He have been calculated at the multi-reference singles and doubles configuration interaction (MRSDCI) level with spin-orbit splitting effects included. These surfaces provide a way to check the qualitative applicability of the MCSCF calculations. They also exhibit the avoided crossing between the B2Σ and A2II1/2 surfaces that is partially responsible for collision induced relaxation from the 2P3/2 to the 2P1/2 atomic levels.

Sobre Virg., Buc. 4.18-25, puer nascens, y la tradición de la écfrasis en Roma

Directory of Open Access Journals (Sweden)

Joan Gómez Pallarès

2001-06-01

Full Text Available The aim of this paper is to apply, as a way of interpretation of Virgil’s Fourth Bucolic, verses 18-25, the idea that one of his “inspiration” sources could have been the visual and iconic universe in which the poet flourished. Taking into account the argumentation about different types of ekphraseis, we try to define what we call “implicit ekphrasis”, that is, a kind of ekphrasis not produced by isolated artistic objects, but another one based on concepts, in order to apply it to our verses commentary. The results could allow us to say that the icons which, at Rome, symbolized aeternitas, aurea aetas, felicitas temporum, tempora anni, etc., permit the poet (among other inspiration sources to build his message of a better time through the puer nascens’s metaphor.

Phenotyping of VIGS-mediated gene silencing in rice using a vector derived from a DNA virus.

Science.gov (United States)

Kant, Ravi; Dasgupta, Indranil

2017-07-01

Target genes in rice can be optimally silenced if inserted in antisense or hairpin orientation in the RTBV-derived VIGS vector and plants grown at 28 °C and 80% humidity after inoculation. Virus induced gene silencing (VIGS) is a method used to transiently silence genes in dicot as well as monocot plants. For the important monocot species rice, the Rice tungro bacilliform virus (RTBV)-derived VIGS system (RTBV-VIGS), which uses agroinoculation to initiate silencing, has not been standardized for optimal use. Here, using RTBV-VIGS, three sets of conditions were tested to achieve optimal silencing of the rice marker gene phytoene desaturase (pds). The effect of orientation of the insert in the RTBV-VIGS plasmid (sense, antisense and hairpin) on the silencing of the target gene was then evaluated using rice magnesium chelatase subunit H (chlH). Finally, the rice Xa21 gene, conferring resistance against bacterial leaf blight disease (BLB) was silenced using RTBV-VIGS system. In each case, real-time PCR-based assessment indicated approximately 40-80% fall in the accumulation levels of the transcripts of pds, chlH and Xa21. In the case of pds, the appearance of white streaks in the emerging leaves, and for chlH, chlorophyll levels and F v /F m ratio were assessed as phenotypes for silencing. For Xa21, the resistance levels to BLB were assessed by measuring the lesion length and the percent diseased areas of leaves, following challenge inoculation with Xanthomonas oryzae. In each case, the RTBV-MVIGS system gave rise to a discernible phenotype indicating the silencing of the respective target gene using condition III (temperature 28 °C, humidity 80% and 1 mM MES and 20 µM acetosyringone in secondary agrobacterium culture), which revealed the robustness of this gene silencing system for rice.

New oral anticoagulants: their advantages and disadvantages compared with vitamin K antagonists in the prevention and treatment of patients with thromboembolic events.

Science.gov (United States)

Mekaj, Ymer H; Mekaj, Agon Y; Duci, Shkelzen B; Miftari, Ermira I

2015-01-01

Despite the discovery and application of many parenteral (unfractionated and low-molecular-weight heparins) and oral anticoagulant vitamin K antagonist (VKA) drugs, the prevention and treatment of venous and arterial thrombotic phenomena remain major medical challenges. Furthermore, VKAs are the only oral anticoagulants used during the past 60 years. The main objective of this study is to present recent data on non-vitamin K antagonist oral anticoagulants (NOACs) and to analyze their advantages and disadvantages compared with those of VKAs based on a large number of recent studies. NOACs are novel direct-acting medications that are selective for one specific coagulation factor, either thrombin (IIa) or activated factor X (Xa). Several NOACs, such as dabigatran (a direct inhibitor of FIIa) and rivaroxaban, apixaban and edoxaban (direct inhibitors of factor Xa), have been used for at least 5 years but possibly 10 years. Unlike traditional VKAs, which prevent the coagulation process by suppressing the synthesis of vitamin K-dependent factors, NOACs directly inhibit key proteases (factors IIa and Xa). The important indications of these drugs are the prevention and treatment of deep vein thrombosis and pulmonary embolisms, and the prevention of atherothrombotic events in the heart and brain of patients with acute coronary syndrome and atrial fibrillation. They are not fixed, and dose-various strengths are available. Most studies have reported that more advantages than disadvantages for NOACs when compared with VKAs, with the most important advantages of NOACs including safety issues (ie, a lower incidence of major bleeding), convenience of use, minor drug and food interactions, a wide therapeutic window, and no need for laboratory monitoring. Nonetheless, there are some conditions for which VKAs remain the drug of choice. Based on the available data, we can conclude that NOACs have greater advantages and fewer disadvantages compared with VKAs. New studies are required

In vitro anticoagulation monitoring of low-molecular-weight heparin

Institute of Scientific and Technical Information of China (English)

WANG Jian-qi; SHI Xu-bo; YANG Jin-gang; HU Da-yi

2009-01-01

Background Although low-molecular-weight heparin has replaced unfractionated heparin to become the primary anticoagulation drug for treatment of acute coronary syndrome, there is no convenient bedside monitoring method. We explored the best laboratory monitoring method of low-molecular-weight heparins (enoxapadn, dalteparin, and nadroparin) by use of the Sonoclot coagulation analyzer to monitor the activated clotting time.Methods Atotal of 20 healthy volunteers were selected and 15 ml of fasting venous blood samples were collected and incubated. Four coagulants, kaolin, diatomite, glass bead, and magnetic stick, were used to determine the activated clotting time of the low-molecular-weight heparins at different in vitro anti-Xa factor concentrations. A correlation analysis was made to obtain the regression equation. The activated clotting time of the different low-molecular-weight heparins with the same anti-Xa factor concentration was monitored when the coagulant glass beads were applied. Results The activated clotting time measured using the glass beads, diatomite, kaolin, and magnetic stick showed a linear correlation with the concentration of nadroparin (r= 0.964, 0.966, 0.970, and 0.947, respectively). The regression equation showed that the linear slopes of different coagulants were significantly different (glass beads 230.03 s/IU,diatomite 89.91 s/IU, kaolin 50.87 s/IU, magnetic stick could not be calculated). When the concentration of the anti-Xa factor was the same for different low-molecular-weight heparins, the measured activated clotting time was different after the application of the glass bead coagulant.Conclusions The glass bead coagulant is most feasible for monitoring the in vitro anticoagulation activity of nadroparin.The different effects of different low-molecular-weight heparins on the activated clotting time may be related to the different anti-Ila activities.

SU-E-I-10: Automatic Monitoring of Accumulated Dose Indices From DICOM RDSR to Improve Radiation Safety in X-Ray Angiography

International Nuclear Information System (INIS)

Omar, A; Bujila, R; Nowik, P; Karambatsakidou, A

2014-01-01

Purpose: To investigate the potential benefits of automatic monitoring of accumulated patient and staff dose indicators, i.e., CAK and KAP, from DICOM Radiation Dose Structured Reports (RDSR) in x-ray angiography (XA). Methods: Recently RDSR has enabled the convenient aggregation of dose indices and technique parameters for XA procedures. The information contained in RDSR objects for three XA systems, dedicated to different types of clinical procedures, has been collected and aggregated in a database for over one year using a system developed with open-source software at the Karolinska University Hospital. Patient weight was complemented to the RDSR data via an interface with the Hospital Information System (HIS). Results: The linearly approximated trend in KAP over a time period of a year for cerebrovascular, pelvic/peripheral vascular, and cardiovascular procedures showed a decrease of 12%, 20%, and 14%, respectively. The decrease was mainly due to hardware/software upgrades and new low-dose imaging protocols, and partially due to ongoing systematic radiation safety education of the clinical staff. The CAK was in excess of 3 Gy for 15 procedures, and exceeded 5 Gy for 3 procedures. The dose indices have also shown a significant dependence on patient weight for cardiovascular and pelvic/peripheral vascular procedures; a 10 kg shift in mean patient weight can result in a dose index increase of 25%. Conclusion: Automatic monitoring of accumulated dose indices can be utilized to notify the clinical staff and medical physicists when the dose index has exceeded a predetermined action level. This allows for convenient and systematic follow-up of patients in risk of developing deterministic skin injuries. Furthermore, trend analyses of dose indices over time is a valuable resource for the identification of potential positive or negative effects (dose increase/decrease) from changes in hardware, software, and clinical work habits

SU-E-I-10: Automatic Monitoring of Accumulated Dose Indices From DICOM RDSR to Improve Radiation Safety in X-Ray Angiography

Energy Technology Data Exchange (ETDEWEB)

Omar, A; Bujila, R; Nowik, P; Karambatsakidou, A [Karolinska University Hospital, Stockholm (Sweden)

2014-06-01

Purpose: To investigate the potential benefits of automatic monitoring of accumulated patient and staff dose indicators, i.e., CAK and KAP, from DICOM Radiation Dose Structured Reports (RDSR) in x-ray angiography (XA). Methods: Recently RDSR has enabled the convenient aggregation of dose indices and technique parameters for XA procedures. The information contained in RDSR objects for three XA systems, dedicated to different types of clinical procedures, has been collected and aggregated in a database for over one year using a system developed with open-source software at the Karolinska University Hospital. Patient weight was complemented to the RDSR data via an interface with the Hospital Information System (HIS). Results: The linearly approximated trend in KAP over a time period of a year for cerebrovascular, pelvic/peripheral vascular, and cardiovascular procedures showed a decrease of 12%, 20%, and 14%, respectively. The decrease was mainly due to hardware/software upgrades and new low-dose imaging protocols, and partially due to ongoing systematic radiation safety education of the clinical staff. The CAK was in excess of 3 Gy for 15 procedures, and exceeded 5 Gy for 3 procedures. The dose indices have also shown a significant dependence on patient weight for cardiovascular and pelvic/peripheral vascular procedures; a 10 kg shift in mean patient weight can result in a dose index increase of 25%. Conclusion: Automatic monitoring of accumulated dose indices can be utilized to notify the clinical staff and medical physicists when the dose index has exceeded a predetermined action level. This allows for convenient and systematic follow-up of patients in risk of developing deterministic skin injuries. Furthermore, trend analyses of dose indices over time is a valuable resource for the identification of potential positive or negative effects (dose increase/decrease) from changes in hardware, software, and clinical work habits.

Federal Health Care Center: VA and DOD Need to Address Ongoing Difficulties and Better Prepare for Future Integrations

Science.gov (United States)

2016-02-01

related documentation, performing data reliability checks (such as examining the data for missing values), and interviewing FHCC officials. After taking...and personnel Staffing, training, and the transfer of DOD civilian personnel to VA Xa Property Construction, transfer of property, and physical ...29For example, geriatric and mental health clinical areas were initially grouped with other

Human active X-specific DNA methylation events showing stability across time and tissues

Science.gov (United States)

Joo, Jihoon Eric; Novakovic, Boris; Cruickshank, Mark; Doyle, Lex W; Craig, Jeffrey M; Saffery, Richard

2014-01-01

The phenomenon of X chromosome inactivation in female mammals is well characterised and remains the archetypal example of dosage compensation via monoallelic expression. The temporal series of events that culminates in inactive X-specific gene silencing by DNA methylation has revealed a ‘patchwork' of gene inactivation along the chromosome, with approximately 15% of genes escaping. Such genes are therefore potentially subject to sex-specific imbalance between males and females. Aside from XIST, the non-coding RNA on the X chromosome destined to be inactivated, very little is known about the extent of loci that may be selectively silenced on the active X chromosome (Xa). Using longitudinal array-based DNA methylation profiling of two human tissues, we have identified specific and widespread active X-specific DNA methylation showing stability over time and across tissues of disparate origin. Our panel of X-chromosome loci subject to methylation on Xa reflects a potentially novel mechanism for controlling female-specific X inactivation and sex-specific dimorphisms in humans. Further work is needed to investigate these phenomena. PMID:24713664

Use of membrane technology and resins for the separation and purification of polyphenols purple tree tomato (Solanum betaceum Cav

Directory of Open Access Journals (Sweden)

Elena Beltrán

2016-12-01

Full Text Available The polyphenols fractionation of mesocarp juices, placenta and purple tree tomato peel using the pore size of the membrane as a means of selection was performed using micro and ultrafiltration tangential; tests made with HPLC showed that fractionation of phenolic compounds was not performed. The processes of concentration of the clarified juices of placenta and tree tomato peel by reverse osmosis obtained a volumetric concentration factor of 2 and 2.2 respectively. The polyphenol concentration increased by 1.5 times for placenta and 2.4 times for peel and antioxidant capacity increased by 2.4 times for both juices. The anthocyanins of placenta increased by 2.6 times. The use of the resin XA 5071 FG concentrated phenolic compounds with an increase of antioxidant capacity in a range between 4 and 5.5, and anthocyanins concentration was increased 1.8 times in the placenta juice. In conclusion the process of polyphenols concentration of tree tomato was more efficient using the resin XA 5071 FG than the reverse osmosis applied in this research.

Resolution of the crystal structure of the deficient perovskite LaNiO2.5 from neutron powder diffraction data

International Nuclear Information System (INIS)

Alonso, J.A.; Martinez-Lope, M.J.

1996-01-01

The oxygen-deficient perovskite LaNiO 2.5 has been prepared by controlled reduction of LaNiO 3 with Zr metal. The XRD pattern could be indexed in a monoclinic unit-cell with dimensions a 0 xa 0 xa 0 (a 0 : lattice parameter of the ideal cubic perovskite). The indexing of the neutron powder diffraction pattern needed a doubled cell to account for the superstructure reflections originated by the oxygen vacancy ordering and the tilting of the Ni coordination polyhedra. The structure was solved and refined from the neutron powder data. The oxygen vacancies are ordered in such a way that square planar NiO 4 and NiO 6 octahedra alternate in the ab plane along the [110] direction. Both kinds of Ni polyhedra are fairly distorted and tilted in order to optimize the La-O distances, giving rise to a highly strained structure of metastable character. In fact, the compound readily takes oxygen, above 175 C in air, to give the much more stable LaNiO 3 perovskite. (orig.)

Influences of the disease resistance conferred by the individual ...

African Journals Online (AJOL)

To research possible influences of the disease resistance conferred by different trans-resistance genes on the transgenic rice plants in their yields and grain quality, three transgenic rice lines, including two with the resistance genes Pi-d2 and Pi-d3, respectively, for rice blast, and one with the resistance gene Xa21 for rice ...

Neutral V production with 14.6 x A GeV/c silicon beams

International Nuclear Information System (INIS)

Eiseman, S.E.; Etkin, A.; Foley, K.J.; Hackenburg, R.W.; Longacre, R.S.; Love, W.A.; Morris, T.W.; Platner, E.D.; Saulys, A.C.; Lindenbaum, S.J.; Chan, C.S.; Kramer, M.A.; Zhao, K.; Hallman, T.J.; Madansky, L.; Bonner, B.E.; Buchanan, J.A.; Chiou, C.N.; Clement, J.M.; Corcoran, M.D.; Kruk, J.W.; Mutchler, G.S.; Nessi-Tedaldi, F.; Nessi, M.; Roberts, J.B.

1990-01-01

We present the results of a measurement of neutral V production with 14.6xA GeV/c Si beams on Au and Cu targets. The Λ and K s 0 yields were measured as a function of negative particle multiplicity. Effective temperatures were determined from an exponential fit to the transverse mass distributions. (orig.)

Hydrogenic donor in a quantum well with an electric field

International Nuclear Information System (INIS)

Jayakumar, K.; Balasubramanian, S.; Tomak, M.

1985-08-01

Variational calculations of the binding energy of a hydrogenic donor in a quantum well formed by GaAs and Gasub(1-x)A1sub(x)As with a constant electric field are performed for different electric fields and well widths. A critical electric field is defined and its variation with well width is presented. (author)

76 FR 17360 - Fisheries of the Exclusive Economic Zone Off Alaska; Octopus in the Bering Sea and Aleutian...

Science.gov (United States)

2011-03-29

.... 101126521-0640-02] RIN 0648-XA322 Fisheries of the Exclusive Economic Zone Off Alaska; Octopus in the Bering... allowable catch of octopus in the Bering Sea and Aleutian Islands (BSAI). This action is necessary to allow... subpart H of 50 CFR part 600 and 50 CFR part 679. The 2011 initial total allowable catch (ITAC) of octopus...

76 FR 64248 - Gulf of Mexico Reef Fish Fishery; Closure of the 2011 Gulf of Mexico Commercial Sector for...

Science.gov (United States)

2011-10-18

.... 040205043-4043-01] RIN 0648-XA766 Gulf of Mexico Reef Fish Fishery; Closure of the 2011 Gulf of Mexico... the commercial sector for greater amberjack in the exclusive economic zone (EEZ) of the Gulf of Mexico... Reef Fish Resources of the Gulf of Mexico (FMP). The FMP was prepared by the Gulf of Mexico Fishery...

Subcutaneous Administration of Low-Molecular-Weight Heparin to Horses Inhibits Ex Vivo Equine Herpesvirus Type 1-Induced Platelet Activation

Directory of Open Access Journals (Sweden)

Tracy Stokol

2018-05-01

Full Text Available Equine herpesvirus type 1 (EHV-1 is a major cause of infectious respiratory disease, abortion and neurologic disease. Thrombosis in placental and spinal vessels and subsequent ischemic injury in EHV-1-infected horses manifests clinically as abortion and myeloencephalopathy. We have previously shown that addition of heparin anticoagulants to equine platelet-rich plasma (PRP can abolish ex vivo EHV-1-induced platelet activation. The goal of this study was to test whether platelets isolated from horses treated with unfractionated heparin (UFH or low-molecular-weight heparin (LMWH were resistant to ex vivo EHV-1-induced activation. In a masked, block-randomized placebo-controlled cross-over trial, 9 healthy adult horses received 4 subcutaneous injections at q. 12 h intervals of one of the following treatments: UFH (100 U/kg loading dose, 3 maintenance doses of 80 U/kg, 2 doses of LMWH (enoxaparin 80 U/kg 24 h apart with saline at the intervening 12 h intervals, or 4 doses of saline. Blood samples were collected before treatment and after 36 h, 40 h (4 h after the last injection and 60 h (24 h after the last injection. Two strains of EHV-1, Ab4 and RacL11, were added to PRP ex vivo and platelet membrane expression of P selectin was measured as a marker of platelet activation. Drug concentrations were monitored in a Factor Xa inhibition (anti-Xa bioassay. We found that LMWH, but not UFH, inhibited platelet activation induced by low concentrations (1 × 106 plaque forming units/mL of both EHV-1 strains at 40 h. At this time point, all horses had anti-Xa activities above 0.1 U/ml (range 0.15–0.48 U/ml with LMWH, but not UFH. By 60 h, a platelet inhibitory effect was no longer detected and anti-Xa activity had decreased (range 0.03 to 0.07 U/ml in LMWH-treated horses. Neither heparin inhibited platelet activation induced by high concentrations (5 × 106 plaque forming units/mL of the RacL11 strain. We found substantial between horse

Kaitsevägi hangib iseliikuvaid suurtükke / Andres Einmann

Index Scriptorium Estoniae

Einmann, Andres

2013-01-01

Kaitseministeerium kulutab tuleval aastal investeeringuteks 43,26 miljonit eurot. Kavas on hankida uut sõjatehnikat: suurtükke ja lahingumasinaid, teine Thales Raytheoni Ground Master 403 tüüpi radar, Sisu XA-188 soomukeid. Suurim projekt on viie kasarmu ehitamine: aasta lõpuks valmivad neli kasarmut Võrus, Jõhvis ja Ämaris ning peale selle renoveeritakse üks hoone Miinisadamas

O Jardim dos Sonhos

Directory of Open Access Journals (Sweden)

RAUL CÂNOVAS

2010-06-01

Full Text Available O jardim dos sonhos sempre foi um ideal dos homens. No Antigo Egito, já se falava em um jardim sempre verde para onde as pessoas de bom coração iam após a morte. E na mitologia grega, um lindo jardim era palco das festas bucólicas dos deuses. As grandes religiões também citavam jardins como paraísos, como o Jardim do Éden. Neste artigo, Raul Cânovas nos leva a refletir sobre o sentido de um “jardim perfeito”, sem tratar a perfeição como apenas plástica e estruturada com exatidão, mas referindo-se a um jardim que nos inspire e emocione, emancipado de modismos passageiros. O paisagista também nos alerta sobre as condições mutáveis de um jardim, que nunca está finalizado. O paisagismo não é apenas técnica; é também sensibilidade, utilidade, sustentabilidade e equilíbrio das forças da natureza.

JICA -- working from the grass roots up. Vietnam.

Science.gov (United States)

1997-11-01

The fact that Japan has reduced its foreign aid by 10% for fiscal 1998 will require the Japan International Cooperation Agency's (JICA) Medical Cooperation Department (MCD) to review both the number of projects it funds and program management. The MCD is developing new guidelines for primary health care programs that will reflect the principles embedded in the Program of Action of the 1994 International Conference on Population and Development. The managing director of the MCD believes that an effective way to promote primary health care is to focus on reproductive health/family planning and then broaden the scope of activities. The current reproductive health project being implemented in Nghe An Province of Viet Nam is expected to make a great contribution to the improvement of community health. The MCD also wants to explore bottom-up primary health care approaches with the cooperation of nongovernmental organizations (NGOs). Thus, the Viet Nam project is being conducted in collaboration with the NGO JOICFP and may pioneer new avenues in governmental/NGO cooperation worldwide. The new budget cuts will force JICA to review its disbursement and project management procedures. Thus, all future projects will use the project cycle management approach, including the use of a participatory project design matrix. JICA will also be fostering a sense of ownership of projects from the grassroots to the national level that will allow projects to become sustainable.

INTERNALISASI STANDAR HAM INTERNASIONAL DALAM PENGUJIAN UNDANG-UNDANG OLEH MAHKAMAH KONSTITUSI

Directory of Open Access Journals (Sweden)

Titon Slamet Kurnia

2016-06-01

Tulisan ini membahas isu proses internalisasi standar HAM internasional dalam forum domestik melalui mekanisme pengujian konstitusionalitas undang-undang oleh MKRI. Tulisan ini berargumen bahwa MKRI seyogianya mempertimbangkan standar HAM internasional dalam menguji konstitusionalitas undangundang berdasarkan Bab XA UUD NRI 1945. Argumen itu didasarkan pada preskripsi bahwa standar HAM internasional berlaku/mengikat kepada negara dan mensyaratkannya untuk menyesuaikan undangundang beserta tindakan pejabatnya dengan kaidah HAM internasional tersebut

Resonant Tunneling Quantum Well Integrated Optical Waveguide Modulator/ Switch

Science.gov (United States)

1994-07-01

perform this task. However, our search was not successful . Fortunately, we developed our own software as part of a Phase II SBIR program entitled...scattered waves can be represented as 5 Pinal 0794.3246 AF-QUANT Cont. No. F49620-94.C-0008 n=0T = tLt2.Le ikea (rrei2k2P, (I)i~k,Xa a, t1Lt2Le jklxa

Dosimetry characterization and clinical application of Exa skin: Bolus of high of high density for use with photons; Caracterizacion dosimetrica y aplicacion clinica de Exaskin: bolus de alta densidad para uso con fotones

Energy Technology Data Exchange (ETDEWEB)

Ortiz Seidel, M.; Velazquez Miranda, S.

2013-07-01

Bolus of high density eXaSkin of density 1.6 g/cm{sub 3} is calculated correctly in the planning systems, is easy to use and generates optimum coupling with the radiation area, at the same time which is easily reproducible in their placement, avoiding the use of electron beams. On the other hand its behavior varies very slightly with the presence of air gaps. (Author)

End modes in arrays of modulated Su–Schrieffer–Heeger chains

Indian Academy of Sciences (India)

2016-07-15

Jul 15, 2016 ... is not an edge mode. For no other combination of XA,. XB and φ investigated in this work, could one obtain such a spectrum. Wavefunction of all the edge modes is similar to that obtained in a chain with all NNN terms modulated. To study the effect of the presence of other chains and to find if such states are ...

The pepper Bs4C proteins are localized to the endoplasmic reticulum (ER) membrane and confer disease resistance to bacterial blight in transgenic rice.

Science.gov (United States)

Wang, Jun; Zeng, Xuan; Tian, Dongsheng; Yang, Xiaobei; Wang, Lanlan; Yin, Zhongchao

2018-03-30

Transcription activator-like effector (TALE)-dependent dominant disease resistance (R) genes in plants, also referred to as executor R genes, are induced on infection by phytopathogenic bacteria of the genus Xanthomonas harbouring the corresponding TALE genes. Unlike the traditional R proteins, the executor R proteins do not determine the resistance specificity and may function broadly in different plant species. The executor R gene Bs4C-R in the resistant genotype PI 235047 of the pepper species Capsicum pubescens (CpBs4C-R) confers disease resistance to Xanthomonas campestris pv. vesicatoria (Xcv) harbouring the TALE genes avrBsP/avrBs4. In this study, the synthetic genes of CpBs4C-R and two other Bs4C-like genes, the susceptible allele in the genotype PI585270 of C. pubescens (CpBs4C-S) and the CaBs4C-R homologue gene in the cultivar 'CM334' of Capsicum annum (CaBs4C), were characterized in tobacco (Nicotiana benthamiana) and rice (Oryza sativa). The Bs4C genes induced cell death in N. benthamiana. The functional Bs4C-eCFP fusion proteins were localized to the endoplasmic reticulum (ER) membrane in the leaf epidermal cells of N. benthamiana. The Xa10 promoter-Bs4C fusion genes in transgenic rice conferred strain-specific disease resistance to Xanthomonas oryzae pv. oryzae (Xoo), the causal agent of bacterial blight in rice, and were specifically induced by the Xa10-incompatible Xoo strain PXO99 A (pHM1avrXa10). The results indicate that the Bs4C proteins from pepper species function broadly in rice and the Bs4C protein-mediated cell death from the ER is conserved between dicotyledonous and monocotyledonous plants, which can be utilized to engineer novel and enhanced disease resistance in heterologous plants. © 2018 TEMASEK LIFE SCIENCES LABORATORY. MOLECULAR PLANT PATHOLOGY © 2018 JOHN WILEY & SONS LTD.

Rivaroxaban limits complement activation compared with warfarin in antiphospholipid syndrome patients with venous thromboembolism.

Science.gov (United States)

Arachchillage, D R J; Mackie, I J; Efthymiou, M; Chitolie, A; Hunt, B J; Isenberg, D A; Khamashta, M; Machin, S J; Cohen, H

2016-11-01

Essentials Complement activation has a pathogenic role in thrombotic antiphospholipid syndrome (APS). Coagulation proteases such as factor Xa can activate complement proteins. Complement activation markers were elevated in anticoagulated thrombotic APS patients. Complement activation decreased in APS patients switching from warfarin to rivaroxaban. Background Complement activation may play a major role in the pathogenesis of thrombotic antiphospholipid syndrome (APS). Coagulation proteases such as factor Xa can activate complement proteins. Aims To establish whether rivaroxaban, a direct factor Xa inhibitor, limits complement activation compared with warfarin in APS patients with previous venous thromboembolism (VTE). Methods A total of 111 APS patients with previous VTE, on warfarin target INR 2.5, had blood samples taken at baseline and at day 42 after randomization in the RAPS (Rivaroxaban in Antiphospholipid Syndrome) trial. Fifty-six patients remained on warfarin and 55 switched to rivaroxaban. Fifty-five normal controls (NC) were also studied. Markers of complement activation (C3a, C5a, terminal complement complex [SC5b-9] and Bb fragment) were assessed. Results APS patients had significantly higher complement activation markers compared with NC at both time-points irrespective of the anticoagulant. There were no differences between the two patient groups at baseline, or patients remaining on warfarin at day 42. In 55 patients randomized to rivaroxaban, C3a, C5a and SC5b-9 were lower at day 42 (median (ng mL -1 ) [confidence interval] 64 [29-125] vs. 83 [35-147], 9 [2-15] vs. 12 [4-18] and 171 [56-245] vs. 201 [66-350], respectively) but levels of Bb fragment were unchanged. There were no correlations between rivaroxaban levels and complement activation markers. Conclusions APS patients with previous VTE on warfarin exhibit increased complement activation, which is likely to occur via the classical pathway and is decreased by rivaroxaban administration

Single- and multiple-dose pharmacokinetics, pharmacodynamics, and safety of apixaban in healthy Chinese subjects

Directory of Open Access Journals (Sweden)

Cui Y

2013-12-01

Full Text Available Yimin Cui,1 Yan Song,2 Jessie Wang,2 Zhigang Yu,2 Alan Schuster,2 Yu Chen Barrett,2 Charles Frost2 1Peking University First Hospital, Beijing, People's Republic of China; 2Bristol-Myers Squibb, Princeton, NJ, USA Background: The pharmacokinetics (PK, pharmacodynamics (PD, and safety of apixaban were assessed in healthy Chinese subjects in this randomized, placebo-controlled, double-blind, single-sequence, single- and multiple-dose study. Subjects and methods: Eighteen subjects 18–45 years of age were randomly assigned (2:1 ratio to receive apixaban or matched placebo. Subjects received a single 10 mg dose of apixaban or placebo on day 1, followed by 10 mg apixaban or placebo twice daily for 6 days (days 4–9. The PK and PD of apixaban were assessed by collecting plasma samples for 72 hours following the dose on day 1 and the morning dose on day 9, and measuring apixaban concentration and anti-Xa activity. Safety was assessed via physical examinations, vital sign measurements, electrocardiograms, and clinical laboratory evaluations. Results: PK analysis showed similar characteristics of apixaban after single and multiple doses, including a median time to maximum concentration of ~3 hours, mean elimination half-life of ~11 hours, and renal clearance of ~1.2 L/hour. The accumulation index was 1.7, consistent with twice-daily dosing and the observed elimination half-life. Single-dose data predict multiple-dose PK, therefore apixaban PK are time-independent. The relationship between anti-Xa activity and plasma apixaban concentrations appears to be linear. Apixaban was safe and well tolerated, with no bleeding-related adverse events reported. Conclusion: Apixaban was safe and well tolerated in healthy Chinese subjects. Apixaban PK and PD were predictable and consistent with findings from previous studies in Asian and non-Asian subjects. The administration of apixaban does not require any dose modification based on race. Keywords: apixaban, oral

Dissolution of targets for the production of Mo-99: Part 1. Influence of NaOH concentration and the addition of NaNO{sub 3} and NaNO{sub 2} on the dissolution time

Energy Technology Data Exchange (ETDEWEB)

Camilo, Ruth L.; Araujo, Izilda da C.; Mindrisz, Ana C.; Forbicini, Christina A.L.G. de O., E-mail: rcamilo@ipen.br, E-mail: icaraujo@ipen.br, E-mail: acmindri@ipen.br, E-mail: cforbici@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN/SP), Sao Paulo, SP (Brazil)

2011-07-01

Faced with global crisis in the production of radioisotope {sup 99}Mo, which product of decay, {sup 99}mTc, is the tracer element most often used in nuclear medicine and accounts for about 80% of all diagnostic procedures in vivo, since September 2008 Brazil is developing the project called Brazilian Multipurpose Reactor (RMB). Within the Brazilian Nuclear Program (PNB) the construction of the RMB, is seen as a long term solution to meet all domestic demand relative to the supply of radioisotopes and radiopharmaceuticals. In the process to be studied to obtain {sup 99}Mo from irradiated UA1{sub x}-A1 LEU targets employing alkaline dissolution, processing time should be minimized, considering the short half life of {sup 99}Mo and {sup 99}mTc, about 66 h and 6 h, respectively. That makes dissolution time a significant factor in the development of the process. This paper presents the results of alkaline dissolution of scraps of Al, used to simulate the dissolution process of UA1{sub x}-A1 targets. Al corresponds to about 79% of the total weight of the UA1{sub x}-A1 target. The effect of NaOH concentration on dissolution time for the interval of 1 to 3.5 mol.L-1 was studied, keeping the molar ratio in 1Al:2.16NaOH and the initial temperature of 88 degree C. The influence of reagent composition over dissolution time was studied using three different solutions: a) 3 mol.L{sup -1} NaOH, b) 3 mol.L{sup -1} NaOH/NaNO{sub 3} and c) 3 mol.L{sup -1} NaOH/NaNO{sub 2}, keeping the same molar ratio and temperature. The results showed that the dissolution time decreases with increasing NaOH concentration and the addition of NaNO{sub 3} or NaNO{sub 2} in the NaOH solution reduces both dissolution time and volume of gases released. (author)

International Conference on Organometallic Chemistry (13th) Held in Torino, Europe on 4-9 September 1988. Abstracts

Science.gov (United States)

1988-09-09

190, 8057 ZUrich, Switzerland Joseph Edwin and William E.Geiger, Department of Chemistry, University of Vermont, Burlington, Vermont, 05405 Arnold L...On Synthesis Of Dialkyl d-Trimethylsilyloxyalkylphosphonates Zhao Yong-Zhen and Li Zhong- Rua Dpartment o chemistry, Hua Zhong Normal University, Wuhan...Jose Vicente. Jose-AntelC hAd. Na-Yeij~xa Qhicote. Ju~an-Francisco Gutliez-Jugo. Carmen Ramirez do Arel lano. Departamento do Oulmica InordanIca

Drug: D09737 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available D09737 Drug Epoetin kappa (INN); Epoetin kappa (genetical recombination) (Epoetin ...alfa biosimilar 1) (JAN); Epoetin alfa BS (TN) ... C809H1301N229O240S5 ... APPRLICDSR VLERYLLEAK EAENITTGCA EHCSLN...c category: 3999 ATC code: B03XA01 Chemical group: DG00177 ... See Epoetin alfa [DR:D03231] EPOR [HSA:2057] [KO:K05079] ... CAS: 879555-13-2 PubChem: 124490477 ...

Comparison of effective dose for imaging of mandible between multi-detector CT and cone-beam CT

International Nuclear Information System (INIS)

Jeong, Dae Kyo; Lee, Sang Chul; Huh, Kyung Hoe; Yi, Won Jin; Lee, Sam Sun; Choi, Soon Chul

2012-01-01

The aim of this study was to compare the effective dose for imaging of mandible between multi-detector computed tomography (MDCT) and cone-beam computed tomography (CBCT). An MDCT with low dose technique was also compared with them. Thermoluminescent dosimeter (TLD) chips were placed at 25 organ sites of an anthropomorphic phantom. The mandible of the phantom was exposed using 2 different types of MDCT units (Somatom Sensation 10 for standard-dose MDCT, Somatom Emotion 6 for low-dose MDCT) and 3 different CBCT units (AZ3000CT, Implagraphy, and Kavo 3D eXaM). The radiation absorbed dose was measured and the effective dose was calculated according to the ICRP 2007 report. The effective dose was the highest for Somatom Sensation 10 (425.84 μSv), followed by AZ3000CT (332.4 μSv), Somatom Emotion 6 (199.38 μSv), and 3D eXaM (111.6 μSv); it was the lowest for Implagraphy (83.09 μSv). The CBCT showed significant variation in dose level with different device. The effective doses of MDCTs were not significantly different from those of CBCTs for imaging of mandible. The effective dose of MDCT could be markedly decreased by using the low-dose technique.

Thermal-hydraulic analysis of research reactor core with different LEU fuel types using RELAP5

Energy Technology Data Exchange (ETDEWEB)

El-Sahlamy, Neama M. [Nuclear and Radiological Regulatory Authority, Cairo (Egypt)

2017-11-15

In the current work, comparisons between the core performances when using different LEU fuels are done. The fuels tested are UA1{sub X}-A1, U{sub 3}O{sub 8}-Al, and U{sub 3}Si{sub 2}-Al fuels with 19.7 % enrichment. Calculations are done using RELAP5 code to evaluate the thermal-hydraulic performance of the IAEA benchmark 10 MW reactor. First, a reassessment of the slow reactivity insertion transient with UA1{sub X}-A1 LEU fuel to compare the results with those reported in the IAEA TECDOC [1]. Then, comparisons between the thermal-hydraulic core performances when using the three LEU fuels are done. The assessment is performed at initial power of 1.0 W. The reactor power is calculated using the RELAP5 point kinetic model. The reactivity feedback, from changes in water density and fuel temperature, is considered for all cases. From the results it is noticed that U{sub 3}Si{sub 2}-Al fuel gives the best fuel performance since it has the minimum value of peak fuel temperature and the minimum peak clad surface temperature, as operating parameters. Also, it gives the maximum value of the Critical Heat Flux Ratio and the lowest tendency to flow instability occurrence.

Compression of digital images in radiology. Results of a consensus conference; Kompression digitaler Bilddaten in der Radiologie. Ergebnisse einer Konsensuskonferenz

Energy Technology Data Exchange (ETDEWEB)

Loose, R. [Klinikum Nuernberg-Nord (Germany). Inst. fuer Diagnostische und Interventionelle Radiologie; Braunschweig, R. [BG Kliniken Bergmannstrost, Halle/Saale (Germany). Klinik fuer Bildgebende Diagnostik und Interventionsradiologie; Kotter, E. [Universitaetsklinikum Freiburg (Germany). Abt. Roentgendiagnostik; Mildenberger, P. [Mainz Univ. (Germany). Klinik und Poliklinik fuer Diagnostische und Interventionelle Radiologie; Simmler, R.; Wucherer, M. [Klinikum Nuernberg (Germany). Inst. fuer Medizinische Physik

2009-01-15

Purpose: Recommendations for lossy compression of digital radiological DICOM images in Germany by means of a consensus conference. The compression of digital radiological images was evaluated in many studies. Even though the results demonstrate full diagnostic image quality of modality-dependent compression between 1:5 and 1:200, there are only a few clinical applications. Materials and Methods: A consensus conference with approx. 80 interested participants (radiology, industry, physics, and agencies) without individual invitation was organized by the working groups AGIT and APT of the German Roentgen Society DRG to determine compression factors without loss of diagnostic image quality for different anatomical regions for CT, CR/DR, MR, RF/XA examinations. The consent level was specified as at least 66 %. Results: For individual modalities the following compression factors were recommended: CT (brain) 1:5, CT (all other applications) 1:8, CR/DR (all applications except mammography) 1:10, CR/DR (mammography) 1:15, MR (all applications) 1:7, RF/XA (fluoroscopy, DSA, cardiac angio) 1:6. The recommended compression ratios are valid for JPEG and JPEG 2000 /Wavelet compressions. Conclusion: The results may be understood as recommendations and indicate limits of compression factors with no expected reduction of diagnostic image quality. They are similar to the current national recommendations for Canada and England. (orig.)

Multiaxial ratcheting behavior of zirconium alloy tubes under combined cyclic axial load and internal pressure

Energy Technology Data Exchange (ETDEWEB)

Chen, G.; Zhang, X. [School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Xu, D.K. [Environmental Corrosion Center, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China); Li, D.H. [Hunan Taohuajiang Nuclear Power Co., Ltd, Yiyang, 413000 (China); Chen, X. [School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Zhang, Z., E-mail: zhe.zhang@tju.edu.cn [School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China)

2017-06-15

In this study, a series of uniaxial and multiaxial ratcheting tests were conducted at room temperature on zirconium alloy tubes. The experimental results showed that for uniaxial symmetrical cyclic test, the axial ratcheting strain ɛ{sub x} did not accumulate obviously in initial stage, but gradually increased up to 1% with increasing stress amplitude σ{sub xa}. For multiaxial ratcheting tests, the zirconium alloy tube was highly sensitive to both the axial stress amplitude σ{sub xa} and the internal pressure p{sub i}. The hoop ratcheting strain ɛ{sub θ} increased continuously with the increase of axial stress amplitude, whereas the evolution of axial ratcheting strain ɛ{sub x} was related to the axial stress amplitude. The internal pressure restricted the ratcheting accumulation in the axial direction, but promoted the hoop ratcheting strain on the contrary. The prior loading history greatly restrained the ratcheting behavior of subsequent cycling with a small internal pressure. - Highlights: •Uniaxial and multiaxial ratcheting behavior of the zirconium alloy tubes are investigated at room temperature. •The ratcheting depends greatly on the stress amplitude or internal pressure. •The interaction between the axial and hoop ratcheting mechanisms is greatly dependent on the internal pressure level. •The ratcheting is influenced significantly by the loading history of internal pressure.

A microbially derived tyrosine-sulfated peptide mimics a plant peptide hormone.

Science.gov (United States)

Pruitt, Rory N; Joe, Anna; Zhang, Weiguo; Feng, Wei; Stewart, Valley; Schwessinger, Benjamin; Dinneny, José R; Ronald, Pamela C

2017-07-01

The biotrophic pathogen Xanthomonas oryzae pv. oryzae (Xoo) produces a sulfated peptide named RaxX, which shares similarity to peptides in the PSY (plant peptide containing sulfated tyrosine) family. We hypothesize that RaxX mimics the growth-stimulating activity of PSY peptides. Root length was measured in Arabidopsis and rice treated with synthetic RaxX peptides. We also used comparative genomic analyses and reactive oxygen species burst assays to evaluate the activity of RaxX and PSY peptides. Here we found that a synthetic sulfated RaxX derivative comprising 13 residues (RaxX13-sY), highly conserved between RaxX and PSY, induces root growth in Arabidopsis and rice in a manner similar to that triggered by PSY. We identified residues that are required for activation of immunity mediated by the rice XA21 receptor but that are not essential for root growth induced by PSY. Finally, we showed that a Xanthomonas strain lacking raxX is impaired in virulence. These findings suggest that RaxX serves as a molecular mimic of PSY peptides to facilitate Xoo infection and that XA21 has evolved the ability to recognize and respond specifically to the microbial form of the peptide. © 2017 UT-Battelle LLC. New Phytologist © 2017 New Phytologist Trust.

Comparison of effective dose for imaging of mandible between multi-detector CT and cone-beam CT

Energy Technology Data Exchange (ETDEWEB)

Jeong, Dae Kyo; Lee, Sang Chul; Huh, Kyung Hoe; Yi, Won Jin; Lee, Sam Sun; Choi, Soon Chul [School of Dentistry, Seoul National University, Seoul (Korea, Republic of)

2012-06-15

The aim of this study was to compare the effective dose for imaging of mandible between multi-detector computed tomography (MDCT) and cone-beam computed tomography (CBCT). An MDCT with low dose technique was also compared with them. Thermoluminescent dosimeter (TLD) chips were placed at 25 organ sites of an anthropomorphic phantom. The mandible of the phantom was exposed using 2 different types of MDCT units (Somatom Sensation 10 for standard-dose MDCT, Somatom Emotion 6 for low-dose MDCT) and 3 different CBCT units (AZ3000CT, Implagraphy, and Kavo 3D eXaM). The radiation absorbed dose was measured and the effective dose was calculated according to the ICRP 2007 report. The effective dose was the highest for Somatom Sensation 10 (425.84 {mu}Sv), followed by AZ3000CT (332.4 {mu}Sv), Somatom Emotion 6 (199.38 {mu}Sv), and 3D eXaM (111.6 {mu}Sv); it was the lowest for Implagraphy (83.09 {mu}Sv). The CBCT showed significant variation in dose level with different device. The effective doses of MDCTs were not significantly different from those of CBCTs for imaging of mandible. The effective dose of MDCT could be markedly decreased by using the low-dose technique.

Multiaxial ratcheting behavior of zirconium alloy tubes under combined cyclic axial load and internal pressure

International Nuclear Information System (INIS)

Chen, G.; Zhang, X.; Xu, D.K.; Li, D.H.; Chen, X.; Zhang, Z.

2017-01-01

In this study, a series of uniaxial and multiaxial ratcheting tests were conducted at room temperature on zirconium alloy tubes. The experimental results showed that for uniaxial symmetrical cyclic test, the axial ratcheting strain ɛ x did not accumulate obviously in initial stage, but gradually increased up to 1% with increasing stress amplitude σ xa . For multiaxial ratcheting tests, the zirconium alloy tube was highly sensitive to both the axial stress amplitude σ xa and the internal pressure p i . The hoop ratcheting strain ɛ θ increased continuously with the increase of axial stress amplitude, whereas the evolution of axial ratcheting strain ɛ x was related to the axial stress amplitude. The internal pressure restricted the ratcheting accumulation in the axial direction, but promoted the hoop ratcheting strain on the contrary. The prior loading history greatly restrained the ratcheting behavior of subsequent cycling with a small internal pressure. - Highlights: •Uniaxial and multiaxial ratcheting behavior of the zirconium alloy tubes are investigated at room temperature. •The ratcheting depends greatly on the stress amplitude or internal pressure. •The interaction between the axial and hoop ratcheting mechanisms is greatly dependent on the internal pressure level. •The ratcheting is influenced significantly by the loading history of internal pressure.

Search for and study of the effective mass spectra of nucleon clusters produced in relativistic nucleon collisions

International Nuclear Information System (INIS)

Didenko, L.A.; Grishin, V.G.; Kuznetsov, A.A.

1991-01-01

The effective mass spectra of nucleon clusters, produced in p, d, He and C collisions with carbon nuclei at P=4.2xA GeV/c are studied. The results obtained show that clusters with proton multiplicity n p =2 and 3 can be interpreted as decay products of nucleon resonances with a width from a few MeV to a few tens MeV. 11 refs.; 6 figs.; 4 tabs

Single- and multiple-dose pharmacokinetics, pharmacodynamics, and safety of apixaban in healthy Chinese subjects [Corrigendum

Directory of Open Access Journals (Sweden)

Cui Y

2014-03-01

Full Text Available Cui Y, Song Y, Wang J, et al. Clinical Pharmacology: Advances and Applications. 2013;5(1:177–184.Note that on page 182, Figure 3 should be corrected as follows, with the line for mean anti-Xa activity extended through to 72 hours post dose on Day 9, and the Day 1 plasma apixaban concentration-time profile rendering error bars and symbols more visually apparent.Read the original article

Assessment of VME-PCI Interfaces with Linux Drivers

CERN Document Server

Schossmater, K; CERN. Geneva

2000-01-01

Abstract This report summarises the performance measurements and experiences recorded by testing three commercial VME-PCI interfaces with their Linux drivers. These interfaces are manufactured by Wiener, National Instruments and SBS Bit 3. The developed C programs are reading/writing a VME memory in different transfer modes via these interfaces. A dual processor HP Kayak XA-s workstation was used with the CERN certified Red Hat Linux 6.1 running on it.

Application of QA geoscience investigations

International Nuclear Information System (INIS)

Henderson, J.T.

1980-01-01

This paper discusses the evolution of a classical hardware QA program (as currently embodied in DOE/ALO Manual Chapter 08XA; NRC 10CFR Part 50, Appendix B; and other similar documents) into the present geoscience quality assurance programs that address eventual NRC licensing, if required. In the context of this paper, QA will be restricted to the tasks associated with nuclear repositories, i.e. site identification, selection, characterization, verification, and utilization

JPRS Report, Science & Technology, 16th International Congress of the International Society for Photogrammetry and Remote Sensing -- Volume 2

Science.gov (United States)

1989-01-27

Rego Barbosa, Osvaldo Caldas; MCT - MINISTERIO DA CIENCIA E TECNOLOGIA , INPE - INSTITUTO DE PESQUISAS ESPACIAIS, Rod. Presidente Dutra, km 40 12630...economic crisis tne country J.- xa^+ y recoanition from the governmental planners of the priorities ana importance of INPE’s role...87 8, 216 430 8, 646 The situation changed and in the last three years a clear -cove^is being observed. Not only Jh«* •=>«* fche u-er tenden y

SKS splitting observed at Romanian broad-band seismic network

Science.gov (United States)

Ivan, Marian; Popa, Mihaela; Ghica, Daniela

2008-12-01

Shear-wave splitting results are presented for the broad-band stations of the Romanian seismic network. For stations BUC1 and CRAR (located in Moesian Platform), IAS (in East-European Platform), TIRR and CVD (in Central Dobrudja-Black Sea microplate), TIM and DRGR (in Dacia-Tisza plate, including Apuseni Mts.), BURAR, BZS and GZR (in, or very close to the Carpathian Arc), the fast directions ( φ) are around 135°. The mean delay values ( δt) of the slow wave are slightly greater for the stations placed in platform areas ( δt ~ 1.5 s) than for the stations situated in the (proximity) of Carpathians ( δt ~ 1.2 s). For the MLR station located in the South-Western part of Vrancea area, at the Carpathian Bend, the fast direction is 48°, similar to VOIR station (located in Southern Carpathians, 70 km West of MLR). At VRI and PLOR, located in the North-Eastern part of Vrancea, the fast axis is oriented approximately on North-South direction, with a possible dependence of the splitting parameters with back azimuth. At least for some stations, the splitting results are not consistent with vertical coherent lithospheric anisotropy.

Porphyrinic metal-organic framework/macroporous carbon composites for electrocatalytic applications

International Nuclear Information System (INIS)

Yin, Duanduan; Liu, Jian; Bo, Xiangjie; Li, Mian; Guo, Liping

2017-01-01

Graphical abstract: Zr-PorMOF/MPC composites were prepared, which used to detect H 2 O 2 and simultaneously detect UA, XA and HX Display Omitted -- Highlights: •Preparing Zr-PorMOF/MPC composites by a simple one-step solvothermal reaction. •Enhanced electrocatalytic activity at Zr-PorMOF/MPC than Zr-PorMOF and MPC. •A low detection limit, short response time and low applied potential towards H 2 O 2 reduction. •Simultaneous determination of UA, XA and HX. -- Abstract: In this work, a novel porphyrinic metal-organic framework-based composite has been successfully synthesized by a simple one-step solvothermal method through growing Zr-PorMOF on macroporous carbon (MPC). Porphyrin-base MOFs combining the structural adjustable of MOFs and the specific catalytic activity of biomimetic catalysts play an important role in electrocatalysis. A series of characterization show that the roles of MPC as follow: (1) MPC could avoid the agglomeration of Zr-PorMOF particles and increase the specific surface area; (2) MPC could improve the electrochemical stability of Zr-PorMOF particles; (3) MPC could reduce the electron transfer resistance. Therefore, MPC plays the role of the conductive bridges to provide facile charge transport. The obtained Zr-PorMOF/MPC composites exhibit much better electrocatalytic activity for the reduction of hydrogen peroxide (H 2 O 2 ) than the pristine Zr-PorMOF due to the synergy of Zr-PorMOF and MPC. This enzyme-free H 2 O 2 sensor shows two linear relationships in the ranges 0.5–137 μM (R 2 = 0.991, sensitivity = 66 μA mM −1 ) and 137–3587 μM (R 2 = 0.993, sensitivity = 16 μA mM −1 ), with a low over-potential at −0.2 V, a fast response time within 1 s and a low limit of detection (LOD) of 0.18 μM. Moreover, Zr-PorMOF/MPC composites were used to simultaneously detect uric acid (UA), xanthine (XA) and hypoxanthine (HX). These three substances are degradation products of purine metabolism. In addition, Zr-PorMOF/MPC composites

Estimating Crustal Properties Directly from Satellite Tracking Data by Using a Topography-based Constraint

Science.gov (United States)

Goossens, S. J.; Sabaka, T. J.; Genova, A.; Mazarico, E. M.; Nicholas, J. B.; Neumann, G. A.; Lemoine, F. G.

2017-12-01

The crust of a terrestrial planet is formed by differentiation processes in its early history, followed by magmatic evolution of the planetary surface. It is further modified through impact processes. Knowledge of the crustal structure can thus place constraints on the planet's formation and evolution. In particular, the average bulk density of the crust is a fundamental parameter in geophysical studies, such as the determination of crustal thickness, studies of the mechanisms of topography support, and the planet's thermo-chemical evolution. Yet even with in-situ samples available, the crustal density is difficult to determine unambiguously, as exemplified by the results for the Gravity and Recovery Interior Laboratory (GRAIL) mission, which found an average crustal density for the Moon that was lower than generally assumed. The GRAIL results were possible owing to the combination of its high-resolution gravity and high-resolution topography obtained by the Lunar Orbiter Laser Altimeter (LOLA) onboard the Lunar Reconnaissance Orbiter (LRO), and high correlations between the two datasets. The crustal density can be determined by its contribution to the gravity field of a planet, but at long wavelengths flexure effects can dominate. On the other hand, short-wavelength gravity anomalies are difficult to measure, and either not determined well enough (other than at the Moon), or their power is suppressed by the standard `Kaula' regularization constraint applied during inversion of the gravity field from satellite tracking data. We introduce a new constraint that has infinite variance in one direction, called xa . For constraint damping factors that go to infinity, it can be shown that the solution x becomes equal to a scale factor times xa. This scale factor is completely determined by the data, and we call our constraint rank-minus-1 (RM1). If we choose xa to be topography-induced gravity, then we can estimate the average bulk crustal density directly from the data

The discovery of glycine and related amino acid-based factor Xa inhibitors

Energy Technology Data Exchange (ETDEWEB)

Kohrt, Jeffrey T.; Filipski, Kevin J.; Cody, Wayne L.; Bigge, Christopher F.; La, Frances; Welch, Kathleen; Dahring, Tawny; Bryant, John W.; Leonard, Daniele; Bolton, Gary; Narasimhan, Lakshmi; Zhang, Erli; Peterson, J. Thomas; Haarer, Staci; Sahasrabudhe, Vaishali; Janiczek, Nancy; Desiraju, Shrilakshmi; Hena, Mostofa; Fiakpui, Charles; Saraswat, Neerja; Sharma, Raman; Sun, Shaoyi; Maiti, Samarendra N.; Leadley, Robert; Edmunds, Jeremy J. (Naeja); (Pfizer)

2010-12-03

Herein, we report on the identification of three potent glycine and related amino acid-based series of FXa inhibitors containing a neutral P1 chlorophenyl pharmacophore. A X-ray crystal structure has shown that constrained glycine derivatives with optimized N-substitution can greatly increase hydrophobic interactions in the FXa active site. Also, the substitution of a pyridone ring for a phenylsulfone ring in the P4 sidechain resulted in an inhibitor with enhanced oral bioavailability.

Regulation of Metastasis and DNA Damage Resistance Pathways by Transposable Elements

Science.gov (United States)

2014-10-01

significantly predictive of LMS expression in primary human tumors include: several TLRs, AIM2, IFI16, and RIG-I (Figure XA). 5 In order to test whether any of...108-121, October 2014. Highlighted in Cell 2014, Arnoult N and Karlseder J. ALT Telomeres Borrow from Meiosis to Get Moving. 8. Sawyer SL, Tian L...Approved for Public Release; Distribution Unlimited The views, opinions and/or findings contained in this report are those of the author(s) and

Xanthogranulomatous Appendicitis in a Child: Report of a Case and Review of the Literature

OpenAIRE

Al-Rawabdeh, Sura M.; Prasad, Vinay; King, Denis R.; Kahwash, Samir B.

2013-01-01

Xanthogranulomatous inflammation is a well-described inflammatory process, which may involve any organ but is most frequently encountered in the gall bladder and the kidney. There are rare reports of xanthogranulomatous appendicitis (XA) in the adult population, but only one brief mention of such a diagnosis in a child. In this report, we describe the case of an 11-year-old boy who presented with clinical signs and symptoms of acute appendicitis necessitating appendectomy. Upon microscopic ex...

Graphene prepared by one-pot solvent exfoliation as a highly sensitive platform for electrochemical sensing

Energy Technology Data Exchange (ETDEWEB)

Wu, Can; Cheng, Qin [Key Laboratory for Large-Format Battery Materials and System, Ministry of Education, School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China); Wu, Kangbing, E-mail: kbwu@hust.edu.cn [Key Laboratory for Large-Format Battery Materials and System, Ministry of Education, School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China); Wu, Gang [Materials Physics and Applications Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Li, Qing, E-mail: qing_li_2@brown.edu [Materials Physics and Applications Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

2014-05-01

Highlights: • Graphene was prepared by one-step solvent exfoliation as superior electrode material. • Compared with RGO, prepared graphene exhibited stronger signal enhancement. • A widespread and highly-sensitive electrochemical sensing platform was constructed. - Abstract: Graphene was easily obtained via one-step ultrasonic exfoliation of graphite powder in N-methyl-2-pyrrolidone. Scanning electron microscopy, transmission electron microscopy, Raman and particle size measurements indicated that the exfoliation efficiency and the amount of produced graphene increased with ultrasonic time. The electrochemical properties and analytical applications of the resulting graphene were systematically studied. Compared with the predominantly-used reduced graphene oxides, the obtained graphene by one-step solvent exfoliation greatly enhanced the oxidation signals of various analytes, such as ascorbic acid (AA), dopamine (DA), uric acid (UA), xanthine (XA), hypoxanthine (HXA), bisphenol A (BPA), ponceau 4R, and sunset yellow. The detection limits of AA, DA, UA, XA, HXA, BPA, ponceau 4R, and sunset yellow were evaluated to be 0.8 μM, 7.5 nM, 2.5 nM, 4 nM, 10 nM, 20 nM, 2 nM, and 1 nM, which are much lower than the reported values. Thus, the prepared graphene via solvent exfoliation strategy displays strong signal amplification ability and holds great promise in constructing a universal and sensitive electrochemical sensing platform.

A need for evidence-based clinical practice guidelines for the use of heparins in the elderly

Directory of Open Access Journals (Sweden)

Isabelle Gouin-Thibault

2010-04-01

Full Text Available Isabelle Gouin-Thibault1,2, Virginie Siguret1,2, Eric Pautas2,31Assistance Publique Hôpitaux de Paris, Laboratoire d’Hématologie, Hôpital Charles Foix, Paris, France; 2Université Paris Descartes, INSERM U, Paris, France; 3Assistance Publique Hôpitaux de Paris, Unité de Gériatrie Aiguë, Hôpital Charles Foix, Paris, FranceAbstract: Low-molecular-weight heparins (LMWHs have been widely studied in pivotal clinical trials or in several meta-analyses. However, the safety and optimal use of LMWHs in high-risk patients such as the very elderly remains uncertain since these patients are usually excluded from clinical trials. In terms of LMWHs in the elderly, the main concerns are renal failure and the risk of accumulation. A clinical approach consisting of a LMWH dose reduction in the elderly should be considered with great caution in terms of efficacy, since it has been tested neither in the treatment of VTE nor in VTE prophylaxis. If monitoring is considered in patients receiving therapeutic dose LMWHs, appropriate target ranges for peak anti-Xa activity levels should be used and so far, no anti-Xa activity-based guidelines have been issued. Moreover, no data support any laboratory monitoring in elderly patients treated with prophylactic dose LMWHs.Keywords: elderly patients, low-molecular-weight heparin, renal insufficiency, evidence-based medicine

Impact of Pre-Pregnancy BMI on B Vitamin and Inflammatory Status in Early Pregnancy: An Observational Cohort Study

Directory of Open Access Journals (Sweden)

Anne-Lise Bjørke-Monsen

2016-11-01

Full Text Available Maternal nutrition and inflammation have been suggested as mediators in the development of various adverse pregnancy outcomes associated with maternal obesity. We have investigated the relation between pre-pregnancy BMI, B vitamin status, and inflammatory markers in a group of healthy pregnant women. Cobalamin, folate, pyridoxal 5′-phosphate, and riboflavin; and the metabolic markers homocysteine, methylmalonic acid, and 3-hydroxykynurenine/xanthurenic acid ratio (HK/XA; and markers of cellular inflammation, neopterin and kynurenine/tryptophan ratio (KTR were determined in pregnancy week 18 and related to pre-pregnancy body mass index (BMI, in 2797 women from the Norwegian Mother and Child Cohort Study (MoBa. Pre-pregnancy BMI was inversely related to folate, cobalamin, pyridoxal 5′-phosphate (PLP, and riboflavin (p < 0.001, and associated with increased neopterin and KTR levels (p < 0.001. Inflammation seemed to be an independent predictor of low vitamin B6 status, as verified by low PLP and high HK/XA ratio. A high pre-pregnancy BMI is a risk factor for low B vitamin status and increased cellular inflammation. As an optimal micronutrient status is vital for normal fetal development, the observed lower B vitamin levels may contribute to adverse pregnancy outcomes associated with maternal obesity and B vitamin status should be assessed in women with high BMI before they get pregnant.

A linear functional differential equation with distributions in the input

Directory of Open Access Journals (Sweden)

Vadim Z. Tsalyuk

2003-10-01

Full Text Available This paper studies the functional differential equation $$ dot x(t = int_a^t {d_s R(t,s, x(s} + F'(t, quad t in [a,b], $$ where $F'$ is a generalized derivative, and $R(t,cdot$ and $F$ are functions of bounded variation. A solution is defined by the difference $x - F$ being absolutely continuous and satisfying the inclusion $$ frac{d}{dt} (x(t - F(t in int_a^t {d_s R(t,s,x(s}. $$ Here, the integral in the right is the multivalued Stieltjes integral presented in cite{VTs1} (in this article we review and extend the results in cite{VTs1}. We show that the solution set for the initial-value problem is nonempty, compact, and convex. A solution $x$ is said to have memory if there exists the function $x$ such that $x(a = x(a$, $x(b = x(b$, $ x(t in [x(t-0,x(t+0]$ for $t in (a,b$, and $frac{d}{dt} (x(t - F(t = int_a^t {d_s R(t,s,{x}(s}$, where Lebesgue-Stieltjes integral is used. We show that such solutions form a nonempty, compact, and convex set. It is shown that solutions with memory obey the Cauchy-type formula $$ x(t in C(t,ax(a + int_a^t C(t,s, dF(s. $$

Reversing the Effect of Oral Anticoagulant Drugs: Established and Newer Options.

Science.gov (United States)

Ansell, Jack E

2016-06-01

The vitamin K antagonists (VKAs) have been the standard (and only) oral anticoagulants used for the long-term treatment or prevention of venous thromboembolism or stroke in patients with atrial fibrillation. The coagulopathy induced by VKAs can be reversed with vitamin K, and in urgent situations, the vitamin K-dependent coagulation factors can be replaced by transfusion. In the last decade, a new class of oral anticoagulants has been developed, direct oral anticoagulants that bind to a specific coagulation factor and neutralize it. These compounds were shown to be effective and safe compared with the VKAs and were licensed for specific indications, but without a specific reversal agent. The absence of a reversal agent is a barrier to more widespread use of these agents. Currently, for the management of major life-threatening bleeding with the direct oral anticoagulants, most authorities recommend the use of four factor prothrombin complex concentrates. There are now three reversal agents in development and poised to enter the market. Idarucizumab is a specific antidote targeted to reverse the direct thrombin inhibitor, dabigatran, which was recently approved for use in the USA. Andexanet alfa is an antidote targeted to reverse the oral direct factor Xa inhibitors as well as the indirect inhibitor enoxaparin. Ciraparantag is an antidote targeted to reverse the direct thrombin and factor Xa inhibitors as well as the indirect inhibitor enoxaparin.

Effects of Oscillation Frequency and Amplitude on Separation in an Unsteady Turbulent Flow.

Science.gov (United States)

1980-09-01

be performed with much of the aircraft immersed in turbulent flow. When in operation near the ground or landing platform , unsteady, turbulent flow...34 - .-,...i ,aXa. 8O- IDa I"l N 0 N( ’A0 󈧨 a r. 0 a 0.a " - M - if l’ . t 1 - o t I.- I.- 𔃻 I I I Ni ilNl 1i * 11 it O ag 0) - -i "NUm M CA myp WiX ~ U’iCL

"XANSONS for COD": a new small BOINC project in crystallography

Science.gov (United States)

Neverov, Vladislav S.; Khrapov, Nikolay P.

2018-04-01

"XANSONS for COD" (http://xansons4cod.com) is a new BOINC project aimed at creating the open-access database of simulated x-ray and neutron powder diffraction patterns for nanocrystalline phase of materials from the collection of the Crystallography Open Database (COD). The project uses original open-source software XaNSoNS to simulate diffraction patterns on CPU and GPU. This paper describes the scientific problem this project solves, the project's internal structure, its operation principles and organization of the final database.

Linearizability conditions for Lotka-Volterra planar complex cubic systems

International Nuclear Information System (INIS)

Gine, Jaume; Romanovski, Valery G

2009-01-01

In this paper, we investigate the linearizability problem for the two-dimensional planar complex system x-dot=x(1-a 10 x-a 01 y-a 20 x 2 -a 11 xy-a 02 y 2 ), y-dot=(1-b 10 x-b 01 y-b 20 x 2 -b 11 xy-b 02 y 2 ). The necessary and sufficient conditions for the linearizability of this system are found. From them the conditions for isochronicity of the corresponding real system can be derived

Materials Research at Stanford University, 1 July 1980-30 June 1981.

Science.gov (United States)

1981-07-01

extract such information from the tunneling that is subject to corrections required to account for both an apparent region of depressed superconductivity...temperature for the f irst time, Pre 1 im i na ry measurenh.nts show that tile detector is capable of a noise temperature for pul se detect.ion of 3 inK ...phases and couples it into a SQUID via a superconducting transformer. Because XA> XB, changes in the distribution of A & B phases cause changes in

Fourteen-Day Subacute Intravenous Toxicity Study of Hypertonic Saline/ Dextran 70 (Trade name) and its Constituents in New Zealand White Rabbits

Science.gov (United States)

1989-11-01

of Hypertonic Saline/Dextran 70C and its Constituents in New Zealand White Rabbits," Toxicology Series 248, was audited on 20 October 1989. CAROLYNM...at tA "e a .6 L C C o L a L Lm .. .. a. a4 1 . . ao 3.&ow2 aCCa .0 00 c -C a- 4;. *; a 0O .. t x.T 2Cu u . u uu0 0 Uc L 01 2.:4A.1 4xa&C -I - -N .CA -e

Chronic kidney disease and anticoagulation

DEFF Research Database (Denmark)

Sciascia, Savino; Radin, Massimo; Schreiber, Karen

2017-01-01

Anticoagulation in patients with impaired kidney function can be challenging since drugs' pharmacokinetics and bioavailability are altered in this setting. Patients with chronic kidney disease (CKD) treated with conventional anticoagulant agents [vitamin K antagonist (VKA), low-molecular weight...... are eliminated via the kidneys pose additional challenges. More recently, two classes of direct oral anticoagulant agents (DOACs) have been investigated for the prevention and management of venous thromboembolic events: the direct factor Xa inhibitors rivaroxaban, apixaban and edoxaban, and the direct thrombin...

Installation Restoration Program. Phase 2. Confirmation/Quantification. Stage 1. Problem Confirmation Study: Otis Air National Guard Base, Massachusetts, Air National Guard Support Center, Andrews Air Force Base, Maryland.

Science.gov (United States)

1985-09-04

six surface water sampling locations are recommended. If there are any existing private wells off-Base in the vicinity of the Cranberry Bog south of the... Cranberry Bog *Scale: 1" 800’ 0800 0 400 800 FIGURE 1-9 SITE MAP FOR PETROL FUEL STORAGE AREA 102 A _XA LA.*. the middle 1950’s, the 14,000 and 22,500 balrel...flat, plain sloping gently to the south. Elevations generally range from 100 to 140 feet above mean sea level (MSL). Numerous depressions , frequently

Proceedings of the Conference on the Design of Experiments in Army Research Development and Testing (31st) Held at the Madison, Wisconsin on 23-25 October 1986

Science.gov (United States)

1986-06-01

indicates a ne ed for corrective action. If the scheme is applied to each of three employe es, the total sample is n = 6,000, about 12 percent of workload...x8 implies B. It should be noted that the calculations of xA and x8 yield wor st case va 1 ues if the null hypotheses are inequa 1 iti es. Each...parameter n is assumed to be independent of ~· Glaser (1984) employes a more general formulation with the Weibull distribution assuming that the

Reversal Strategies for NOACs

DEFF Research Database (Denmark)

Husted, Steen; Verheugt, Freek; Comuth, Willemijn

2015-01-01

, coagulation factor concentrates or NOAC-specific antidotes could be used. Coagulation factor concentrates can be used in patients with haemophilia and to reverse the effect of VKAs but, in NOAC-treated patients, results are inconsistent and these agents could potentially have pro-thrombotic effects. Specific...... antidotes for NOACs are expected to be on the market soon. Phase III clinical trials with a humanized antibody fragment directed against dabigatran (idarucizumab) and recombinant, modified factor Xa (andexanet alfa) are ongoing. A molecule (aripazine) with broad activity against various anticoagulants...

Apixaban versus enoxaparin for thromboprophylaxis after knee replacement (ADVANCE-2): a randomised double-blind trial

DEFF Research Database (Denmark)

Lassen, Michael Rud; Raskob, Gary E; Gallus, Alexander

2010-01-01

efficacy and safety of these drugs after elective total knee replacement. METHODS: In ADVANCE-2, a multicentre, randomised, double-blind phase 3 study, patients undergoing elective unilateral or bilateral total knee replacement were randomly allocated through an interactive central telephone system......BACKGROUND: Low-molecular-weight heparins such as enoxaparin are preferred for prevention of venous thromboembolism after major joint replacement. Apixaban, an orally active factor Xa inhibitor, might be as effective, have lower bleeding risk, and be easier to use than is enoxaparin. We assessed...

Proceedings of the Army Numerical Analysis Conference (11th) Held at Frankford Arsenal, Philadelphia, Pa., on 13-14 February 1974

Science.gov (United States)

1974-12-01

World Conference on Earthquake Engineering, Santiago, Chile , January 13 - 18, 1969. 2. English, G. W., and Adams, P. F., "Experiments on Laterally... Chile , January 13 - 18, 1969. 4. Wakabayashi, M., "Frames Under Strong Impulsive, Wind or Seismic Loading", Proceedings of the International...while 501 / f(Vzb) = A.. ,. » _i/.. \\i i .. rv»i* e’(x ) + u.[g’(x ) - g’ixj] + vb[h’(xa) - h’(xb)] + V’^ + vIh ’(xb) (uaWV V Lhl

Statistical coronary motion models for 2D + t/3D registration of X-ray coronary angiography and CTA

DEFF Research Database (Denmark)

Baka, N.; Metz, C. T.; Schultz, C.

2013-01-01

Accurate alignment of intra-operative X-ray coronary angiography (XA) and pre-operative cardiac CT angiography (CTA) may improve procedural success rates of minimally invasive coronary interventions for patients with chronic total occlusions. It was previously shown that incorporating patient...... specific coronary motion extracted from 4D CTA increases the robustness of the alignment. However, pre-operative CTA is often acquired with gating at end-diastole, in which case patient specific motion is not available. For such cases, we investigate the possibility of using population based coronary...

Impacts and adaptation of the cropping systems to climate change in the Northeast Farming Region of China

DEFF Research Database (Denmark)

Yin, Xiaogang; Olesen, Jørgen Eivind; Wang, M.

2016-01-01

The Northeast Farming Region of China (NFR) is a very important crop growing area, comprising seven sub-regions: Xing’anling (XA), Sanjiang (SJ), Northwest Songliao (NSL), Central Songliao (CSL), Southwest Songliao (SSL), Changbaishan (CB) and Liaodong (LD), which has been severely affected...... to become more severe for crop production under climate change. Adaptation measures that have already been implemented in recent decades to cope with current climatic limitations include changes in timing of cultivation, variety choice, soil tillage practices, crop protection, irrigation and use of plastic...

Phased-Array Monolithic PEM for FT Spectrometry With Applications in Explosive Detection and CB Defense

Science.gov (United States)

2008-12-01

developed in house; this interface allows the problem set up in COM- SOL to be transferred, via COMSOL Script (COMSOL AB, 2006), Java /JNI and C...wave that propagates along the x axis and gene- rates a local oscillation of amplitude )(0 xA , phase )(0 x , and angular frequency . If the...κ , where  /2k is the (real) wavenumber. Fig. 3b shows a set of N point sources at N  ...21 and oscillating with the same angular

Reusable Launch Vehicle Technology Program

Science.gov (United States)

Freeman, Delma C., Jr.; Talay, Theodore A.; Austin, R. Eugene

1997-01-01

Industry/NASA reusable launch vehicle (RLV) technology program efforts are underway to design, test, and develop technologies and concepts for viable commercial launch systems that also satisfy national needs at acceptable recurring costs. Significant progress has been made in understanding the technical challenges of fully reusable launch systems and the accompanying management and operational approaches for achieving a low cost program. This paper reviews the current status of the RLV technology program including the DC-XA, X-33 and X-34 flight systems and associated technology programs. It addresses the specific technologies being tested that address the technical and operability challenges of reusable launch systems including reusable cryogenic propellant tanks, composite structures, thermal protection systems, improved propulsion and subsystem operability enhancements. The recently concluded DC-XA test program demonstrated some of these technologies in ground and flight test. Contracts were awarded recently for both the X-33 and X-34 flight demonstrator systems. The Orbital Sciences Corporation X-34 flight test vehicle will demonstrate an air-launched reusable vehicle capable of flight to speeds of Mach 8. The Lockheed-Martin X-33 flight test vehicle will expand the test envelope for critical technologies to flight speeds of Mach 15. A propulsion program to test the X-33 linear aerospike rocket engine using a NASA SR-71 high speed aircraft as a test bed is also discussed. The paper also describes the management and operational approaches that address the challenge of new cost effective, reusable launch vehicle systems.

New Functional Tools for Antithrombogenic Activity Assessment of Live Surface Glycocalyx.

Science.gov (United States)

Dimitrievska, Sashka; Gui, Liqiong; Weyers, Amanda; Lin, Tylee; Cai, Chao; Wu, Wei; Tuggle, Charles T; Sundaram, Sumati; Balestrini, Jenna L; Slattery, David; Tchouta, Lise; Kyriakides, Themis R; Tarbell, John M; Linhardt, Robert J; Niklason, Laura E

2016-09-01

It is widely accepted that the presence of a glycosaminoglycan-rich glycocalyx is essential for endothelialized vasculature health; in fact, a damaged or impaired glycocalyx has been demonstrated in many vascular diseases. Currently, there are no methods that characterize glycocalyx functionality, thus limiting investigators' ability to assess the role of the glycocalyx in vascular health. We have developed novel, easy-to-use, in vitro assays that directly quantify live endothelialized surface's functional heparin weights and their anticoagulant capacity to inactivate Factor Xa and thrombin. Using our assays, we characterized 2 commonly used vascular models: native rat aorta and cultured human umbilical vein endothelial cell monolayer. We determined heparin contents to be ≈10 000 ng/cm(2) on the native aorta and ≈10-fold lower on cultured human umbilical vein endothelial cells. Interestingly, human umbilical vein endothelial cells demonstrated a 5-fold lower anticoagulation capacity in inactivating both Factor Xa and thrombin relative to native aortas. We verified the validity and accuracy of the novel assays developed in this work using liquid chromatography-mass spectrometry analysis. Our assays are of high relevance in the vascular community because they can be used to establish the antithrombogenic capacity of many different types of surfaces such as vascular grafts and transplants. This work will also advance the capacity for glycocalyx-targeting therapeutics development to treat damaged vasculatures. © 2016 American Heart Association, Inc.

Development of instrumentation and technological procedures for industrial and medical applications of ionizing radiation. Final project report, October 2001 - September 2004

International Nuclear Information System (INIS)

Osmera, B.; Posta, S.; Jansky, B.

2004-01-01

The project consisted of the following stages (Stage symbol; Stage name; Stage output; Fields of application): E01; Neutron detection and spectrometry using doped scintillators; A spectrometry system for fast neutron measurements in low neutron intensity fields; Fuel storage facilities, analysis of samples contaminated by uranium and transuranium elements, university teaching. E02; Neutron and gamma spectrometry in mixed neutron/gamma fields; A system for the spectrometry of mixed neutron/gamma fields; Neutron and gamma spectrometry in working environment, radiation protection of military equipment, metrology in neutron/gamma fields, university teaching. E03; Neutron detection methods based on fission fragment track counting; A system for neutron fluence determination based on fission fragment track counting; Storage cask monitoring, radiation protection, university teaching. E04; Calibration methods for gamma scanning of fuel assemblies; A calibration system for fuel pin inspection via gamma distribution measurement; Nuclear fuel burnup assessment, BUC technology implementation, spent fuel processing. E05; Optimization of the neutron capture therapy method at the LVR-15 reactor; Treatment of selected tumorous and non-tumorous diseases; Radiotherapy - novel therapy methods in oncology, novel methods of non-tumorous disease therapy, operation of the irradiation facilities of the LVR-15 reactor with simultaneous neutron capture therapy procedures. Details of each of the stages are given. (P.A.)

Review of the IAEA nuclear fuel cycle and material section activities connected with nuclear fuel including WWER fuel

International Nuclear Information System (INIS)

Sokolov, F.

2001-01-01

Program activities on Nuclear Fuel Cycle and Materials cover the areas of: 1) raw materials (B.1.01); 2) fuel performance and technology (B.1.02); 3) pent fuel (B.1.03); 4) fuel cycle issues and information system (B.1.04); 5) support to technical cooperation activities (B.1.05). The IAEA activities in fuel performance and technology in 2001 include organization of the fuel experts meetings and completion of the Co-ordinate Research Projects (CRP). The special attention is given to the advanced post-irradiation examination techniques for water reactor fuel and fuel behavior under transients and LOCA conditions. An international research program on modeling of activity transfer in primary circuit of NPP is finalized in 2001. A new CRP on fuel modeling at extended burnup (FUMEX II) has planed to be carried out during the period 2002-2006. In the area of spent fuel management the implementation of burnup credit (BUC) in spent fuel management systems has motivated to be used in criticality safety applications, based on economic consideration. An overview of spent fuel storage policy accounting new fuel features as higher enrichment and final burnup, usage of MOX fuel and prolongation of the term of spent fuel storage is also given

The calculational VVER burnup Credit Benchmark No.3 results with the ENDF/B-VI rev.5 (1999)

Energy Technology Data Exchange (ETDEWEB)

Rodriguez Gual, Maritza [Centro de Tecnologia Nuclear, La Habana (Cuba). E-mail: mrgual@ctn.isctn.edu.cu

2000-07-01

The purpose of this papers to present the results of CB3 phase of the VVER calculational benchmark with the recent evaluated nuclear data library ENDF/B-VI Rev.5 (1999). This results are compared with the obtained from the other participants in the calculations (Czech Republic, Finland, Hungary, Slovaquia, Spain and the United Kingdom). The phase (CB3) of the VVER calculation benchmark is similar to the Phase II-A of the OECD/NEA/INSC BUC Working Group benchmark for PWR. The cases without burnup profile (BP) were performed with the WIMS/D-4 code. The rest of the cases have been carried with DOTIII discrete ordinates code. The neutron library used was the ENDF/B-VI rev. 5 (1999). The WIMS/D-4 (69 groups) is used to collapse cross sections from the ENDF/B-VI Rev. 5 (1999) to 36 groups working library for 2-D calculations. This work also comprises the results of CB1 (obtained with ENDF/B-VI rev. 5 (1999), too) and CB3 for cases with Burnup of 30 MWd/TU and cooling time of 1 and 5 years and for case with Burnup of 40 MWd/TU and cooling time of 1 year. (author)

Honrar al padre y salvar a la patria en No hay causa perdida de Álvaro Uribe Vélez

Directory of Open Access Journals (Sweden)

Wilson Orozco

Full Text Available Álvaro Uribe Vélez (2012 en sus memorias No hay causa perdida da cuenta de sus ocho años de presidencia pero también de ciertos elementos de su vida privada. Uno de los eventos que realza es el intento de secuestro y asesinato de su padre Alberto Uribe Sierra en 1983. Este evento, junto con el secuestro y muerte de otras reconocidas personalidades le sirven al narrador para recrear una atmósfera de zozobra y tensión para justificar toda su política de seguridad militar. Dado que las memorias están narradas de una manera maniquea y en la forma del thriller de suspenso, se utilizaron las herramientas de la narratología para desentrañar su alto contenido patriarcal. Básicamente, se encontró que el narrador entronca hábilmente eventos personales y de conocimiento público para justificar su lucha y la salvación de la patria. La presentación que hace el narrador de sí mismo es la de un héroe que está constantemente abocado a restituir un orden conservador y un pasado de felicidad bucólica.

Women Aboard Navy Ships: A Comprehensive Health and Readiness Research Project. Volume 1

Science.gov (United States)

1996-12-31

is a woman [9]. Since screening rates for cervical and breast cancer are considered markers of quality health care, such factors affecting women’s...Urinary tract infection El El j. Hernia (other than hiatal) 1El El]_ 1. Hepatitis (Circle type) A B C El El Page -M4 WA 17. During the past 30 days did...ha y i .l El ............. h. Urinary tract infection El El d. KDnpeysinfcin El El j. Hernia (other than hiatal) El El ... k.~~~ An.xa .r u. i .. l

Aplicación de los microcontroladores a la docencia de sistemas digitales: “Termómetro digital a tiempo real y conexión serie a PC”

OpenAIRE

Ramírez Mendoza, Agurtzane

2006-01-01

El objetivo de este Trabajo de Fin de Carrera es servir de referencia para una práctica de la asignatura de Sistemas Electrónicos Digitales. Se diseñará el hardware y el software necesario para que, paso a paso, los alumnos de esta asignatura entren en contacto con el mundo de los microcontrolador, y más concretamente con el PIC16F87XA. Mediante pasos sencillos el alumno tomará contacto con los periféricos más importantes de este microcontrolador, formándose una base consist...

Atrial fibrillation in the elderly

Science.gov (United States)

Franken, Roberto A.; Rosa, Ronaldo F.; Santos, Silvio CM

2012-01-01

This review discusses atrial fibrillation according to the guidelines of Brazilian Society of Cardiac Arrhythmias and the Brazilian Cardiogeriatrics Guidelines. We stress the thromboembolic burden of atrial fibrillation and discuss how to prevent it as well as the best way to conduct cases of atrial fibrillatios in the elderly, reverting the arrhythmia to sinus rhythm, or the option of heart rate control. The new methods to treat atrial fibrillation, such as radiofrequency ablation, new oral direct thrombin inhibitors and Xa factor inhibitors, as well as new antiarrhythmic drugs, are depicted. PMID:22916053

Cerebral Venous Sinus Thrombosis in a Patient with Undiagnosed Factor VII Deficiency.

Science.gov (United States)

Qadir, Hira; Rashid, Anila; Adil, Salman Naseem

2017-09-01

Factor VII (FVII) deficiency is one of the rare inherited bleeding disorders. Thrombosis has been occasionally described in inherited FVII deficiency. Here, we report a young female with undiagnosed FVII deficiency who presented with cerebral venous sinus thrombosis (CVST). Oral contraceptive pill was found to be prothrombotic risk factor. The CVSToccurred in spite of the congenital FVII deficiency indicating that no definitive antithrombotic protection is assured by this defect. Low molecular weight heparin and anti-Xa assay were found to be safe choice of anticoagulation and monitoring, respectively, in this patient.

AFRRI (Armed Forces Radiobiology Research Institute) Reports, April-June 1989.

Science.gov (United States)

1989-07-01

pared w ith ) -rav photons, and 1. 34 compared "with bremisstrahlu ng X ra\\ys. Bremsstrahlung radiation was also signiticantl\\ more effective than...nes) ( . IS. /9). 1 kxporiielhxlation ol’[DN ’\\ has also been correlated xA iti celular dittlcrentiatiori (13. 14). (C- 13011\\N I F- I I5 cells, a...ith l)LA- aler I ss cek ss th iether I S II W, 1t). 6))- 10’. 12)) nonidentical man . pared to tile flask boosted w\\ith lo)’. or 241) ,It)’ mnonuucar

Analise funcional das traduccións en linguas en proceso de normalización: o caso da traducción do comic en galego

OpenAIRE

Sinner, Carsten

2002-01-01

In the case of the Galician language, the translation of comics is quite important, because it contributes to the normalization of use of the Galician language and allows young readers to become familiar with the norm. The article focusses on an analysis of the Galician translation with the French original and a Spanish version of the text.

[gl] A traducción de comics, no caso do galego xoga un papel moi importante xa que o seu obxectivo é sobre todo normalizar o uso da lin...

AVE5026, a new hemisynthetic ultra-low-molecular-weight heparin for the prevention of venous thromboembolism in patients after total knee replacement surgery--TREK: a dose-ranging study

DEFF Research Database (Denmark)

Lassen, M R; Dahl, O E; Mismetti, P

2009-01-01

BACKGROUND: AVE5026 is a new hemisynthetic ultra-low-molecular-weight heparin, with a novel anti-thrombotic profile resulting from high anti-factor (F)Xa activity and residual anti-FIIa activity. AVE5026 is in clinical development for venous thromboembolism (VTE) prevention, a frequent complication....... The primary safety outcome was the incidence of major bleeding. RESULTS: The primary efficacy outcome was assessed in 464 patients. There was a significant dose-response across the five AVE5026 groups for VTE prevention (Pincidence of VTE ranging from 5.3% to 44.1% compared with 35...

AVE5026, a new hemisynthetic ultra-low-molecular-weight heparin for the prevention of venous thromboembolism in patients after total knee replacement surgery

DEFF Research Database (Denmark)

Lassen, Michael Rud; Dahl, O E; Mismetti, P

2009-01-01

BACKGROUND: AVE5026 is a new hemisynthetic ultra-low-molecular-weight heparin, with a novel anti-thrombotic profile resulting from high anti-factor (F)Xa activity and residual anti-FIIa activity. AVE5026 is in clinical development for venous thromboembolism (VTE) prevention, a frequent complication....... The primary safety outcome was the incidence of major bleeding. RESULTS: The primary efficacy outcome was assessed in 464 patients. There was a significant dose-response across the five AVE5026 groups for VTE prevention (Pincidence of VTE ranging from 5.3% to 44.1% compared with 35...

High-resolution mid-IR spectrometer based on frequency upconversion

DEFF Research Database (Denmark)

Hu, Qi; Dam, Jeppe Seidelin; Pedersen, Christian

2012-01-01

We demonstrate a novel approach for high-resolution spectroscopy based on frequency upconversion and postfiltering by means of a scanning Fabryx2013;Perot interferometer. The system is based on sum-frequency mixing, shifting the spectral content from the mid-infrared to the near-visible region al......-frequency 1064xA0;nm laser. We investigate water vapor emission lines from a butane burner and compare the measured results to model data. The presented method we suggest to be used for real-time monitoring of specific gas lines and reference signals....

ARC2D - EFFICIENT SOLUTION METHODS FOR THE NAVIER-STOKES EQUATIONS (DEC RISC ULTRIX VERSION)

Science.gov (United States)

Biyabani, S. R.

1994-01-01

computers to emulate Cray system time calls, which should be easy to modify for other machines as well. The standard distribution media for this version is a 9-track 1600 BPI ASCII Card Image format magnetic tape. The Cray version was developed in 1987. The IBM ES/3090 version is an IBM port of the Cray version. It is written in IBM VS FORTRAN and has the capability of executing in both vector and parallel modes on the MVS/XA operating system and in vector mode on the VM/XA operating system. Various options of the IBM VS FORTRAN compiler provide new features for the ES/3090 version, including 64-bit arithmetic and up to 2 GB of virtual addressability. The IBM ES/3090 version is available only as a 9-track, 1600 BPI IBM IEBCOPY format magnetic tape. The IBM ES/3090 version was developed in 1989. The DEC RISC ULTRIX version is a DEC port of the Cray version. It is written in FORTRAN 77 for RISC-based Digital Equipment platforms. The memory requirement is approximately 7Mb of main memory. It is available in UNIX tar format on TK50 tape cartridge. The port to DEC RISC ULTRIX was done in 1990. COS and UNICOS are trademarks and Cray is a registered trademark of Cray Research, Inc. IBM, ES/3090, VS FORTRAN, MVS/XA, and VM/XA are registered trademarks of International Business Machines. DEC and ULTRIX are registered trademarks of Digital Equipment Corporation.

Ubiquitin-fusion as a strategy to modulate protein half-life: A3G antiviral activity revisited

International Nuclear Information System (INIS)

Cadima-Couto, Iris; Freitas-Vieira, Acilino; Nowarski, Roni; Britan-Rosich, Elena; Kotler, Moshe; Goncalves, Joao

2009-01-01

The human APOBEC3G (A3G) is a potent inhibitor of HIV-1 replication and its activity is suppressed by HIV-1 virion infectivity factor (Vif). Vif neutralizes A3G mainly by inducing its degradation in the proteasome and blocking its incorporation into HIV-1 virions. Assessing the time needed for A3G incorporation into virions is, therefore, important to determine how quickly Vif must act to induce its degradation. We show that modelling the intracellular half-life of A3G can induce its Vif-independent targeting to the ubiquitin-proteasome system. By using various amino acids (X) in a cleavable ubiquitin-X-A3G fusion, we demonstrate that the half-life (t1/2) of X-A3G can be manipulated. We show that A3G molecules with a half-life of 13 min are incorporated into virions, whereas those with a half-life shorter than 5 min were not. The amount of X-A3G incorporated into virions increases from 13 min (Phe-A3G) to 85 min (Asn-A3G) and remains constant after this time period. Interestingly, despite the presence of similar levels of Arg-A3G (t1/2 = 28 min) and Asp-A3G (t1/2 = 65 min) into HIV-1 Δvif virions, inhibition of viral infectivity was only evident in the presence of A3G proteins with a longer half-life (t1/2 ≥ 65 min).

When Failure Means Success: Accepting Risk in Aerospace Development

Science.gov (United States)

Dumbacher, Daniel L.; Singer, Christopher E.

2009-01-01

Over the last three decades, NASA has been diligent in qualifying systems for human space flight. As the Agency transitions from operating the Space Shuttle, its employees must learn to accept higher risk levels to generate the data needed to certify its next human space flight system. The Marshall Center s Engineering workforce is developing the Ares I crew launch vehicle and designing the Ares V cargo launch vehicle for safety, reliability, and cost-effective operations. This presentation will provide a risk retrospective, using first-hand examples from the Delta Clipper-Experimental Advanced (DC-XA) and the X-33 single-stage-to-orbit flight demonstrators, while looking ahead to the upcoming Ares I-X uncrewed test flight. The DC-XA was successfully flown twice in 26 hours, setting a new turnaround-time record. Later, one of its 3 landing gears did not deploy, it tipped over, and was destroyed. During structural testing, the X-33 s advanced composite tanks were unable to withstand the forces to which it was subjected and the project was later cancelled. These are examples of successful failures, as the data generated are captured in databases used by vehicle designers today. More recently, the Ares I-X flight readiness review process was streamlined in keeping with the mission's objectives, since human lives are not at stake, which reflects the beginning of a cultural change. Failures are acceptable during testing, as they provide the lessons that actually lead to mission success. These and other examples will stimulate the discussion of when to accept risk in aerospace projects.

Molecular diagnostic testing for Klinefelter syndrome and other male sex chromosome aneuploidies

Directory of Open Access Journals (Sweden)

Hager Karl

2012-04-01

Full Text Available Abstract Background Male sex chromosome aneuploidies are underdiagnosed despite concomitant physical and behavioral manifestations. Objective To develop a non-invasive, rapid and high-throughput molecular diagnostic assay for detection of male sex chromosome aneuploidies, including 47,XXY (Klinefelter, 47,XYY, 48,XXYY and 48,XXXY syndromes. Methods The assay utilizes three XYM and four XA markers to interrogate Y:X and X:autosome ratios, respectively. The seven markers were PCR amplified using genomic DNA isolated from a cohort of 323 males with aneuploid (n = 117 and 46,XY (n = 206 karyotypes. The resulting PCR products were subjected to Pyrosequencing, a quantitative DNA sequencing method. Results Receiver operator characteristic (ROC curves were used to establish thresholds for the discrimination of aneuploid from normal samples. The XYM markers permitted the identification of 47,XXY, 48,XXXY and 47,XYY syndromes with 100% sensitivity and specificity in both purified DNA and buccal swab samples. The 48,XXYY karyotype was delineated by XA marker data from 46,XY; an X allele threshold of 43% also permitted detection of 48,XXYY with 100% sensitivity and specificity. Analysis of X chromosome-specific biallelic SNPs demonstrated that 43 of 45 individuals (96% with 48,XXYY karyotype had two distinct X chromosomes, while 2 (4% had a duplicate X, providing evidence that 48,XXYY may result from nondisjunction during early mitotic divisions of a 46,XY embryo. Conclusions Quantitative Pyrosequencing, with high-throughput potential, can detect male sex chromosome aneuploidies with 100% sensitivity.

Retention of plutonium in mouse tissues as affected by antiviral compounds and their analogs

International Nuclear Information System (INIS)

Lindenbaum, A.; Rosenthal, M.W.; Guilmette, R.A.

1975-01-01

The chelating agent DTPA (diethylenetriaminepentaacetic acid) is an effective therapeutic substance for decorporation of extracellar monomeric plutonium in the mouse and dog, but is much less effective in removing intracellular polymeric plutonium (Pu-P). In the absence of effective therapy, this intracellular plutonium is long retained in the body, particularly in reticuloendothelial tissues like the liver. Our interest, therefore, turned to the development of adjunct substances capable of removing additional plutonium from the liver beyond that removable by DTPA alone. We showed that glucan, a yeast cell wall polysaccharide, is a useful adjunct to DTPA for removal of Pu-P from the mouse liver. Its toxicity, however, makes it a less than desirable drug for potential human use. Therefore, we initiated a search for more soluble (and presumably less hazardous) therapeutic agents similar to glucan, i.e., capable of adjunct action with DTPA. Of over 20 substances tested the most successful results were obtained with two antiviral, antitumor compounds, the pyran copolymers XA-124-177 and XA-146-85-2. These are condensation products of divinyl ether and maleic anhydride. Another analog, EMH-227, prepared by condensation of acrylic acid and itaconic acid, was similarly successful. Maximal removal of plutonium from mouse liver was obtained with a single intravenous (I.V.) injection of 10 to 90 mg/kg of pyran copolymer given 5 days after I.V. Pu-P administration. Although these doses increased splenic uptake of plutonium, a dose of 10 mg/kg produced a minimal increase in the splenic burden while producing maximal removal of hepatic plutonium

Changes in heparin dose response slope during cardiac surgery: possible result in inaccuracy in predicting heparin bolus dose requirement to achieve target ACT.

Science.gov (United States)

Ichikawa, Junko; Mori, Tetsu; Kodaka, Mitsuharu; Nishiyama, Keiko; Ozaki, Makoto; Komori, Makiko

2017-09-01

The substantial interpatient variability in heparin requirement has led to the use of a heparin dose response (HDR) technique. The accuracy of Hepcon-based heparin administration in achieving a target activated clotting time (ACT) using an HDR slope remains controversial. We prospectively studied 86 adult patients scheduled for cardiac surgery requiring cardiopulmonary bypass. The total dose of calculated heparin required for patient and pump priming was administered simultaneously to achieve a target ACT of 450 s for HDR on the Hepcon HMS system. Blood samples were obtained after the induction of anesthesia, at 3 min after heparin administration and after the initiation of CPB to measure kaolin ACT, HDR slope, whole-blood heparin concentration based on the HDR slope and anti-Xa heparin concentration, antithrombin and complete blood count. The target ACT of 450 s was not achieved in 68.6% of patients. Compared with patients who achieved the target ACT, those who failed to achieve their target ACT had a significantly higher platelet count at baseline. Correlation between the HDR slope and heparin sensitivity was poor. Projected heparin concentration and anti-Xa heparin concentration are not interchangeable based on the Bland-Altman analysis. It can be hypothesized that the wide discrepancy in HDR slope versus heparin sensitivity may be explained by an inaccurate prediction of the plasma heparin level and/or the change in HDR of individual patients, depending on in vivo factors such as extravascular sequestration of heparin, decreased intrinsic antithrombin activity level and platelet count and/or activity.

Novel thermophilic hemicellulases for the conversion of lignocellulose for second generation biorefineries.

Science.gov (United States)

Cobucci-Ponzano, Beatrice; Strazzulli, Andrea; Iacono, Roberta; Masturzo, Giuseppe; Giglio, Rosa; Rossi, Mosè; Moracci, Marco

2015-10-01

The biotransformation of lignocellulose biomasses into fermentable sugars is a very complex procedure including, as one of the most critical steps, the (hemi) cellulose hydrolysis by specific enzymatic cocktails. We explored here, the potential of stable glycoside hydrolases from thermophilic organisms, so far not used in commercial enzymatic preparations, for the conversion of glucuronoxylan, the major hemicellulose of several energy crops. Searches in the genomes of thermophilic bacteria led to the identification, efficient production, and detailed characterization of novel xylanase and α-glucuronidase from Alicyclobacillus acidocaldarius (GH10-XA and GH67-GA, respectively) and a α-glucuronidase from Caldicellulosiruptor saccharolyticus (GH67-GC). Remarkably, GH10-XA, if compared to other thermophilic xylanases from this family, coupled good specificity on beechwood xylan and the best stability at 65 °C (3.5 days). In addition, GH67-GC was the most stable α-glucuronidases from this family and the first able to hydrolyse both aldouronic acid and aryl-α-glucuronic acid substrates. These enzymes, led to the very efficient hydrolysis of beechwood xylan by using 7- to 9-fold less protein (concentrations thermophilic enzymes. In addition, remarkably, together with a thermophilic β-xylosidase, they catalyzed the production of xylose from the smart cooking pre-treated biomass of one of the most promising energy crops for second generation biorefineries. We demonstrated that search by the CAZy Data Bank of currently available genomes and detailed enzymatic characterization of recombinant enzymes allow the identification of glycoside hydrolases with novel and interesting properties and applications. Copyright © 2015 Elsevier Inc. All rights reserved.

A review of antithrombotic therapy and the rationale and design of the randomized edoxaban in patients with peripheral artery disease (ePAD) trial adding edoxaban or clopidogrel to aspirin after femoropopliteal endovascular intervention.

Science.gov (United States)

Tangelder, Marco J D; Nwachuku, Chuke E; Jaff, Michael; Baumgartner, Iris; Duggal, Anil; Adams, George; Ansel, Gary; Grosso, Michael; Mercuri, Michele; Shi, Minggao; Minar, Erich; Moll, Frans L

2015-04-01

Compared with the coronary setting, knowledge about antithrombotic therapies after endovascular treatment (EVT) is inadequate in patients with peripheral artery disease (PAD). Based on a review of trials and guidelines, which is summarized in this article, there is scant evidence that antithrombotic drugs improve outcome after peripheral EVT. To address this knowledge gap, the randomized, open-label, multinational edoxaban in patients with Peripheral Artery Disease (ePAD) study (ClinicalTrials.gov identifier NCT01802775) was designed to explore the safety and efficacy of a combined regimen of antiplatelet therapy with clopidogrel and anticoagulation with edoxaban, a selective and direct factor Xa inhibitor, both combined with aspirin. As of July 2014, 203 patients (144 men; mean age 67 years) from 7 countries have been enrolled. These patients have been allocated to once-daily edoxaban [60 mg for 3 months (or 30 mg in the presence of factors associated with increased exposure)] or clopidogrel (75 mg/d for 3 months). All patients received aspirin (100 mg/d) for the 6-month duration of the study. The primary safety endpoint is major or clinically relevant nonmajor bleeding; the primary efficacy endpoint is restenosis or reocclusion at the treated segment(s) measured at 1, 3, and 6 months using duplex ultrasound scanning. All outcomes will be assessed and adjudicated centrally in a masked fashion. The ePAD study is the first of its kind to investigate a combined regimen of antiplatelet therapy and anticoagulation through factor Xa inhibition with edoxaban. © The Author(s) 2015.

Spotlight on unmet needs in stroke prevention: The PIONEER AF-PCI, NAVIGATE ESUS and GALILEO trials.

Science.gov (United States)

Hemmrich, Melanie; Peterson, Eric D; Thomitzek, Karen; Weitz, Jeffrey I

2016-09-28

Atrial fibrillation (AF) is a major healthcare concern, being associated with an estimated five-fold risk of ischaemic stroke. In patients with AF, anticoagulants reduce stroke risk to a greater extent than acetylsalicylic acid (ASA) or dual antiplatelet therapy (DAPT) with ASA plus clopidogrel. Non-vitamin K antagonist oral anticoagulants (NOACs) are now a widely-accepted therapeutic option for stroke prevention in non-valvular AF (NVAF). There are particular patient types with NVAF for whom treatment challenges remain, owing to sparse clinical data, their high-risk nature or a need to harmonise anticoagulant and antiplatelet regimens if co-administered. This article focuses on three randomised controlled trials (RCTs) that are investigating the utility of rivaroxaban, a direct, oral, factor Xa inhibitor, in additional areas of stroke prevention where data for anticoagulants are lacking: oPen-label, randomized, controlled, multicentre study explorIng twO treatmeNt stratEgiEs of Rivaroxaban and a dose-adjusted oral vitamin K antagonist treatment (PIONEER AF-PCI); New Approach riVaroxoban Inhibition of factor Xa in a Global trial vs Aspirin to prevenT Embolism in Embolic Stroke of Undetermined Source (NAVIGATE ESUS); and Global study comparing a rivAroxaban-based antithrombotic strategy to an antipLatelet-based strategy after transcatheter aortIc vaLve rEplacement to Optimize clinical outcomes (GALILEO). Data from these studies present collaborative efforts to build upon existing registrational Phase III data for rivaroxaban, driving the need for effective and safe treatment of a wider range of patients for stroke prevention.

Epitope mapping of functional domains of human factor V with human and mouse monoclonal antibodies

International Nuclear Information System (INIS)

Annamalai, A.E.; Rao, A.K.; Chiu, H.C.; Wang, D.; Dutta-Roy, A.K.; Colman, R.W.

1986-01-01

The authors previously described two human monoclonal antibodies (MAbs) which inactivated factor V. The authors have now purified the predominant antibody (H2) on protein A Sepharose using a pH gradient and typed it as IgG 1 ,. Immunoprecipitation of 125 I-human factor Va with H2 demonstrated specificity for the heavy chain (D), Mr = 105,000. The authors compared using ELISA the competitive binding to factor Va, of H2, H1 and two mouse MAbs, B38 (directed to E) and B10 (to activation peptide, Cl). All four antibodies recognized distinct epitopes in factor V with steric overlap in some cases. Factor Xa showed a concentration dependent competition for binding of H1, H2 and B38 but not B10 to factor V/Va in ELISA. All MAbs bound to factor V/Va in the absence of Ca ++ . However, Ca ++ at 8 mM increased the binding of H1 and H2 to 165% and 360% and did not have any effect on the binding of either mouse MAbs. Prothrombin at a concentration of up to 400 μg/ml did not inhibit binding of any of these antibodies. Thus, both the light (E) and heavy (D) chains of factor Va but not the activation peptide (Cl) interact with factor Xa as defined by the MAbs. In addition, sites on both chains for Ca ++ are recognized by particular MAbs (H1 and H2). These studies increase their knowledge of the interactions of factor V domains in the formation of prothrombinase complex

Structure, microstructure and magnetic properties of Sr1-xCaxCrO3 (0≤x≤1)

International Nuclear Information System (INIS)

Castillo-Martinez, E.; Duran, A.; Alario-Franco, M.A.

2008-01-01

The effect of the calcium concentration on the structural, microstructural and magnetic properties of Sr (1-x) Ca x CrO 3 with 0≤x≤1 has been studied. The compounds were prepared using high pressure and high temperature synthesis. X-ray diffraction shows that the samples evolve from the cubic Pm-3m space group for x=0-0.2 to tetragonal I4/mcm for x=0.4-0.5, then to the orthorhombic Pbnm space group for x=0.6, 0.8 and 1.0. Electron diffraction and high-resolution transmission electron microscopy confirmed the respective cells for the end compositions: a p xa p xa p (Pm-3m) for SrCrO 3 ; and the √(2)a p x√(2)a p x2a p (Pbnm) for CaCrO 3 . For intermediate compositions some extra spots appear in the electron diffraction patterns while the electron micrographs indicate the presence of microdomains. Magnetic measurements show Curie-Weiss behaviour at high temperature for all the samples. A sharp antiferromagnetic (AFM) transition at about 91.5 K appears for x=0.8-1 together with a weak ferromagnetic ordering below T N . - Graphical abstract: HRTEM image of a crystal of Sr 0.5 Ca 0.5 CrO 3 showing a random distribution of 2a p ∼7.6 A all along the crystal that lacks long range order. Inset shows the FFT of the area of the image and of a tenth of that area showing the influence of the coherence length

The Arabidopsis flagellin receptor FLS2 mediates the perception of Xanthomonas Ax21 secreted peptides.

Science.gov (United States)

Danna, Cristian H; Millet, Yves A; Koller, Teresa; Han, Sang-Wook; Bent, Andrew F; Ronald, Pamela C; Ausubel, Frederick M

2011-05-31

Detection of microbes by plants relies in part on an array of pattern-recognition receptors that recognize conserved microbial signatures, so-called "microbe-associated molecular patterns." The Arabidopsis thaliana receptor-like kinase FLS2 is the pattern-recognition receptor for bacterial flagellin. Similarly to FLS2, the rice transmembrane protein XA21 is the receptor for the sulfated form of the Xanthomonas oryzae pv. oryzae secreted protein Ax21. Here we show that Ax21-derived peptides activate Arabidopsis immunity, triggering responses similar to those elicited by flagellin, including an oxidative burst, induction of defense-response genes, and enhanced resistance to bacterial pathogens. To identify Arabidopsis Xa21 functional homologs, we used a reverse genetics approach to screen T-DNA insertion mutants corresponding to all 47 of the Arabidopsis genes encoding non-RD kinases belonging to the interleukin-1 receptor-associated kinase (IRAK) family. Surprisingly, among all of these mutant lines, only fls2 mutants exhibited a significant loss of response to Ax21-derived peptides. Ax21 peptides also failed to activate defense-related responses in an fls2-24 mutant that does not bind Flg22. Moreover, a Flg22Δ2 variant of Flg22 that binds to FLS2 but does not activate FLS2-mediated signaling suppressed Ax21-derived peptide signaling, indicating mutually exclusive perception of Flg22 or Ax21 peptides by FLS2. The data indicate that FLS2 functions beyond flagellin perception to detect other microbe-associated molecular patterns.

Evaluation of the efficacy and safety of rivaroxaban using a computer model for blood coagulation.

Directory of Open Access Journals (Sweden)

Rolf Burghaus

Full Text Available Rivaroxaban is an oral, direct Factor Xa inhibitor approved in the European Union and several other countries for the prevention of venous thromboembolism in adult patients undergoing elective hip or knee replacement surgery and is in advanced clinical development for the treatment of thromboembolic disorders. Its mechanism of action is antithrombin independent and differs from that of other anticoagulants, such as warfarin (a vitamin K antagonist, enoxaparin (an indirect thrombin/Factor Xa inhibitor and dabigatran (a direct thrombin inhibitor. A blood coagulation computer model has been developed, based on several published models and preclinical and clinical data. Unlike previous models, the current model takes into account both the intrinsic and extrinsic pathways of the coagulation cascade, and possesses some unique features, including a blood flow component and a portfolio of drug action mechanisms. This study aimed to use the model to compare the mechanism of action of rivaroxaban with that of warfarin, and to evaluate the efficacy and safety of different rivaroxaban doses with other anticoagulants included in the model. Rather than reproducing known standard clinical measurements, such as the prothrombin time and activated partial thromboplastin time clotting tests, the anticoagulant benchmarking was based on a simulation of physiologically plausible clotting scenarios. Compared with warfarin, rivaroxaban showed a favourable sensitivity for tissue factor concentration inducing clotting, and a steep concentration-effect relationship, rapidly flattening towards higher inhibitor concentrations, both suggesting a broad therapeutic window. The predicted dosing window is highly accordant with the final dose recommendation based upon extensive clinical studies.

Fragile X--a challenge to models of the mind and to best clinical practice.

Science.gov (United States)

Hay, David A

2008-06-01

Cornish et al. (2008, this issue) provide an excellent review of Fragile X a common but very complex cause of intellectual disability. They report on a cohort of such males of normal intelligence quotient (IQ) and socioeconomic status (SES), but who have deficits in selective attention and growing impairment in response inhibition. This paper has theoretical views for our models of the mind and clinical implications for families where Fragile X may never have been considered as a possible cause of some of the problems in male and female family members and possibly as well for other disorders such as attention deficit hyperactivity disorder (ADHD) and autism.

Dirac delta-plus (or minus) function in optics and mesooptics

International Nuclear Information System (INIS)

Soroko, L.M.

1987-01-01

The topic of this article is Dirac delta-plus function and its application in Hilbert optics and mesooptics. The article begins with the introduction of the backgrounds and of the underlying relations. Then the properties of the coherent imaging system containing various spatial frequency filters are treated. The analysis of mesooptical imaging system used for observation of the straight line particle tracks in the nuclear emulsion is presented. It is shown that in a general case the convolution kernel of mesooptical system is a superposition of the form a 1 δ + (x)+a 2 x (d/dx)δ + (x)

Algebraic polynomials with random coefficients

Directory of Open Access Journals (Sweden)

K. Farahmand

2002-01-01

Full Text Available This paper provides an asymptotic value for the mathematical expected number of points of inflections of a random polynomial of the form a0(ω+a1(ω(n11/2x+a2(ω(n21/2x2+…an(ω(nn1/2xn when n is large. The coefficients {aj(w}j=0n, w∈Ω are assumed to be a sequence of independent normally distributed random variables with means zero and variance one, each defined on a fixed probability space (A,Ω,Pr. A special case of dependent coefficients is also studied.

[Atrial fibrillation in elderly].

Science.gov (United States)

Arquizan, Caroline

2012-11-01

Atrial fibrilation (AF) is frequent and a strong risk factor for ischemic stroke in elderly. Ischemic stroke in patients with AF are more severe. Vitamine K antagonist therapy is highly effective for stroke prevention but is associated with hemorrhagic risk. The new oral anticoagulants (direct thrombin inhibitor [dabigatran], and direct factor Xa inhibitors [rivaroxaban and apixaban]) have all shown non inferiority or superiority, with better safety, considering the risk of intracranial haemorrhage. On this basis, it is justified to give them in priority in the vast majority of patients with AF, the choice of the drug and the dose is individual.

Reusable launch vehicle development research

Science.gov (United States)

1995-01-01

NASA has generated a program approach for a SSTO reusable launch vehicle technology (RLV) development which includes a follow-on to the Ballistic Missile Defense Organization's (BMDO) successful DC-X program, the DC-XA (Advanced). Also, a separate sub-scale flight demonstrator, designated the X-33, will be built and flight tested along with numerous ground based technologies programs. For this to be a successful effort, a balance between technical, schedule, and budgetary risks must be attained. The adoption of BMDO's 'fast track' management practices will be a key element in the eventual success of NASA's effort.

Severe jaundice due to intrahepatic cholestasis after initiating anticoagulation with rivaroxaban.

Science.gov (United States)

Aslan, Abdullah N; Sari, Cenk; Baştuğ, Serdal; Sari, Sevil Ö; Akçay, Murat; Durmaz, Tahir; Bozkurt, Engin

2016-03-01

Rivaroxaban, a highly selective direct factor Xa inhibitor, is a new oral anticoagulant approved by the US Food and Drug Administration in November 2011 for stroke prophylaxis in patients with nonvalvular atrial fibrillation. Because of its efficacy and once-a-day dosing, it is commonly preferred in patients with nonvalvular atrial fibrillation and intolerance to warfarin in clinical practice. However, it can result in some adverse effects such as bleeding, rashes and liver injury. Here, we described a very rare adverse reaction of rivaroxaban, jaundice due to intrahepatic cholestasis, appeared in a 71-year-old male patient after taking rivaroxaban.

Endoscopic management of acute peptic ulcer bleeding.

Science.gov (United States)

Lu, Yidan; Chen, Yen-I; Barkun, Alan

2014-12-01

This review discusses the indications, technical aspects, and comparative effectiveness of the endoscopic treatment of upper gastrointestinal bleeding caused by peptic ulcer. Pre-endoscopic considerations, such as the use of prokinetics and timing of endoscopy, are reviewed. In addition, this article examines aspects of postendoscopic care such as the effectiveness, dosing, and duration of postendoscopic proton-pump inhibitors, Helicobacter pylori testing, and benefits of treatment in terms of preventing rebleeding; and the use of nonsteroidal anti-inflammatory drugs, antiplatelet agents, and oral anticoagulants, including direct thrombin and Xa inhibitors, following acute peptic ulcer bleeding. Copyright © 2014 Elsevier Inc. All rights reserved.

Direct oral anticoagulants and venous thromboembolism

Directory of Open Access Journals (Sweden)

Massimo Franchini

2016-09-01

Full Text Available Venous thromboembolism (VTE, consisting of deep vein thrombosis and pulmonary embolism, is a major clinical concern associated with significant morbidity and mortality. The cornerstone of management of VTE is anticoagulation, and traditional anticoagulants include parenteral heparins and oral vitamin K antagonists. Recently, new oral anticoagulant drugs have been developed and licensed, including direct factor Xa inhibitors (e.g. rivaroxaban, apixaban and edoxaban and thrombin inhibitors (e.g. dabigatran etexilate. This narrative review focusses on the characteristics of these direct anticoagulants and the main results of published clinical studies on their use in the prevention and treatment of VTE.

Luminescent phosphors, based on rare earth substituted oxyfluorides in the A(1){sub 3-x} A(2){sub x}MO{sub 4}F family with A(1)/A(2)=Sr, Ca, Ba and M=Al, Ga

Energy Technology Data Exchange (ETDEWEB)

Park, Sangmoon, E-mail: spark@silla.ac.k [Department of Engineering in Energy and Applied Chemistry, Silla University, Busan 617-736 (Korea, Republic of); Vogt, Thomas [NanoCenter and Department of Chemistry and Biochemistry, University of South Carolina, Columbia 29208, SC (United States)

2009-09-15

A new family of UV-activated phosphors made by substituting rare-earth activators such as trivalent Eu, Tb, Tm and Er into A(1){sub 3-x}A(2){sub x}MO{sub 4}F host lattices (A(1)/A(2)=Sr, Ca, Ba; M=Al, Ga) are introduced and their activation and emission spectra as well as their CIE values reported. The Tm-substituted system can be activated using light with a wavelength of 360 nm. Relative intensities of a family of Tb-substituted green phosphors activated at 254 nm and with emissions centered near 548 nm are discussed.

Disadvantages of VKA and requirements for novel anticoagulants.

Science.gov (United States)

Shameem, Raji; Ansell, Jack

2013-06-01

Vitamin K antagonists have been in wide use for over 70 years. Warfarin, the most commonly used vitamin K antagonist, has been shown to be highly effective in treating and preventing thrombosis. Despite this, warfarin has many disadvantages, which has led to the development of a new class of oral anticoagulants targeted to specific coagulation factors designated as target-specific oral anticoagulants (TSOAs). TSOAs include the thrombin inhibitors (dabigatran) and factor Xa inhibitors (rivaroxaban, apixaban). This chapter reviews the disadvantages of warfarin and evaluates both the advantages and disadvantages of the new oral anticoagulants. © 2013 Elsevier Ltd. All rights reserved.

Meta-analysis of randomized controlled trials on risk of myocardial infarction from the use of oral direct thrombin inhibitors

DEFF Research Database (Denmark)

Artang, Ramin; Rome, Eric; Nielsen, Jørn Dalsgaard

2013-01-01

. To address these questions, we systematically searched MEDLINE and performed a meta-analysis on randomized trials that compared oral DTIs with warfarin for any indication with end point of MIs after randomization. We furthermore performed a secondary meta-analysis on atrial fibrillation stroke prevention...... to experience an MI than their counterparts treated with warfarin (285 of 23,333 vs 133 of 16,024, odds ratio 1.35, 95% confidence interval 1.10 to 1.66, p = 0.005). For secondary analysis, 8 studies (69,615 patients) were identified that compared warfarin with alternative anticoagulant including factor Xa...

Preparation of thin layers of BiSrCaCuO by method MOCVD

International Nuclear Information System (INIS)

Beran, P.; Stejskal, J.; Strejc, A.; Nevriva, M.; Sedmibudsky, D.; Leitner, J.

1999-01-01

Preparation of superconducting material on the basis mixed oxides of BiSrCaCuO by chemical vapour deposition (CVD) method is described. Surface morphology and concentration profiles of elements were analyzed by scanning electron microscope and microprobe. Phase of layers was analysed by X-ray diffraction (radiation of Cu kα ). Samples of thin layers were characterized by magnetic susceptibility in temperature interval 10 to 150 K. Obtained results confirm formation of superconducting phases Bi 2 Sr 2 Ca 1 Cu 2 O x and Bi 2 Sr 2 Xa 2 Cu 3 O x

The relationship between content, valence state of Fe and colour in Xiuyan jade

International Nuclear Information System (INIS)

Qiu Zhaoming; Rang Mei; Huang Junjie

1992-01-01

Mineralogically, Xiuyan jade is serpentine jade. XRD, IR and TEM studies indicate that the jade consists mainly of antigorite with a minor amount of chrysotile. Two favourite samples (P xA , P x1-1 ), chosen for research on 57 Fe Moessbauer spectra, are only antigorite. Studies indicate that: a. iron ion in antigorite enters the lattice as impurity; b. Fe 2+ and Fe 3+ substitute for Mg in the coordination octahedron; and c. the colour of jade is related to content of Fe, and Fe 2+ / Fe 3+ ≤ 1 is favourite for colour-forming

Plantas Invasoras

OpenAIRE

Díaz Varela, Ramón Alberto

2009-01-01

Enxeñaría Técnica Agricola. Especialidade en Hortofruticultura e Xardinaría As invasións biolóxicas constitúen unha das ameazas máis serias para a conservación da biodiversidade no ámbito do cambio global que está a experimentar o planeta. A introdución e aclimatación de especies en territorios alleos non é unha novidade na historia, xa que tivo lugar polo menos dende os comezos da agricultura. Estes procesos presentaron máximos de ocorrencia en determinados momentos da historia, como p...

Effect of Co-Administration of Rivaroxaban and Clopidogrel on Bleeding Time, Pharmacodynamics and Pharmacokinetics: A Phase I Study

Directory of Open Access Journals (Sweden)

Michael Becka

2012-02-01

Full Text Available Dual antiplatelet therapy with acetylsalicylic acid and a thienopyridine, such as clopidogrel, is effective for the secondary prevention of cardiovascular events in patients with acute coronary syndrome, but there is still a substantial residual risk of recurrence. Although anticoagulant therapy with a vitamin K antagonist (e.g. warfarin in conjunction with antiplatelet therapy has been shown to reduce the risk of cardiovascular events, the rates of bleeding were increased with these combination therapies; hence, triple therapy with warfarin is currently only recommended in patients at low risk of bleeding. In addition, there are other limitations associated with vitamin K antagonist therapy, including the need for routine coagulation monitoring and dose adjustment to maintain the treatment within the therapeutic range. Rivaroxaban is an oral, direct Factor Xa inhibitor; in clinical practice, it is likely that rivaroxaban will be given to patients who also receive antiplatelet therapy, such as clopidogrel. This randomized, non-blinded, three-way crossover study investigated the effect of rivaroxaban on bleeding time when co­administered with clopidogrel. In addition, the influence of clopidogrel on the safety, tolerability, pharmacodynamics and pharmacokinetics of rivaroxaban was investigated. Of 27 healthy male subjects who received a single 300 mg dose of clopidogrel, 14 were identified as clopidogrel responders and were then randomized to the following three treatments: (A two doses of clopidogrel on two consecutive days (300 mg on day 1; 75 mg on day 2; (B one dose of rivaroxaban (15 mg; or (C a combination of treatments A and B (rivaroxaban given on day 2. All treatments were well tolerated. Bleeding time with co­administration of rivaroxaban and clopidogrel was significantly prolonged in four subjects, compared with either drug alone: combination treatment increased the overall least squares-means to 3.77 times baseline (90% confidence

LOS FANTASMAS DEL COMUNISMO Y MARX EN CHILE EN LA DÉCADA DE 1870

Directory of Open Access Journals (Sweden)

LUIS ORTEGA MARTÍNEZ

2011-10-01

Full Text Available La instalación y el trágico fin de la Comuna de París a comienzos de 1871 fueron cubiertos con particular atención por la prensa de Valparaíso y Santiago. Ese interés no fue sólo el de espectadores distantes ante un suceso de por sí dramático. Sus reportajes fueron vinculados a las transformaciones en el ámbito productivo que había comenzado a experimentar la sociedad chilena desde la década de 1850, que paulatinamente comenzaron a generar un mundo de asalariados en las principales ciudades del país. Conjuntos de trabajadores cada vez más numerosos se formaron en la construcción ferroviaria y de otras obras civiles; también ello se verificó en las nuevas actividades productivas, en particular en la industria fabril y la producción de carbón. Los reportajes acerca de los sucesos de París fueron un llamado de atención de la prensa a la élite, pues en Chile poco a poco se comenzaba formar el mundo de los trabajadores. Con ello, el fantasma del Comunismo y del propio Karl Marx comenzaban a asomarse en el hasta entonces bucólico horizonte chileno.

Comparison of established and novel purity tests for the quality control of heparin by means of a set of 177 heparin samples.

Science.gov (United States)

Alban, Susanne; Lühn, Susanne; Schiemann, Simone; Beyer, Tanja; Norwig, Jochen; Schilling, Claudia; Rädler, Oliver; Wolf, Bernhard; Matz, Magnus; Baumann, Knut; Holzgrabe, Ulrike

2011-01-01

The widespread occurrence of heparin contaminated with oversulfated chrondroitin sulfate (OSCS) in 2008 initiated a comprehensive revision process of the Pharmacopoeial heparin monographs and stimulated research in analytical techniques for the quality control of heparin. Here, a set of 177 heparin samples from the market in 2008 as well as pure heparin sodium spiked with defined amounts of OSCS and DS were used to evaluate established and novel methods for the quality control of heparin. Besides (1)H nuclear magnetic resonance spectroscopy (NMR), the assessment included two further spectroscopic methods, i.e., attenuated total reflection-infrared spectroscopy (ATR-IR) and Raman spectroscopy, three coagulation assays, i.e., activated partial thromboplastin time (aPTT) performed with both sheep and human plasma and the prothrombin time (PT), and finally two novel purity assays, each consisting of an incubation step with heparinase I followed by either a fluorescence measurement (Inc-PolyH-assay) or by a chromogenic aXa-assay (Inc-aXa-assay). NMR was shown to allow not only sensitive detection, but also quantification of OSCS by using the peak-height method and a response factor determined by calibration. Chemometric evaluation of the NMR, ATR-IR, and Raman spectra by statistical classification techniques turned out to be best with NMR spectra concerning the detection of OSCS. The validity of the aPTT, the current EP assay, could be considerably improved by replacing the sheep plasma by human plasma. In this way, most of the contaminated heparin samples did not meet the novel potency limit of 180 IU/mg. However, also more than 50% of the uncontaminated samples had interpretation of the results.

Amblyomma americanum tick calreticulin binds C1q but does not inhibit activation of the classical complement cascade.

Science.gov (United States)

Kim, Tae Kwon; Ibelli, Adriana Mércia Guaratini; Mulenga, Albert

2015-02-01

In this study we characterized Amblyomma americanum (Aam) tick calreticulin (CRT) homolog in tick feeding physiology. In nature, different tick species can be found feeding on the same animal host. This suggests that different tick species found feeding on the same host can modulate the same host anti-tick defense pathways to successfully feed. From this perspective it's plausible that different tick species can utilize universally conserved proteins such as CRT to regulate and facilitate feeding. CRT is a multi-functional protein found in most taxa that is injected into the vertebrate host during tick feeding. Apart from it's current use as a biomarker for human tick bites, role(s) of this protein in tick feeding physiology have not been elucidated. Here we show that annotated functional CRT amino acid motifs are well conserved in tick CRT. However our data show that despite high amino acid identity levels to functionally characterized CRT homologs in other organisms, AamCRT is apparently functionally different. Pichia pastoris expressed recombinant (r) AamCRT bound C1q, the first component of the classical complement system, but it did not inhibit activation of this pathway. This contrast with reports of other parasite CRT that inhibited activation of the classical complement pathway through sequestration of C1q. Furthermore rAamCRT did not bind factor Xa in contrast to reports of parasite CRT binding factor Xa, an important protease in the blood clotting system. Consistent with this observation, rAamCRT did not affect plasma clotting or platelet aggregation. We discuss our findings in the context of tick feeding physiology.

A Reasoning And Hypothesis-Generation Framework Based On Scalable Graph Analytics

Energy Technology Data Exchange (ETDEWEB)

Sukumar, Sreenivas Rangan [ORNL

2016-01-01

Finding actionable insights from data has always been difficult. As the scale and forms of data increase tremendously, the task of finding value becomes even more challenging. Data scientists at Oak Ridge National Laboratory are leveraging unique leadership infrastructure (e.g. Urika-XA and Urika-GD appliances) to develop scalable algorithms for semantic, logical and statistical reasoning with unstructured Big Data. We present the deployment of such a framework called ORiGAMI (Oak Ridge Graph Analytics for Medical Innovations) on the National Library of Medicine s SEMANTIC Medline (archive of medical knowledge since 1994). Medline contains over 70 million knowledge nuggets published in 23.5 million papers in medical literature with thousands more added daily. ORiGAMI is available as an open-science medical hypothesis generation tool - both as a web-service and an application programming interface (API) at http://hypothesis.ornl.gov . Since becoming an online service, ORIGAMI has enabled clinical subject-matter experts to: (i) discover the relationship between beta-blocker treatment and diabetic retinopathy; (ii) hypothesize that xylene is an environmental cancer-causing carcinogen and (iii) aid doctors with diagnosis of challenging cases when rare diseases manifest with common symptoms. In 2015, ORiGAMI was featured in the Historical Clinical Pathological Conference in Baltimore as a demonstration of artificial intelligence to medicine, IEEE/ACM Supercomputing and recognized as a Centennial Showcase Exhibit at the Radiological Society of North America (RSNA) Conference in Chicago. The final paper will describe the workflow built for the Cray Urika-XA and Urika-GD appliances that is able to reason with the knowledge of every published medical paper every time a clinical researcher uses the tool.

Beyond Stroke Prevention in Atrial Fibrillation: Exploring Further Unmet Needs with Rivaroxaban.

Science.gov (United States)

Gibson, C M; Hankey, G J; Nafee, T; Welsh, R C

2018-03-22

With improved life expectancy and the aging population, the global burden of atrial fibrillation (AF) continues to increase, and with AF comes an estimated fivefold increased risk of ischaemic stroke. Prophylactic anticoagulant therapy is more effective in reducing the risk of ischaemic stroke in AF patients than acetylsalicylic acid or dual-antiplatelet therapy combining ASA with clopidogrel. Non-vitamin K antagonist oral anticoagulants are the standard of care for stroke prevention in patients with non-valvular AF. The optimal anticoagulant strategy to prevent thromboembolism in AF patients who are undergoing percutaneous coronary intervention and stenting, those who have undergone successful transcatheter aortic valve replacement and those with embolic stroke of undetermined source are areas of ongoing research. This article provides an update on three randomized controlled trials of rivaroxaban, a direct, oral factor Xa inhibitor, that are complete or are ongoing, in these unmet areas of stroke prevention: oPen-label, randomized, controlled, multicentre study explorIng twO treatmeNt stratEgiEs of Rivaroxaban and a dose-adjusted oral vitamin K antagonist treatment strategy in patients with Atrial Fibrillation who undergo Percutaneous Coronary Intervention (PIONEER AF-PCI) trial; the New Approach riVaroxaban Inhibition of factor Xa in a Global trial vs Aspirin to prevenT Embolism in Embolic Stroke of Undetermined Source (NAVIGATE ESUS) trial and the Global study comparing a rivAroxaban-based antithrombotic strategy to an antipLatelet-based strategy after transcatheter aortIc vaLve rEplacement to Optimize clinical outcomes (GALILEO) trial. The data from these studies are anticipated to help address continuing challenges for a range of patients at risk of stroke. Schattauer.

Rational and efficient preparation of a chimeric protein containing a tandem dimer of thrombopoietin mimetic peptide fused to human growth hormone in Escherichia coli.

Science.gov (United States)

Wang, Song; Shen, Mingqiang; Xu, Yang; Chen, Fang; Chen, Mo; Chen, Shilei; Wang, Aiping; Zhang, Zhou; Ran, Xinze; Cheng, Tianmin; Su, Yongping; Wang, Junping

2013-04-01

The 14-mer thrombopoietin mimetic peptide (TMP), especially in the form of dimer, displayed potent megakaryocytopoiesis activity in vitro. However, it is difficult to prepare such short peptide with high bioactivity through gene-engineering approaches. In this study, a chimeric protein containing a tandem dimer of TMP (dTMP) fused to human growth hormone (hGH), a kind of hematopoietic growth factor that activates the same signal pathways as thrombopoietin, was produced in Escherichia coli by soluble expression. By rational utilization of the XmnI and EcoRV restriction sites, a PCR fragment encoding dTMP-GH was inserted into the plasmid vector pMAL-p2X at the position right after Xa factor cleavage site, in frame with maltose-binding protein (MBP) gene. Under optimized conditions, a high-level expression of soluble MBP-dTMP-GH fusion protein was obtained. By application of amylose resin chromatography, Xa factor digestion, hydrophobic chromatography followed by gel filtration, the dTMP-GH fusion protein was separated. Finally, a relatively high yield of dTMP-GH fusion protein with high purity (>98%) and without redundant amino acid was achieved, as identified by high-performance liquid chromatography, mass spectrometry, and amino acid sequencing. The functional assays showed that dTMP-GH could promote the proliferation of megakaryoblast cells and maturation of murine megakaryocytes derived from bone marrow, in a dose-dependent manner. Moreover, an enhanced effect of dTMP-GH on megakaryocytopoiesis was found as compared with equimolar concentration of dTMP and rhGH. This work provides a new avenue to generate thrombopoietic agents based on TMP.

Use of anticoagulants in elderly patients: practical recommendations

Directory of Open Access Journals (Sweden)

Helia Robert-Ebadi

2009-04-01

Full Text Available Helia Robert-Ebadi, Grégoire Le Gal, Marc RighiniDivision of Angiology and Hemostasis (HRE, MR, Department of Internal Medicine, Geneva University Hospital and Faculty of Medicine, Geneva, Switzerland, and Department of Internal Medicine and Chest Diseases, EA 3878 (GETBO, Brest University Hospital, Brest, France (GLGAbstract: Elderly people represent a patient population at high thromboembolic risk, but also at high hemorrhagic risk. There is a general tendency among physicians to underuse anticoagulants in the elderly, probably both because of underestimation of thromboembolic risk and overestimation of bleeding risk. The main indications for anticoagulation are venous thromboembolism (VTE prophylaxis in medical and surgical settings, VTE treatment, atrial fibrillation (AF and valvular heart disease. Available anticoagulants for VTE prophylaxis and initial treatment of VTE are low molecular weight heparins (LMWH, unfractionated heparin (UFH or synthetic anti-factor Xa pentasaccharide fondaparinux. For long-term anticoagulation vitamin K antagonists (VKA are the first choice and only available oral anticoagulants nowadays. Assessing the benefit-risk ratio of anticoagulation is one of the most challenging issues in the individual elderly patient, patients at highest hemorrhagic risk often being those who would have the greatest benefit from anticoagulants. Some specific considerations are of utmost importance when using anticoagulants in the elderly to maximize safety of these treatments, including decreased renal function, co-morbidities and risk of falls, altered pharmacodynamics of anticoagulants especially VKAs, association with antiplatelet agents, patient education. Newer anticoagulants that are currently under study could simplify the management and increase the safety of anticoagulation in the future.Keywords: anticoagulation, elderly patients, venous thromboembolism, hemorrhagic risk, atrial fibrillation, thrombin inhibitors, factor Xa

An accurate and efficient method for large-scale SSR genotyping and applications.

Science.gov (United States)

Li, Lun; Fang, Zhiwei; Zhou, Junfei; Chen, Hong; Hu, Zhangfeng; Gao, Lifen; Chen, Lihong; Ren, Sheng; Ma, Hongyu; Lu, Long; Zhang, Weixiong; Peng, Hai

2017-06-02

Accurate and efficient genotyping of simple sequence repeats (SSRs) constitutes the basis of SSRs as an effective genetic marker with various applications. However, the existing methods for SSR genotyping suffer from low sensitivity, low accuracy, low efficiency and high cost. In order to fully exploit the potential of SSRs as genetic marker, we developed a novel method for SSR genotyping, named as AmpSeq-SSR, which combines multiplexing polymerase chain reaction (PCR), targeted deep sequencing and comprehensive analysis. AmpSeq-SSR is able to genotype potentially more than a million SSRs at once using the current sequencing techniques. In the current study, we simultaneously genotyped 3105 SSRs in eight rice varieties, which were further validated experimentally. The results showed that the accuracies of AmpSeq-SSR were nearly 100 and 94% with a single base resolution for homozygous and heterozygous samples, respectively. To demonstrate the power of AmpSeq-SSR, we adopted it in two applications. The first was to construct discriminative fingerprints of the rice varieties using 3105 SSRs, which offer much greater discriminative power than the 48 SSRs commonly used for rice. The second was to map Xa21, a gene that confers persistent resistance to rice bacterial blight. We demonstrated that genome-scale fingerprints of an organism can be efficiently constructed and candidate genes, such as Xa21 in rice, can be accurately and efficiently mapped using an innovative strategy consisting of multiplexing PCR, targeted sequencing and computational analysis. While the work we present focused on rice, AmpSeq-SSR can be readily extended to animals and micro-organisms. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

Why Ser and not Thr brokers catalysis in the trypsin fold.

Science.gov (United States)

Pelc, Leslie A; Chen, Zhiwei; Gohara, David W; Vogt, Austin D; Pozzi, Nicola; Di Cera, Enrico

2015-02-24

Although Thr is equally represented as Ser in the human genome and as a nucleophile is as good as Ser, it is never found in the active site of the large family of trypsin-like proteases that utilize the Asp/His/Ser triad. The molecular basis of the preference of Ser over Thr in the trypsin fold was investigated with X-ray structures of the thrombin mutant S195T free and bound to an irreversible active site inhibitor. In the free form, the methyl group of T195 is oriented toward the incoming substrate in a conformation seemingly incompatible with productive binding. In the bound form, the side chain of T195 is reoriented for efficient substrate acylation without causing steric clash within the active site. Rapid kinetics prove that this change is due to selection of an active conformation from a preexisting ensemble of reactive and unreactive rotamers whose relative distribution determines the level of activity of the protease. Consistent with these observations, the S195T substitution is associated with a weak yet finite activity that allows identification of an unanticipated important role for S195 as the end point of allosteric transduction in the trypsin fold. The S195T mutation abrogates the Na(+)-dependent enhancement of catalytic activity in thrombin, activated protein C, and factor Xa and significantly weakens the physiologically important allosteric effects of thrombomodulin on thrombin and of cofactor Va on factor Xa. The evolutionary selection of Ser over Thr in trypsin-like proteases was therefore driven by the need for high catalytic activity and efficient allosteric regulation.

Influência do ambiente no rendimento e na qualidade de grãos de genótipos de trigo com irrigação por aspersão no Estado de São Paulo Environmental influence on grain yield and grain quality of wheat genotypes with sprinkler irrigation in the State of São paulo, Brazil

Directory of Open Access Journals (Sweden)

JOÃO CARLOS FELICIO

2001-01-01

Full Text Available Avaliaram-se a influência do ambiente em 20 genótipos de trigo, no rendimento e qualidade de grãos, a adaptabilidade e a reação a doenças, em regiões onde a irrigação se faz necessária para permitir o bom desempenho agronômico de um genótipo. Instalaram-se os experimentos em Tatuí, Votuporanga, Ribeirão Preto e Mococa, Estado de São Paulo, no período de 1995-98. Avaliaram-se, também, a tolerância dos genótipos ao alumínio tóxico em solução nutritiva e a qualidade industrial para panificação. Com bom rendimento de grãos destacaram-se: em Tatuí, os genótipos IAC 351, IAC 335, IAC 289 e Mochis; em Votuporanga, IAC 289, TUI"S" e SERI*3/BUC; em Ribeirão Preto e Mococa, o IAC 370. No conceito de genótipo ideal, o IAC 370 apresentou alta capacidade produtiva, foi responsivo à melhoria do ambiente e sensível às condições desfavoráveis do ambiente. Entre as doenças, a ferrugem-da-folha foi a de abrangência generalizada com maior incidência em Tatuí. Anahuac, IAC 287, CAL/CHKW//VEE"S" e IAC 370 foram os mais suscetíveis ao oídio. Os genótipos Anahuac, IAC 287, JCAM//EMU"S"/YACO"S", PFAU e IAC 339 foram os mais sensíveis à toxicidade por Al3+. Os genótipos Anahuac, IAC 24, IAC 287, IAC 289, IAC 334, PFAU, TUI"S", IAC 339, IAC 370 e IAC 351 apresentaram características de farinha com bom potencial para panificação.Environmental influence was evaluated in 20 wheat genotypes in relation to grain yield and quality, adaptability and disease reaction in regions where irrigation is necessary for good agronomical performance. The experiments were carried out at Tatuí, Votuporanga, Ribeirão Preto, and Mococa in the State of São Paulo, Brazil, during 1995-98. Genotypes were also evaluated for tolerance to aluminum toxicity in nutrient solutions and for industrial quality for bread production. The genotypes IAC 351, IAC 335, IAC 289 and Mochis presented high grain yield in Tatuí; IAC 289, TUI"S" and SERI*3/BUC in

Molecular aspects in clinical hemostasis research at Karolinska Institutet.

Science.gov (United States)

Blombäck, Margareta

2010-05-21

The development of hemostasis research at Karolinska Institutet is described, focusing first on the initial findings of the fibrinogen structure and the hereditary bleeding disorders, hemophilia A and von Willebrand's disease. Basic research has focused on new biomarkers for cardiovascular/thromboembolic disorders, such as myocardial infarction and stroke, including preeclampsia and diabetes, with studies on the importance of decreased fibrinolysis in these disorders. Since long, the structure of the fibrin network has been evaluated, and recently the influence of aspirin and new thrombin and factor Xa inhibitors has been investigated. Research on the contact pathway of coagulation has also started at the Unit. 2010 Elsevier Inc. All rights reserved.

The Sortie-Generation Model System. Volume VI. Spares Subsystem,

Science.gov (United States)

1981-09-01

1020 F0rPT(I5,2’X,A18,F8.5,I4, F6 ..2,F9.5,I6,F12.2,T21,2F6.2) 3360 WRITE(2)NSNOUT (IOUjT), DEKWJT(IOUT), IQAOT(IOMJ), 3370 & FAPOUT(IOUJT),INITSOIJT(IOUT...tC IOOOCCCCCCO0COCCC rzOOOCzCCzzOc c 0MC =CCaCCr C C aCCa , 3. 3 3 L. U.3a33aL. 3 3i. .3 3 i. 3 3 . ~_K-17~t.. - 0 -0 g . .l C xCCr0 zJ1 wc ck aNC -C

Dicty_cDB: SSD429 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 622 e-175 1 AJ510162 |AJ510162.1 Cloning vector pDXA-YFP-NotI. 216 1e-52 1 X85120 |X85120.1 Artificial sequences cloning...pDXA-GFP2, complete sequence. 216 1e-52 1 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. ...XA-CFP. 216 1e-52 1 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA...-HC. 216 1e-52 1 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 1e-52 1 AJ510166 |AJ5

About Positivity of Green's Functions for Nonlocal Boundary Value Problems with Impulsive Delay Equations

Directory of Open Access Journals (Sweden)

Alexander Domoshnitsky

2014-01-01

Full Text Available The impulsive delay differential equation is considered (Lx(t=x′(t+∑i=1mpi(tx(t-τi(t=f(t, t∈[a,b],  x(tj=βjx(tj-0, j=1,…,k, a=t0xa=c,  φ∈L∞a,b;  θ, c∈R. Various results on existence and uniqueness of solutions and on positivity/negativity of the Green's functions for this equation are obtained.

Transferência de calor transiente na agitação linear intermitente de latas Transient heat transfer by intermittent shake of cans

Directory of Open Access Journals (Sweden)

Homero Ferracini Gumerato

2007-09-01

Full Text Available Foi estudada a transferência de calor transiente na agitação linear e intermitente (ALI de embalagens metálicas contendo simulantes de alimentos, objetivando-se sua aplicação em processos de pasteurização ou esterilização e conseqüentes tratamentos térmicos mais eficientes, homogêneos e com produto de melhor qualidade. Foram utilizados quatro meios fluidos simulantes de alimentos de diferentes viscosidades e massas específicas: três óleos e água. Foram combinados efeitos de cinco tratamentos, sendo: meio simulante (4 níveis, espaço livre (3 níveis, freqüência de agitação (4 níveis, amplitude de agitação (2 níveis e posição das latas (4 níveis. Os ensaios de aquecimento e resfriamento foram feitos em tanque com água à temperatura de 98 °C e 17-20 °C, respectivamente. Com os dados de penetração de calor em cada experimento, foram calculados os parâmetros de penetração de calor fh, jh, fc e jc. Os resultados foram modelados utilizando-se grupos de números adimensionais e expressos em termos de Nusselt, Prandtl, Reynolds e funções trigonométricas (com medidas de amplitude e freqüência de agitação, espaço livre e dimensões da embalagem. Foram estabelecidas as duas Equações gerais para as fases de aquecimento e resfriamento: Nu = ReA –0,199.Pr –0,288.sen(xa/AM0,406.cos(xf/FA–1,039.cos((xf/FA.(EL/H.p–4,556 Aquecimento Nu = 0,1295.ReA–0,047.Pr –0,193.sen(xa/AM0,114.cos(xf/FA–0,641.cos((xf/FA.(EL/H.p–2,476 Resfriamento O processo de ALI pode ser aplicado em pasteurizadores ou autoclaves estáticas horizontais e verticais, com modificações simples. Concluiu-se que a ALI aumenta significativamente a taxa de transferência de calor, tanto no aquecimento como no resfriamento.The transient heat transfer during the intermittent and linear shaking of tin plate cans containing simulating food was studied in order to apply this technology in the pasteurization and sterilization processes, achieving

77 FR 17323 - Special Conditions: XtremeAir GmbH, XA42; Acrobatic Category Aerodynamic Stability

Science.gov (United States)

2012-03-26

... planform and is of composite construction. The engine is a Lycoming AEIO-580-B1A with a rated power of 315... can perform any of the maneuvers listed in the Aresti Catalog. Generally, the evolution of the... review and discussions with the manufacturer and civil aviation authorities. Discussion of Comments A...

76 FR 80829 - Special Conditions: XtremeAir GmbH, XA42; Acrobatic Category Aerodynamic Stability

Science.gov (United States)

2011-12-27

... gear, conventional low-wing planform and is of composite construction. The engine is a Lycoming AEIO.... Generally, the evolution of the ``unlimited'' types of acrobatic airplanes, with very low mass, exceptional... further FAA review and discussions with the manufacturer and civil aviation authorities. Applicability As...

Magnetic studies of the S=1 Heisenberg chain [Ni(Pr(i)xa)(2)(pyr)](n)

Czech Academy of Sciences Publication Activity Database

Orendáčová, A.; Orendáč, M.; Trávníček, Zdeněk; Meisel, M. W.

2003-01-01

Roč. 196, č. 1 (2003), s. 278-281 ISSN 0031-8965 R&D Projects: GA ČR GA203/00/0152 Institutional research plan: CEZ:AV0Z5038910 Keywords : ANISOTROPY * COMPLEX Subject RIV: CE - Biochemistry Impact factor: 0.950, year: 2003

Why do adult women in Vietnam take iron tablets?

Directory of Open Access Journals (Sweden)

Zhao Yun

2006-06-01

Full Text Available Abstract Background Conducting iron supplementation programs has been a major strategy to reduce iron deficiency anemia in pregnancy. However, only a few countries have reported improvements in the anemia rate at a national level. The strategies used for control of nutrition problems need regular review to maintain and improve their effectiveness. The objective of this study was to analyze the factors in compliance with taking iron tablets, where daily doses of iron (60 mg and folic acid (400 μg were distributed in rural Vietnamese communes. Methods A cross sectional survey was conducted in Nghe An province, Vietnam in January, 2003. The study population was adult women aged less than 35 years who delivered babies between August 1st 2001 and December 1st 2002 (n = 205, of which 159 took part in the study. Data for the study were collected from a series of workshops with community leaders, focus group discussions with community members and a questionnaire survey. Results Improvements in the rate of anemia was not given a high priority as one of the commune's needs, but the participants still made efforts to continue taking iron tablets. Two major factors motivated the participants to continue taking iron tablets; their experience of fewer spells of dizziness (50%, and their concern for the health of their newborn baby (54%. When examining the reasons for taking iron tablets for at least 5–9 months, the most important factor was identified as 'a frequent supply of iron tablets' (OR = 11.93, 95% CI: 4.33–32.85. Conclusion The study found that multiple poor environmental risk factors discouraged women from taking iron tablets continuously. The availability (frequent supply of iron tablets was the most effective way to help adult women to continue taking iron tablets.

THE USE OF POROUS CERAMICS FOR EVAPORATIVE AND EVAPORATIVE – VAPOR –COMPRESSION SYSTEMS

Directory of Open Access Journals (Sweden)

Cheban D.N.

2013-04-01

Full Text Available The use of natural evaporative cooling is one of technical solutions of problem of energy efficiency in air conditioning systems. The use of evaporative cooling in the first combined cooling stage allows reducing the load on the condenser of the cooling machine due to reducing of the condensing temperature. This combination allows the use of this type of system in any climatic conditions, including regions with small water resources. Multi-porous ceramic structure is used in evaporative air coolers and water coolers in this case. The objective of this paper is to show advantages of the using of porous ceramic as a working attachment, and to show advantages of the proposed scheme of compression-evaporation systems in comparison with standard vapor compression systems. Experimental research proved the fact, that in the film mode cooling efficiency of air flow is between EA=0,6÷0,7 and is slightly dependent of water flow. For countries with hot and dry climate where reserves of water are limited, it is recommended to use cyclical regime with EA≈0,65 value, or to use channel regime with a value of EA≈0,55. This leads to considerable energy savings. It has been determined, that combined air conditioning system is completely closed on the consumption of water at the parameters of the outside air equal to tA =32ºC and XA>13g/kg (in system with direct evaporative cooling machine, and tA=32ºC and XA>12g/kg (in system with indirect evaporative cooling machine. With these parameters, the cost of water in evaporative cooling stage can be fully compensated by condensate from the evaporator chiller.

PARMÊNIDES E O CAMINHO DA JUSTIÇA

Directory of Open Access Journals (Sweden)

Hilda Helena Soares Bentes

2011-07-01

Full Text Available Resumo: Propõe-se a analisar o pensamento de Parmênides, indicativo de uma concepção de Justiça a meio caminho entre o período pré-socrático e os sistemas filosóficos de Platão e Aristóteles. Inscreve-se Parmênides na fronteira de um pensar mítico e na busca de uma ordenação racional de ideias. O caminho delineado por Parmênides estabelece vias antitéticas, destacando-se o caminho do conhecimento verdadeiro. Viagem conduzida pela Deusa Justiça, em que se revela o itinerário rumo a um nível de maior abstração, afastando-se do plano da dóxa, reino das opiniões contrastantes. Trata-se da viagem do homem sábio em busca da sabedoria, dos fundamentos teóricos que balizam a condição humana e o Direito. Abstract: It seeks to analyze Parmenides´ thought, expressive of a conception of Justice that can be situated between the presocratic period and the philosophical systems of Plato and Aristotle. Parmenides is classified on the border of a mythical thinking and a search of a rational organization of ideas. The way outlined by Parmenides establishes two antithetical directions, with emphasis on the way of true knowledge. The journey is led by the Goddess of Justice, occasion when the path towards a level of more abstraction is taken, off the dóxa stage, considered the realm of the contrasting opinions. It concerns the journey of the wise man in search of wisdom, of the theoretical bases that founded the human condition and the Law.

Interfacial Microstructure Formed by Reactive Metal Penetration of Al into Mullite

International Nuclear Information System (INIS)

Du, T.B.; Ewsuk, K.G.; Fahrenholtz, W.G.; Loehman, R.E.; Lu, P.

1999-01-01

Microstructure in the reaction interface between molten Al and dense mullite have been studied by transmission electron microscopy to provide insight into mechanisms for forming ceramic-metal composites by reactive metal penetration. The reactions, which have the overall stoichiometry, 3Al number sign iz01 + (8+ x)A1 + 13 AlzO + xA1 + 6Si, were carried out at temperatures of 900, 1100, and 1200oC for 5 minutes and 60 minutes, and 1400oC for 15 minutes. Observed phases generally were those given in the above reaction, although their proportions and interracial rnicrostructures differed strongly with reaction temperature. After reaction at 900oC, a thin Al layer separated unreacted mullite from the cx-AlzO and Al reaction products. No Si phase was found near the reaction front. After 5 minutes at 1100''C, the nxtction front contained Si, ct-A120, and an aluminum oxide phase with a high concentration of Si. After 60 minutes at 11O(YC many of the cx-A120g particles were needle-shaped with a preferred orientation. After reaction at 1200oC, the reaction front contained a high density of Si particles that formed a continuous layer over many of the mullite grains. The sample reacted at 140VC for 15 minutes had a dense ct-A120J reaction layer less than 2m thick. Some isolated Si particles were present between the a-AlzO layer and the unreacted mullite. Using previously measured reaction kinetics data, the observed temperature dependence of the interracial microstructure have been modeled as three sequential steps, each one of which is rate-limiting in a different temperature range

Developing climate resilient rice through genomics assisted breeding

Directory of Open Access Journals (Sweden)

Valarmathi Muthu

2017-10-01

Full Text Available Rice is one of the major cereal food crops whose production has to be doubled to achieve the projected demand [1] and current yield trends are not sufficient to meet the projected growth in production. Increasing the rice production by 30% during 2030 needs overcoming challenges viz., yield plateau, declining land, water and labor resources and predicted effects of global climate change. Development of high performance rice genotypes with enhanced yield potential and resilience to climate change will help in sustained increase in rice production. Deployment of genomic technologies can accelerate development and delivery of improved germplasm with enhanced resilience and adaptability [2, 3]. In this context, the present study was undertaken with an aim of developing rice genotypes pyramided with QTLs/genes controlling tolerance against various biotic and abiotic stresses viz., bacterial leaf blight (xa13, Xa21, blast (Pi9, Gall midge (Gm4, drought (qDTY1.1 qDTY2.1, submergence (Sub1 and salinity (Saltol. CBMAS14065 an elite culture harboring QTLs controlling tolerance against drought, salinity and submergence was crossed with a donor harboring BLB, Blast and Gall midge resistant genes. True F1s were backcrossed with CBMAS14065 and BC1F1 progenies were subjected to foreground selection using markers linked to the target traits. Superior plants (18 of BC1F1 generation were subjected to background selection which revealed 71.42 - 86.90% recurrent parent (CBMAS14065 genome recovery. Selected BC1F1 plants were advanced to BC2F1 generation backcrossing with CBMAS14065. In BC2F1 generation, through foreground selection 6-8 QTL/gene positive plants have been selected and advanced for further evaluation. The superior lines with desired QTLs/genes will be subjected to rigorous phenotypic evaluation against target stresses and advanced further.

Expression and characterization of antimicrobial peptides Retrocyclin-101 and Protegrin-1 in chloroplasts to control viral and bacterial infections.

Science.gov (United States)

Lee, Seung-Bum; Li, Baichuan; Jin, Shuangxia; Daniell, Henry

2011-01-01

Retrocyclin-101 (RC101) and Protegrin-1 (PG1) are two important antimicrobial peptides that can be used as therapeutic agents against bacterial and/or viral infections, especially those caused by the HIV-1 or sexually transmitted bacteria. Because of their antimicrobial activity and complex secondary structures, they have not yet been produced in microbial systems and their chemical synthesis is prohibitively expensive. Therefore, we created chloroplast transformation vectors with the RC101 or PG1 coding sequence, fused with GFP to confer stability, furin or Factor Xa cleavage site to liberate the mature peptide from their fusion proteins and a His-tag to aid in their purification. Stable integration of RC101 into the tobacco chloroplast genome and homoplasmy were confirmed by Southern blots. RC101 and PG1 accumulated up to 32%-38% and 17%∼26% of the total soluble protein. Both RC101 and PG1 were cleaved from GFP by corresponding proteases in vitro, and Factor Xa-like protease activity was observed within chloroplasts. Confocal microscopy studies showed location of GFP fluorescence within chloroplasts. Organic extraction resulted in 10.6-fold higher yield of RC101 than purification by affinity chromatography using His-tag. In planta bioassays with Erwinia carotovora confirmed the antibacterial activity of RC101 and PG1 expressed in chloroplasts. RC101 transplastomic plants were resistant to tobacco mosaic virus infections, confirming antiviral activity. Because RC101 and PG1 have not yet been produced in other cell culture or microbial systems, chloroplasts can be used as bioreactors for producing these proteins. Adequate yield of purified antimicrobial peptides from transplastomic plants should facilitate further preclinical studies. © 2010 The Authors. Plant Biotechnology Journal © 2010 Society for Experimental Biology and Blackwell Publishing Ltd.

Pharmacokinetics of heparin and related polysaccharides

International Nuclear Information System (INIS)

Boneu, B.; Dol, F.; Caranobe, C.; Sie, P.; Houin, G.

1989-01-01

The pharmacodynamic profile of standard heparin (SH), a low molecular weight derivative (CY 216) and of dermatan sulfate (DS), a new potential antithrombotic drug, was investigated in the rabbit over a large range of doses. After bolus i.v. injection of low doses, the biological activity of SH disappeared exponentially; however, its half-life was prolonged when the dose injected increased, and over 158 micrograms/kg (100 anti-factor Xa U/kg) the biological activity disappeared as a concave-convex curve. CY 216 disappeared more slowly than SH at low doses but faster than SH at higher doses. More than 90% of the DS biological activity present 1 minute after the i.v. injection disappeared exponentially without dose-dependent effects. Increasing doses of the three drugs were then delivered for 5 h under continuous infusions. Below 500 micrograms/kg/h the DS and CY 216 plateau concentrations were higher than that of SH while above this dose the SH concentration was higher than that of DS and CY 216. These observations may be explained by the results of pharmacokinetics experiments where 125 I-labeled compounds were delivered by bolus i.v. injection in association with increasing doses of their unlabeled counterparts. For SH there was a 10-fold difference between the half-life of the lower dose (32 micrograms/kg or 5 anti-factor Xa U/kg) and that of the higher dose (3200 micrograms/kg); it was demonstrated that the half-life of SH continuously shortened as its plasma concentration decreased. In contrast the CY 216 and DS half-lives were very close, independent of the dose delivered, and therefore longer than that of SH at low doses and shorter than that of SH at higher doses

Contrasting Patterns of Genomic Diversity Reveal Accelerated Genetic Drift but Reduced Directional Selection on X-Chromosome in Wild and Domestic Sheep Species.

Science.gov (United States)

Chen, Ze-Hui; Zhang, Min; Lv, Feng-Hua; Ren, Xue; Li, Wen-Rong; Liu, Ming-Jun; Nam, Kiwoong; Bruford, Michael W; Li, Meng-Hua

2018-04-01

Analyses of genomic diversity along the X chromosome and of its correlation with autosomal diversity can facilitate understanding of evolutionary forces in shaping sex-linked genomic architecture. Strong selective sweeps and accelerated genetic drift on the X-chromosome have been inferred in primates and other model species, but no such insight has yet been gained in domestic animals compared with their wild relatives. Here, we analyzed X-chromosome variability in a large ovine data set, including a BeadChip array for 943 ewes from the world's sheep populations and 110 whole genomes of wild and domestic sheep. Analyzing whole-genome sequences, we observed a substantially reduced X-to-autosome diversity ratio (∼0.6) compared with the value expected under a neutral model (0.75). In particular, one large X-linked segment (43.05-79.25 Mb) was found to show extremely low diversity, most likely due to a high density of coding genes, featuring highly conserved regions. In general, we observed higher nucleotide diversity on the autosomes, but a flat diversity gradient in X-linked segments, as a function of increasing distance from the nearest genes, leading to a decreased X: autosome (X/A) diversity ratio and contrasting to the positive correlation detected in primates and other model animals. Our evidence suggests that accelerated genetic drift but reduced directional selection on X chromosome, as well as sex-biased demographic events, explain low X-chromosome diversity in sheep species. The distinct patterns of X-linked and X/A diversity we observed between Middle Eastern and non-Middle Eastern sheep populations can be explained by multiple migrations, selection, and admixture during the domestic sheep's recent postdomestication demographic expansion, coupled with natural selection for adaptation to new environments. In addition, we identify important novel genes involved in abnormal behavioral phenotypes, metabolism, and immunity, under selection on the sheep X-chromosome.

An implementation of the NiftyRec medical imaging library for PIXE-tomography reconstruction

Science.gov (United States)

Michelet, C.; Barberet, P.; Desbarats, P.; Giovannelli, J.-F.; Schou, C.; Chebil, I.; Delville, M.-H.; Gordillo, N.; Beasley, D. G.; Devès, G.; Moretto, P.; Seznec, H.

2017-08-01

A new development of the TomoRebuild software package is presented, including ;thick sample; correction for non linear X-ray production (NLXP) and X-ray absorption (XA). As in the previous versions, C++ programming with standard libraries was used for easier portability. Data reduction requires different steps which may be run either from a command line instruction or via a user friendly interface, developed as a portable Java plugin in ImageJ. All experimental and reconstruction parameters can be easily modified, either directly in the ASCII parameter files or via the ImageJ interface. A detailed user guide in English is provided. Sinograms and final reconstructed images are generated in usual binary formats that can be read by most public domain graphic softwares. New MLEM and OSEM methods are proposed, using optimized methods from the NiftyRec medical imaging library. An overview of the different medical imaging methods that have been used for ion beam microtomography applications is presented. In TomoRebuild, PIXET data reduction is performed for each chemical element independently and separately from STIMT, except for two steps where the fusion of STIMT and PIXET data is required: the calculation of the correction matrix and the normalization of PIXET data to obtain mass fraction distributions. Correction matrices for NLXP and XA are calculated using procedures extracted from the DISRA code, taking into account a large X-ray detection solid angle. For this, the 3D STIMT mass density distribution is used, considering a homogeneous global composition. A first example of PIXET experiment using two detectors is presented. Reconstruction results are compared and found in good agreement between different codes: FBP, NiftyRec MLEM and OSEM of the TomoRebuild software package, the original DISRA, its accelerated version provided in JPIXET and the accelerated MLEM version of JPIXET, with or without correction.

Direct Oral Anticoagulants: An Overview for the Interventional Radiologist

Energy Technology Data Exchange (ETDEWEB)

Kumar, Pradesh, E-mail: pradeshkumar@doctors.org.uk; Ravi, Rajeev, E-mail: rajeev.ravi@aintree.nhs.uk; Sundar, Gaurav, E-mail: gaurav.sundar@aintree.nhs.uk [Aintree University Hospitals NHS Foundation Trust, Radiology Department (United Kingdom); Shiach, Caroline, E-mail: caroline.shiach@aintree.nhs.uk [Aintree University Hospitals NHS Foundation Trust, Haematology Department (United Kingdom)

2017-03-15

The direct oral anticoagulants (DOACs) have emerged as a good alternative for the treatment of thromboembolic diseases, and their use in clinical practice is increasing rapidly. The DOACs act by blocking the activity of one single step in the coagulation cascade. These drugs act downstream in the common pathway of the coagulation cascade by directly antagonising the action of thrombin or factor Xa. The development of DOACs represents a paradigm shift from the oral vitamin K antagonists such as warfarin. This article aims to describe the properties of the currently available DOACs including pharmacology and dosing. We also address the strategies for periprocedural management and reversal of anticoagulation of patients treated with these agents.

Rivaroxaban-Induced Nontraumatic Spinal Subdural Hematoma: An Uncommon Yet Life-Threatening Complication

Directory of Open Access Journals (Sweden)

Mazen Zaarour

2015-01-01

Full Text Available In the last decade, the desire for safer oral anticoagulants (OACs led to the emergence of newer drugs. Available clinical trials demonstrated a lower risk of OACs-associated life-threatening bleeding events, including intracranial hemorrhage, compared to warfarin. Nontraumatic spinal hematoma is an uncommon yet life-threatening neurosurgical emergency that can be associated with the use of these agents. Rivaroxaban, one of the newly approved OACs, is a direct factor Xa inhibitor. To the best of our knowledge, to date, only two published cases report the incidence of rivaroxaban-induced nontraumatic spinal subdural hematoma (SSDH. Our case is the third one described and the first one to involve the cervicothoracic spine.

9433 Design Pointing Anomaly. Volume II. Appendices

Science.gov (United States)

1976-01-30

A X/A4 r42/ jC Pa4 ,oo/ £’dr/O N/ IV /pal B-87 ONb 1JP4C& PA64K W ’CIO4JL;O UEC- CA6 .rOSIN-A ~ ~VO 45 F ORT NO. PAGE CHECKED MODEL 7-&,td1V Z-/aZo or...BPS 13.12 Lubritation Treatment (Proprietary) BPS 16.1S Stainless Steel Passivation BPS 16.32 Primer Zinc-Chromate BPS 19.01 Packaging and Sealing...e at-orfr7ed mixork. 7--7-V-5O64ai �-SI-30?O, R~~MRGMLRCR COPY 0- /Z𔄁,r REWORK TREATMENT TRW BEARINGS P/N 32708-1 & -3 inse all bearing

Direct Oral Anticoagulants: An Overview for the Interventional Radiologist

International Nuclear Information System (INIS)

Kumar, Pradesh; Ravi, Rajeev; Sundar, Gaurav; Shiach, Caroline

2017-01-01

The direct oral anticoagulants (DOACs) have emerged as a good alternative for the treatment of thromboembolic diseases, and their use in clinical practice is increasing rapidly. The DOACs act by blocking the activity of one single step in the coagulation cascade. These drugs act downstream in the common pathway of the coagulation cascade by directly antagonising the action of thrombin or factor Xa. The development of DOACs represents a paradigm shift from the oral vitamin K antagonists such as warfarin. This article aims to describe the properties of the currently available DOACs including pharmacology and dosing. We also address the strategies for periprocedural management and reversal of anticoagulation of patients treated with these agents.

Blind Pose Prediction, Scoring, and Affinity Ranking of the CSAR 2014 Dataset.

Science.gov (United States)

Martiny, Virginie Y; Martz, François; Selwa, Edithe; Iorga, Bogdan I

2016-06-27

The 2014 CSAR Benchmark Exercise was focused on three protein targets: coagulation factor Xa, spleen tyrosine kinase, and bacterial tRNA methyltransferase. Our protocol involved a preliminary analysis of the structural information available in the Protein Data Bank for the protein targets, which allowed the identification of the most appropriate docking software and scoring functions to be used for the rescoring of several docking conformations datasets, as well as for pose prediction and affinity ranking. The two key points of this study were (i) the prior evaluation of molecular modeling tools that are most adapted for each target and (ii) the increased search efficiency during the docking process to better explore the conformational space of big and flexible ligands.

La utopía banal: la urbanización, la globalización y lo anti-bucólico en Últimas noticias del paraíso

Directory of Open Access Journals (Sweden)

Mac John Wilson

2012-01-01

Full Text Available One of the consequences of globalization in Spain has been the import of the so-called Anglo suburban culture coming from the western world. The development of this culture comes from pastoral roots, in that humans seek to live peacefully with each other as well as with non-humans. Nevertheless, as it has come into contact with capitalism, this pastoral culture has failed because it is commodified like any other consumer product. The Spanish residential communities that have inherited this cultural history in part are known as urbanizaciones. In Clara Sanchez's novel, Últimas noticias del paraíso, these communities reveal themselves as places built to bring together humanity and nature but that, from the perspective of a coming-of-age adolescent, in actuality are centers of artificiality condemned to banality. What this current work proposes is that Últimas noticias del paraíso presents itself as an anti-pastoral and in this way underlines the problems that the globalization of capitalistic culture brings with it by spreading alienation and ambivalence on the part of humanity when confronted with the natural world, even while maintaining a pastoral mask.

Dollar Summary of Federal Supply Classification and Service Category by Company, FY 87. Part 10. 5955-6650

Science.gov (United States)

1987-01-01

0 9 LA- I 4 n * f6 IM Iý 4 m0 n -6 .4 M I4NO *0 0 C’ M VM0 tCJOP # 0 m v O a- 0 .4 -4 .4 -4 . -4 -4 .4 in 4 64 I -C6I *- 1 a 1- .0 6 1- V)f if. U...0H 0 xc w 0 W co <H Q4 Q- 0 C) 1 0 WU 0 1 H W IL < H w) Wj <) 4 1.- 0 H acca ~ cc xa 4 H H c .4 4)I c 0 I-H na zc cc 1- 40 m-c c IQ01 Z ZH 0 O w 0- a

On quadratic residue codes and hyperelliptic curves

Directory of Open Access Journals (Sweden)

David Joyner

2008-01-01

Full Text Available For an odd prime p and each non-empty subset S⊂GF(p, consider the hyperelliptic curve X S defined by y 2 =f S (x, where f S (x = ∏ a∈S (x-a. Using a connection between binary quadratic residue codes and hyperelliptic curves over GF(p, this paper investigates how coding theory bounds give rise to bounds such as the following example: for all sufficiently large primes p there exists a subset S⊂GF(p for which the bound |X S (GF(p| > 1.39p holds. We also use the quasi-quadratic residue codes defined below to construct an example of a formally self-dual optimal code whose zeta function does not satisfy the ``Riemann hypothesis.''

Reversal of target-specific oral anticoagulants

Science.gov (United States)

Siegal, D.M.; Cuker, Adam

2014-01-01

Target-specific oral anticoagulants (TSOACs) provide safe and effective anticoagulation for the prevention and treatment of thrombosis in a variety of clinical settings by interfering with the activity of thrombin (dabigatran) or factor Xa (rivaroxaban, apixaban, edoxaban, betrixaban). Although TSOACs have practical advantages over vitamin K antagonists (VKAs), there are currently no antidotes to reverse their anticoagulant effect. Herein we summarize the available evidence for TSOAC reversal using nonspecific and specific reversal agents. We discuss important limitations of existing evidence, which is derived from studies in human volunteers, animal models and in vitro experiments. Studies evaluating the safety and efficacy of reversal agents on clinical outcomes such as bleeding and mortality in patients with TSOAC-associated bleeding are needed. PMID:24880102

Exact Performance of General Second-Order Processors for Gaussian Inputs

Science.gov (United States)

1983-10-15

general than the characteristic function considered in [3, eq. 5], which itself required a very lengthy analytic treatment to get the probability...8217 1970 13=2*12 1980 I4 = N/I3 1990 FOR 15=1 TO 12 2000 I6=(:i5-l)*I4+l 2010 IF I6<=H2 THEN 2050 2020 N6 = -CCN4-I6-1 > 2030 N7 = - Ca6 -Nl-i;’ 2040...GOTO 2070 2050 N6= ca6 -i:j 2060 H7=-C(N3-I6-1) 2070 FOR 17=0 TO H-I3 STEP I 2080 18=17+15 2090 19=18+12 2100 N8 = X(I8-n-Xa9-l> 2110 N9 = Ya8-l

High-producing MBL2 genotypes increase the risk of acute and chronic carditis in patients with history of rheumatic fever

DEFF Research Database (Denmark)

Schafranski, Marcelo Derbli; Pereira Ferrari, Lílian; Scherner, Daniela

2008-01-01

with a history of RF. Polymorphisms in exon 1 and in the X/Y promoter region of the MBL2 gene were determined by PCR-SSP in 149 patients with a history of RF and 147 controls. Genotypes associated with the high production of MBL (YA/YA and YA/XA) were more frequent in the patients with acute (26/35, 74...... patients presenting MBL2 genotypes related to the low production of MBL (10/14, 71% vs. 10/28, 36%; p=0.048, OR 0.22, 95% CI 0.05-0.89). We concluded that MBL2 genotypes associated with the high production of MBL seem to be involved in the pathogenesis of rheumatic carditis and its progression to CRHD....

A mutli-technique search for the most primitive CO chondrites

Science.gov (United States)

Alexander, C. M. O'D.; Greenwood, R. C.; Bowden, R.; Gibson, J. M.; Howard, K. T.; Franchi, I. A.

2018-01-01

As part of a study to identify the most primitive COs and to look for weakly altered CMs amongst the COs, we have conducted a multi-technique study of 16 Antarctic meteorites that had been classified as primitive COs. For this study, we have determined: (1) the bulk H, C and N abundances and isotopes, (2) bulk O isotopic compositions, (3) bulk modal mineralogies, and (4) for some selected samples the abundances and compositions of their insoluble organic matter (IOM). Two of the 16 meteorites do appear to be CMs - BUC 10943 seems to be a fairly typical CM, while MIL 090073 has probably been heated. Of the COs, DOM 08006 appears to be the most primitive CO identified to date and is quite distinct from the other members of its pairing group. The other COs fall into two groups that are less primitive than DOM 08006 and ALH 77307, the previously most primitive CO. The first group is composed of members of the DOM 08004 pairing group, except DOM 08006. The second group is composed of meteorites belonging to the MIL 03377 and MIL 07099 pairing groups. These two pairing groups should probably be combined. There is a dichotomy in the bulk O isotopes between the primitive (all Antarctic finds) and the more metamorphosed COs (mostly falls). This dichotomy can only partly be explained by the terrestrial weathering experienced by the primitive Antarctic samples. It seems that the more equilibrated samples interacted to a greater extent with 16O-poor material, probably water, than the more primitive meteorites.

Gafas

Directory of Open Access Journals (Sweden)

Ramon Balius i Juli

2007-06-01

Full Text Available Este número de la revista, como podéis ver, es un número monográfico dedicado al tema Visión y Deporte. Era necesario encontrar una portada adecuada a estos dos conceptos. Pensamos que reúne estas cualidades un cartel de la Colección de la Biblioteca del Deporte, en el cual un atleta con gafas, vestido con una camiseta del BUC (Barcelona Universitari Club,* está a punto de lanzar la jabalina. Su aspecto es el de un deportista de diseño bien estructurado, quizá un poco cuadriculado, que está haciendo su trabajo con seguridad. Este cartel se había editado para anunciar los 3.os Campeonatos de España Universitarios de Atletismo que se celebraron en Barcelona, en el Estadio de Montjuich (sic los días 9 y 10 de mayo de 1936. Menos de dos meses después tenía que inaugurarse en el mismo escenario la denominada Olimpíada Popular, acontecimiento que la sublevación militar del 18 de julio, inicio de la Guerra Civil, impidió. Lo que resulta significativo de este cartel son las gafas del protagonista. Creemos que son pocos los deportistas que compiten con esta ayuda. Posiblemente con las gafas se quería potenciar el carácter intelectual y universitario del atleta. Creemos que no es casual que el récord del mundo de 1936 lo poseía el finés Matti Jarvinen, que usaba gafas.

Procoagulant, tissue factor-bearing microparticles in bronchoalveolar lavage of interstitial lung disease patients: an observational study.

Directory of Open Access Journals (Sweden)

Federica Novelli

Full Text Available Coagulation factor Xa appears involved in the pathogenesis of pulmonary fibrosis. Through its interaction with protease activated receptor-1, this protease signals myofibroblast differentiation in lung fibroblasts. Although fibrogenic stimuli induce factor X synthesis by alveolar cells, the mechanisms of local posttranslational factor X activation are not fully understood. Cell-derived microparticles are submicron vesicles involved in different physiological processes, including blood coagulation; they potentially activate factor X due to the exposure on their outer membrane of both phosphatidylserine and tissue factor. We postulated a role for procoagulant microparticles in the pathogenesis of interstitial lung diseases. Nineteen patients with interstitial lung diseases and 11 controls were studied. All subjects underwent bronchoalveolar lavage; interstitial lung disease patients also underwent pulmonary function tests and high resolution CT scan. Microparticles were enumerated in the bronchoalveolar lavage fluid with a solid-phase assay based on thrombin generation. Microparticles were also tested for tissue factor activity. In vitro shedding of microparticles upon incubation with H₂O₂ was assessed in the human alveolar cell line, A549 and in normal bronchial epithelial cells. Tissue factor synthesis was quantitated by real-time PCR. Total microparticle number and microparticle-associated tissue factor activity were increased in interstitial lung disease patients compared to controls (84±8 vs. 39±3 nM phosphatidylserine; 293±37 vs. 105±21 arbitrary units of tissue factor activity; mean±SEM; p<.05 for both comparisons. Microparticle-bound tissue factor activity was inversely correlated with lung function as assessed by both diffusion capacity and forced vital capacity (r² = .27 and .31, respectively; p<.05 for both correlations. Exposure of lung epithelial cells to H₂O₂ caused an increase in microparticle-bound tissue factor

Cocos nucifera Linn. (Palmae) husk fiber ethanolic extract: antioxidant capacity and electrochemical investigation.

Science.gov (United States)

Oliveira, Monika Bezerra dos Santos; Valentim, Iara Barros; de Vasconcelos, Camila Calado; Omena, Cristhiane Maria Bazílio; Bechara, Etelvino José Henriques; da Costa, João Gomes; Freitas, Mikael de Lima; Sant'Ana, Antônio Euzébio Goulart; Goulart, Marília Oliveira Fonseca

2013-02-01

The present study aims to determine the antioxidant capacity of the ethanolic extracts of husk fiber of four coconut (Cocos nucifera L.) varieties (yellow dwarf, green dwarf, giant and hybrid) and to evaluate the electrochemical behavior of these extracts on a glassy carbon electrode and on a modified glassy carbon electrode. The highest values of total phenolic content were obtained for the hybrid (531 ± 24 mg GAE g(-1) dry extract) and yellow dwarf (501 ± 29 mg GAE g(-1) dry extract) varieties and the lowest was for the green dwarf variety with 58 ± 9 mg GAE g(-1) dry extract. The ability of the extracts to scavenge DPPH˙ radicals was in the order of giant > yellow dwarf > hybrid > green dwarf and the IC50 values varied from 8.6 to 55.9 μg mL(-1). All varieties showed reducing potential by the use of FRAP and CUPRAC methods, with the lowest performance obtained for the green dwarf variety. Additionally, through the use of mimetic biomembranes, ethanolic extracts of coconut husk were shown to protect lipids against oxidative damage independent of the variety. The main antioxidants identified in the extract of yellow dwarf variety by UPLC-MS were quercetin and catechin. Cyclic voltammetric studies of the ethanolic extracts on glassy carbon electrode confirmed the presence of easily oxidized compounds, and the high antioxidant capacity of the varieties. This capacity was expressed as mg quercetin equivalents g(-1) dry extract and ranged from 25.9 up to 53.5 mg QE g(-1). A poly-xanthurenic acid (poly-Xa)/multi-walled carbon nanotube (MWCNT) / glassy carbon modified electrode (poly-Xa/MWCNT/GCE) was used for this purpose. Our findings suggest that these extracts are potentially important antioxidant supplements for the everyday human diet, pharmaceutical and cosmetic industries, thereby aggregating value to the enormous amount of waste from the coconut industry, mostly used for burning purposes.

Deep vein thrombosis: a clinical review

Directory of Open Access Journals (Sweden)

Kesieme EB

2011-04-01

Full Text Available Emeka Kesieme1, Chinenye Kesieme2, Nze Jebbin3, Eshiobo Irekpita1, Andrew Dongo11Department of Surgery, Irrua Specialist Teaching Hospital, Irrua, Nigeria; 2Department of Paediatrics, Irrua Specialist Teaching Hospital, Irrua, Nigeria; 3Department of Surgery, University of Port Harcourt Teaching Hospital, Port-Harcourt, NigeriaBackground: Deep vein thrombosis (DVT is the formation of blood clots (thrombi in the deep veins. It commonly affects the deep leg veins (such as the calf veins, femoral vein, or popliteal vein or the deep veins of the pelvis. It is a potentially dangerous condition that can lead to preventable morbidity and mortality.Aim: To present an update on the causes and management of DVT.Methods: A review of publications obtained from Medline search, medical libraries, and Google.Results: DVT affects 0.1% of persons per year. It is predominantly a disease of the elderly and has a slight male preponderance. The approach to making a diagnosis currently involves an algorithm combining pretest probability, D-dimer testing, and compression ultrasonography. This will guide further investigations if necessary. Prophylaxis is both mechanical and pharmacological. The goals of treatment are to prevent extension of thrombi, pulmonary embolism, recurrence of thrombi, and the development of complications such as pulmonary hypertension and post-thrombotic syndrome.Conclusion: DVT is a potentially dangerous condition with a myriad of risk factors. Prophylaxis is very important and can be mechanical and pharmacological. The mainstay of treatment is anticoagulant therapy. Low-molecular-weight heparin, unfractionated heparin, and vitamin K antagonists have been the treatment of choice. Currently anticoagulants specifically targeting components of the common pathway have been recommended for prophylaxis. These include fondaparinux, a selective indirect factor Xa inhibitor and the new oral selective direct thrombin inhibitors (dabigatran and selective

Prolonged Activated Clotting Time after Protamine Administration Does Not Indicate Residual Heparinization after Cardiopulmonary Bypass in Pediatric Open Heart Surgery.

Science.gov (United States)

Yamamoto, Tomohiro; Wolf, Hans-Gerd; Sinzobahamvya, Nicodème; Asfour, Boulos; Hraska, Victor; Schindler, Ehrenfried

2015-08-01

In open heart surgery, heparinization is commonly neutralized using an empirical heparin:protamine ratio ranging between 1:1 and 1:1.5. However, these ratios may result in protamine overdose that should be avoided for its negative side effects on the coagulation system. This study aimed to indicate the appropriate treatment for prolonged activated clotting time (ACT) after protamine administration following cardiopulmonary bypass (CPB) in pediatric open heart surgery by investigating the underlying reasons for it. Twenty-seven children (open heart surgery were included. Heparin was administered only before CPB (400 IU/kg) and in the pump priming volume for CPB (2,000 IU) and was neutralized by 1:1 protamine after CPB. The blood heparin concentration was measured using anti-Xa assay. ACT and blood concentrations of heparin, coagulation factors, thrombin-antithrombin complex, and prothrombin fragment 1 + 2 were assessed. A rotational thromboelastometry (ROTEM; Tem International GmbH, München, Bayern, Germany) was used to confirm the coagulation status and residual heparin after protamine administration. Anti-Xa assay showed that there is no residual heparin in the blood after 1:1 protamine administration. Nevertheless, ACT (128.89 ± 3.09 seconds before heparin administration) remained prolonged (177.14 ± 5.43 seconds at 10 minutes after protamine, 182.00 ± 5.90 seconds at 30 minutes after protamine). The blood concentrations of coagulation factors were significantly lower than those before heparin administration (p < 0.01). The low FIBTEM MCF of ROTEM (4.43 ± 0.32 mm) at 10 minutes after protamine indicated low fibrinogen concentration. Prolonged ACT after heparin neutralization by 1:1 protamine administration does not necessarily indicate residual heparin, but low blood concentrations of coagulation factors should be considered as a reason as well. Accordingly, supply of coagulation factors instead of additional protamine should be

Conversion of xylan by recyclable spores of Bacillus subtilis displaying thermophilic enzymes.

Science.gov (United States)

Mattossovich, Rosanna; Iacono, Roberta; Cangiano, Giuseppina; Cobucci-Ponzano, Beatrice; Isticato, Rachele; Moracci, Marco; Ricca, Ezio

2017-11-28

The Bacillus subtilis spore has long been used to display antigens and enzymes. Spore display can be accomplished by a recombinant and a non-recombinant approach, with the latter proved more efficient than the recombinant one. We used the non-recombinant approach to independently adsorb two thermophilic enzymes, GH10-XA, an endo-1,4-β-xylanase (EC 3.2.1.8) from Alicyclobacillus acidocaldarius, and GH3-XT, a β-xylosidase (EC 3.2.1.37) from Thermotoga thermarum. These enzymes catalyze, respectively, the endohydrolysis of (1-4)-β-D-xylosidic linkages of xylans and the hydrolysis of (1-4)-β-D-xylans to remove successive D-xylose residues from the non-reducing termini. We report that both purified enzymes were independently adsorbed on purified spores of B. subtilis. The adsorption was tight and both enzymes retained part of their specific activity. When spores displaying either GH10-XA or GH3-XT were mixed together, xylan was hydrolysed more efficiently than by a mixture of the two free, not spore-adsorbed, enzymes. The high total activity of the spore-bound enzymes is most likely due to a stabilization of the enzymes that, upon adsorption on the spore, remained active at the reaction conditions for longer than the free enzymes. Spore-adsorbed enzymes, collected after the two-step reaction and incubated with fresh substrate, were still active and able to continue xylan degradation. The recycling of the mixed spore-bound enzymes allowed a strong increase of xylan degradation. Our results indicate that the two-step degradation of xylans can be accomplished by mixing spores displaying either one of two required enzymes. The two-step process occurs more efficiently than with the two un-adsorbed, free enzymes and adsorbed spores can be reused for at least one other reaction round. The efficiency of the process, the reusability of the adsorbed enzymes, and the well documented robustness of spores of B. subtilis indicate the spore as a suitable platform to display enzymes

Detection of the electronic structure of iron-(iii)-oxo oligomers forming in aqueous solutions.

Science.gov (United States)

Seidel, Robert; Kraffert, Katrin; Kabelitz, Anke; Pohl, Marvin N; Kraehnert, Ralph; Emmerling, Franziska; Winter, Bernd

2017-12-13

The nature of the small iron-oxo oligomers in iron-(iii) aqueous solutions has a determining effect on the chemical processes that govern the formation of nanoparticles in aqueous phase. Here we report on a liquid-jet photoelectron-spectroscopy experiment for the investigation of the electronic structure of the occurring iron-oxo oligomers in FeCl 3 aqueous solutions. The only iron species in the as-prepared 0.75 M solution are Fe 3+ monomers. Addition of NaOH initiates Fe 3+ hydrolysis which is followed by the formation of iron-oxo oligomers. At small enough NaOH concentrations, corresponding to approximately [OH]/[Fe] = 0.2-0.25 ratio, the iron oligomers can be stabilized for several hours without engaging in further aggregation. Here, we apply a combination of non-resonant as well as iron 2p and oxygen 1s resonant photoelectron spectroscopy from a liquid microjet to detect the electronic structure of the occurring species. Specifically, the oxygen 1s partial electron yield X-ray absorption (PEY-XA) spectra are found to exhibit a peak well below the onset of liquid water and OH - (aq) absorption. The iron 2p absorption gives rise to signal centered between the main absorption bands typical for aqueous Fe 3+ . Absorption bands in both PEY-XA spectra are found to correlate with an enhanced photoelectron peak near 20 eV binding energy, which demonstrates the sensitivity of resonant photoelectron (RPE) spectroscopy to mixing between iron and ligand orbitals. These various signals from the iron-oxo oligomers exhibit maximum intensity at [OH]/[Fe] = 0.25 ratio. For the same ratio, we observe changes in the pH as well as in complementary Raman spectra, which can be assigned to the transition from monomeric to oligomeric species. At approximately [OH]/[Fe] = 0.3 we begin to observe particles larger than 1 nm in radius, detected by small-angle X-ray scattering.

5meCpG epigenetic marks neighboring a primate-conserved core promoter short tandem repeat indicate X-chromosome inactivation.

Science.gov (United States)

Machado, Filipe Brum; Machado, Fabricio Brum; Faria, Milena Amendro; Lovatel, Viviane Lamim; Alves da Silva, Antonio Francisco; Radic, Claudia Pamela; De Brasi, Carlos Daniel; Rios, Álvaro Fabricio Lopes; de Sousa Lopes, Susana Marina Chuva; da Silveira, Leonardo Serafim; Ruiz-Miranda, Carlos Ramon; Ramos, Ester Silveira; Medina-Acosta, Enrique

2014-01-01

X-chromosome inactivation (XCI) is the epigenetic transcriptional silencing of an X-chromosome during the early stages of embryonic development in female eutherian mammals. XCI assures monoallelic expression in each cell and compensation for dosage-sensitive X-linked genes between females (XX) and males (XY). DNA methylation at the carbon-5 position of the cytosine pyrimidine ring in the context of a CpG dinucleotide sequence (5meCpG) in promoter regions is a key epigenetic marker for transcriptional gene silencing. Using computational analysis, we revealed an extragenic tandem GAAA repeat 230-bp from the landmark CpG island of the human X-linked retinitis pigmentosa 2 RP2 promoter whose 5meCpG status correlates with XCI. We used this RP2 onshore tandem GAAA repeat to develop an allele-specific 5meCpG-based PCR assay that is highly concordant with the human androgen receptor (AR) exonic tandem CAG repeat-based standard HUMARA assay in discriminating active (Xa) from inactive (Xi) X-chromosomes. The RP2 onshore tandem GAAA repeat contains neutral features that are lacking in the AR disease-linked tandem CAG repeat, is highly polymorphic (heterozygosity rates approximately 0.8) and shows minimal variation in the Xa/Xi ratio. The combined informativeness of RP2/AR is approximately 0.97, and this assay excels at determining the 5meCpG status of alleles at the Xp (RP2) and Xq (AR) chromosome arms in a single reaction. These findings are relevant and directly translatable to nonhuman primate models of XCI in which the AR CAG-repeat is monomorphic. We conducted the RP2 onshore tandem GAAA repeat assay in the naturally occurring chimeric New World monkey marmoset (Callitrichidae) and found it to be informative. The RP2 onshore tandem GAAA repeat will facilitate studies on the variable phenotypic expression of dominant and recessive X-linked diseases, epigenetic changes in twins, the physiology of aging hematopoiesis, the pathogenesis of age-related hematopoietic

Petroleum resources assessment on the western part of the Kunsan Basin

Energy Technology Data Exchange (ETDEWEB)

Park, K S; Park, K P; Sunwoo, D; Yoo, D G; Cheong, T J; Oh, J H; Bong, P Y; Son, J D; Lee, H Y; Ryu, B J; Son, B K; Hwang, I G; Kwon, Y I; Lee, Y J; Kim, H J [Korea Institute of Geology Mining and Materials, Taejon (Korea, Republic of)

1997-12-01

Palynomorphs including spores, pollen and organic-walled microfossils and calcareous microfossils such as ostracods, charophytes and gastropods were studied for the biostratigraphic work of Kachi-1 and IIH-1Xa wells. All the microfossils yielded from two wells indicate nonmarine environment ranging from shallow lacustrine to fluvial one. The paleoclimates have been fluctuated between subtropical and cool temperate with arid/humid alternating conditions. The fluvial sandstone of the interval between 2017 m and 2021 m could be a potential reservoir rock in the well Kachi-1. The sandstone from 1587 m to 1592 could be also a potential reservoir rock even if further study is necessary for the cap rock. Content of organic matter is very low and the type is compared to III in the section penetrated by the above two wells. Thermal maturity might reach top of oil window at depth about 1200 m by Tmax and about 1300 m by biomarker analysis in the Kachi-1 well. On the basis of illite crystallinity, the top of oil generation zone could be located at the depth 1600 m. The thermal maturity could not be determined in the IIH-1Xa well, because of the extremely low organic matter content or bad state of samples. Hydrocarbon genetic potential is almost null in the both well except for a few sample in the thermally immature interval. Analysis of approximately 3,300 Line-km of multichannel seismic data integrated with 3 well data provides an insight of structural evolution of the western part of the Yellow Sea Basin. Tectonics of the rifting phase have been established on the basis of structural and stratigraphic analyses of depositional sequences and their seismic expressions. Based on available well data, the rifting probably began in the Cretaceous time had continued until Paleocene. It is considered that compressional force immediately after rifting event deformed sedimentary sections. During the period of Paleocene to middle Miocene, the sediments were deposited in stable

5meCpG epigenetic marks neighboring a primate-conserved core promoter short tandem repeat indicate X-chromosome inactivation.

Directory of Open Access Journals (Sweden)

Filipe Brum Machado

Full Text Available X-chromosome inactivation (XCI is the epigenetic transcriptional silencing of an X-chromosome during the early stages of embryonic development in female eutherian mammals. XCI assures monoallelic expression in each cell and compensation for dosage-sensitive X-linked genes between females (XX and males (XY. DNA methylation at the carbon-5 position of the cytosine pyrimidine ring in the context of a CpG dinucleotide sequence (5meCpG in promoter regions is a key epigenetic marker for transcriptional gene silencing. Using computational analysis, we revealed an extragenic tandem GAAA repeat 230-bp from the landmark CpG island of the human X-linked retinitis pigmentosa 2 RP2 promoter whose 5meCpG status correlates with XCI. We used this RP2 onshore tandem GAAA repeat to develop an allele-specific 5meCpG-based PCR assay that is highly concordant with the human androgen receptor (AR exonic tandem CAG repeat-based standard HUMARA assay in discriminating active (Xa from inactive (Xi X-chromosomes. The RP2 onshore tandem GAAA repeat contains neutral features that are lacking in the AR disease-linked tandem CAG repeat, is highly polymorphic (heterozygosity rates approximately 0.8 and shows minimal variation in the Xa/Xi ratio. The combined informativeness of RP2/AR is approximately 0.97, and this assay excels at determining the 5meCpG status of alleles at the Xp (RP2 and Xq (AR chromosome arms in a single reaction. These findings are relevant and directly translatable to nonhuman primate models of XCI in which the AR CAG-repeat is monomorphic. We conducted the RP2 onshore tandem GAAA repeat assay in the naturally occurring chimeric New World monkey marmoset (Callitrichidae and found it to be informative. The RP2 onshore tandem GAAA repeat will facilitate studies on the variable phenotypic expression of dominant and recessive X-linked diseases, epigenetic changes in twins, the physiology of aging hematopoiesis, the pathogenesis of age-related hematopoietic

Determinants of marginalization and inequitable maternal health care in North–Central Vietnam: a framework analysis

Directory of Open Access Journals (Sweden)

Pauline Binder-Finnema

2015-07-01

Full Text Available Background: Vietnam has achieved great improvements in maternal healthcare outcomes, but there is evidence of increasing inequity. Disadvantaged groups, predominantly ethnic minorities and people living in remote mountainous areas, do not gain access to maternal health improvements despite targeted efforts from policymakers. Objective: This study identifies underlying structural barriers to equitable maternal health care in Nghe An province, Vietnam. Experiences of social inequity and limited access among child-bearing ethnic and minority women are explored in relation to barriers of care provision experienced by maternal health professionals to gain deeper understanding on health outcomes. Design: In 2012, 11 focus group discussions with women and medical care professionals at local community health centers and district hospitals were conducted using a hermeneutic–dialectic method and analyzed for interpretation using framework analysis. Results: The social determinants ‘limited negotiation power’ and ‘limited autonomy’ orchestrate cyclical effects of shared marginalization for both women and care professionals within the provincial health system’s infrastructure. Under-staffed and poorly equipped community health facilities refer women and create overload at receiving health centers. Limited resources appear diverted away from local community centers as compensation to the district for overloaded facilities. Poor reputation for low care quality exists, and professionals are held in low repute for causing overload and resulting adverse outcomes. Country-wide reforms force women to bear responsibility for limited treatment adherence and health insight, but overlook providers’ limited professional development. Ethnic minority women are hindered by relatives from accessing care choices and costs, despite having advanced insight about government reforms to alleviate poverty. Communication challenges are worsened by non

Determinants of marginalization and inequitable maternal health care in North–Central Vietnam: a framework analysis

Science.gov (United States)

Binder-Finnema, Pauline; Lien, Pham T. L.; Hoa, Dinh T. P.; Målqvist, Mats

2015-01-01

Background Vietnam has achieved great improvements in maternal healthcare outcomes, but there is evidence of increasing inequity. Disadvantaged groups, predominantly ethnic minorities and people living in remote mountainous areas, do not gain access to maternal health improvements despite targeted efforts from policymakers. Objective This study identifies underlying structural barriers to equitable maternal health care in Nghe An province, Vietnam. Experiences of social inequity and limited access among child-bearing ethnic and minority women are explored in relation to barriers of care provision experienced by maternal health professionals to gain deeper understanding on health outcomes. Design In 2012, 11 focus group discussions with women and medical care professionals at local community health centers and district hospitals were conducted using a hermeneutic–dialectic method and analyzed for interpretation using framework analysis. Results The social determinants ‘limited negotiation power’ and ‘limited autonomy’ orchestrate cyclical effects of shared marginalization for both women and care professionals within the provincial health system’s infrastructure. Under-staffed and poorly equipped community health facilities refer women and create overload at receiving health centers. Limited resources appear diverted away from local community centers as compensation to the district for overloaded facilities. Poor reputation for low care quality exists, and professionals are held in low repute for causing overload and resulting adverse outcomes. Country-wide reforms force women to bear responsibility for limited treatment adherence and health insight, but overlook providers’ limited professional development. Ethnic minority women are hindered by relatives from accessing care choices and costs, despite having advanced insight about government reforms to alleviate poverty. Communication challenges are worsened by non-existent interpretation systems

Determinants of marginalization and inequitable maternal health care in North-Central Vietnam: a framework analysis.

Science.gov (United States)

Binder-Finnema, Pauline; Lien, Pham T L; Hoa, Dinh T P; Målqvist, Mats

2015-01-01

Vietnam has achieved great improvements in maternal healthcare outcomes, but there is evidence of increasing inequity. Disadvantaged groups, predominantly ethnic minorities and people living in remote mountainous areas, do not gain access to maternal health improvements despite targeted efforts from policymakers. This study identifies underlying structural barriers to equitable maternal health care in Nghe An province, Vietnam. Experiences of social inequity and limited access among child-bearing ethnic and minority women are explored in relation to barriers of care provision experienced by maternal health professionals to gain deeper understanding on health outcomes. In 2012, 11 focus group discussions with women and medical care professionals at local community health centers and district hospitals were conducted using a hermeneutic-dialectic method and analyzed for interpretation using framework analysis. The social determinants 'limited negotiation power' and 'limited autonomy' orchestrate cyclical effects of shared marginalization for both women and care professionals within the provincial health system's infrastructure. Under-staffed and poorly equipped community health facilities refer women and create overload at receiving health centers. Limited resources appear diverted away from local community centers as compensation to the district for overloaded facilities. Poor reputation for low care quality exists, and professionals are held in low repute for causing overload and resulting adverse outcomes. Country-wide reforms force women to bear responsibility for limited treatment adherence and health insight, but overlook providers' limited professional development. Ethnic minority women are hindered by relatives from accessing care choices and costs, despite having advanced insight about government reforms to alleviate poverty. Communication challenges are worsened by non-existent interpretation systems. For maternal health policy outcomes to become effective

Upgrade and optimization of control systems help E.ON's Scholven plant to increase plant lifecycle and meet new market requirements

Energy Technology Data Exchange (ETDEWEB)

Alexander Frick; Joerg Orth

2006-07-01

A large percentage of Germany's installed base of power stations will continue to operate well into the next decade. E.ON therefore continues to focus on optimizing and maintaining its operating plants. A key component is the process control system - the data, information and nerve center of these plants. Parts shortages related to outdated technology and new, added process and operational requirements demand focused capital investment. E.ON has therefore implemented a program to upgrade a large part of the process control infrastructure at the Scholven facility. An important step was the successful replacement of the Unit C process control system during a ten-week maintenance outage in fall 2005. The new power station control system selected was ABB's System 800xA. 7 figs.

AFOSR (Air Force Office of Scientific Research) Technical Report Summaries, July-September 1983.

Science.gov (United States)

1983-09-01

I ~ ~ ~ fllffbff flfl fffIN hl h9hhhhhhhI 0mhhhhF/8h5/2hME lffffffffffffl 2.2l PHOTOGRAPH THIS SHEET 0) LEVEL INVENTORY z 0 I DOCUMENT IDENTIFICATION... MCQ . LILU C) -0 L. Z- m (C. *..iV 0 :--M L - -0 41 - w M - = C c m < 0 L L.. "t Wco t- . C - W -Z L C3C 0) M- co- - - < 0l..(AJ (D ) -- U n 0. aL...U10- .. v C 0 .1U -L L-UW.O- -0 < -- 44-00in 0 / 10 14 ( - (A 0 0- 0 ixa .410 > C 0 .L UC 41 vJC Cw MIX -- -M DIM U C4 1-L C - 0 - C)U1 )Q) XC 1000 xa o

Meltability in system of K2TaF7-NaF-NaCl-KCl

International Nuclear Information System (INIS)

Kartsev, V.E.; Kovalev, F.V.; Korshunov, B.G.

1975-01-01

Thermographic and visual-polythermal techniques were used to study the meltability in K 2 TaF 7 -NaF-NaCl-KCl system. The tetrahedron-forming sections NaF-NaCl-K 2 TaF 7 xKCl and NaF-K 2 TaF 7 xKCl-2K 2 TaF 7 xNaCl divide the concentration tetrahedron into three particular tetrahedra: NaF-K 2 TaF 7 xKCl-2K 2 TaF 7 xNaCl-K 2 TaF 7 , NaF-NaCl-K 2 TaF 7 xKCl-2K 2 TaF 7 xaCl, and NaF-NaCl-KCl-K 2 TaF 7 xKCl. Non-variant equilibrium points in all of the particular four-component systems have been determined