Neutron Decay with PERC: a Progress Report

International Nuclear Information System (INIS)

Konrad, G; Abele, H; Erhart, J; Fillunger, H; Gösselsberger, C; Horvath, M; Jericha, E; Klauser, C; Maix, R K; Nowak, S; Sauerzopf, C; Beck, M; Heil, W; Drescher, C; Dubbers, D; Märkisch, B; Mest, H; Rebrova, N; Roick, C; Klenke, J

2012-01-01

The PERC collaboration will perform high-precision measurements of angular correlations in neutron beta decay at the beam facility MEPHISTO of the Forschungs-Neutronenquelle Heinz Maier-Leibnitz in Munich, Germany. The new beam station PERC, a clean, bright, and versatile source of neutron decay products, is designed to improve the sensitivity of neutron decay studies by one order of magnitude. The charged decay products are collected by a strong longitudinal magnetic field directly from inside a neutron guide. This combination provides the highest phase space density of decay products. A magnetic mirror serves to perform precise cuts in phase space, reducing related systematic errors. The new instrument PERC is under development by an international collaboration. The physics motivation, sensitivity, and applications of PERC as well as the status of the design and preliminary results on uncertainties in proton spectroscopy are presented in this paper.

Protect and Restore Red River Watershed, 2007-2008 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Bransford, Stephanie [Nez Perce Tribe Fisheries/Watershed Program

2009-05-04

The Nez Perce Tribe Department of Fisheries Resource Management, Watershed Division approaches watershed restoration with a ridge-top to ridge-top approach. The Nez Perce Tribe (NPT) and the Nez Perce National Forest (NPNF) have formed a partnership in completing watershed restoration activities, and through this partnership more work is accomplished by sharing funding and resources in our effort. The Nez Perce Tribe began watershed restoration projects within the Red River Watershed of the South Fork Clearwater River in 2001. Progress has been made in restoring the watershed through road decommissioning and culvert replacement. From completing a watershed assessment to two NEPA efforts and a final stream restoration design, we will begin the effort of restoring the mainstem channel of Red River to provide spawning and rearing habitat for anadromous and resident fish species. Roads have been surveyed and prioritized for removal or improvement as well as culverts being prioritized for replacement to accommodate fish passage throughout the watershed. Another major, and extremely, important component of this project is the Red River Meadow Conservation Easement. We have begun the process of pursuing a conservation easement on approximately 270 acres of prime meadow habitat (Red River runs through this meadow and is prime spawning and rearing habitat).

77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID

Science.gov (United States)

2012-11-15

... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...

Association between Residential Proximity to PERC Dry Cleaning Establishments and Kidney Cancer in New York City

Directory of Open Access Journals (Sweden)

Jing Ma

2009-01-01

Full Text Available Perchloroethylene (PERC is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994–2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.

Association between Residential Proximity to PERC Dry Cleaning Establishments and Kidney Cancer in New York City

International Nuclear Information System (INIS)

Ma, J.; Lessner, L.; Lessner, L.; Carpenter, D.O.; Schreiber, J.

2010-01-01

Perchloroethylene (PERC) is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994-2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.

White Sturgeon Management Plan in the Snake River between Lower Granite and Hells Canyon Dams; Nez Perce Tribe, 1997-2005 Final Report.

Energy Technology Data Exchange (ETDEWEB)

Nez Perce Tribe Resources Management Staff, (Nez Perce Tribe, Department of Fisheries Resource Management, Lapwai, ID)

2005-09-01

White sturgeon in the Hells Canyon reach (HCR) of the Snake River are of cultural importance to the Nez Perce Tribe. However, subsistence and ceremonial fishing opportunities have been severely limited as a result of low numbers of white sturgeon in the HCR. Hydrosystem development in the Columbia River Basin has depressed numbers and productivity of white sturgeon in the HCR by isolating fish in impounded reaches of the basin, restricting access to optimal rearing habitats, reducing the anadromous forage base, and modifying early life-history habitats. Consequently, a proactive management plan is needed to mitigate for the loss of white sturgeon production in the HCR, and to identify and implement feasible measures that will restore and rebuild the white sturgeon population to a level that sustains viability and can support an annual harvest. This comprehensive and adaptive management plan describes the goals, objectives, strategies, actions, and expected evaluative timeframes for restoring the white sturgeon population in the HCR. The goal of this plan, which is to maintain a viable, persistent population that can support a sustainable fishery, is supported by the following objectives: (1) a natural, stable age structure comprising both juveniles and a broad spectrum of spawning age-classes; (2) stable or increasing numbers of both juveniles and adults; (3) consistent levels of average recruitment to ensure future contribution to reproductive potential; (4) stable genetic diversity comparable to current levels; (5) a minimum level of abundance of 2,500 adults to minimize extinction risk; and (6) provision of an annual sustainable harvest of 5 kg/ha. To achieve management objectives, potential mitigative actions were developed by a Biological Risk Assessment Team (BRAT). Identified strategies and actions included enhancing growth and survival rates by restoring anadromous fish runs and increasing passage opportunities for white sturgeon, reducing mortality rates

Grande Ronde Basin Supplementation Program; Lostine River, 2000 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)

2003-03-01

The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.

Grande Ronde Basin Supplementation Program; Lostine River, 2001 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)

2003-03-01

The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.

Juan Ramón Jiménez and Nietzsche

Directory of Open Access Journals (Sweden)

John P. Devlin

1983-01-01

Full Text Available The young Juan Ramón Jiménez shared the enthusiasm for the writings of Nietzsche prevalent among his contemporaries. More significant are the interest in and affinity with Nietzsche which persisted into the poet's maturity. Jiménez found in Nietzsche not only a man of ideas but a poet who claimed to be a potent spiritual force. Both writers held that the modern age could recover a sense of spiritual integrity through the will of the individual to live and interpret human existence as an aesthetic phenomenon. Nietzsche's views on the nature of art and the role of the artist helped to sustain Jiménez' exalted and elitist view of poetry and the poet's mission. Jiménez felt an ethical kinship with the philosopher who asserted the absolute uniqueness of the creative individual, the end of whose existence was self-realization through his art. Nietzsche's doctrine of heroic vitalism as an antidote to chronic spiritual malaise corresponds to Jiménez' revitalized vision of the poetic word proclaimed in the Diario and elaborated in subsequent verse and prose writings.

High precision neutron polarization for PERC

International Nuclear Information System (INIS)

Klauser, C.

2013-01-01

The decay of the free neutron into a proton, an electron and an anti-electron neutrino offers a simple system to study the semi-leptonic weak decay. High precision measurements of angular correlation coefficients of this decay provide the opportunity to test the standard model on the low energy frontier. The Proton Electron Radiation Channel PERC is part of a new generation of expriments pushing the accuracy of such an angular correlation coefficient measurement towards 10 -4 . Past experiments have been limited to an accuracy of 10 -3 with uncertainties on the neutron polarization as one of the leading systematic errors. This thesis focuses on the development of a stable, highly precise neutron polarization for a large, divergent cold neutron beam. A diagnostic tool that provides polarization higher than 99.99 % and analyzes with an accuracy of 10 -4 , the Opaque Test Bench, is presented and validated. It consists of two highly opaque polarized helium cells. The Opaque Test Bench reveals depolarizing effects in polarizing supermirrors commonly used for polarization in neutron decay experiments. These effects are investigated in detail. They are due to imperfect lateral magnetization in supermirror layers and can be minimized by significantly increased magnetizing fields and low incidence angle and supermirror factor m. A subsequent test in the crossed (X-SM) geometry demonstrated polarizations up to 99.97% from supermirrors only, improving neutron polarization with supermirrors by an order of magnitude. The thesis also discusses other neutron optical components of the PERC beamline: Monte-Carlo simulations of the beamline under consideration of the primary guide are carried out. In addition, calculation shows that PERC would statistically profit from an installation at the European Spallation source. Furthermore, beamline components were tested. A radio-frequency spin flipper was confirmed to work with an efficiency higher than 0.9999. (author) [de

Innovative manufacturing technologies for low-cost, high efficiency PERC-based PV modules

Energy Technology Data Exchange (ETDEWEB)

Yelundur, Vijay [Suniva Inc., Norcross, GA (United States)

2017-04-19

The goal this project was to accelerate the deployment of innovative solar cell and module technologies that reduce the cost of PERC-based modules to best-in-class. New module integration technology was to be used to reduce the cost and reliance on conventional silver bus bar pastes and enhance cell efficiency. On the cell manufacturing front, the cost of PERC solar cells was to be reduced by introducing advanced metallization approaches to increase cell efficiency. These advancements will be combined with process optimization to target cell efficiencies in the range of 21 to 21.5%. This project will also explore the viability of a bifacial PERC solar cell design to enable cost savings through the use of thin silicon wafers. This project was terminated on 4/30/17 after four months of activity due financial challenges facing the recipient.

75 FR 28612 - Environmental Impact Statements; Notice of Availability

Science.gov (United States)

2010-05-21

... Counties, OR and Adams and Nez Perce Counties, ID, Wait Period Ends: 06/21/2010, Contact: Robert W. Rock.... EIS No. 20100181, Final EIS, DOE, MS, Kemper County Integrated Gasification Combined-Cycle (IGCC...

Personalized Energy Reduction Cyber-Physical System (PERCS): A gamified end-user platform for energy efficiency and demand response.

Energy Technology Data Exchange (ETDEWEB)

Sintov, Nicole; Orosz, Michael; Schultz, P. Wesley

2015-01-01

The mission of the Personalized Energy Reduction Cyber-physical System (PERCS) is to create new possibilities for improving building operating efficiency, enhancing grid reliability, avoiding costly power interruptions, and mitigating greenhouse gas emissions. PERCS proposes to achieve these outcomes by engaging building occupants as partners in a user-centered smart service platform. Using a non-intrusive load monitoring approach, PERCS uses a single sensing point in each home to capture smart electric meter data in real time. The household energy signal is disaggregated into individual load signatures of common appliances (e.g., air conditioners), yielding near real-time appliance-level energy information. Users interact with PERCS via a mobile phone platform that provides household- and appliance-level energy feedback, tailored recommendations, and a competitive game tied to energy use and behavioral changes. PERCS challenges traditional energy management approaches by directly engaging occupant as key elements in a technological system.

Optimization of Rear Local Al-Contacts on High Efficiency Commercial PERC Solar Cells with Dot and Line Openings

Directory of Open Access Journals (Sweden)

Peisheng Liu

2014-01-01

Full Text Available Crystalline silicon PERCs with dot or line openings on rear surface were studied here. By measuring the minor carrier lifetimes of the PERCs with dot and line openings, passivation effects of rear surface with dot and line openings were discussed. The performance affected by dot and line openings was analyzed in detail by testing the open-circuit voltages, short-circuit current densities, fill factors, and conversion efficiencies of the PERCs. The results show that the wider space resulted in better minor carrier lifetimes on the rear surface. And the cells with a line opening space of 0.5 mm had an average of 0.22% improvement of conversion efficiency, compared with the cells with full-area Al-BSF. On the other hand, the dot opening PERCs exhibited only a conversion efficiency of 17.4%, although there had been good rear surface reflectivity. The bad Al-Si alloy layer and large hollow densities in dot Al-contacts resulted in bad performance of the PERCs with dot openings.

Plaidoyer pour le lavage de nez dans les pathologies naso ...

African Journals Online (AJOL)

Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.

Lower Red River Meadow Stream Restoration Project

International Nuclear Information System (INIS)

1996-05-01

As part of a continuing effort to restore anadromous fish populations in the South Fork Clearwater River basin of Idaho, Bonneville Power Administration (BPA) proposes to fund the Lower Red River Meadow Restoration Project (Project). The Project is a cooperative effort with the Idaho Soil and Water Conservation District, Nez Perce National Forest, Idaho Department of Fish and Game (IDFG), and the Nez Perce Tribe of Idaho. The proposed action would allow the sponsors to perform stream bank stabilization, aquatic and riparian habitat improvement activities on IDFG's Red River Management Area and to secure long-term conservation contracts or agreements for conducting streambank and habitat improvement activities with participating private landowners located in the Idaho County, Idaho, study area. This preliminary Environmental Assessment (EA) examines the potential environmental effects of stabilizing the stream channel, restoring juvenile fish rearing habitat and reestablishing a riparian shrub community along the stream

Coho Salmon Master Plan, Clearwater River Basin.

Energy Technology Data Exchange (ETDEWEB)

Nez Perce Tribe; FishPro

2004-10-01

The Nez Perce Tribe has a desire and a goal to reintroduce and restore coho salmon to the Clearwater River Subbasin at levels of abundance and productivity sufficient to support sustainable runs and annual harvest. Consistent with the Clearwater Subbasin Plan (EcoVista 2003), the Nez Perce Tribe envisions developing an annual escapement of 14,000 coho salmon to the Clearwater River Subbasin. In 1994, the Nez Perce Tribe began coho reintroduction by securing eggs through U.S. v. Oregon; by 1998 this agreement provided an annual transfer of 550,000 coho salmon smolts from lower Columbia River hatchery facilities for release in the Clearwater River Subbasin. In 1998, the Northwest Power and Conservation Council authorized the Bonneville Power Administration to fund the development of a Master Plan to guide this reintroduction effort. This Master Plan describes the results of experimental releases of coho salmon in the Clearwater River Subbasin, which have been ongoing since 1995. These data are combined with results of recent coho reintroduction efforts by the Yakama Nation, general coho life history information, and historical information regarding the distribution and life history of Snake River coho salmon. This information is used to assess a number of alternative strategies aimed at restoring coho salmon to historical habitats in the Clearwater River subbasin. These data suggest that there is a high probability that coho salmon can be restored to the Clearwater River subbasin. In addition, the data also suggest that the re-establishment of coho salmon could be substantially aided by: (1) the construction of low-tech acclimation facilities; (2) the establishment of a 'localized' stock of coho salmon; and (3) the construction of hatchery facilities to provide a source of juvenile coho salmon for future supplementation activities. The Nez Perce Tribe recognizes that there are factors which may limit the success of coho reintroduction. As a result of these

The Native American Persistence in Higher Education: A Journey through Story to Identify the Family Support to Native American Graduates

Science.gov (United States)

Bisbee, Yolanda J. Guzman

2013-01-01

This Indigenous Framed Research will utilize counter-storytelling through shared collaborator stories provided by Nez Perce Native American Graduates. The methodology is shaped by an Indigenous Framework as this form of research promotes and develops a culturally resonant environment for constructing, analyzing and sharing information. The…

76 FR 44000 - Environmental Impact Statements; Notice of Availability

Science.gov (United States)

2011-07-22

..., Review Period Ends: 08/15/2011, Contact: Charles J. O'Neill 615-781-5772. EIS No. 20110226, Draft EIS, USFS, ID, Little Slate Project, Proposes Watershed Improvement, Timber Harvest, Fuel Treatments, Soil Restoration and Access Changes in the Little Slate Creek, Salmon River Ranger District, Nez Perce National...

Cryopreservation of Adult Male Spring and Summer Chinook Salmon Gametes in the Snake River Basin, 1997 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Faurot, Dave; Kucera, Paul A.; Armstrong, Robyn D. (Nez Perce Tribe, Lapwai, ID)

1998-06-01

Chinook salmon populations in the Northwest are decreasing in number. The Nez Perce Tribe was funded in 1997 by the Bonneville Power Administration to coordinate and initiate gene banking of adult male gametes from Endangered Species Act (ESA) listed spring and summer chinook salmon in the Snake River basin.

Trophic structure and mercury biomagnification in tropical fish assemblages, Iténez River, Bolivia.

Directory of Open Access Journals (Sweden)

Marc Pouilly

Full Text Available We examined mercury concentrations in three fish assemblages to estimate biomagnification rates in the Iténez main river, affected by anthropogenic activities, and two unperturbed rivers from the Iténez basin, Bolivian Amazon. Rivers presented low to moderate water mercury concentrations (from 1.25 ng L(-1 to 2.96 ng L(-1 and natural differences in terms of sediment load. Mercury biomagnification rates were confronted to trophic structure depicted by carbon and nitrogen stable isotopes composition (δ(15N; δ(13C of primary trophic sources, invertebrates and fishes. Results showed a slight fish contamination in the Iténez River compared to the unperturbed rivers, with higher mercury concentrations in piscivore species (0.15 µg g(-1 vs. 0.11 µg g(-1 in the unperturbed rivers and a higher biomagnification rate. Trophic structure analysis showed that the higher biomagnification rate in the Iténez River could not be attributed to a longer food chain. Nevertheless, it revealed for the Iténez River a higher contribution of periphyton to the diet of the primary consumers fish species; and more negative δ(13C values for primary trophic sources, invertebrates and fishes that could indicate a higher contribution of methanotrophic bacteria. These two factors may enhance methylation and methyl mercury transfer in the food web and thus, alternatively or complementarily to the impact of the anthropogenic activities, may explain mercury differences observed in fishes from the Iténez River in comparison to the two other rivers.

Universal Prevention Program Outcomes: Safe Schools Healthy Students in a Rural, Multicultural Setting

Science.gov (United States)

Harris, Elizabeth; McFarland, Joyce; Siebold, Wendi; Aguilar, Rafael; Sarmiento, Ana

2007-01-01

The Idaho Consortium for Safe Schools Healthy Students consists of three school districts in rural North Central Idaho and the Nez Perce Tribe's Students for Success Program. Universal prevention programs implemented in the elementary schools include Second Step and the middle schools implemented the Life Skills program. Each of the three…

Northeast Oregon Hatchery Spring Chinook Master Plan, Technical Report 2000.

Energy Technology Data Exchange (ETDEWEB)

Ashe, Becky L.; Concannon, Kathleen; Johnson, David B.

2000-04-01

Spring chinook salmon populations in the Imnaha and Grande Ronde rivers are listed as threatened under the Endangered Species Act (ESA) and are at high risk of extirpation. The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and Oregon Department of Fish and Wildlife, are co-managers of conservation/restoration programs for Imnaha and Grande Ronde spring chinook salmon that use hatchery supplementation and conventional and captive broodstock techniques. The immediate goal of these programs is to prevent extirpation and provide the potential for restoration once factors limiting production are addressed. These programs redirect production occurring under the Lower Snake River Compensation Plan (LSRCP) from mitigation to conservation and restoration. Both the Imnaha and Grande Ronde conservation/restoration programs are described in ESA Section 10 permit applications and the co-managers refer to the fish production from these programs as the Currently Permitted Program (CPP). Recently, co-managers have determined that it is impossible to produce the CPP at Lookingglass Hatchery, the LSRCP facility intended for production, and that without additional facilities, production must be cut from these conservation programs. Development of new facilities for these programs through the Columbia Basin Fish and Wildlife Program is considered a new production initiative by the Northwest Power Planning Council (NPPC) and requires a master plan. The master plan provides the NPPC, program proponents and others with the information they need to make sound decisions about whether the proposed facilities to restore salmon populations should move forward to design. This master plan describes alternatives considered to meet the facility needs of the CPP so the conservation program can be fully implemented. Co-managers considered three alternatives: modify Lookingglass Hatchery; use existing facilities elsewhere in the Basin; and use new facilities in

Salmonid Gamete Preservation in the Snake River Basin, 1998 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Armstrong, Robyn; Kucera, Paul A. (Nez Perce Tribe, Lapwai, ID)

1999-03-01

Steelhead (Oncorhynchus mykiss) and salmon (Oncorhynchus tshawytscha)populations in the Northwest are decreasing. The Nez Perce Tribe (Tribe) was funded in 1998 by the Bonneville Power Administration to coordinate gene banking of male gametes from Endangered Species Act (ESA) listed steelhead and spring and summer chinook salmon in the Snake River basin.

Optimization of Controllable Factors in the Aluminum Silicon Eutectic Paste and Rear Silicon Nitride Mono-Passivation Layer of PERC Solar Cells

Science.gov (United States)

Park, Sungeun; Park, Hyomin; Kim, Dongseop; Yang, JungYup; Lee, Dongho; Kim, Young-Su; Kim, Hyun-Jong; Suh, Dongchul; Min, Byoung Koun; Kim, Kyung Nam; Park, Se Jin; Kim, Donghwan; Lee, Hae-Seok; Nam, Junggyu; Kang, Yoonmook

2018-05-01

Passivated emitter and rear contact (PERC) is a promising technology owing to high efficiency can be achieved with p-type wafer and their easily applicable to existing lines. In case of using p-type mono wafer, 0.5-1% efficiency increase is expected with PERC technologies compared to existing Al BSF solar cells, while for multi-wafer solar cells it is 0.5-0.8%. We addressed the optimization of PERC solar cells using the Al paste. The paste was prepared from the aluminum-silicon alloy with eutectic composition to avoid the formation of voids that degrade the open-circuit voltage. The glass frit of the paste was changed to improve adhesion. Scanning electron microscopy revealed voids and local back surface field between the aluminum electrode and silicon base. We confirmed the conditions on the SiNx passivation layer for achieving higher efficiency and better adhesion for long-term stability. The cell characteristics were compared across cells containing different pastes. PERC solar cells with the Al/Si eutectic paste exhibited the efficiency of 19.6%.

Aurelio Martínez Mutis

Directory of Open Access Journals (Sweden)

Rafaél Maya

1979-10-01

Full Text Available La aparición de Aurelio Martínez Mutis en el escenario de las letras colombianas, hace unos treinta y cinco años, más o menos, fue súbita y fulgurante. Su "Epopeya del Cóndor", poesía premiada en el concurso abierto por la revista Mundial, que dirigía en París Rubén Darío, lo hizo célebre, de la noche a la mañana, entre los pueblos de habla hispana.

A estratégia de pricing do Modelo Continente Hipermercados : perceção do consumidor

OpenAIRE

Sousa, Vasco Monteiro Carvalho de

2016-01-01

O objetivo da presente investigação é estudar a perceção dos consumidores sobre as estratégias de pricing do Modelo Continente Hipermercados, e surge no formato de uma tese de dissertação. O tema desta investigação abrange objetos predominantes da área de Marketing, nomeadamente o pricing, a distribuição e a perceção do consumidor. No estudo foi aplicado o método de estudo de caso incluindo a observação, análise e discussão. A investigação foi dividida por um lado na abordag...

José Miguel Jiménez receives Order of Alfonso X the Wise

CERN Multimedia

CERN Bulletin

2016-01-01

On 12 July 2016, José Miguel Jiménez, Head of CERN Technology Department, has been awarded a spanish civil decoration — an encomienda — of the Order of Alfonso X the Wise (see here), for his outstanding experience in the field of research and scientific management in particle physics.   The ceremony took place at the National Library of Spain, in Madrid, on 12 July. From left: Marcial Marín Hellín, Secretary of State for Education, Professional training and Universities; José María Lassalle Ruiz, Secretary of State for Culture; Íñigo Méndez de Vigo y Montojo, Ministry of Education, Culture and Sport; José Miguel Jiménez, Head of CERN Technology Department; Carmen Vela Olmo, Secretary of State for Investigation, Development and Innovation. (Photo: ©Javier Martínez de la Torre, M...

PERC 2 High-End Computer System Performance: Scalable Science and Engineering

Energy Technology Data Exchange (ETDEWEB)

Daniel Reed

2006-10-15

During two years of SciDAC PERC-2, our activities had centered largely on development of new performance analysis techniques to enable efficient use on systems containing thousands or tens of thousands of processors. In addition, we continued our application engagement efforts and utilized our tools to study the performance of various SciDAC applications on a variety of HPC platforms.

Review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)

DEFF Research Database (Denmark)

Jensen, Kim Ebensgaard

2014-01-01

A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)......A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)...

Simulation Tools for Forest Health Analysis: An Application in the Red River Watershed, Idaho

Science.gov (United States)

Andrew J. McMahan; Eric L. Smith

2006-01-01

Software tools for landscape analyses--including FVS model extensions, and a number of FVS-related pre- and post-processing “tools”--are presented, using an analysis in the Red River Watershed, Nez Perce National Forest as an example. We present (1) a discussion of pre-simulation data analysis; (2) the Physiographic Information Extraction System (PIES), a tool that can...

Fish Passage Assessment: Big Canyon Creek Watershed, Technical Report 2004.

Energy Technology Data Exchange (ETDEWEB)

Christian, Richard

2004-02-01

This report presents the results of the fish passage assessment as outlined as part of the Protect and Restore the Big Canyon Creek Watershed project as detailed in the CY2003 Statement of Work (SOW). As part of the Northwest Power Planning Council's Columbia Basin Fish and Wildlife Program (FWP), this project is one of Bonneville Power Administration's (BPA) many efforts at off-site mitigation for damage to salmon and steelhead runs, their migration, and wildlife habitat caused by the construction and operation of federal hydroelectric dams on the Columbia River and its tributaries. The proposed restoration activities within the Big Canyon Creek watershed follow the watershed restoration approach mandated by the Fisheries and Watershed Program. Nez Perce Tribal Fisheries/Watershed Program vision focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects. We strive toward maximizing historic ecosystem productive health, for the restoration of anadromous and resident fish populations. The Nez Perce Tribal Fisheries/Watershed Program (NPTFWP) sponsors the Protect and Restore the Big Canyon Creek Watershed project. The NPTFWP has the authority to allocate funds under the provisions set forth in their contract with BPA. In the state of Idaho vast numbers of relatively small obstructions, such as road culverts, block thousands of miles of habitat suitable for a variety of fish species. To date, most agencies and land managers have not had sufficient, quantifiable data to adequately address these barrier sites. The ultimate objective of this comprehensive inventory and assessment was to identify all barrier crossings within the watershed. The barriers were then prioritized according to the

El Profesor Académico, Dr. Pablo Gómez Martínez.

Directory of Open Access Journals (Sweden)

Zoilo Cuéllar-Montoya

2007-12-01

Más adelante, en la misma Presidencia de la Academia del Profesor Pedro José Almánzar Vargas (1963 – 1965, fue promovido Gómez Martínez a la categoría de Miembro de Número(2,10 con el trabajo “Ilio-cisto-plastia con colgajo sero-muscular invertido y reconstrucción de vejigas funcionales” (2,11. En la sesión ordinaria de la Academia del día 12 de marzo de 1964, el Académico Correspondiente Gómez Martínez presentó el trabajo mencionado(2,12 y, en la sesión ordinaria del día 14 de mayo de 1964, en virtud de haber quedado vacantes las sillas de los Señores Académicos de Número Jaime Jaramillo Arango, fallecido en Bogotá, el 31 de julio de 1962(2,13, Manuel José Luque Guevara, retirado por precarias condiciones de salud(2,14, y Fernando Torres Restrepo, trasladado definitivamente a los Estados Unidos(2,15, la Academia, en votación secreta, eligió, como Miembros de Número, a los Señores Académicos Correspondientes Pablo Gómez Martínez, Alfredo Artunduaga y J. Hernando Hernández Garay(2,16...

Red River Stream Improvement Final Design Nez Perce National Forest.

Energy Technology Data Exchange (ETDEWEB)

Watershed Consulting, LLC

2007-03-15

This report details the final stream improvement design along the reach of Red River between the bridge below Dawson Creek, upstream for approximately 2 miles, Idaho County, Idaho. Geomorphic mapping, hydrologic profiles and cross-sections were presented along with existing fish habitat maps in the conceptual design report. This information is used to develop a stream improvement design intended to improve aquatic habitat and restore riparian health in the reach. The area was placer mined using large bucket dredges between 1938 and 1957. This activity removed most of the riparian vegetation in the stream corridor and obliterated the channel bed and banks. The reach was also cut-off from most valley margin tributaries. In the 50 years since large-scale dredging ceased, the channel has been re-established and parts of the riparian zone have grown in. However, the recruitment of large woody debris to the stream has been extremely low and overhead cover is poor. Pool habitat makes up more than 37% of the reach, and habitat diversity is much better than the project reach on Crooked River. There is little large woody debris in the stream to provide cover for spawning and juvenile rearing, because the majority of the woody debris does not span a significant part of the channel, but is mainly on the side slopes of the stream. Most of the riparian zone has very little soil or subsoil left after the mining and so now consists primarily of unconsolidated cobble tailings or heavily compacted gravel tailings. Knapweed and lodgepole pine are the most successful colonizers of these post mining landforms. Tributary fans which add complexity to many other streams in the region, have been isolated from the main reach due to placer mining and road building.

South Fork Salmon River Watershed Restoration, 2008-2009 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Reaney, Mark D. [Nez Perce Tribe Department of Fisheries Resource Management

2009-04-15

The watershed restoration work elements within the project area, the South Fork Salmon River Watershed, follow the watershed restoration approach adopted by the Nez Perce Tribe Department of Fisheries Resource Management (DFRM) - Watershed Division. The vision of the Nez Perce Tribe DFRM-Watershed Division focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects and strategies that rely on natural fish production and healthy river ecosystems. The Nez Perce Tribe DFRM-Watershed Division strives towards maximizing historic ecosystem productivity and health for the restoration of anadromous and resident fish populations and the habitat on which all depend on for future generations Originally, this project was funded to create a step/pool stream channel that was appropriate to restore fish passage where the 'Glory Hole Cascade' is currently located at the Stibnite Mine. Due to unforeseen circumstances at the time, the project is unable to move forward as planned and a request for a change in scope of the project and an expansion of the geographic area in which to complete project work was submitted. No additional funds were being requested. The ultimate goal of this project is to work with the holistic, ridge top to ridge top approach to protect and restore the ecological and biological functions of the South Fork Salmon River Watershed to assist in the recovery of threatened and endangered anadromous and resident fish species. FY 2008 Work Elements included two aquatic organism passage (AOP) projects to restore habitat connectivity to two fish-bearing tributaries to the East Fork South Fork Salmon River, Salt and Profile Creeks. The Work Elements also included road survey and assessment

Genetic diversity and conservation of Picea chihuahuana Martínez ...

African Journals Online (AJOL)

SAM

2014-07-09

Jul 9, 2014 ... individuals within a population and among populations within a species. Hence ... risks related to loss of species, populations and genetic resources; c) ... this spruce and two other congeners, Picea mexicana. Martínez and Picea .... high levels of self-fertilization and mating between closely related ...

Loyola University distingue al Ing. Martínez

OpenAIRE

Lezcano, Liseth

2011-01-01

El Ing. Axel Martínez, Director de Recursos Humanos de la Universidad Tecnológica de Panamá (UTP), recibió un reconocimiento que le hizo el Instituto de Recursos Humanos y Relaciones Industriales de Loyola University Chicago (LUC), como egresado destacado del Programa de Maestría en Recursos Humanos, por la prestigiosa carrera académica y por sus éxitos profesionales en un importante ambiente académico.

Genetic diversity and conservation of Picea chihuahuana Martínez ...

African Journals Online (AJOL)

The conservation of genetic diversity in tree populations is an essential component of sustainable forest management. Picea chihuahuana Martínez is an endemic conifer species in Mexico and is considered to be endangered. P. chihuahuana covers a total area of no more than 300 ha at the Sierra Madre Occidental, ...

Več kot predgovor: "urednik" Pepite Jiménez:

OpenAIRE

Fock, Ignac

2014-01-01

The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) "editor". Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator - ficti...

Controversy, Conflict and Compromise: A History of the Lower Snake River Development

Science.gov (United States)

1994-01-01

river, farmers cultivated the loess-covered hills, and ranchers grazed sheep and cattle in the Channeled Scablands. Towns grew up to serve the...North America, the Nez Perce and Palouse practiced selective breeding. They castrated poorer stallions and traded inferior stock to neighboring...rains," making it impossible for "some kinds of grain [to] flourish," he noted that cattle and horses grew fat on the rich bunchgrass, and, like Lewis

Tropic and race. Miguel Jiménez López and the Japanese Immigration in Colombia, 1920-1929

Directory of Open Access Journals (Sweden)

Abel Fernando Martínez Martín

2017-01-01

Full Text Available This article discusses the debate on immigration in Colombia, specifically focusing on Japanese immigration, an problem, by being so far from the desired European immigration. Likewise, the important role played by the psychiatrist and conservative Colombian politician Miguel Jiménez Lopez and his theory of degeneration of the Colombian race. Jiménez Lopez is the author of "The yellow immigration in the America", a publication of the National Academy of Medicine, written in response to the Ministry of Industries about the question for the possible impact of a Japanese immigration in the eastern plains. Jiménez Lopez maintains the problem from medicalization and biology, using more arguments from geographical determinism and racism that from eugenics, to justify that a Japanese immigration to Colombia was not advisable, because it jeopardizes the progressive bleaching managed —with the passage of time— by the Colombian race.

The 'Mini-Perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath: 3-year results in 72 patients

International Nuclear Information System (INIS)

Sung, Yon Mi; Choo, Sung Wook; Jeon, Seong Soo; Shin, Sung Wook; Park, Kwang Bo; Do, Young Soo

2006-01-01

To assess the efficacy and safety of a 'mini-perc' technique of percutaneous nephrolithotomy using a 14-Fr peel-away sheath for the removal of pyelocaliceal stones, and to determine appropriate inclusion criteria. Form July 1999 to June 2002, the medical records and radiographic images of 72 patients who underwent the 'mini-perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath, were reviewed to determine clinical history, stone characteristics, immediate stone free rate, final stone free rate after additional procedures, complications, and hospital stay. We also analyzed the effect of the longest stone diameter, the cumulative longest diameter of stones, the cumulative stone burden, and the stone density on the immediate stone free rate using a Fisher exact test. The only major complication, arterial bleeding, occurred in a patient with Child A liver cirrhosis and was successfully treated by embolization with coils and a gelatin sponge. The immediate stone free rate was 80.6%, which was significantly influenced by stone diameter but not stone density. The mean hospital stay after the procedure was 3.97 days. The 'mini-perc' technique of percutaneous nephrolithotomy, which uses the 14-Fr peel-away sheath, is a safe and effective modality for treating renal calculi

Review of García, Jiménez & Martínez (2010 Guía para incorporar la perspectiva de género a la investigación en salud

Directory of Open Access Journals (Sweden)

Teresa Cabruja-Ubach

2014-12-01

Full Text Available Se trata de una reseña de la “Guía para incorporar la perspectiva de género a la investigación en salud” de María del Mar García Calvente ,  María Luisa Jiménez rodrigo y Emilia Martínez Morante, de la Escuela Andaluza de Salud Pública, 2010, que consiste en un documento de ayuda a la investigación en salud pues a partir de exponer los sesgos androcéntricos y patriarcales de la investigación en salud, organiza un sistema de buenas prácticas para cada uno de los pasos en el proceso de investigación. Trabajo muy riguroso e indispensable para colaborar en una investigación y atención en la salud más justa e igualitaria.

Transtorno de Estresse Pós-Traumático e Perceção da Doença em Jovens Sobreviventes de Cancro Infantil

Directory of Open Access Journals (Sweden)

Elisa Kern de Castro

2015-07-01

Full Text Available ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70 e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C e de perceção da doença – “Revised Illness Perception Questionnaire for Healthy People” (IPQ-RH.ResultadosA presença de sintomas de TEPT variade 9,2% a 18,5% na amostra, e a perceção da doença esteve correlacionada com os sintomas deste transtorno. As subescalas Representação Emocional e Coerência da Doença (IPQ-RH, foram preditoras dos sintomas de Reexperiência (β = 0,0370; p < 0,01; β = 0,261; p < 0,05, respetivamente. A subescala Representação Emocional (IPQ-RH também foi preditora de sintomas de Esquiva (β = 0,330; p < 0,001.ConclusãoConcluiu-se que a perceção da doença deve ser investigada para prevenir os sintomas de TEPT em sobreviventes de câncer infantil.

Las “Historias ilustrativas de la violencia” de Edilberto Jiménez: narrativa, testimonio y memoria

Directory of Open Access Journals (Sweden)

Elisa Cairati

2013-06-01

Full Text Available This work aims to analyse the cultural contents and aesthetic position of Edilberto Jiménez Quispe’s illustrations of the age of violence, presented in Chungui: violencia y trazos de memoria (Lima, 2009. Jiménez, through the plastic and figurative traditional style, makes public the concealed and denied memory of the Internal Armed Conflict. The combination of testimonies and paintings is concerned as an emotional significance of memory: a space of re-established dialogue after the age of violence, in the direction of the elaboration of identity in the region of Ayacucho.

Martínez Sanabria en un país de artesanos

OpenAIRE

Jimena Montaña Cuéllar

2011-01-01

De la arquitectura orgánica a la arquitectura del lugar en las casas Wilkie (1962) y Calderón (1963) de Fernando Martínez Sanabria. Germán Darío Rodríguez Botero. Universidad Nacional de Colombia (Sede Bogotá), Facultad de Artes, Colección Punto aparte, Bogotá, 2007, 232 págs.

Transtorno de Estresse Pós-Traumático e Perceção da Doença em Jovens Sobreviventes de Cancro Infantil

OpenAIRE

Elisa Kern de Castro; Renata Klein Zancan; Lauro José Gregianin

2015-01-01

ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT) e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70) e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C) e de perceçã...

Impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física

Directory of Open Access Journals (Sweden)

Diego Augusto Santos Silva

2012-06-01

Full Text Available Objetivou-se verificar o impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física. Participaram do estudo 217 acadêmicos, com média de 20.6 anos de idade (DP = 0.6, sendo 54.8% do sexo masculino. Coletaram-se informações sobre perceção da imagem corporal por meio da escala de silhuetas de Stunkard et al. (1983. O nível de escolaridade dos pais e dados sociodemográficos foram coletados por questionário autoadministrado. Empregaram-se a estatística descritiva e a regressão logística multinomial, adotando-se nível de significância de 5%. Em relação à perceção da imagem corporal, 41% dos alunos estavam insatisfeitos por magreza e 28.1% por excesso de peso. As chances de insatisfação por excesso de peso foram de sete a oito vezes maiores nos acadêmicos com escolaridade materna superiores a quatro anos de escolaridade, independentemente de sexo, idade, situação conjugal, nível econômico e curso. Não houve associação entre escolaridade paterna e imagem corporal. Conclui-se que há necessidade de uma educação básica e superior de qualidade com assuntos vinculados à perceção corporal e hábitos saudáveis, pois muitos acadêmicos apresentaram insatisfação com a imagem corporal e tal probabilidade foi maior em estudantes filhos de mães com mais de cinco anos de escolaridade.

The PERC trademark process: Existing and potential applications for induction coupled plasma technology in hazardous and radioactive waste treatment

International Nuclear Information System (INIS)

Blutke, A.S.; Vavruska, J.S.; Serino, J.F.

1996-01-01

Plasma Technology, Inc. (PTI), a Santa Fe, New Mexico corporation has developed the Plasma Energy Recycle and Conversion (PERC)trademark treatment process as a safe and environmentally clean alternative to conventional thermal destruction technologies. The PERC trademark treatment process uses as its heat source an advanced Induction Coupled Plasma (ICP) torch connected to a reaction chamber system with an additional emission control system. For example, organic-based gas, liquid, slurry, and/or solid waste streams can be converted into usable or even salable products while residual emissions are reduced to an absolute minimum. In applications for treatment of hazardous and radioactive waste streams, the PERC system could be used for destruction of the hazardous organic constituents and/or significant waste volume reduction while capturing the radioactive fraction in a non-leachable form. Like Direct Current (DC) and Alternating Current (AC) arc plasma systems, ICP torches offer sufficient energy to decompose, melt and/or vitrify any waste stream. The decision for an arc plasma or an IC plasma system has to be made on a case by case evaluation and is highly dependent on the specific waste stream's form and composition. Induction coupled plasma technology offers one simple, but significant difference compared to DC or AC arc plasma systems: the ICP torch is electrodeless. To date, enormous research effort has been spent to improve the lifetime of electrodes and the effectiveness of related cooling systems. Arc plasma systems are established in research laboratories worldwide and are approaching a broad use in commercial applications. ICP technology has been improved relatively recently, but nowadays offers complete new and beneficial approaches in the field of waste conversion and treatment

Lago artificial de Martiánez Canarias – España

Directory of Open Access Journals (Sweden)

Amigó, Juan A.

1980-06-01

Full Text Available In this article a technical description is given of the works of the Artificial Lake of Martiánez. This work that was executed after gaining some 33,000 m² from the sea mainly consisted of creating a small artificial lake of seawater surrounded by solariums, beaches and gardens. Inside the lake — that has an area of some 15,000 m² — five natural islands were formed, most of which have tourist complexes built on them, consisting of: night club, restaurants, bars, terraces, etc.

En este artículo se hace una descripción técnica de las obras del Lago Artificial de Martiánez. Esta obra, realizada tras ganar al mar unos 33.000 m² consistió, principalmente, en la creación de un pequeño lago artificial de agua de mar rodeado de solarios, playas y jardines. En el interior del lago —cuya superficie es de unos 15.000 m²— se formaron cinco islas naturales, en la mayor de las cuales se construyó un complejo turístico que consta de: sala de fiestas, restaurantes, bares, terrazas, etc.

Libertad e inconformismo: sobre la concepción del relato de José Jiménez Lozano

Directory of Open Access Journals (Sweden)

Moreno González, Santiago

2010-12-01

Full Text Available José Jiménez Lozano is a unique writer in the Hispanic literary scene of these last decades. His work is vast and diverse, and this initial observation does not escape his narrative, which genre the write demonstrates more prolifically. Despite the apparent diversity, there is outstanding unity underlying Jiménez Lozano´s entire work. This unity lies not only on the constant return to the same matters, but also on the approaches or the reasons, from which his literary work begins. The writer reflects over his work and lets his ideas expand through the diverse manifestations of his ideas on prose. It is a talk about the rhetorical writing of this article, valuing the coherent existence between reflection and literary practice.José Jiménez Lozano es un escritor singular dentro del panorama literario hispánico de las últimas décadas. Su obra es vasta y diversa y a esta observación inicial no escapa su narrativa, género en el que el escritor se muestra más prolífico. A pesar de la diversidad aparente, existe una notable unidad subyacente a toda la obra de Jiménez Lozano. Esta unidad reposa no sólo sobre el regreso constante a unos mismos asuntos sino también sobre los planteamientos o fundamentos de los que parte su creación literaria. El escritor reflexiona sobre su labor y deja diseminado, a través de las diversas manifestaciones de su prosa de ideas, un discurso sobre la escritura que este artículo sintetiza, valorando, asimismo, la coherencia existente entre esta reflexión y la praxis literaria.

El acontecimiento en el cuento: nueva lectura de José Jiménez Lozano

OpenAIRE

Martínez-Illán, A. (Antonio)

2010-01-01

Se reseña un libro que estudia como un todo los cuentos de Jiménez Lozano publicados hasta la fecha (y, en particular, La Piel de los tomates) a la luz de una teoría del cuento desde la categoría del acontecimiento.

Big Canyon Creek Ecological Restoration Strategy.

Energy Technology Data Exchange (ETDEWEB)

Rasmussen, Lynn; Richardson, Shannon

2007-10-01

He-yey, Nez Perce for steelhead or rainbow trout (Oncorhynchus mykiss), are a culturally and ecologically significant resource within the Big Canyon Creek watershed; they are also part of the federally listed Snake River Basin Steelhead DPS. The majority of the Big Canyon Creek drainage is considered critical habitat for that DPS as well as for the federally listed Snake River fall chinook (Oncorhynchus tshawytscha) ESU. The Nez Perce Soil and Water Conservation District (District) and the Nez Perce Tribe Department of Fisheries Resources Management-Watershed (Tribe), in an effort to support the continued existence of these and other aquatic species, have developed this document to direct funding toward priority restoration projects in priority areas for the Big Canyon Creek watershed. In order to achieve this, the District and the Tribe: (1) Developed a working group and technical team composed of managers from a variety of stakeholders within the basin; (2) Established geographically distinct sub-watershed areas called Assessment Units (AUs); (3) Created a prioritization framework for the AUs and prioritized them; and (4) Developed treatment strategies to utilize within the prioritized AUs. Assessment Units were delineated by significant shifts in sampled juvenile O. mykiss (steelhead/rainbow trout) densities, which were found to fall at fish passage barriers. The prioritization framework considered four aspects critical to determining the relative importance of performing restoration in a certain area: density of critical fish species, physical condition of the AU, water quantity, and water quality. It was established, through vigorous data analysis within these four areas, that the geographic priority areas for restoration within the Big Canyon Creek watershed are Big Canyon Creek from stream km 45.5 to the headwaters, Little Canyon from km 15 to 30, the mainstem corridors of Big Canyon (mouth to 7km) and Little Canyon (mouth to 7km). The District and the Tribe

Production of high titer attenuated poliovirus strains on the serum-free PER.C6(®) cell culture platform for the generation of safe and affordable next generation IPV.

Science.gov (United States)

Sanders, Barbara P; Oakes, Isabel de los Rios; van Hoek, Vladimir; Liu, Ying; Marissen, Wilfred; Minor, Philip D; Wimmer, Eckard; Schuitemaker, Hanneke; Custers, Jerome H H V; Macadam, Andrew; Cello, Jeronimo; Edo-Matas, Diana

2015-11-27

As poliovirus eradication draws closer, alternative Inactivated Poliovirus Vaccines (IPV) are needed to overcome the risks associated with continued use of the Oral Poliovirus Vaccine and of neurovirulent strains used during manufacture of conventional (c) IPV. We have previously demonstrated the susceptibility of the PER.C6(®) cell line to cIPV strains; here we investigated the suspension cell culture platform for growth of attenuated poliovirus strains. We examined attenuated Sabin strain productivity on the PER.C6(®) cell platform compared to the conventional Vero cell platform. The suitability of the suspension cell platform for propagation of rationally-attenuated poliovirus strains (stabilized Sabin type 3 S19 derivatives and genetically attenuated and stabilized MonoCre(X) strains), was also assessed. Yields were quantified by infectious titer determination and D-antigen ELISA using either serotype-specific polyclonal rabbit sera for Sabin strains or monoclonal cIPV-strain-specific antibodies for cIPV, S19 and MonoCre(X) strains. PER.C6(®) cells supported the replication of Sabin strains to yields of infectious titers that were in the range of cIPV strains at 32.5°C. Sabin strains achieved 30-fold higher yields (pSabin strain productivity on the PER.C6(®) cell platform was maintained at 10l scale. Yields of infectious titers of S19 and MonoCre(X) strains were 0.5-1 log10 lower than seen for cIPV strains, whereas D-antigen yield and productivities in doses/ml using rationally-attenuated strains were in line with yields reported for cIPV strains. Sabin and rationally-attenuated polioviruses can be grown to high infectious titers and D-antigen yields. Sabin strain infection shows increased productivity on the PER.C6(®) cell platform as compared to the conventional Vero cell platform. Novel cell platforms with the potential for higher yields could contribute to increased affordability of a next generation of IPV vaccines needed for achieving and

La historieta como transmisora de ideología: España Una, Grande y Libre (Carlos Giménez = Comic-strip in transmitting ideology: España Una, Grande y Libre (Carlos Giménez

Directory of Open Access Journals (Sweden)

Armiche Carrillo Delgado

2015-06-01

Full Text Available Aunque tradicionalmente se consideró a los cómics como un simple entretenimiento juvenil, lo cierto es que en realidad constituyen una herramienta para la transmisión de concepciones ideológicas y valores. A través del análisis de la obra de Carlos Giménez, publicada en El Papus, veremos como la historieta es perfectamente capaz de convertirse en una forma de lucha ideológica.Although traditionally considered to comics as a mere youth entertainment, the truth is that actually constitute a tool for the transmission of values and ideological concepts. Through the analysis of the work of Carlos Giménez, published in El Papus, we see how the comic-strip is perfectly capable of becoming a form of ideological struggle.

CERT tribal internship program. Final intern report: David Conrad, 1993

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-09-01

The intern`s report contains a Master`s thesis entitled, ``An implementation analysis of the US Department of Energy`s American Indian policy as part of its environmental restoration and waste management mission.`` This thesis examines the implementation of a working relationship between the Nez Perce Tribe and the US Department of Energy`s Office of Environmental Restoration and Waste Management at the Hanford reservation. It examines the relationship using a qualitative methodology and three generations of policy analysis literature to gain a clear understanding of the potential for successful implementation.

Era Sanctorum: la beatificación inconclusa del padre Diego Martínez, SJ (1627-1634

Directory of Open Access Journals (Sweden)

Coello de la Rosa, Alexandre

2009-06-01

Full Text Available This essay analyzes the politics of sanctity of the Society of Jesus in Viceregal Peru (17th Century through the process of beatification of the Spanish Father Diego Martínez (1627-34. An unfinished process that has been filed in the Jesuit archives for centuries and was never introduced in the Sacred Congregation of Rites, in the Vatican.Este ensayo analiza las políticas de santidad de la Compañía de Jesús en el Perú virreinal (siglo XVII a través del proceso de beatificación del padre extremeño Diego Martínez (1627-34. Un proceso inconcluso que ha permanecido en los archivos jesuitas durante siglos y que nunca se introdujo en la Sagrada Congregación de Ritos, en el Vaticano.

Synthetic virus seeds for improved vaccine safety: Genetic reconstruction of poliovirus seeds for a PER.C6 cell based inactivated poliovirus vaccine.

Science.gov (United States)

Sanders, Barbara P; Edo-Matas, Diana; Papic, Natasa; Schuitemaker, Hanneke; Custers, Jerome H H V

2015-10-13

Safety of vaccines can be compromised by contamination with adventitious agents. One potential source of adventitious agents is a vaccine seed, typically derived from historic clinical isolates with poorly defined origins. Here we generated synthetic poliovirus seeds derived from chemically synthesized DNA plasmids encoding the sequence of wild-type poliovirus strains used in marketed inactivated poliovirus vaccines. The synthetic strains were phenotypically identical to wild-type polioviruses as shown by equivalent infectious titers in culture supernatant and antigenic content, even when infection cultures are scaled up to 10-25L bioreactors. Moreover, the synthetic seeds were genetically stable upon extended passaging on the PER.C6 cell culture platform. Use of synthetic seeds produced on the serum-free PER.C6 cell platform ensures a perfectly documented seed history and maximum control over starting materials. It provides an opportunity to maximize vaccine safety which increases the prospect of a vaccine end product that is free from adventitious agents. Copyright © 2015 Elsevier Ltd. All rights reserved.

“Todo lo que sigue es sencillamente estupendo”. Escritoras en las cartas de Ezequiel Martínez Estrada a Victoria Ocampo

Directory of Open Access Journals (Sweden)

Tania Diz

2016-11-01

Full Text Available While Ezequiel Martínez Estrada writes Marta Riquelme, between his fiction and essays, and Victoria Ocampo begins to write her memories; it arises from both an emotional and intellectual relationship through letters along more than 15 years since the late '40s and until the death of Martinez Estrada in 1964. This article will discuss much of those letters with the intended to show that one of the central axes of the epistolary is the construction by Martínez Estrada, his interlocutor in a character: writer women who acquire multiple identities including Marta Riquelme looks.

More than a Preface: the »Editor« of Pepita Jiménez

OpenAIRE

Ignac Fock

2014-01-01

The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) “editor”. Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator – ficti...

78 FR 24718 - Nez Perce-Clearwater National Forests; Idaho; Lolo Insect & Disease Project

Science.gov (United States)

2013-04-26

... Lolo Creek watershed. A total of 500 miles occurs within designated PACFISH buffers. Desired Condition... or displaced soil or loss of organic matter. Desired Condition: Soils are productive (functioning... riparian habitat conservation areas. Deferred maintenance opportunities (such as any needed reconstruction...

Treatment of moderate hallux valgus by percutaneous, extra-articular reverse-L Chevron (PERC) osteotomy.

Science.gov (United States)

Lucas y Hernandez, J; Golanó, P; Roshan-Zamir, S; Darcel, V; Chauveaux, D; Laffenêtre, O

2016-03-01

The aim of this study was to report a single surgeon series of consecutive patients with moderate hallux valgus managed with a percutaneous extra-articular reverse-L chevron (PERC) osteotomy. A total of 38 patients underwent 45 procedures. There were 35 women and three men. The mean age of the patients was 48 years (17 to 69). An additional percutaneous Akin osteotomy was performed in 37 feet and percutaneous lateral capsular release was performed in 22 feet. Clinical and radiological assessments included the type of forefoot, range of movement, the American Orthopedic Foot and Ankle (AOFAS) score, a subjective rating and radiological parameters. The mean follow-up was 59.1 months (45.9 to 75.2). No patients were lost to follow-up. The mean AOFAS score increased from 62.5 (30 to 80) pre-operatively to 97.1 (75 to 100) post-operatively. A total of 37 patients (97%) were satisfied. At the last follow up there was a statistically significant decrease in the hallux valgus angle, the intermetatarsal angle and the proximal articular set angle. The range of movement of the first metatarsophalangeal joint improved significantly.. There was more improvement in the range of movement in patients who had fixation of the osteotomy of the proximal phalanx. Preliminary results of this percutaneous approach are promising. This technique is reliable and reproducible. Its main asset is that it maintains an excellent range of movement. The PERC osteotomy procedure is an effective approach for surgical management of moderate hallux valgus which combines the benefits of percutaneous surgery with the versatility of the chevron osteotomy whilst maintaining excellent first MTPJ range of motion. ©2016 The British Editorial Society of Bone & Joint Surgery.

The philologist Pedro Martínez López: an imaginative liberal lampoonist | El filólogo Pedro Martínez López: un libelista liberal imaginativo

Directory of Open Access Journals (Sweden)

Aline Vauchelle-Haquet

2006-12-01

Full Text Available In 1830, the philologist Pedro Martínez López was forced to go into exile in France for political reasons. In 1832, he published Representación a Fernando VII, rey de España, a lampoon in which he made a whole string of accusations against the tyrant. At the end of the following year, he published España en 1833, al expirar Fernando VII, another lampoon in which he blamed the king's despotic reign for the country's disastrous situation and asserted that such abuses and injustices could only be remedied by re-establishing the Constitution of Cádiz of 1812. In 1834, he ceased to rail against his political enemies, changed strategy, and using his considerable imagination, wrote a kind of fable entitled Una noche en el infierno, vista entre sueños. With a mixture of humour and acid wit, it told of how all the devils in the Kingdom of Darkness, embracing the «sacred» cause of liberalism, vented their anger on the deceased Ferdinand and his followers, who were still in power. It would appear that the work was a success, since it was republished in 1836. In 1835, disillusioned with the tepid and conservative liberal regime of the Estatuto Real, Martínez López wrote another story, Las Brujas en Zugarramurdi, in which different satanic creatures, this time sorceresses, take it upon themselves to defeat moderantismo and establish a progressive regime. After this, he ceased to publish lampoons and political parables and devoted himself to producing learned works, bringing out various dictionaries and grammars which were republished several times. | En 1830, el filólogo Pedro Martínez López tuvo que exiliarse a Francia por motivos políticos. En 1832, sacó a luz en Burdeos una Representación a Fernando VII, rey de España, panfleto en el que espetaba toda una sarta de acusaciones contra el tirano. A finales del año siguiente, publicó La España en 1833, al expirar Fernando VII, otro libelo en que responsabilizaba al despotismo de la

New Data on the Life of the Peruvian-Bolivian Composer Pedro Ximénez-Abrill Tirado (1784-1856

Directory of Open Access Journals (Sweden)

José Manuel Izquierdo König

2017-07-01

Full Text Available Since the mid-nineteenth century the name of Pedro Ximénez Abrill Tirado has been known in musicological and historiographical studies. However, his role and relevance as composer has been acknowledged only recently in the study of historical repertoires of South America, with the discovery of scores containing his music in a private collection in Bolivia, which was later acquired by various archives and individuals. In spite of this, biographical accounts on him have kept using the same information for decades, and mythical constructions have increased rapidly during the last decade. This paper presents a new biographical picture of Pedro Ximénez, with a broader understanding of the context surrounding his life and works along with the transition of his life between Peru and Bolivia, on the basis of important new sources gathered by both authors through research in various archives.

La influencia de Javier Marías en la traducción española de Martínez-Lage de Absalom, Absalom!

OpenAIRE

Alpuente Civera, Miguel; Marco Borillo, Josep; Martínez Vilinsky, Bárbara

2013-01-01

En el posfacio a su traducción de Absalom, Absalom!, Miguel Martínez-Lage declara haber tomado como «modelos estilísticos» a aquellos narradores en lengua española cuya prosa muestra sin lugar a dudas la influencia de Faulkner. En el presente artículo nos proponemos identificar, en primer lugar, los rasgos de estilo comunes a la traducción de Martínez-Lage y a uno de los modelos estilísticos mencionados –la novela Fiebre y lanza, de Javier Marías– y, en segundo lugar, los aspectos de la tradu...

Vida y obra de Luis Jiménez Moreno (1929-2007

Directory of Open Access Journals (Sweden)

Antonio Jiménez García

2008-10-01

Full Text Available Luis Jiménez Moreno passed away on 27 of October, 2007, 77 years old. For the last 30 years he was professor at Universidad Complutense de Madrid. He became Full Professor. He had studied in Salamanca, Roma, Valencia and München. He got a Ph. Degree whith a tesis about Nietzsche`s Antropological Thought by leading of José Luis López Aranguren. He was High School Teacher in Andujar, Ávila and Badalona; after he was professor at Universities of Barcelona and Madrid. This article develops information about his life and his works: books, articles, essays, conferences, papers to Congress, Symposios, Scientic meetings…

Realismo, margen y fragmentariedad en la narrativa de Ezequiel Martínez Estrada

OpenAIRE

Gasillón, María Lourdes

2012-01-01

En primer lugar, este trabajo intenta analizar los ensayos escritos por Ezequiel Martínez Estrada sobre Franz Kafka (1967) para luego reconocer sus influencias en el concepto de lo real y realismo en sus propias narraciones ficcionales. En este caso, se abordará uno de sus cuentos más conocidos, “Marta Riquelme”, que construye discursivamente una imagen de lo/s otro/s en distintos planos textuales: autor, narrador, organización, género, personajes, etc. Tanto el ensayista argentino como el es...

FACETS OF THE ICONOGRAPHY OF DON JUAN MARTÍNEZ SILÍCEO, ARCHBISHOP OF TOLEDO = ALGUNOS ASPECTOS EN TORNO A LA ICONOGRAFÍA DEL ARZOBISPO DE TOLEDO DON JUAN MARTÍNEZ SILÍCEO

Directory of Open Access Journals (Sweden)

María Alegra García García

2014-02-01

Full Text Available Juan Martínez Siliceo (c. 1477-1557 was a Roman Catholic cardinal and archbishop and a distinguished humanist and mathematician who played an important role in the History and culture of Toledo and Spain during the 16th century. Furthermore, he was admired and recognized even after his death thanks to different literary sources and historiography. This article aims to approach his iconography through a selection of the most important literary and artistic sources from the 16th and 17th Centuries.Juan Martínez Silíceo (c.1477-1557, además de cardenal y arzobispo de Toledo, fue un importante humanista y matemático que desempeñó un destacado papel en la historia y cultura del Toledo y la España del siglo XVI y que gozó de gran admiración y reconocimiento más allá de su muerte, tal como evidencian las fuentes literarias y la historiografía posterior. Sin embargo, aún quedan pendientes de estudio pormenorizado algunos aspectos relativos a su relación con las artes. Este artículo pretende plantear un primer acercamiento a la iconografía de Silíceo a través de una selección de las fuentes literarias y visuales de los siglos XVI al XVIII consideradas más relevantes.

Enfermedad y muerte de Don Gonzalo Jiménez de Quesada

Directory of Open Access Journals (Sweden)

Fernando Serpa Florez

1997-12-01

Full Text Available

La lepra es una enfermedad que se caracteriza por la insidia de su presencia, su lenta evolución y la progresiva incapacidad que en sus víctimas causa.

Esto y el temor que ha infundido desde tiempos bíblicos, han hecho que ante ella se haya mantenido una actitud ambivalente de negación hasta donde es posible y de rechazo irracional a quien la padece, por temor al contagio.

Ejemplo de ello es el aura de sagrado misterio que envuelve la leyenda de los padecimientos del Adelantado don Gonzalo Jiménez de Quesada (1509-1579, conquistador del Nuevo Reino de Granada y fundador de Santafé de Bogotá en el año de 1538, muerto a la edad, avanzada para la época, de setenta años.

No se puede afirmar, en forma definitiva, que el conquistador fuera leproso. Se acepta, acogiendo el argumento de autoridad que tiene el primer historiador médico entre nosotros, don Pedro María Ibáñez, quien escribió en 1884, en las Memorias para la Historia de la Medicina en Santa Fe, que en “1579 falleció en la ciudad de Mariquita, y de mal de lepra o elefancía de los

Coincide ello con lo que consigna don José María Vergara y Vergara en su Cuadro Cronológico de la Nueva Granada (hoi Estados Unidos de Colombia, desde los cipas hasta nuestros días (se ha conservado la ortografía usada a mediados del siglo XIX, preconizada por don Andrés Bello, estudio publicado en 1866, en que informa que a poco de posesionarse el tercer Presidente del Nuevo Reino, don Lope Díez Aux de Armendáriz: “ocurrió la muerte del adelantado Gonzalo Jiménez de Quesada que tuvo lugar en Mariquita el 16 de febrero de 1579, a la edad de ochenta años no cumplidos (sic, i de enfermedad de lepra (…” (2.

Estos conceptos fueron debatidos por contemporáneos de Vergara y de Ibáñez como el doctor Juan de Dios Carrasquilla aduciendo, entre otros argumentos, que la lepra no fue mencionada por los coetáneos del conquistador. Y que la sífilis, com

Knowledge Translation of the PERC Rule for Suspected Pulmonary Embolism: A Blueprint for Reducing the Number of CT Pulmonary Angiograms.

Science.gov (United States)

Drescher, Michael J; Fried, Jeremy; Brass, Ryan; Medoro, Amanda; Murphy, Timothy; Delgado, João

2017-10-01

Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA) for pulmonary embolism (PE) ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC) rule, multi-modal education using principles of knowledge translation (KT), and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9-11.2]) to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3-9.4]) pPatient characteristics were similar for both periods. Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.

Salmon and the Adaptive Capacity of Nimiipuu (Nez Perce) Culture to Cope with Change

Science.gov (United States)

Colombi, Benedict J.

2012-01-01

Change due to natural disturbances and disasters, population growth and decline, economic crises, and environmental and climate change creates significant cultural challenges. Rapid change and the transformation it brings also involve complex relationships between sovereign tribes, resources, and the global system. This article explores how salmon…

78 FR 9029 - Nez Perce-Clearwater National Forests; ID; Clear Creek Integrated Restoration Project

Science.gov (United States)

2013-02-07

.... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and..., and big game species. Fire dependent wildlife species would benefit from landscape burning. Watershed...

77 FR 9621 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

Science.gov (United States)

2012-02-17

.... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and... mammals, and big game species. Fire dependent wildlife species would benefit from landscape burning...

77 FR 775 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

Science.gov (United States)

2012-01-06

.... Shifting tree species composition by retaining and planting early seral species (i.e. ponderosa pine... such as insect, disease, and fire. Historical logging practices and fire suppression have created a... habitats by retaining large trees and promoting establishment of tall shrubs and hardwood tree by using...

77 FR 6778 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

Science.gov (United States)

2012-02-09

... patterns that more closely emulate natural mixed severity disturbance. Shifting tree species composition by... logging practices and fire suppression have created a landscape that is more highly fragmented than what... management would increase high quality early seral wildlife habitats by retaining large trees and promoting...

Trayectos de lectura de Espacio, de Juan Ramón Jiménez

OpenAIRE

Luján Atienza, Ángel Luis

2013-01-01

El estudio de Espacio, de Juan Ramón Jiménez, a partir de la teoría cognitiva de las metáforas conceptuales y la fusión de dominios conceptuales (blending), en confluencia con la filosofía heideggeriana, descubre en el poema dos movimientos contradictorios: el de la fuga y de la búsqueda de un centro, que se pueden poner en relación con dos trayectos de lectura y dos tendencias hermenéuticas: la modernista y la post-modernista. En este contexto se tratan de explicar las paradojas y complejida...

Leoncio Martínez Un personaje que marcó pauta en la disidencia

OpenAIRE

Omaira Zambrano Roa

2014-01-01

Cuando se analiza la historia política de un país, se observa énfasis en el estudio de sus períodos gubernamentales y en sus partidos políticos, en los cuales existen personajes que marcaron pauta en su desarrollo de la Nación. Durante la dictadura del general Juan Vicente Gómez (1908-1935)  uno de estos personajes característicos fue Leoncio Martínez, quien ostenta entre sus labores más conocidas la fundación del semanario humorístico Fantoches junto a Francisco Pimentel (Job Pim). En el año...

Perceções de carreira e de sucesso em função do género

OpenAIRE

Tocalino, Renata Leone Pio Galveia

2013-01-01

Tese de mestrado, Psicologia (Secção de Psicologia da Educação e da Orientação), Universidade de Lisboa, Faculdade de Psicologia, 2013 A presente investigação visa explorar o efeito do fator género no desenvolvimento da carreira das mulheres e dos homens, analisando a distribuição das formações e das profissões, as perceções de género e de sucesso profissional, os modelos, as crenças de autoeficácia, as motivações no trabalho e as experiências profissionais significativas. A fundamentação ...

Joaquín Ruiz-Giménez, the Catholic exemplar: notes for a political and intellectual biography up to 1963 | Joaquín Ruiz-Giménez o el católico total: apuntes para una biografía política e intelectual hasta 1963

Directory of Open Access Journals (Sweden)

Javier Muñoz Soro

2006-12-01

Full Text Available The biography of Joaquín Ruiz-Giménez is a virtual paradigm of two historical phenomena which distinguished the last two decades of the Franco regime and, to a large extent, paved the way for the future democracy: on the one hand, the rift between Catholic and Falangist intellectuals and the regime which they had enthusiastically helped to establish after the civil war; and on the other, the secularization of its political thinking and practice. Ruíz-Giménez, ambassador and minister under Franco, was an exception among the Catholic laity that collaborated with the dictatorship, in that he held high government positions and, despite all the reservations concerning his personal development, for many of his peers as well as many aspiring figures of the coming generations, he symbolized the definitive renunciation of all legitimacy of power based on victory in battle or on Catholic natural law, and the definitive adoption of the language of human rights and democracy. | La biografía de Joaquín Ruiz-Giménez representa casi de manera paradigmática dos fenómenos históricos que caracterizaron las dos últimas décadas del franquismo y sentaron, en buena medida las bases de la futura democracia: por un lado, el alejamiento de los intelectuales católicos y falangistas respecto al régimen que habían contribuido a levantar con entusiasmo tras la guerra civil; por otro, la secularización de su pensamiento y práctica política. Ruiz-Giménez, embajador y ministro de Franco, fue una excepción entre los seglares católicos que colaboraron con la dictadura desempeñando altas responsabilidades de gobierno y, pese a todas las cautelas de su evolución personal, simbolizó para bastantes compañeros de su generación, así como para muchos jóvenes alumnos de las nuevas generaciones, la renuncia definitiva a toda legitimación del poder basada en la victoria de las armas o en el iusnaturalismo católico y la adopción irreversible del lenguaje de

An Indian tribal view of the back end of the nuclear fuel cycle: historical and cultural lessons

International Nuclear Information System (INIS)

Tano, M.L.; Powankee, D.; Lester, A.D.

1995-01-01

The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation and the Yakama Indian Nation have entered into cooperative agreements with the US Department of Energy to oversee the cleanup of the Hanford Reservation. The Mescalero Apache Tribe and the Meadow Lake Tribal Council have come under severe criticism from some ''ideological pure'' Indians and non-Indians for aiding and abetting the violation of Mother Earth by permitting the land to be contaminated by radioactive wastes. This paper suggests that this view of the Indian relationship to nature and the environment is too narrow and describes aspects of Indian religion that support tribal involvement in radioactive waste management. (O.M.)

Fall Chinook Salmon Survival and Supplementation Studies in the Snake River Reservoirs, 1996 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Williams, John G.; Bjornn (Bjomn), Theodore C.

1998-05-01

In 1996, the National Marine Fisheries Service, the Nez Perce Tribe, and the U.S. Fish and Wildlife Service completed the second year of cooperative research to investigate migrational characteristics of subyearling fall chinook salmon in the Snake River Basin. In spring and early summer, we captured natural subyearling fall chinook salmon by beach seine, PIT tagged them, and released them in two reaches of the Snake River. Also, subyearling fall chinook salmon reared at Lyons Ferry Hatchery were PIT tagged at the hatchery, transported, and released weekly at Pittsburg Landing on the Snake River and Big Canyon Creek on the Clearwater River to collect data on survival detection probabilities, and travel time.

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River: March 1, 1994--June 15, 1994; TOPICAL

International Nuclear Information System (INIS)

Ashe, B.L.; Miller, A.C.; Kucera, P.A.; Blenden, M.L.

1995-01-01

In 1994, the Nez Perce Tribe began a smolt monitoring study on the Imnaha River in cooperation with the Fish Passage Center (FPC). A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from March 1 to June 15, 1994. We PIT tagged and released 956 wild chinook salmon, 661 hatchery chinook salmon, 1,432 wild steelhead trout and 2,029 hatchery steelhead trout. Cumulative interrogation rates at mainstem Snake and Columbia River dams were 62.2% for wild chinook salmon, 45.2% for hatchery chinook salmon, 51.3% for wild steelhead trout, and 34.3% for hatchery steelhead trout

Ces silences de la narration qui rapprochèrent Jean Giono et Juan Ramón Jiménez

Directory of Open Access Journals (Sweden)

Dominique Bonnet

2010-01-01

Full Text Available This article intends to show how JeanGiono discovered a purity of writing inJuan Ramón Jiménez that he practicedhimself in his elliptical narratives. Thus,this purifying desire that both sought intheir writings would be one of the commonpoints that would persuade Jean Giono todo the film adaptation of Platero y yo.

En memoria de Michael Jiménez (1948-2001

Directory of Open Access Journals (Sweden)

Mauricio Archila Neira

2001-01-01

Full Text Available El 1 de septiembre de 2001 murió el historiador Michael Jiménez. Su apellido provenía de España de donde emigró su abuelo en busca de mejor suerte al otro lado del Atlántico. Nacido en el pequeño pueblo de Merced, California (Estados Unidos en agosto de 1948 en el seno de una familia obrera, Michael vivió su infancia en Colombia. A fines de ese año, su padre se desplazó a estas tierras para ser funcionario de la Texas, una multinacional petrolera que tenía sus reales en Puerto Boyacá. Michael estudió en el colegio Nueva Granada -becado por la Texas- hasta los catorce años. En dicho colegio fue compañero de pupitre de Herbert Braun, descendiente a su vez de una familia de emigrantes a Colombia, y con quien la vida lo juntaría de nuevo en las tierras del norte y en oficios similares.

El Manuscrito Cerramientos y trazas de montea de Ginés Martínez de Aranda

Directory of Open Access Journals (Sweden)

Calvo López, José

2009-03-01

Full Text Available Ginés Martínez de Aranda, master mason in the cathedrals of Cádiz and Santiago de Compostela during the late 16^th century, wrote a manuscript, Cerramientos y trazas de montea, concerning geometrical problems in stone construction. This article deals with the copy of Cerramientos in the Servicio Histórico Militar (Madrid, its copyist, dating, the existence of an earlier version and whether or not Aranda intended to publish it. Also examined are the connections between Cerramientos and other Spanish stonecutting texts of the period, such as those by Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia or Juan de Portor y Castro. Finally, an assessment is made of Martínez de Aranda’s original contributions to European stonecutting literatura.

El arquitecto y cantero baezano Ginés Martínez de Aranda, que trabajó a finales del siglo XVI y ejerció la maestría de las catedrales de Cádiz y Santiago de Compostela, compuso un manuscrito llamado Cerramientos y trazas de montea, que trata de los problemas geométricos de la construcción pétrea. El artículo analiza la copia del manuscrito conservada en el Servicio Histórico Militar de Madrid, la identidad del copista, la fecha de la primera redacción de la obra y la de la copia conservada, y el destino de la obra; a continuación, se estudia la relación del manuscrito con otras obras españolas de cantería, en especial las de Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia y Juan de Portor y Castro, para finalizar tratando diversas aportaciones originales de Aranda a la literatura europea de la cantería.

Knowledge Translation of the PERC Rule for Suspected Pulmonary Embolism: A Blueprint for Reducing the Number of CT Pulmonary Angiograms

Directory of Open Access Journals (Sweden)

Michael J. Drescher

2017-09-01

Full Text Available Introduction: Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA for pulmonary embolism (PE ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC rule, multi-modal education using principles of knowledge translation (KT, and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. Methods: We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. Results: CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9–11.2] to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3–9.4] p<0.001. The absolute reduction in PACT ordered was 1.72 per 1,000 visits (a 16% reduction. Patient characteristics were similar for both periods. Conclusion: Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.

Perceção dos pais em relação à inclusão de crianças com Necessidades Educativas Especiais no ensino regular

Directory of Open Access Journals (Sweden)

Elisabete Matos Freitas

2015-05-01

Full Text Available http://dx.doi.org/10.5902/1984686X15273O papel dos pais no processo de inclusão de crianças com necessidades educativas especiais é fundamental, seja no apoio familiar, desmontando mitos e criando um contexto favorável à experiência e à proximidade. O objetivo deste trabalho é, assim, conhecer as perceções dos pais relativamente à inclusão, assim como os factores que as influenciam. Para isso, foi aplicado um inquérito a 300 pais, com e sem filhos com necessidades educativas especiais. Os resultados permitiram perceber atitudes genericamente positivas, sem diferenças relativamente ao género e ao fato de serem pais de crianças com necessidades educativas especiais. Contudo as variáveis idade, escolaridade e proximidade / contato pareceram influenciar a perceção em relação a inclusão de crianças NEE. Assim, os pais com atitudes mais favoráveis à inclusão tendem a ser os mais novos, que tiveram proximidade / contato com criança NEE. Os resultados são discutidos em função da literatura.

Literatura y realidad histórica. Un reencuentro con Ezequiel Martínez Estrada y su interpretación del Martín Fierro

Directory of Open Access Journals (Sweden)

Amán Rosales Rodríguez

2010-01-01

Full Text Available The purpose of this paper is to critically review some of the main theoretical tenets in Ezequiel Martínez Estrada’s pessimistic stance about the Argentinean history and society of his time. Focusing on his critical remarks about the so-called «literatura o poesía gauchesca» as well as on his enthusiastic assessment of José Hernández’ Martín Fierro, the achievements and missing points in Martínez Estrada’s skeptical diagnosis will be underlined and put in broader philosophical context. For the Argentinean writer the controversial notion of a “superimposed reality” – as he infers its existence from the Martín Fierro – captures a kind of ambivalent metaphysical concurrence among the literary creation, the geographical setting and the sociopolitical state of the country.

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 23--June 24, 1996. Annual report 1996

International Nuclear Information System (INIS)

Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.

1997-04-01

For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 23--June 24, 1996. Annual report 1996; ANNUAL

International Nuclear Information System (INIS)

Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.

1997-01-01

For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts

La presidencia de María Estela Martínez de Perón : la búsqueda de legitimidad y la descalificación del “otro” (1974-1976)

OpenAIRE

Napal, María Celeste

2016-01-01

Napal, M. C. (2016). La presidencia de María Estela Martínez de Perón: la búsqueda de legitimidad y la descalificación del “otro” (1974-1976). Divulgatio, 1(1). El presente artículo busca analizar, a través de los discursos presidenciales, la imagen que la presidente María Estela Martínez de Perón (Isabel) construye del “otro” no partidario en un contexto político en el que se ve cuestionada su propia legitimidad. Partimos de la idea de que el período de su presidencia (1° de julio de 1974...

El Retrato de la última hija de Juan Bautista Martínez del Mazo, boceto para el Retrato de la familia del pintor del Kunsthistorisches Museum de Viena

Directory of Open Access Journals (Sweden)

Gutiérrez Pastor, Ismael

2005-09-01

Full Text Available Por adquisición en el comercio de antigüedades francés se conserva en una colección particular de Bilbao el Retrato de una niña (fig. 2, pintura de carácter velazqueño, que puede ser clasificada perfectamente como obra indiscutible del pintor Juan Bautista Martínez del Mazo (¿Beteta?, Cuenca, 1611-Madrid, 1667, tanto por la característica soltura técnica, como por tratarse de uno de los modelos infantiles que aparecen en el Retrato de la familia del pintor del Kunsthistorisches Museum de Viena (fig. 3, en relación con la cual se conoce otro Retrato de Luis Martínez del Mazo conservado en la Dulwich Picture Gallery de Londres (fig. 1. La importancia de la obra es notable no sólo porque incrementa el catálogo de Martínez del Mazo con una obra indudable, sino también por contribuir a precisar la cronología de la pintura conservada en Viena...

Francisco Ibarra Martínez: renovador de la pedagogía cubana

Directory of Open Access Journals (Sweden)

Lic. Osmar Oliva-Crespo

2015-10-01

Full Text Available The article entitled Francisco Ibarra Martínez: reformer of Cuban Pedagogy, is first of all a well deserved homage to one of the most important pedagogues of the republican period. His thought and his work are approached, from his initial stage of academic formation to his contributions to the educational cuban thought. Stands out his social dimension of his pedagogic work, his integration to the civic life of the city, his reforming vision of the practice of sports and study of the history of his country. Likewise, we refer to his contributions to the historiography as a science, the journalism and his concern for the social and political destination of the country. For this reason this work has among its contributions the treatment to the local history from the specific fild of pedagogy and education, modestly contributing to the rescue of historic memory.

Perceção de falhas de memória, ansiedade e depressão em pacientes com dor crónica

OpenAIRE

Lobato, Filipa

2012-01-01

Dissertação apresentada à Universidade Fernando Pessoa como parte dos requisitos para a obtenção do grau de Mestre em Psicologia, ramo de Psicologia Clínica e da Saúde Diversos estudos têm mostrado que as alterações cognitivas e os estados de humor fazem parte dos quadros com pacientes com dor, o que acaba por limitar, ainda mais, a sua autonomia em termos funcionais das atividades do dia-a-dia. O principal objetivo do presente estudo foi analisar a perceção de falhas de memóri...

Chemins de traverse d’Ignacio Martínez de Pisón, roman de l’absence, roman de l’amour

Directory of Open Access Journals (Sweden)

André-Alain Morello

2012-08-01

Full Text Available Chemins de traverse d’Ignacio Martínez de Pisón se présente comme la pseudo autobiographie d’un adolescent, Felipe, qui, à la mort de sa mère, est condamné à vivre avec un père marginal. Le texte est aussi la conversion d’un récit de type picaresque en un roman qui débouche sur la découverte mutuelle d’un père et d’un fils. L’errance des deux personnages, chemin de fuite destiné à compenser la disparition de Cecilia, conduit à une sorte d’assomption de l’amour.Caminos secundarios, de Ignacio Martínez de Pisón, se presenta como la supuesta autobiografía de un adolescente, Felipe, quien, a la muerte de su madre, se ve forzado a vivir con un padre marginal. El texto es también la evolución de una narración de carácter picaresco hacia una novela que desemboca en el descubrimiento mutuo entre padre e hijo. El vagabundeo de ambos personajes, escape y consuelo por la desaparición de Cecilia, lleva a una forma de exaltación amorosa.

78 FR 41782 - Nez Perce-Clearwater National Forests; Idaho; Notice To Proceed With Forest Plan Revision

Science.gov (United States)

2013-07-11

... pursuant to the 2012 Forest Planning Rule. This process will ultimately result in a Forest Land Management... Planning Rule) which implements the NFMA. Forest Plans describe the strategic direction for management of... is the first phase of the planning process. Only informal public input is required at this stage (36...

Inventario de bienes de Juan Martínez, escribano público de Jerez de la Frontera en la primera mitad del siglo XV

Directory of Open Access Journals (Sweden)

M.ª Belén Piqueras García

2013-12-01

Full Text Available The present study is centered in the analysis of the Inventory of valuable objects of Juan Martínez, Jerez de la Frontera notary public during the first half of 15th century; Persecuting to bring to light this document from notarial type, until now unpublished, that approached its content and diplomatic analysis.

Retorno de un cruzado, by José Jiménez Lozano. Creation, Intertextuality and Originality of a Writing Process

Directory of Open Access Journals (Sweden)

Guadalupe Arbona Abascal

2017-01-01

Full Text Available This paper analyzes the writing process of José Jiménez Lozano’s Retorno de un cruzado (2013, his 24th novel. First, taking into account the author’s comments about the creation of the text, it presents the different versions and the literary reasons for his final choice. Second, literary intertextualities found in the novel are examined. Finally, the condition of the main character as storyteller is identified as the novel’s major source of originality.

Diiagnóstico económico y financiero de Electrónica Martínez de Cartagena

OpenAIRE

García García, Nuria

2015-01-01

Este Trabajo Fin de Máster está incluido en los estudios del Máster en Contabilidad y Finanzas Corporativas realizados en la Universidad Politécnica de Cartagena en el curso académico 2014-2015. El objetivo principal de este proyecto es realizar un análisis económico y financiero de la empresa Electrónica Martínez de Cartagena, S.L. en el periodo de 2008 a 2013, mediante la utilización de una serie de técnicas estudiadas a lo largo de la carrera y perfeccionadas durante el M...

(ReConstrução Mítica de Eva Perón no Romance Santa Evita (1996 – Tomás Eloy Martínez

Directory of Open Access Journals (Sweden)

Josiane Valcarenghi Ribeiro Nantes

2017-06-01

Full Text Available Eva Perón é um nome significativo na história política da Argentina, sua influência surtiu, e continua surtindo efeito, no povo desse país até os dias atuais. “Evita” foi odiada/amada em níveis extremos, tanto que foi considerada uma santa, um mito para muitas pessoas. Tomás Eloy Martínez escreveu o romance – Santa Evita (1995 – em que narra como viveu a esposa de Juan Domingo Perón. Nesta obra encontra-se muitos elementos que dão indícios da (remitificação de Eva, por isso tenta-se aqui, explorar como se deu a (reconstrução mitológica de Eva Perón, personagem histórica no romance Santa Evita (1996 de Tomás Eloy Martínez, e ainda, expor quais foram os procedimentos adotados pelo autor que (reconstruíram esse mito. Utiliza-se, como base teórica, Linda Hutcheon (1991 e Fleck (2007 no conceito de metaficção historiográfica, Mircea Eliade (1991 e Martín Cezar Feijó (1984 no que cabe à análise do Mito. Esta breve pesquisa se dará a partir da análise bibliográfica e de forma comparativa entre a história e a escrita ficcional do romance Santa Evita (1996 de Tomás Eloy Martínez, discute-se os elementos utilizados e o caminho percorrido para a (reconstrução do mito Eva Perón na obra citada.

The Literary Criticism and Memoirs of Juan Ramón Jiménez

Directory of Open Access Journals (Sweden)

Allen W. Phillips

1983-01-01

Full Text Available Equally as demanding of others as he was of himself, Juan Ramón Jiménez conceived of literary criticism as a serious and exacting task. The critic and the poet, standing side by side, are devoted to complementary activities of mutual enrichment. However fragmentary and partial the critical opinions of Juan Ramón may be (also outspoken and polemical in nature, they are invaluable as a personal historical and aesthetic guide to about fifty or sixty years of Hispanic literary development (1900-1960. Not to take them into account is to fail to recognize a highly important aspect of his total artistic personality. These varied critical texts are a product of a first rate intelligence and the sensibility of a writer of consummate discrimination who was endowed not only with an excellent memory but also a very special talent for appreciating the authentic. Juan Ramón as a critic is quick to praise (San Juan, Bécquer, Dario, Unamuno and Machado and at the same time strong in his censure of certain contemporaries. Several recently collected volumes of miscellaneous critical materials have resolved the bibliographical muddle for the initial study of this fundamental aspect of the poet, but still particularly important are the expressionistic portraits of Españoles de tres mundos , longer tributes to Valle, Ortega and Villaespesa as well as the extensive lectures delivered in his latter years. Examination of these pages gives us an historical and creative overview of the period in which he lived and worked in addition to original considerations about the evolution of Hispanic poetry. Of course, one of the constant focal points of his literary criticism was the modernist epoch of his early days, a movement or attitude which he considered to be a modern twentieth century renaissance. Together with detailed study of these two areas of historical and aesthetic nature, in the ensuing pages some conclusions are pointed out as to the essence of poetry

Francisco Martínez de la Rosa and church-state controversial relation in Spain (1834-1835

Directory of Open Access Journals (Sweden)

María José Vilar García

2016-12-01

Full Text Available This study aims to provide and analyze Francisco Martínez de la Rosa’s unpublished correspondence during his term as President of the Spanish Government in the 1834-1835 biennium, maintained with Amat di San Filippo Luigi, nuncio in Spain, and kept in the Vatican Secret Archives. Such correspondence consists of three letters with official mail format, although they could be considered rather confidential for their content. In these documents, the Spanish government strives, albeit unsuccessfully, to achieve recognition by Rome of Elizabeth II of Spain and his liberal regime. And last but not least, in this paper, it is also noteworthy to highlight the urgent need to fill the many vacant Dioceses in Spain.

A prática de formação da câmara municipal de Setúbal: a perceção dos

OpenAIRE

Claré, Lúcia Sofia Balagueira

2013-01-01

Dissertação de Mestrado em Gestão Estratégica de Recursos Humanos O objetivo global desta investigação assenta na prática de formação da Câmara Municipal de Setúbal, a partir da perceção dos dirigentes entrevistados. Na Administração Pública e ao nível da Gestão de Recursos Humanos, a formação tem vindo a ser encarada como um elemento chave para a melhoria da performance organizacional, através da aquisição de novas qualificações dos seus trabalhadores, refletindo-se no aum...

A military officer in Rif: Jesús Jiménez Ortoneda (1911-1936

Directory of Open Access Journals (Sweden)

José Luis Villanova

2009-08-01

Full Text Available This paper uses original and for the most part unpublished documentation in order to examine the career of Jesús Jiménez Ortoneda, a highly successful career officer who served in the Spanish Protectorate of Morocco between 1907 and 1936. He occupied important positions in the political administration of the Protectorate (as director of the political section of Melilla’s Oficina Central de Intervenciones and a senior official in the Department of Indigenous Affairs; he was fluent in Arab and Tamazight, and gained a sound knowledge of the geography of the Rif mountains. His military career, in which he achieved the rank of lieutenant colonel, was characterized by his strictly professional attitude. He was one of the few career officers in Africa who were faithful to Spain’s republican government and who did not participate in the military uprising of 1936. This discussion of his career brings into question some well-established ideas concerning Spanish colonial policy in Morocco.

La légalisation de l’eugénisme en Espagne. Les théories de Jiménez de Asúa dans Libertad de amar y derecho a morir (1928

Directory of Open Access Journals (Sweden)

María Flores Rodríguez

2013-03-01

Full Text Available Cet article étudie les théories eugénistes du juriste et socialiste espagnol Luis Jiménez de Asúa, exposées dans son livre Libertad de amar y derecho a morir (1928, dont l’examen met en évidence l’importance des débats autour de la légalisation de l’eugénisme en Espagne. En démontrant sa viabilité juridique, fondée sur le respect du droit et des principes socialistes, Jiménez de Asúa ouvre de nouvelles perspectives au mouvement eugéniste espagnol, laissant entrevoir les contours d’un nouvel ordre, au détriment de la Dictature de Primo de Rivera, déjà sclérosée.

Why interdisciplinary research enriches the study of crime. Comment on "Statistical physics of crime: A review" by M.R. D'Orsogna and M. Perc

Science.gov (United States)

Donnay, Karsten

2015-03-01

The past several years have seen a rapidly growing interest in the use of advanced quantitative methodologies and formalisms adapted from the natural sciences to study a broad range of social phenomena. The research field of computational social science [1,2], for example, uses digital artifacts of human online activity to cast a new light on social dynamics. Similarly, the studies reviewed by D'Orsogna and Perc showcase a diverse set of advanced quantitative techniques to study the dynamics of crime. Methods used range from partial differential equations and self-exciting point processes to agent-based models, evolutionary game theory and network science [3].

SÈNECA, L. A.: Tragèdies, edició crítica de Tomàs Martínez Romero, 2 volums, Barcelona, Barcino, 1995 («Els Nostres Clàssics», Col.lecció B, núm. 14-15)

OpenAIRE

Pujol i Gómez, Josep

1998-01-01

Obra ressenyada: L. A. SÈNECA; edició crítica de Tomàs MARTÍNEZ ROMERO, Tragèdies. Barcelona: Barcino, 1995. Tomàs Martínez fa una edició crítica de les traduccions catalanes medievals de les següents tragèdies de Sèneca: 'Hercules furens', 'Thyestes', 'Thebais (Phoenissiae)', 'Hippolytus (Phaedra)' 'Oedipus', 'Troades', 'Medea' i 'Agamemnon'. A banda de l'edició, tracta qüestions com la difusió tardomedieval de Sèneca a la corona d'Aragó, la bibliografia sobre la diversitat dels mètodes d...

Vargas Jiménez, Dolores: Picasso: iconografías del baile.

Directory of Open Access Journals (Sweden)

José Jiménez Guerrero

2016-01-01

Full Text Available Fue en el año 1967. Bajo el mecenazgo de una institución ya desaparecida, el Liceo de Málaga, se convocó la primera edición del «Premio Málaga de Investigación». Esta loable iniciativa tuvo una continuidad temporal ininterrumpida hasta 1999. Tras ocho años de silencio, y gracias al respaldo de la Real Academia de Bellas Artes de San Telmo y de la Academia Malagueña de Ciencias, y al patrocinio de la entidad Cajamar, este prestigioso premio fue de nuevo convocado. A ello se sumó en el año 2012 la decisión adoptada por la Diputación de Málaga de publicar los trabajos premia dos en las dos modalidades del referido premio: Humanidades y Ciencias. Los libros editados forman parte de la colección que lleva por título «Premios Málaga de Investigación». En la convocatoria del año 2013, el premio de la sección humanística recayó en el trabajo presentado por Dolores Vargas Jiménez, doctora en Historia del Arte, bajo el título de Picasso: iconografías del baile. Y siguiendo lo preestablecido, su obra fue editada por la entidad supramunicipal.

Linguistic Norms at the Crossover: The Verbal Tenses and Modes, and the Structure of the Predicate in «Libro decimosexto» from Comentarios de erudición by Bartolomé Jiménez Patón

Directory of Open Access Journals (Sweden)

Juan Miguel Monterrubio Prieto

2013-11-01

Full Text Available This study examines verb modes and tenses as well as the predicate structure in «Libro decimosexto» of Bartolomé Jiménez Patón’s Comentarios de erudición in an effort to demonstrate how the text straddles the line between Medieval and Golden Age norms. Jiménez Patón, thus, combines traits already considered archaic at the time, due perhaps to his solid training in grammar and his linguistic awareness, with those modern solutions which, towards the end of the 1500’s, were forging the new Spanish language (that of the «plain style», which he championed, one that was gradually being refined in order to take its place as the language of culture.

Carlos Martínez Assad, coord. 2010. El camino de la rebelión del general Saturnino Cedillo. México: Editorial Océano ISBN 978-607-40034-7-5

Directory of Open Access Journals (Sweden)

Victor Rayon García

2015-01-01

Full Text Available Carlos Martínez Assad publicó Los rebeldes vencidos. Cedillo contra el Estado cardenista en 1990. En ese trabajo, el ahora investigador emérito por la Universidad Nacional Autónoma de México y el Sistema Nacional de Investigadores dio cuenta, mediante un meticuloso análisis de fuentes primarias, de la última rebelión que conmovió al México contemporáneo. La investigación de Martínez Assad tuvo muchos méritos, aunque tal vez el mayor de ellos fue el hecho de analizar el movimiento de Saturnino Cedillo en sus aspectos económicos, sociales, políticos e ideológicos. Con la seriedad académica que siempre lo caracteriza, el ahora también Premio Nacional de Ciencias y Artes 2013 examinó los momentos más importantes en la vida del cacique potosino: su incursión en el torbellino revolucionario (1912, su apoyo al Plan de Agua Prieta (1920, su alianza con los gobiernos de Álvaro Obregón (1920-1924 y Plutarco Elías Calles (1924-1928, y su enfrentamiento final con el gobierno de Lázaro Cárdenas (1934-1940. De esta manera, Martínez Assad demostró que Cedillo, al rechazar el socialismo, las huelgas y el ejido, fue expuesto por el Estado cardenista —empeñado en lograr una centralización política y administrativa— como aliado de las compañías petroleras expropiadas el 18 de marzo de 1938 y portavoz del fascismo alemán en México.

Hebrew Hermeneutics and Inquisitorial Persecution: The Case of The Hebraist from Salamanca Martín Martínez de Cantalapiedra (XVI^th Century

Directory of Open Access Journals (Sweden)

Ricardo Muñoz Solla

2016-12-01

Full Text Available

Halfway through the 16th century in Spain the reading and interpretation of the Bible based on its original languages involved a very real danger for humanists who were seeking a better understanding of the Scriptures. The exclusive authority of the Latin Vulgate version declared by the Council of Trent in 1546 hindered the intellectual work of many Biblicists and Theologians, who were subjected to tight ideological control. In this context it must be considered the case of the Hebraist and scholar from the University of Salamanca, Martín Martínez de Cantalapiedra (1518-1579, who was prosecuted by the Inquisition of Valladolid in 1572 along with his colleagues Fray Luis de León and Gaspar de Grajal. All of them were accused of deviating from the genuine sense of the Vulgate in their more literal interpretations of the Masoretic text. The purpose of this article is to provide new evidence for the intellectual biography of Master Martínez de Cantalapiedra as well a to analyze the hermeneutical principles exposed during his inquisitorial in which he defended the Hebrew knowledge as an essential means of interpreting the Old Testament.

Santa Efigenia / Ifigenia : hagiografía y mito en "San Mateo en Etiopía", de Felipe Godínez

OpenAIRE

Márquez, Esther

2017-01-01

Este artículo aborda el estudio de las fuentes de San Mateo en Etiopía, obra que lleva a las tablas la vida del apóstol San Mateo, centrándose en el episodio de la evangelización de Etiopía y la conversión al cristianismo de Santa Efigenia, la hija del rey Egipo. Mediante el examen de sus fuentes, tanto hagiográficas como mitológicas, se pretende demostrar la contaminación que lleva a cabo Godínez entre la historia de Santa Efigenia y el mito de Ifigenia, la hija de Agamenón. El estudio compa...

El converso sevillano Nicolás Martínez de Medina (o de Sevilla, contador mayor de Castilla. Apuntes para una biografía = Nicolás Martínez Medina (or de Sevilla, Sevilian Converso and Chief Accountant of Castile. Notes for a Biography

Directory of Open Access Journals (Sweden)

Isabel Montes Romero-Camacho

2014-06-01

Full Text Available A partir de la conquista de Sevilla, en 1248, fueron muchos los judíos, primero, y los conversos, después, que llegaron a ocupar una posición preeminente, tanto en la ciudad, como en la corte, desempeñando, casi siempre, importantes oficios, al servicio de la hacienda real castellana, en una secuencia prácticamente ininterrumpida que va desde Alfonso X (1252-1284 hasta la nueva dinastía Trastámara. Uno de estos importantes conversos fue Nicolás Martínez de Medina (o de Sevilla, cuya actuación pública se desarrolló durante los reinados y a la sombra de los primeros Trastámara, desde Enrique II (1369-1379 hasta Juan II (1406-1454 y que, tras una brillante carrera en Sevilla y en la corte, llegaría a ser contador mayor de Castilla y, por tanto, uno de los personajes más influyentes de su época.After the conquest of Seville in 1248, many Jews and later «Conversos» played a prominent role both in the city and in the Court. They occupied significant positions at the service of the Spanish royal treasury almost uninterruptedly from the reign of Alfonso X (1252-1284 to that of the new Trastámara dynasty. One of these important «Conversos» was Nicolás Martínez de Medina (or de Sevilla, who held public positions under the reigns of the first Trastámara kings, from Enrique II (1369-1379 to Juan II (1406-1454. After a brilliant career in Seville and in the Court, he would become chief accountant of Castile and, consequently, one of the most influential individuals of his time.

An Indian tribal view of the back end of the nuclear fuel cycle: Historical and cultural lessons

International Nuclear Information System (INIS)

Tano, M.L.; Reuben, J.H.; Powaukee, D.; Lester, A.D.

1996-01-01

Indian tribes of the western United States, including the Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and the Yakama Indian Nation, have entered into cooperative agreements with the U.S. Department of Energy to oversee the cleanup of the Hanford Reservation, in Washington state. These and other tribes considering involvement in nuclear waste management programs have been subjected to severe criticism from some Indians and non-Indians, accusing them of aiding and abetting the violation of Mother Earth by acquiescing in the contamination of lands by radioactive wastes. We'd like to suggest that this view of the Indian relationship to nature and the environment is too narrow. While the purpose of this article is not to suggest that Indian beliefs support the location of waste management facilities on Indian lands, we will describe aspects of Indian religion and culture that support tribal involvement in radioactive waste management and environmental restoration, and participation in radioactive waste management decision making

Homenaje de los Institutos de Derecho Constitucional y Derechos Humanos a Justino Jiménez de Aréchaga en el centenario de su nacimiento

Directory of Open Access Journals (Sweden)

Alberto Pérez Pérez

2014-02-01

Full Text Available Nació hace cien años, pero su pensamiento sigue plenamente vigente.Su gran obra – verdadero tratado de Derecho Constitucional Uruguayo aunque él no le haya dado ese nombre –terminó de publicarse hace casi seis décadas, pero sigue siendo imprescindible obra de consulta para todos los juristas de nuestro país.Falleció en 1980, pero aún hoy – y sin duda por mucho tiempo más – no hay estudio serio de su especialidad que no comience por indagar lo que él pensaba al respecto.Ése es Justino Jiménez de Aréchaga, la grande, inmensa personalidad uruguaya de cuyo nacimiento se cumplen hoy cien años.Los Institutos de Derecho Constitucional y Derechos Humanos, que me honro en dirigir, le rinden hoy un merecidísimo homenaje, que podemos sintetizar en cuatro afirmaciones:I.Justino Jiménez de Aréchaga hizo una obra maestraII.Fue un Maestro del Derecho y de la vida en democraciaIII.Como verdadero Maestro, también nos enseñó/incitó a tratar de continuar su obraIV.El homenaje que le debemos al Maestro Aréchaga consiste, precisamente, no en palabras sino en obras que lo honren.

P1-11: Visual Function and Neurotoxic Symptoms Related to Exposure to Organic Solvents

Directory of Open Access Journals (Sweden)

Ingrid Jimenez Barbosa

2012-10-01

Full Text Available Aim: Exposure to Perchloroethylene (PERC, a solvent used in dry-cleaning, is associated with neurotoxicity and changes in colour vision (CV and contrast sensitivity (CS. However, PERCs' impact on other aspects of visual function (VF such as chromatic contrast sensitivity (CCS, glass pattern detection (GPP, visual search (VS, and global motion sensitivity (GMS remains unclear. This study compared VF and neurotoxicity in two populations at risk, dry-cleaners (cases from Colombia and Australia. Control groups of people with community levels of exposure to PERC were also assessed. Methods: A case-control study of VF in people who are working in the dry-cleaning industry for at least 1 year (n = 40 Colombia; n= 34 Australia with controls (n = 35 each site. VF measures assessed were CSF, CCS, the FM Hue 100 test, VS, GPP, and GMS. Neurotoxic symptoms were assessed using the Q16 modified version questionnaire. Results: Cases had poorer CCS, hue discrimination, GPP, GMS, and higher Q16 scores than controls (p < .05. There was no effect of country. CS function was poorer than controls (p < .05 for spatial frequencies≥0.50 cpd for Australian cases but for ≥1.0 cpd for Colombian cases. There were no significant differences between cases and controls for serial and parallel VS. Conclusion: Our CSF and CV findings indicate that the CS deficit extends to lower spatial frequencies. Furthermore we report a reduction in the detection of form, motion, and CCS. These deficits were associated with neurotoxic symptoms. Because VS was unaffected, it suggests that PERC affects lower order visual functions more severely than higher level cognition.

De mitos y realidades (respuesta a Luciano Martínez

Directory of Open Access Journals (Sweden)

José Luis Coraggio

2009-10-01

Full Text Available Este artículo constituye la respuesta del autor al comentario crítico realizado, en esta misma sección, por Luciano Martínez, en la pasada edición. El autor sostiene que la economía social y solidaria como un ámbito en construcción, que alberga a diversas vertientes que intentan avanzar hacia otra economía. Este carácter si bien puede albergar dudas, no debe transformase en un fatalismo inmovilizador, que permite la actualización constante del libre mercado como institución hegemónica. Antes que una utopía a denunciar desde una visión “realista”, se trata de construir una economía que combine mecanismos de mercado regulados socio-políticamente y relaciones de reciprocidad y redistribución. El texto explora, en pos de la argumentación, algunos de los elementos que conforman la economía social y solidaria.This article represents the author's response to critical commentary made in this section in the last edition by Luciano Martinez. The author maintains that the social and solidarity economy is a sphere under construction, in which several strands can be found. All of these approaches aim to move towards a different type of economy. This character as a developing realm can prompt doubts; this, however, should not lead to a paralyzing fatalism which allows the constant updating of the free market as a hegemonic institution. Far from a utopia to be denounced from a “realistic” viewpoint of economy, its concerns the construction of an economy that combines socio-politically regulated market mechanisms as well as relations of reciprocity and redistribution. The text also explores some of the elements that make up the solidarity and social economy.

BPA riparian fencing and alternative water development projects completed within Asotin Creek Watershed ; 2000 and 2001 Asotin Creek fencing final report of accomplishments

International Nuclear Information System (INIS)

Johnson, B.J.Bradley J.

2002-01-01

The Asotin County Conservation District (ACCD) is the primary entity coordinating habitat projects on both private and public lands within the Asotin Creek watershed. The watershed covers approximately 325 square miles in the Blue Mountains of southeastern Washington in Water Resource Inventory Area (WRIA) 35. According to Washington Department of Fish and Wildlife's (WDFW) Priority WRIA's by ''At-Risk Stock Significance Map'', it is the highest priority WRIA in southeastern Washington. Summer steelhead, bull trout, and Snake River spring chinook salmon which are listed under the Endangered Species Act (ESA), are present in the watershed. WDFW manages it as a Wild Steelhead Reserve; no hatchery fish have been released here since 1997. The ACCD has been working with landowners, Bonneville Power Administration (BPA), Washington State Conservation Commission (WCC), Natural Resource Conservation Service (NRCS), Washington Department of Fish and Wildlife (WDFW), U.S. Forest Service, Pomeroy Ranger District (USFS), Nez Perce Tribe, Washington Department of Ecology (DOE), National Marine Fisheries Service (NMFS), and U.S. Fish and Wildlife Service (USFWS) to address habitat projects in Asotin County. Local students, volunteers and Salmon Corps members from the Nez Perce Tribe have been instrumental in the success of the Model Watershed Program on Asotin Creek. ACCD began coordinating habitat projects in 1995 with the help of BPA funding. Approximately two hundred and seventy-six projects have been implemented as of 1999. The Washington State Legislature was successful in securing funding for endangered salmon and steelhead recovery throughout the State in 1998. While these issues were new to most of the State, the ACCD has been securing and administering funding for endangered salmonids since 1994. The ''Asotin Creek Riparian Planting 2000-053-00 and Asotin Creek Riparian Fencing 2000-054-00'' teamed BPA and the Governor's Salmon Recovery Funding to plant approximately 84

L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo Ibérico e l’azionismo torinese.

OpenAIRE

Bottai, Alessio

2016-01-01

Síntesis L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo ibérico e l’azionismo torinese. Esta investigación tiene como objeto la historia de las relaciones que se mantuvieron durante más de dos décadas entre un grupo de intelectuales italianos, pertenecientes sobre todo a los azionisti, y algunos exponentes del antifranquismo español. Más específicamente, la tesis se centra en las relaciones activas de solidaridad humana y política que vincular...

Estudo sobre a perceção individual de adolescentes no uso de aparatologia funcional removível e a sua predisposição no sucesso do tratamento ortodôntico

OpenAIRE

Figueira, Maria Margarida Góis

2016-01-01

Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Introdução: Esta investigação pretende explorar, estudar e descrever a perceção individual e adaptativa, relativamente ao tratamento com aparelhos funcionais removíveis, da população jovem a ser seguida na consulta assistencial de Ortodontia da Clínica Universitária Egas Moniz, percebendo-se um envolvimento positivo dos pacientes predispõe ao sucesso do seu tratamento. Materiais e Métodos: ...

Towards a Poetry of Silence: Stéphane Mallarmé and Juan Ramón Jiménez

Directory of Open Access Journals (Sweden)

Mervyn Coke-Enguídanos

1983-01-01

Full Text Available In an era of apparent dissolution, "la Obra" of Juan Ramón Jiménez, like "l'Oeuvre" of Stéphane Mallarmé, has for its goal the attainment of timelessness. In both poets, the concept of absolute Time—the timelessness of eternal Time—is yoked with the ideal of silence. But this is no ordinary silence, and certainly not the kind that results from inadequacy of expression. It is the silence of perfection, the expression of the ineffable: pure Poetry. Since the poetic language is the silent language of thought, both Mallarmé and Juan Ramón seek to convey the pure idea. In so doing, both must stringently eliminate whatever is not essential in their poetry. The astonishing paradox, central to Mallarmé and Juan Ramón alike, is the urge to create an "unwritten" poetry.

[Rural medical practice at the beginning of the 20th century. Martínez Saldise (1855-1937), honorary member of Paediatric Society of Madrid in 1927].

Science.gov (United States)

Zafra Anta, Miguel Ángel; Flores Martín, Carlos; Ponte Hernando, Fernando Julio; Gil García, Andrés; Gómez López, Ana; Fernández Durán, Carla

2016-01-01

On the centenary of the foundation of the Paediatrics Society of Madrid, a tribute is presented to rural medical practice of that time, although there are few documents on the history of rural medicine. The main objective is to describe the context of the rural medical practice in the late 19th and beginning 20th century, while presenting a historical biographical review of Manuel Martínez Saldise, who was medical specialist from Cazalegas (Toledo). He was appointed an Honorary Member by the Paediatrics Society of Madrid in 1927. A search was carried out in repositories of digitized media, web portals of history of medicine, PubMed, IME files of local councils and medical colleges. The family archives were reviewed with the collaboration of his descendants. The hiring of rural doctors was carried out by the municipalities, and the salary largely depended on private practice as well as "retainers". Specialist physicians took part in epidemics, legal medicine, and in hygiene measures. They also had disputes with mayors, chiefs, with colleagues and with protectionism. A summary of the biography and occupational activity of Manuel Martínez Saldise is presented. Rural doctors were subjected to the society of their time, with the issues that arose, denouncing the shortcomings of the local administrations, dedicated efforts to their family and the most disadvantaged. Copyright © 2015 Elsevier España, S.L.U. All rights reserved.

« Nez et langues électroniques » : bilan et perspectives pour les huiles alimentaires

Directory of Open Access Journals (Sweden)

Mielle Patrick

2003-07-01

Full Text Available Le « Nez électronique », et plus récemment la « Langue électronique » ont été fort médiatisés durant la dernière décennie. Aussi est-il nécessaire, avec le recul, de faire le point sur les bénéfices que ces technologies peuvent apporter dans le domaine des produits alimentaires, et en particulier pour huiles végétales. On trouve une littérature relativement abondante dans ce domaine, mais les applications qui ont réussi à franchir le cap de l’utilisation industrielle sont extrêmement restreintes. S’agit-il d’une frilosité des industriels pour des investissements de contrôle-qualité ou d’un manque de fiabilité des résultats de laboratoire ? Pourtant, la demande en outils rapides de contrôle-qualité (ou de contrôle d’origine n’a jamais été aussi pressante. Nous expliquerons ce point par la nature même du produit, principalement pour l’huile d’olive extra vierge. D’autres techniques faisant appel à l’enrichissement en composés volatils seront introduites, laissant espérer à l’avenir une amélioration de la fiabilité des analyses.

Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed, Technical Report 2003-2006.

Energy Technology Data Exchange (ETDEWEB)

Rasmussen, Lynn

2007-02-01

The Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed is a multi-phase project to enhance steelhead trout in the Lapwai Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District (District). Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period December 1, 2003 through February 28, 2004 include; seven grade stabilization structures, 0.67 acres of wetland plantings, ten acres tree planting, 500 linear feet streambank erosion control, two acres grass seeding, and 120 acres weed control.

José Martínez Millán y Carlos Javier de Carlos Morales. Religión, política y tolerancia en la Europa Moderna

OpenAIRE

Torres Corominas, Eduardo

2013-01-01

Como fruto maduro de una larga trayectoria docente e investigadora en la Universidad Autónoma de Madrid, José Martínez Millán y Carlos Javier de Carlos Morales ofrecen en Religión, política y tolerancia en la Europa Moderna una serena reflexión sobre la época del Antiguo Régimen que pretende superar, desde los estudios sobre la Corte, los límites y contradicciones de las escuelas y paradigmas precedentes, como la escuela de los Annales y el marxismo, por medio de un discurso renovador donde s...

Ignacio Arellano y Carlos Mata, Vida y obra de Lope de Vega - José Florencio Martínez, Biografía de Lope de Vega. 1562-1635. Un friso literario del Siglo de Oro

Directory of Open Access Journals (Sweden)

Enrico Di Pastena

2012-12-01

Full Text Available Review of Ignacio Arellano y Carlos Mata, Vida y obra de Lope de Vega, Homo Legens (Bibliotheca Homolegens, 63, Madrid, 2011, 334 pp. ISBN: 978-84-92518-72-2 y José Florencio Martínez, Biografía de Lope de Vega. 1562-1635. Un friso literario del Siglo de Oro, PPU, Barcelona, 2011, 783 pp. ISBN: 978-84-477-1114-7.

Alarma sobre el aplastamiento de la persona en la sociedad contemporánea: José Jiménez Lozano en la prensa regional

Directory of Open Access Journals (Sweden)

María Merino Bobillo

2011-11-01

Full Text Available Las enfermedades de la sociedad contemporánea son descritas, con lucidez y brillantez literaria, por el periodista y escritor José Jiménez Lozano, en las entregas periodísticas al Grupo Promecal. Los nacionalismos, la movida y el botellón, la violencia de género, el lenguaje sexista, etc. son retazos de la actualidad que su mirada atraviesa y dimensiona. Sus artículos traspasan la contingencia de lo periodístico para convertirse en propuestas culturales con tonalidad universal. No se quedan en la crítica de los sucesos concretos sino que, apoyándose en ellos, derivan en reflexiones de corte antropológico y ofrecen pensamientos válidos para los lectores de hoy y de mañana.

Análisis e interpretación de la columna de opinión en la obra periodística del murciano José García Martínez

OpenAIRE

Castelo Blasco, Carmen

2015-01-01

Objetivos.- El presente trabajo analiza 300 columnas de opinión del periodista murciano José García Martínez publicadas en el periódico La Verdad entre los años 1975 y 2010. Para ello, se ha utilizado un análisis de contenido que ha permitido identificar las particularidades y características en cuanto a temas, enfoque, estructura y lenguaje que el autor utiliza. Se trata de un periodista singular por el hecho de haber desarrollado durante más de medio siglo su carrera profesional en un único...

Grande Ronde Basin Chinook Salmon Captive Brood and Conventional Supplementation Programs, 2002 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)

2003-07-01

Endangered Species Permit Number 1011 (formerly Permit No. 973) authorizes ODFW to take listed spring chinook salmon juveniles from Catherine Creek (CC), Lostine River (LR) and Grande Ronde River (GR) for research and enhancement purposes. Modification 2 of this permit authorizes ODFW to take adults for spawning and the production and release of smolts for the Captive and Conventional broodstock programs. This report satisfies the requirement that an annual report be submitted. Herein we report on activities conducted and provide cursory data analyses for the Grande Ronde spring chinook salmon Captive and Conventional broodstock projects from 1 January-31 December 2002. The Grande Ronde Basin Spring Chinook Salmon Captive Broodstock Project is designed to rapidly increase numbers of salmon in stocks that are in imminent danger of extirpation. Parr are captured in Catherine Creek, upper Grande Ronde River and Lostine River and reared to adulthood in captivity. Upon maturation, they are spawned (within stocks) and their progeny reared to smoltification before being released into the natal stream of their parents. This program is co-managed by ODFW, National Marine Fisheries Service, the Nez Perce Tribe and Confederated Tribes of the Umatilla Indian Reservation.

Historias y viñetas, una versión del pasado traumático. Carlos Giménez: variaciones entre España y Argentina

Directory of Open Access Journals (Sweden)

Néstor Bórquez

2013-12-01

Full Text Available The following paper shall focus especially on the work of Carlos Giménez, a comic author from Madrid who attempts to represent there Spanish daily life from Civil War times up to the end of the Francoist regime –and his own life experience displays there an unavoidable reference point: 36-39 Malos tiempos, but mostly Paracuellos and Barrio are part of his own life story during the Civil War and the Francoist regime. In Argentina, authors such as Mariano Grassi or María Delia Lozupone and Rafael Cippolini try a similar intimist gaze upon the representation of dictatorship times in Argentina. This paper shall seek to establish a dialogue between these manifestations, attempting thereby to analyze the intimate plot of history and representation in these comic books.

¿Es posible provocar la madurez del conflicto? A propósito de la correspondencia entre Medófilo Medina y Timoleón Jiménez

Directory of Open Access Journals (Sweden)

Adolfo León Atehortúa Cruz

2012-08-01

Full Text Available A partir del intercambio epistolar entre Medófilo Medina y Timoleón Jiménez, el presente artículo debate los puntos centrales de la correspondencia aludida: la vigencia de la lucha armada, la concepción de dominación y dependencia y las vías de la democracia en Colombia. Finalmente, explora la madurez del conflicto armado en nuestro país y las posibilidades de una salida negociada con participación de la sociedad. Como conclusión, ofrece respuesta a dos preguntas: ¿Será posible una salida negociada que preserve la dignidad de los combatientes? Más aún, ¿será posible inducir esa salida desde la sociedad?

Perceções parentais sobre estado nutricional, imagem corporal e saúde em crianças com idade escolar Las percepciones de los padres sobre el estado nutricional, la imagen corporal y la salud en niños en edad escolar Parental perceptions of nutritional status, body image and health in school-aged children

Directory of Open Access Journals (Sweden)

Lúcia Macedo

2012-03-01

Full Text Available Objetivo: avaliar as perceções parentais sobre estado nutricional, imagem corporal e saúde nas crianças que frequentam o 1º ciclo do ensino básico. Material e métodos: foi avaliado o IMC e a perceção dos pais sobre a imagem corporal e saúde dos seus filhos, por questionários enviados a todos os pais das crianças matriculadas nas escolas pertencentes aos Agrupamentos Vertical de Anes de Cernache e de Vila d’Este, do Concelho de Vila Nova de Gaia, no início do ano letivo 2008/2009 (n=936 e incluídas 532 crianças e pais que aderiram (57% da população amostral. As perceções parentais foram comparadas com o percentil de IMC da criança para avaliar eventuais discrepâncias. Trata-se de um estudo descritivo-correlacional. Resultados: verificou-se que 49.9% dos pais apresentaram uma distorção da perceção relativamente ao estado nutricional e 37.9% relativamente à imagem corporal. Constatou-se que apenas a idade da criança tinha relação com a perceção parental sobre a imagem corporal. Os pais referiram ter “boa” perceção de saúde. Conclusão: estes resultados são congruentes com outros na área e alertam os profissionais para a necessidade de uma intervenção mais efetiva na educação para a saúde para prevenir e detetar precocemente casos de crianças em risco de se tornarem obesas.Objetivo: evaluar las percepciones de los padres sobre el estado nutricional, la imagen corporal, la salud de los niños que asisten al 1 º ciclo de la educación básica. Métodos: se evaluaron el IMC y la percepción de los padres sobre la imagen corporal y la salud de sus hijos por medio de cuestionarios, enviados a todos los padres de los niños matriculados en las escuelas pertenecientes a los “Agrupamentos Vertical” de Anes de Cernache y de Vila d’Este, del municipio de Vila Nova de Gaia, al inicio del curso 2008/2009 (n = 936 e incluyó a 532 niños y padres que a él adhirieron (57% de la población de muestreo. Las

Impact of repeated exposure on toxicity of perchloroethylene in Swiss Webster mice

International Nuclear Information System (INIS)

Philip, Binu K.; Mumtaz, Moiz M.; Latendresse, John R.; Mehendale, Harihara M.

2007-01-01

The aim was to study the subchronic toxicity of perchloroethylene (Perc) by measuring injury and repair in liver and kidney in relation to disposition of Perc and its major metabolites. Male SW mice (25-29 g) were given three dose levels of Perc (150, 500, and 1000 mg/kg day) via aqueous gavage for 30 days. Tissue injury was measured during the dosing regimen (0, 1, 7, 14, and 30 days) and over a time course of 24-96 h after the last dose (30 days). Perc produced significant liver injury (ALT) after single day exposure to all three doses. Liver injury was mild to moderate and regressed following repeated exposure for 30 days. Subchronic Perc exposure induced neither kidney injury nor dysfunction during the entire time course as evidenced by normal renal histology and BUN. TCA was the major metabolite detected in blood, liver, and kidney. Traces of DCA were also detected in blood at initial time points after single day exposure. With single day exposure, metabolism of Perc to TCA was saturated with all three doses. AUC/dose ratio for TCA was significantly decreased with a concomitant increase in AUC/dose of Perc levels in liver and kidney after 30 days as compared to 1 day exposures, indicating inhibition of metabolism upon repeated exposure to Perc. Hepatic CYP2E1 expression and activity were unchanged indicating that CYP2E1 is not the critical enzyme inhibited. Hepatic CYP4A expression, measured as a marker of peroxisome proliferation was increased transiently only on day 7 with the high dose, but was unchanged at later time points. Liver tissue repair peaked at 7 days, with all three doses and was sustained after medium and high dose exposure for 14 days. These data indicate that subchronic Perc exposure via aqueous gavage does not induce nephrotoxicity and sustained hepatotoxicity suggesting adaptive hepatic repair mechanisms. Enzymes other than CYP2E1, involved in the metabolism of Perc may play a critical role in the metabolism of Perc upon subchronic exposure

Indoor tetrachloroethylene levels and determinants in Paris dwellings.

Science.gov (United States)

Roda, Célina; Kousignian, Isabelle; Ramond, Anna; Momas, Isabelle

2013-01-01

There is growing public health concern about indoor air quality. Tetrachloroethylene (PERC), a chlorinated volatile organic compound widely used as a solvent in dry cleaning facilities, can be a residential indoor air pollutant. As part of an environmental investigation included in the PARIS (Pollution and asthma Risk: an Infant Study) birth cohort, this study firstly aimed to document domestic PERC levels, and then to identify the factors influencing these levels using standardized questionnaires about housing characteristics and living conditions. Air samples were collected in the child's bedroom over one week using passive devices when infants were 1, 6, 9, and 12 months. PERC was identified and quantified by gas chromatography/mass spectrometry. PERC annual domestic level was calculated by averaging seasonal levels. PERC was omnipresent indoors, annual levels ranged from 0.6 to 124.2 μg/m3. Multivariate linear and logistic regression models showed that proximity to dry cleaning facilities, do-it-yourself activities (e.g.: photographic development, silverware), presence of air vents, and building construction date (<1945) were responsible for higher domestic levels of PERC. This study, conducted in an urban context, provides helpful information on PERC contamination in dwellings, and identifies parameters influencing this contamination. Copyright © 2012 Elsevier Inc. All rights reserved.

Alternativas y acciones en el tema de residuos sólidos planteadas por las municipalidades de Jiménez y Oreamuno y su relación con el desarrollo y la sostenibilidad (Artículo informativo Alternatives and actions regarding solid residues, presented by Jimenez and Oreamuno municipalities and their relation to development and sustainability (Informative

Directory of Open Access Journals (Sweden)

Rooel Campos-Rodríguez

2013-06-01

the integrated management of solid waste. That is why this research focuses on issues of waste management which has become a major environmental problem. So, it is necessary to confront these issues from the perspective of sustainable development, requiring a new vision and awareness of people regarding the environment and the problem of solid waste. An example of dealing with environmental problems is the work that is being developed in the towns of Jiménez and Oreamuno. These municipalities have worked on environmental education, development and sustainability, and the results have been favorable for treatment and proper disposal of solid waste. In Oreamuno, there is a management plan for organic and inorganic solid waste. There is a storage center and the town is expected to implement in the future bioreactors that enable the production of biofertilizers, methane gas collection, removal of metals in the leachate, and the recovery, processing and marketing of recyclable and reusable waste. Meanwhile, the town of Jiménez has a waste management system, recyclable inorganic wastes are utilized in the collection center and organic waste is transformed into organic fertilizer, which is used on farms in the locality. Therefore, the aim of this paper is to analyze these approaches and their relationship to development and sustainability.

Perceções dos(as) psicoterapeutas sobre a influência dos estereótipos de género e das relações íntimas, heterossexuais e não-heterossexuais, nas vivências da disfunção erétil

OpenAIRE

Cunha, Catarina Gradíssimo Dias da

2012-01-01

Dissertação de mestrado integrado em Psicologia (área de especialização em Psicologia Clínica) Esta dissertação constitui-se como um estudo exploratório e descritivo da perceção que os/as psicoterapeutas, com experiência de acompanhamento de casos de Disfunção Erétil, têm acerca do impacto que os estereótipos de género e o funcionamento das relações íntimas têm nas vivências desta disfunção. Para tal, realizaram-se entrevistas semiestruturadas a 9 psicoterapeutas (psicólogos/as...

Modeling the Potential Distribution of Picea chihuahuana Martínez, an Endangered Species at the Sierra Madre Occidental, Mexico

Directory of Open Access Journals (Sweden)

Victor Aguilar-Soto

2015-03-01

Full Text Available Species distribution models (SDMs help identify areas for the development of populations or communities to prevent extinctions, especially in the face of the global environmental change. This study modeled the potential distribution of the tree Picea chihuahuana Martínez, a species in danger of extinction, using the maximum entropy modeling method (MaxEnt at three scales: local, state and national. We used a total of 38 presence data from the Sierra Madre Occidental. At the local scale, we compared MaxEnt with the reclassification and overlay method integrated in a geographic information system. MaxEnt generated maps with a high predictive capability (AUC > 0.97. The distribution of P. chihuahuana is defined by vegetation type and minimum temperature at national and state scales. At the local scale, both models calculated similar areas for the potential distribution of the species; the variables that better defined the species distribution were vegetation type, aspect and distance to water flows. Populations of P. chihuahuana have always been small, but our results show potential habitat greater than the area of the actual distribution. These results provide an insight into the availability of areas suitable for the species’ regeneration, possibly through assisted colonization.

Toma de decisiones y actitudes emprendedoras en estudiantes del 5° grado de secundaria de la Institución Educativa 2015” Pública José Jiménez Borja – Cercado de Lima

OpenAIRE

Riva Novoa, Ronal

2015-01-01

Es una investigación descriptiva correlacional, orientada a estudiar la relación entre toma de decisión y la actitud emprendedora estudiantes del 5° grado de secundaria de la Institución Educativa Pública José Jiménez Borja del Cercado de Lima, Se seleccionó una población de 80 estudiantes de ambos sexos del 5° año de educación secundaria. A dicha población se les aplicó Cuestionario para evaluar la aptitud en la Toma de Decisiones, el cuestionario fue elaborado por Jonifer Benitez (2011) ...

17 January 2014 - Y. Sakurada Japanese Senior Vice Minister of Education, Culture, Sports, Science and Technology signing the Guest book with CERN Director-General R. Heuer and visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez. Head of International Relations R. Voss present throughout.

CERN Multimedia

Pantelia, Anna

2014-01-01

17 January 2014 - Y. Sakurada Japanese Senior Vice Minister of Education, Culture, Sports, Science and Technology signing the Guest book with CERN Director-General R. Heuer and visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez. Head of International Relations R. Voss present throughout.

Effect of the Pulmonary Embolism Rule-Out Criteria on Subsequent Thromboembolic Events Among Low-Risk Emergency Department Patients: The PROPER Randomized Clinical Trial.

Science.gov (United States)

Freund, Yonathan; Cachanado, Marine; Aubry, Adeline; Orsini, Charlotte; Raynal, Pierre-Alexis; Féral-Pierssens, Anne-Laure; Charpentier, Sandrine; Dumas, Florence; Baarir, Nacera; Truchot, Jennifer; Desmettre, Thibaut; Tazarourte, Karim; Beaune, Sebastien; Leleu, Agathe; Khellaf, Mehdi; Wargon, Mathias; Bloom, Ben; Rousseau, Alexandra; Simon, Tabassome; Riou, Bruno

2018-02-13

The safety of the pulmonary embolism rule-out criteria (PERC), an 8-item block of clinical criteria aimed at ruling out pulmonary embolism (PE), has not been assessed in a randomized clinical trial. To prospectively validate the safety of a PERC-based strategy to rule out PE. A crossover cluster-randomized clinical noninferiority trial in 14 emergency departments in France. Patients with a low gestalt clinical probability of PE were included from August 2015 to September 2016, and followed up until December 2016. Each center was randomized for the sequence of intervention periods. In the PERC period, the diagnosis of PE was excluded with no further testing if all 8 items of the PERC rule were negative. The primary end point was the occurrence of a thromboembolic event during the 3-month follow-up period that was not initially diagnosed. The noninferiority margin was set at 1.5%. Secondary end points included the rate of computed tomographic pulmonary angiography (CTPA), median length of stay in the emergency department, and rate of hospital admission. Among 1916 patients who were cluster-randomized (mean age 44 years, 980 [51%] women), 962 were assigned to the PERC group and 954 were assigned to the control group. A total of 1749 patients completed the trial. A PE was diagnosed at initial presentation in 26 patients in the control group (2.7%) vs 14 (1.5%) in the PERC group (difference, 1.3% [95% CI, -0.1% to 2.7%]; P = .052). One PE (0.1%) was diagnosed during follow-up in the PERC group vs none in the control group (difference, 0.1% [95% CI, -∞ to 0.8%]). The proportion of patients undergoing CTPA in the PERC group vs control group was 13% vs 23% (difference, -10% [95% CI, -13% to -6%]; P < .001). In the PERC group, rates were significantly reduced for the median length of emergency department stay (mean reduction, 36 minutes [95% CI, 4 to 68]) and hospital admission (difference, 3.3% [95% CI, 0.1% to 6.6%]). Among very low-risk patients with suspected

La Economía Política y las Motivaciones de Participación Socio-Política de Jóvenes Chilenos: Una Interpretación de los Hallazgos de Martínez, Silva y Hernández (2010 Political Economy and Youth Motivations of Socio-Political Participation: An Interpretation of the Findings From Martínez, Silva and Hernández (2010

Directory of Open Access Journals (Sweden)

Eduardo Silva

2010-11-01

Full Text Available El artículo de Martínez, Silva y Hernández (en este número argumenta que los jóvenes chilenos se han distanciado de la participación sociopolítica convencional, porque perciben una falta de validación de las personas en el sistema sociopolítico actual, debido a la vulneración de derechos, inequidad social y falta de voz y poder de los ciudadanos. Esto choca con sus valores de fraternidad y desarrollo justo y digno de las personas. En este ensayo se examina si ese sentir tiene fundamentos reales en la estructura y lógica del modelo político-económico que ellos critican. Se aborda el tema desde el marco analítico de la economía política, que parte del supuesto de que las estructuras económicas y políticas determinan sujetos sociales, sus intereses y su poder relativo. Se encontró una asociación directa entre la lógica del modelo político-económico y los sentimientos de exclusión que expresaron los entrevistados.The article by Martínez, Silva, and Hernández (in this issue argues that Chilean youth have disengaged from participation in conventional socio-political institutions because they believe that the sociopolitical system does not validate the persons, violates their rights, is highly inequitable, and excludes them from having a real voice in public decision-making. This perception clashes with their values of fraternity and a just and dignified development for everyone. This essay examines if these beliefs have a real basis in the structure and logic of the economic and political model they criticize. This issue is analyzed from a political economy perspective, built on the assumption that economic and political structures determine social subjects, their interests, and their relative power. A direct association was found between the logic of Chile's political-economic model and the feelings of exclusion that the interviewees expressed.

Series Resistance Analysis of Passivated Emitter Rear Contact Cells Patterned Using Inkjet Printing

Directory of Open Access Journals (Sweden)

Martha A. T. Lenio

2012-01-01

Full Text Available For higher-efficiency solar cell structures, such as the Passivated Emitter Rear Contact (PERC cells, to be fabricated in a manufacturing environment, potentially low-cost techniques such as inkjet printing and metal plating are desirable. A common problem that is experienced when fabricating PERC cells is low fill factors due to high series resistance. This paper identifies and attempts to quantify sources of series resistance in inkjet-patterned PERC cells that employ electroless or light-induced nickel-plating techniques followed by copper light-induced plating. Photoluminescence imaging is used to determine locations of series resistance losses in these inkjet-patterned and plated PERC cells.

Improving couples' quality of life through a Web-based prostate cancer education intervention.

Science.gov (United States)

Song, Lixin; Rini, Christine; Deal, Allison M; Nielsen, Matthew E; Chang, Hao; Kinneer, Patty; Teal, Randall; Johnson, David C; Dunn, Mary W; Mark, Barbara; Palmer, Mary H

2015-03-01

To evaluate the feasibility and acceptability of a newly developed web-based, couple-oriented intervention called Prostate Cancer Education and Resources for Couples (PERC). Quantitative, qualitative, mixed-methods approach. Oncology outpatient clinics at the University of North Carolina (UNC) Lineberger Comprehensive Cancer Center at UNC–Chapel Hill. 26 patients with localized prostate cancer (PCa) and their partners. Pre- and postpilot quantitative assessments and a postpilot qualitative interview were conducted. General and PCa-specific symptoms, quality of life, psychosocial factors, PERC’s ease of use, and web activities. Improvement was shown in some PCa-specific and general symptoms (small effect sizes for patients and small-to-medium effect sizes for partners), overall quality of life, and physical and social domains of quality of life for patients (small effect sizes). Web activity data indicated high PERC use. Qualitative and quantitative analyses indicated that participants found PERC easy to use and understand,as well as engaging, of high quality, and relevant. Overall, participants were satisfied with PERC and reported that PERC improved their knowledge about symptom management and communication as a couple. PERC was a feasible, acceptable method of reducing the side effects of PCa treatment–related symptoms and improving quality of life. PERC has the potential to reduce the negative impacts of symptoms and enhance quality of life for patients with localized PCa and their partners, particularly for those who live in rural areas and have limited access to post-treatment supportive care.

Características tecnológicas de la madera de palo morado (Peltogyne mexicana Martínez de tierra colorada, Guerrero, México

Directory of Open Access Journals (Sweden)

J. Navarro-Martínez

2005-01-01

Full Text Available El presente trabajo contribuye al conocimiento de las características y propiedades tecnológicas de la madera de Palo morado (Peltogyne mexicana Martínez, mediante la caracterización anatómica, porcentaje de elementos y determinación de las propiedades físicas y tres mecánicas. Se colectaron dos árboles en Tierra Colorada Guerrero. El material se obtuvo de trozas a 1.30 m de altura. Para el estudio macroscópico se usaron muestras de 7 x 15 x 1 cm y para el microscópico se elaboraron preparaciones fijas de cortes y de material disociado. La madera presenta un color violeta intenso, porosidad difusa, parénquima en bandas y aliforme confluente con cristales, los elementos de vaso son cortos de diámetro medio, con inclusiones, rayos uniseriados, biseriados, triseriados y raramente multiseriados; las fibras son de tipo libriforme de longitud media, diámetro fino y pared gruesa, presenta densidad básica, contracciones y dureza alta.

1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.

CERN Multimedia

Pantelia, Anna

2014-01-01

1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.

A Origem dos Maus-Tratos: Revisão Sobre a Evolução Histórica das Perceções de Criança e Maus-Tratos

Directory of Open Access Journals (Sweden)

Raquel V. Oliveira

2014-03-01

Full Text Available ObjetivoNeste trabalho elabora-se, com base em revisão bibliográfica, a evolução histórica das perceções acerca de maus-tratos e de criança. Começa-se por abordar o constructo de maus-tratos, passando seguidamente pela Antiguidade e Idade Média, onde as crianças eram sujeitas a constantes maus-tratos, sendo prevalentes os maus-tratos físicos, abuso sexual e o trabalho infantil, progredindo até à Idade Moderna, onde a criança passa a ser vista como um ser com características particulares e merecedor de cuidados especiais. Aborda-se de forma breve as tipologias de maus-tratos na atualidade e as variações culturais.ConclusãoTorna-se fulcral compreender o impacto que os maus-tratos têm vindo ao longo da histórico e que continuam a ter na atualidade, sendo fundamental a considerar estes aspetos nas intervenções a serem desenvolvidas nesta área, tendo em particular consideração o amplo leque de variações culturais cada vez mais presentes e evidentes.

Habitat Evaluation Procedures (HEP) Report; Precious Lands Wildlife Management Area, Technical Report 2000-2003.

Energy Technology Data Exchange (ETDEWEB)

Kozusko, Shana

2003-12-01

The Nez Perce Tribe (NPT) currently manages a 15,325 acre parcel of land known as the Precious Lands Wildlife Management Area that was purchased as mitigation for losses incurred by construction of the four lower Snake River dams. The Management Area is located in northern Wallowa County, Oregon and southern Asotin County, Washington (Figure 1). It is divided into three management parcels--the Buford parcel is located on Buford Creek and straddles the WA-OR state line, and the Tamarack and Basin parcels are contiguous to each other and located between the Joseph Creek and Cottonwood Creek drainages in Wallowa County, OR. The project was developed under the Pacific Northwest Electric Power Planning and Conservation Act of 1980 (P.L. 96-501), with funding from the Bonneville Power Administration (BPA). The acreage protected under this contract will be credited to BPA as habitat permanently dedicated to wildlife and wildlife mitigation. A modeling strategy known as Habitat Evaluation Procedure (HEP) was developed by the U.S. Fish and Wildlife Service and adopted by BPA as a habitat equivalency accounting system. Nine wildlife species models were used to evaluate distinct cover type features and provide a measure of habitat quality. Models measure a wide range of life requisite variables for each species and monitor overall trends in vegetation community health and diversity. One product of HEP is an evaluation of habitat quality expressed in Habitat Units (HUs). This HU accounting system is used to determine the amount of credit BPA receives for mitigation lands. After construction of the four lower Snake River dams, a HEP loss assessment was conducted to determine how many Habitat Units were inundated behind the dams. Twelve target species were used in that evaluation: Canada goose, mallard, river otter, downy woodpecker, song sparrow, yellow warbler, marsh wren, western meadowlark, chukar, ring-necked pheasant, California quail, and mule deer. The U.S. Army Corp of

Cellular renewal and improvement of local cell effector activity in peritoneal cavity in response to infectious stimuli.

Directory of Open Access Journals (Sweden)

Alexandra dos Anjos Cassado

Full Text Available The peritoneal cavity (PerC is a singular compartment where many cell populations reside and interact. Despite the widely adopted experimental approach of intraperitoneal (i.p. inoculation, little is known about the behavior of the different cell populations within the PerC. To evaluate the dynamics of peritoneal macrophage (MØ subsets, namely small peritoneal MØ (SPM and large peritoneal MØ (LPM, in response to infectious stimuli, C57BL/6 mice were injected i.p. with zymosan or Trypanosoma cruzi. These conditions resulted in the marked modification of the PerC myelo-monocytic compartment characterized by the disappearance of LPM and the accumulation of SPM and monocytes. In parallel, adherent cells isolated from stimulated PerC displayed reduced staining for β-galactosidase, a biomarker for senescence. Further, the adherent cells showed increased nitric oxide (NO and higher frequency of IL-12-producing cells in response to subsequent LPS and IFN-γ stimulation. Among myelo-monocytic cells, SPM rather than LPM or monocytes, appear to be the central effectors of the activated PerC; they display higher phagocytic activity and are the main source of IL-12. Thus, our data provide a first demonstration of the consequences of the dynamics between peritoneal MØ subpopulations by showing that substitution of LPM by a robust SPM and monocytes in response to infectious stimuli greatly improves PerC effector activity.

Pablo Rodríguez Jiménez. Cartas de Amor en tiempos de guerra. Rafael Uribe Uribe. Selección de textos y prólogo. Bogotá: Editorial Universidad del Rosario, Escuela de Ciencias Humanas, 2014. 256 páginas

OpenAIRE

Eulalia Hernández Ciro

2015-01-01

Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprens...

La conformación de la provincia jesuítica de Toledo en torno al generalato de Diego Laínez 1556-1565

Directory of Open Access Journals (Sweden)

Martín López, David

2014-12-01

Full Text Available The newest Jesuits soon began incardinated in the Iberian territory, home of its founder. As one of the most important territories of Catholic Christianity, soon saw the need to distribute what would soon become a large crown in a number of provinces for a more effective government and evangelization. After the first division, at the time of the Spanish general Lines were the final foundations of penta-provincialization between Portugal, Castile, Aragon, Andalusia and —novelty— Toledo.La novísima Compañía de Jesús empezó pronto a incardinarse en el territorio ibérico, patria de su fundador. Como uno de los territorios más importantes de la Cristiandad católica, pronto se vio la necesidad de distribuir lo que pronto sería una gran corona en una serie de provincias para unos más eficaces gobierno y evangelización. Después de una primera división, en la época del generalato del español Laínez se pusieron las bases de la pentaprovincialización definitiva entre Portugal, Castilla, Aragón, Bética y —la novedad— Toledo.

Práticas de colaboração para inclusão de alunos com Necessidades Educativas Especiais nas escolas portuguesas : Perceções de professores e Equipa técnico pedagógica/ Collaboration practices for inclusion of students with special educational needs

Directory of Open Access Journals (Sweden)

Raquel Batista de Oliveira

2017-12-01

Full Text Available Data de submissão: 30-10-2017 Data de Aceitação: 22-12-2017Este estudo insere-se na temática da inclusão de alunos com Necessidades Educativas Especiais (NEE nas escolas da Região Centro em Portugal Continental,  tendo como objetivo conhecer as perceções dos diferentes atores sobre as práticas inclusivas de alunos com Necessidades Educativas Especiais nas escolas portuguesas com base no Decreto-Lei 3/2008. Neste sentido, procedeu-se a entrevista semiestruturada direcionada para professores da Educação Especial, professores do Ensino Regular, equipa técnico pedagógica, utilizando a técnica análise de conteúdo para as análises dos dados onde pode-se obter alguns resultados. Os resultados desta investigação revelam que no que se refere as perceções dos diferentes atores educativos face à práticas de colaboração, que há alguma convergência nas respostas destes atores, no entanto, emergem algumas divergências nas respostas destes no que se refere a presença dos recursos humanos e materiais, bem como o seu reconhecimento face utilização destes recursos no espaço escolar. Os resultados também revelam que há diferentes respostas dos participantes face a perceção sobre as práticas de colaboração o que remete a necessidade de um maior fortalecimento entre as culturas de escola que visem o desenvolvimento coeso entre todos os agentes educativos no tocante às práticas de colaboração desenvolvidas neste espaço.Collaboration practices for inclusion of students with special educational needs in Portuguese schools: Teacher perceptions and pedagogical technical teamThis study expands upon the theme of inclusion of students with special needs educational (ENE in schools of the Região Centro in Portugal Continental. It aims to know different practitioners’ perceptions of inclusion practices of pupils with special needs educational in Portuguese schools based on the Decree-Law 3/2008. In this respect, semi

Experimental Results and Issues on Equalization for Nonlinear Memory Channel: Pre-Cursor Enhanced Ram-DFE Canceler

Science.gov (United States)

Yuan, Lu; LeBlanc, James

1998-01-01

This thesis investigates the effects of the High Power Amplifier (HPA) and the filters over a satellite or telemetry channel. The Volterra series expression is presented for the nonlinear channel with memory, and the algorithm is based on the finite-state machine model. A RAM-based algorithm operating on the receiver side, Pre-cursor Enhanced RAM-FSE Canceler (PERC) is developed. A high order modulation scheme , 16-QAM is used for simulation, the results show that PERC provides an efficient and reliable method to transmit data on the bandlimited nonlinear channel. The contribution of PERC algorithm is that it includes both pre-cursors and post-cursors as the RAM address lines, and suggests a new way to make decision on the pre-addresses. Compared with the RAM-DFE structure that only includes post- addresses, the BER versus Eb/NO performance of PERC is substantially enhanced. Experiments are performed for PERC algorithms with different parameters on AWGN channels, and the results are compared and analyzed. The investigation of this thesis includes software simulation and hardware verification. Hardware is setup to collect actual TWT data. Simulation on both the software-generated data and the real-world data are performed. Practical limitations are considered for the hardware collected data. Simulation results verified the reliability of the PERC algorithm. This work was conducted at NMSU in the Center for Space Telemetering and Telecommunications Systems in the Klipsch School of Electrical and Computer Engineering Department.

A Interface e as suas dimensões na perceção de credibilidade e confiança na e-Health. Proposta de uma estrutura para análise da Interface

Directory of Open Access Journals (Sweden)

Andreia Pinto de Sousa

2015-07-01

Full Text Available A Interface é incontornável quando se estudam os sistemas de informação. Com este artigo, pretendemos contribuir para o aumento do conhecimento sobre os processos de apresentação de informação de saúde online e, sobre as relações do utilizador com a Interface. A proposta aqui apresentada consiste na divisão da interface em cinco dimensões (visual, arquitetura da informação, interação, presença social e experiência de utilização para um maior conhecimento da relevância de cada uma das dimensões e dos seus elementos no estudo da credibilidade e confiança online. Apresenta-se também um modelo de análise que serve como base de construção dos instrumentos de análise para a recolha de dados que caraterizam os utilizadores, e os seus comportamentos relativamente ao acesso e participação e avaliam a sua perceção de credibilidade e de confiança em websites partindo da análise de cada uma das dimensões da Interface.

Aviadores en el desierto. Aventura y viaje del capitán Rafael Martínez Esteve en el Ḥamad jordano-iraquí (1926

Directory of Open Access Journals (Sweden)

Córdoba, Joaquín Mª

2005-04-01

Full Text Available A comienzos del siglo XX, cuando el redescubrimiento de Oriente se había trocado en su colonización tras la I Guerra Mundial, la poesía del viaje y el reencuentro con gentes y paisajes parecían ya imposibles. De hecho, la literatura «clásica» del viaje a Oriente estaba ya más que acabada. Sin embargo, un accidente de la historia de la aviación española haría que el capitán Rafael Martínez Esteve, integrante de la patrulla que emprendió el viaje Madrid-Manila, viviera una trágica aventura en el desierto jordano- iraquí. Fruto de esa experiencia sería un libro que es, al mismo tiempo que emocionante relato, descripción poética del desierto y la vida de los beduinos, sarcástica mirada a los poderes coloniales, y un amable epígono en la historia de la literatura española de viajes a Oriente.…

INHIBITORY EFFECTS OF PERCHLOROETHYLENE ON HUMAN NEURONAL NICOTINIC ACETYLCHOLINE RECEPTORS.

Science.gov (United States)

Perchloroethylene (PERC) is a volatile organic solvent with a variety of industrial uses. PERC exposure has been shown to cause adverse neurological effects including deficits in vision and memory in exposed individuals. Despite knowledge of these effects, the mechanisms by whi...

Factors of Predicted Learning Disorders and their Interaction with Attentional and Perceptual Training Procedures.

Science.gov (United States)

Friar, John T.

Two factors of predicted learning disorders were investigated: (1) inability to maintain appropriate classroom behavior (BEH), (2) perceptual discrimination deficit (PERC). Three groups of first-graders (BEH, PERC, normal control) were administered measures of impulse control, distractability, auditory discrimination, and visual discrimination.…

75 FR 14131 - Effect on Propane Consumers of the Propane Education and Research Council's Operations, Market...

Science.gov (United States)

2010-03-24

... Propane Education and Research Council's Operations, Market Changes and Federal Programs AGENCY... Education and Research Council (PERC), in conjunction with the cumulative effects of market changes and... requirements under the Propane Education and Research Act of 1996 that established PERC and requires the...

CONTABILIDAD CASTELLANA EN LA PRIMERA MITAD DEL SIGLO XIX: EL LIBRO DE CUENTAS DE MANUEL MARTÍNEZ LERMA

Directory of Open Access Journals (Sweden)

Juan José Martín García

2016-07-01

Full Text Available La aparición en un archivo particular de la localidad burgalesa de Pradoluengo, del libro de cuentas de Manuel Martínez Lerma, y su análisis desde los puntos de vista formal, conceptual y de contenidos, supone uno de los pocos casos sobre contabilidad privada, estudiados en el ámbito rural castellano de la primera mitad del siglo XIX.                   En su funcionamiento interno, este documento contable es deudor de la tradición castellana. Su fin es eminentemente práctico y su contexto cronológico le hace no estar sujeto a supervisiones de estamentos superiores, lo que le otorga una verosimilitud prácticamente absoluta. Sin lugar a dudas, supuso la piedra angular del trabajo de despacho de su redactor, quien, a pesar de declarar como actividad principal la de escribano, diversificó sus negocios en multitud de ámbitos: fabricación de tejidos, comercio al por menor, actividades financieras y de préstamo, compraventa de lanas, adquisición de tierras e inmuebles, etcétera.                  La versatilidad de nuestro personaje, se plasma en múltiples perspectivas que manan constantemente del libro de cuentas, cuyo análisis hemos apoyado con documentación notarial, parroquial y municipal. Manuel se situará progresivamente en lo más alto de la cúspide social, estableciendo relaciones clientelares con grandes comerciantes, convirtiéndose en un destacado fabricante local, accediendo a puestos de responsabilidad municipal, fijando alianzas matrimoniales ventajosas para sus hijos, o siendo pieza clave en el encumbramiento de uno de ellos como arzobispo de Manila.

The reproduction of sea birds of La Hague and of the Nez-de-Jobourg: The search for reasons of decline (Manche)

International Nuclear Information System (INIS)

James, Jean-Baptiste

2001-11-01

Since 1965, the site of the Nez-de-Jobourg, in the Manche district and at the vicinity of the La Hague plant, has been a site of ornithological follow-up, notably because it harbours different population of nesting sea birds. Since 1990, it has been noticed that the population of European shags has been keeping on decreasing, with abnormally low birth rate, while the European herring gull has totally disappeared. If the relationship between this decline and the releases of the La Hague nuclear waste processing plant is easily and quickly suspected, other reasons are also plausible. The authors report a study of this decline and an investigation of its possible origins. After a presentation of the site, of its status regarding hunting and specie protection, and a presentation of other close sites (small islands, bay), the report addresses the case of the European shag. It gives information on its biology, characteristics, location and population, reproduction sites and nesting cycle. It presents the method adopted to test the various hypotheses of origin of the noticed decline: contamination by radioactive materials or by chemical substances, problems of disturbance by fishers, tourists or others, problems of predation, parasitism or lack of food resources. Samplings have been performed within the studied site and also within reference sites located some miles away. Based on data and observations, hypotheses are then discussed. An analytical report of measurement of artificial radio-elements performed by gamma spectrometry is provided

CARACTERIZACIÓN TECNOLÓGICA DE LA MADERA DE Juniperus flaccida VAR. POBLANA MARTÍNEZ

Directory of Open Access Journals (Sweden)

A. Borja de la Rosa

2010-01-01

Full Text Available El presente estudio se realizó con la finalidad de conocer las características y propiedades tecnológicas de la madera de Juniperus flaccida var. poblana Martínez, para lo cual se utilizó la metodología del Laboratorio de Anatomía y Tecnología de la Madera de la División de Ciencias Forestales de la Universidad Autónoma Chapingo. Las propiedades físicas se determinaron según la norma NOM-EE-167-83 y las mecánicas de acuerdo a las normas ASTM 143-83 en el Campo Experimental San Martinito, del Instituto de Investigaciones Forestales, Agrícolas y Pecuarias (INIFAP. Los resultados con relación a las características anatómicas fueron los siguientes: la madera presenta un color castaño claro en el duramen y amarillo pálido en la albura, brillo medio, veteado suave, textura fina, hilo recto, sabor característico y olor aromático. Las traqueidas son largas, de diámetro tangencial mediano y paredes delgadas; presentan una hilera de puntuaciones areoladas seriadas, las puntuaciones de los campos de cruzamiento son tipo cupresoide y el parénquima axial es escaso. Los rayos de tipo uniseriados numerosos, muy bajos y muy angostos; los rayos y las células parenquimatosas axiales presentan aceites. La proporción de elementos fue 92 % de traqueidas, 7.72 de parénquima de rayo y 0.18 % de parénquima axial. La densidad básica fue de 0.50 g·cm-3, las contracciones totales fueron: volumétrica de 8.42 %, tangencial de 4.26 % y radial de 3.02 %; y los hinchamientos totales: volumétrico de 9.17 %, tangencial de 4.45 % y radial de 3.12 %. El punto de saturación de la fibra fue de 33 %; el coeficiente de hinchamiento 0.278 %, y la relación de anisotropía de 1.41. Los valores promedio de las propiedades mecánicas al 12 % de contenido de humedad (CH y en condición verde, se clasificaron de medios a bajos en ambas condiciones de contenido de humedad. Considerando las características anatómicas y los valores de las propiedades f

AcEST: DK950544 [AcEST

Lifescience Database Archive (English)

Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =

AcEST: DK951699 [AcEST

Lifescience Database Archive (English)

Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste

Dance training intensity at 11–14 years is associated with femoral torsion in classical ballet dancers

Science.gov (United States)

Hamilton, D; Aronsen, P; Løken, J H; Berg, I M; Skotheim, R; Hopper, D; Clarke, A; Briffa, N K

2006-01-01

Objective To examine in a cross sectional study the influence of femoral torsion (FT) and passive hip external rotation (PER) on turnout (TO). Starting age, years of classical ballet training, and current and past dance training intensity were assessed to determine their influence on FT, PER, and TO in pre‐professional female dancers. Methods Sixty four dancers (mean (SD) age 18.16 (1.80) years) were recruited from four different dance training programmes. They completed a dance history questionnaire. FT was measured using a clinical method. PER was measured with the subjects prone, and TO was measured with the subjects standing. Results Mean TO was 136°, mean unilateral PER was 49.4°, and mean FT was 18.4°. A positive correlation was observed between PER combined (PERC) and TO (r  =  0.443, pballet training and FTC, PERC, or TO. Dancers who trained for six hours a week or more during the 11–14 year age range had less FT than those who trained less (mean difference 6°, 95% confidence interval 1.4 to 10.3). Students currently training for longer had higher levels of TO (p<0.001) but comparable PERC and FTC. Conclusion FT is significantly associated with PERC. Dancers who trained for six hours a week or more at 11–14 years of age had significantly less FT. FTC had a significant influence on PERC, but no influence on the execution of TO. PMID:16556782

Restoring Anadromous Fish Habitat in Big Canyon Creek Watershed, 2004-2005 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Rasmussen, Lynn (Nez Perce Soil and Conservation District, Lewiston, ID)

2006-07-01

The ''Restoring Anadromous Fish Habitat in the Big Canyon Creek Watershed'' is a multi-phase project to enhance steelhead trout in the Big Canyon Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District. Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period September 1, 2004 through October 31, 2005 include; 2.7 riparian miles treated, 3.0 wetland acres treated, 5,263.3 upland acres treated, 106.5 riparian acres treated, 76,285 general public reached, 3,000 students reached, 40 teachers reached, 18 maintenance plans completed, temperature data collected at 6 sites, 8 landowner applications received and processed, 14 land inventories completed, 58 habitat improvement project designs completed, 5 newsletters published, 6 habitat plans completed, 34 projects installed, 2 educational workshops, 6 displays, 1 television segment, 2 public service announcements, a noxious weed GIS coverage, and completion of NEPA, ESA, and cultural resources requirements.

Santiago Martínez Delgado, pionero del diseño gráfico colombiano: una reseña de su vida y obra

Directory of Open Access Journals (Sweden)

Diego Giovanni Bermúdez Aguirre

2017-06-01

Full Text Available Hablar del diseño gráfico en Colombia como profesión autónoma es aproximarse a una historia todavía en construcción, dada la juventud de este espacio de conocimiento, el cual dio sus primeros pasos solo hasta principios del siglo XX, debido al desarrollo industrial que vino a definir un nuevo lenguaje de producción, estético y comunicativo que ahora se llama “diseño”. Este texto pretende acercarse a la vida de Santiago Martínez Delgado, uno de los primeros hombres que con su obra definió, en el contexto colombiano, los rumbos de una nueva forma de expresión y comunicación: el diseño gráfico. Se intenta comprender el carácter innovador presente en la vida y obra de este diseñador colombiano, desde la ciencia histórica a partir de la condición de lugar de producción, acercamiento al tiempo histórico como reconstrucción o representación de un presente por medio de un proceso de ficcionalización, el cual edifica y evidencia una ruptura temporal entre el pasado, asumido como espacio de experiencia, y el ahora (presente, constituido a partir de una visión prospectiva de la vida en el futuro, horizonte de expectativa.

The Revolutionary Armed Forces of Colombia - People’s Army (FARC-EP): Marxist-Leninist Insurgency or Criminal Enterprise

Science.gov (United States)

2005-12-01

Landazábal’s public defiance of civil authority, the general was relieved of his position and subsequently retired. 32 Socorro Ramírez, “El proceso de...Bogotá D.C., 2003), 273. 33 Socorro Ramírez, “El proceso de paz de Belisario Betancur”, in Tiempos de Paz: Acuerdos en Colombia, 1902-1994, eds...José Miguel Narvaéz Martínez, Deputy Director of the Departamento Administrativo de Seguridad (Colombian equivalent of U.S. FBI), interview by author

Fotogenia literaria en Carreteras secundarias, de Ignacio Martínez de Pisón: un viaje de ida y vuelta

Directory of Open Access Journals (Sweden)

García-Abad García, M. Teresa

2005-06-01

Full Text Available The cinema, his synthetic character, and the dialogue that it establishes from the origin with other arts as literature, has not stopped offering a wide space of synergies for the adaptation practice and for the study of confluence areas between image and word. New generations of writers and directors propiciate across their work an opening that, beside integrating the expressive resources of the literature and the screen, consider the text as a productive and plural activity, capable of being spread in a stereophony that postpones its meaning in every process of reading, making it coincide with a practice of writing and creation. Ignacio Martinez de Pisón's literature contains sugerent keys to advance in the dialogue between literature and cinema in current Spanish narrative.El cine, su carácter sintético, y el diálogo que desde el origen establece con otras artes como la literatura, no han dejado de ofrecer un espacio amplio de sinergias para la práctica adaptativa y para la reflexión acerca de los ámbitos de confluencia entre la imagen y la palabra. Las generaciones de escritores y de directores más jóvenes propician a través de su obra una apertura que, además de integrar los recursos expresivos de la literatura y la pantalla, considera al texto como una actividad productiva y plural capaz de diseminarse en una estereofonía que aplaza su significado en cada proceso de lectura haciéndolo coincidir con una práctica de escritura y de creación. La literatura de Martínez de Pisón contiene claves sugerentes para desentrañar este diálogo entre literatura y cine en la narrativa española actual.

A review of potential neurotoxic mechanisms among three chlorinated organic solvents

International Nuclear Information System (INIS)

Bale, Ambuja S.; Barone, Stan; Scott, Cheryl Siegel; Cooper, Glinda S.

2011-01-01

The potential for central nervous system depressant effects from three widely used chlorinated solvents, trichloroethylene (TCE), perchloroethylene (PERC), and dichloromethane (DCM), has been shown in human and animal studies. Commonalities of neurobehavioral and neurophysiological changes for the chlorinated solvents in in vivo studies suggest that there is a common mechanism(s) of action in producing resultant neurotoxicological consequences. The purpose of this review is to examine the mechanistic studies conducted with these chlorinated solvents and to propose potential mechanisms of action for the different neurological effects observed. Mechanistic studies indicate that this solvent class has several molecular targets in the brain. Additionally, there are several pieces of evidence from animal studies indicating this solvent class alters neurochemical functions in the brain. Although earlier evidence indicated that these three chlorinated solvents perturb the lipid bilayer, more recent data suggest an interaction between several specific neuronal receptors produces the resultant neurobehavioral effects. Collectively, TCE, PERC, and DCM have been reported to interact directly with several different classes of neuronal receptors by generally inhibiting excitatory receptors/channels and potentiating the function of inhibitory receptors/channels. Given this mechanistic information and available studies for TCE, DCM, and PERC, we provide hypotheses on primary targets (e.g. ion channel targets) that appear to be most influential in producing the resultant neurological effects. - Research highlights: → Comparison of neurological effects among TCE, PERC, and DCM. → Correlation of mechanistic findings to neurological effects. → Data support that TCE, PERC, and DCM interact with several ion channels to produce neurological changes.

Telling Tales of War to Teens: Ignacio Martínez de Pisón's Una guerra africana and Morocco as "Open Wound" in the Spanish National Imaginary

Directory of Open Access Journals (Sweden)

Silvia Bermúdez

2006-01-01

Full Text Available Exactly ten years after its traumatic defeat in the Spanish-American War of 1898, Spain appeared to find some compensation for the loss of its last colonies by undertaking the invasion of Morocco in 1908. The enterprise proved difficult when the forces of Abd-el-Krim defeated the Spanish army in the summer of 1921. This terrible loss was metaphorized as an "open wound" and entered the collective imagination by becoming a theme in novels such as José Díaz Fernández's El blocao (1928, Ramón Sender's Imán (1930, and Arturo Barea's series La forja de un rebelde (1941-1944. Known as the "Disaster of Annual," the defeat appeared to be almost forgotten until a series of narratives in the late twentieth and early twenty-first centuries obsessively returned to this particular moment of Spanish history. I focus on how one such narrative, Martínez de Pisón's Una guerra africana (2000, revisits this war as adolescent literature ("novelas juveniles" and within the literary genre of the "novels of the War in Africa," and by so doing, contributes to the articulation of a Spanish collective identity with the historical memory of the feared Moroccan Other.

Voluntad de estilo en el muy joven José Martínez Ruiz: un aprendiz de crítico satírico (1893-1894

Directory of Open Access Journals (Sweden)

Miguel Ángel Martín-Hervás Jiménez

2017-02-01

Full Text Available Este artículo se enmarca dentro la etapa de producción juvenil de José Martínez Ruiz, Azorín (1873-1967 y en él se analizan con un doble objetivo las tres primeras obras de su carrera literaria: La crítica literaria en España (1893, Moratín (1893 y Buscapiés (1894. El primer y principal objetivo consiste en utilizar como fundamento metodológico la teoría de la voluntad de estilo desarrollada por Juan Marichal en su libro Teoría e historia del ensayismo hispánico (1984 para analizar el tipo de personalidad literaria que aspiró a construirse el autor en sus tres primeras obras. En segundo lugar, se comprobará si es cierto o no que bebió en ellas de las fuentes de la ideología anarquista para forjar su imagen pública de escritor. Se concluirá que el futuro Azorín se encontraba en el periodo de 1893-1894 en una fase de aprendizaje y de búsqueda de maestros en la que quiso proyectar de sí mismo la imagen de Crítico Discordante o Crítico Satírico. Asimismo, se aclarará que hasta el momento todavía no había encontrado en el anarquismo el sustrato ideológico-estético que impregnará obras posteriores.

Francisco A. Ortega Martínez y Yobenj Aucardo Chicangana-Bayona, eds. Conceptos fundamentales de la cultura política de la Independencia.

Directory of Open Access Journals (Sweden)

Margarita Garrido

2016-07-01

Full Text Available El libro editado por Francisco Ortega Martínez y Yobenj Aucardo Chicangana-Bayona es, en buena parte, producto de una investigación colectiva sobre los lenguajes políticos del período de la Independencia neogranadina, iniciada ya hace más de siete años con un grupo de estudiantes de maestría de la Universidad Nacional que, al ampliar sus fronteras, ha involucrado a otros investigadores nacionales y extranjeros, con quienes discute su propuesta metodológica y de principios con respecto a la historia conceptual. Lo interesante es que el libro no es la respuesta a un llamado a enviar artículos que más o menos se acomoden a unos temas y problemas, sino el resultado de lecturas conjuntas, debates y reflexiones que le permitió compartir a los autores lo que en su momento entendían por historia conceptual y por cultura política. Así, decidieron formular preguntas que no solo dieran cuenta de la semántica histórica sino que además, como lo plantean en la introducción, indagan por las experiencias que alimentaron los sentidos dados a un concepto y las expectativas que despertaron entre quienes lo usaron. Los conceptos a trabajar fueron escogidos, entendiendo que tenían esa calidad precisamente por haber estado en el centro de los debates por el sentido y el significado de los acontecimientos; porque fue con esos conceptos que los contemporáneos reflexionaron y elaboraron las experiencias vividas.

REHABILITACIÓN DE SUELOS SALINO-SÓDICOS: ESTUDIO DE CASO EN EL DISTRITO DE RIEGO 086, JIMÉNEZ, TAMAULIPAS, MÉXICO

Directory of Open Access Journals (Sweden)

Juana Irma Manzano Banda

2014-07-01

Full Text Available Se evaluó el efecto de la aplicación de estiércol bovino, yeso, ácido sulfúrico y lavado de suelos sobre la concentración de sales solubles y proporción de sodio en dos suelos salino-sódicos, provenientes del Distrito de Riego 086 de Jiménez, Tamaulipas, México. Se utilizaron macetas con 6 kg de suelo bajo condiciones de invernadero para ensayar dos niveles de salinidad-sodicidad (suelo Carretas con nivel moderado y suelo Macahuistle con nivel alto, dos mejoradores inorgánicos (yeso y ácido sulfúrico y un mejorador orgánico (estiércol. Se utilizó un diseño experimental completamente al azar con arreglo factorial 2 × 2 × 3. Las variables de respuesta fueron conductividad eléctrica (CE, porciento de sodio intercambiable (PSI y pH. La salinidad inicial en el suelo Carretas, con CE = 7.75 dS m-1 y Macahuistle con CE = 22.2 dS m-1, disminuyó a menos de 4 dS m-1. El PSI inicial del suelo Carretas fue 18.4 y el del suelo Macahuistle 34, valores que se abatieron a niveles menores de 8. El pH inicial de 7.8 en el suelo Carretas y 8 en el suelo Macahuistle, disminuyeron a un valor de 7.4 con la aplicación de estiércol y ácido sulfúrico. El lavado redujo la salinidad y sodicidad de ambos suelos hasta niveles satisfactorios para cultivos convencionales, con y sin de la aplicación de estiércol bovino, yeso y ácido sulfúrico.

People's Education (for People's Power

Directory of Open Access Journals (Sweden)

Thokozani Mathebula

2013-01-01

Full Text Available The central feature of Athenian citizens' rights, that is, people's participation in government, is also enshrined in the South African Constitution. This article argues for the Athenian style of participatory democracy as a viable model of participation in governing South African schools. The author claims that 'people's education', which had its origins in the principles of the Freedom Charter¹ - was diluted during the negotiationsfor South Africa's new democratic government. As a result, the political and educational ideal of 'people's education for 'people's power' has given way to democratic elitism in post-apartheid South African schools.

La Seguridad Integral: España 2020

OpenAIRE

Pardo Buendía, Mercedes

2009-01-01

Dirección y co-redacción principal: Óscar Jaime Jiménez, Antonio M. Díaz Fernández. Expertos que han participado en la elaboración: Rogelio Alonso Pascual, Félix Arteaga Martín, Pedro Arrojo Agudo, Rut Bermejo Casado, Julio Bordas Martínez, Lorenzo Castro Moral, Andrés García Gómez, Raúl C. Mainar-Jaime, Rafael Martínez Martínez, Miguel Ángel Muñoz Rodríguez, Mercedes Pardo Buendía, René Pita Pita, Gonzalo Sáenz de Miera, Fernando Soteras Escartín, Diego Torrente Robles, F...

Emigration of Natural and Hatchery Chinook Salmon and Steelhead Smolts from the Imnaha River, Oregon, Progress Report 2000-2002.

Energy Technology Data Exchange (ETDEWEB)

Cleary, Peter; Kucera, Paul; Blenden, Michael

2003-12-01

This report summarizes the emigration studies of the Nez Perce Tribe in the Imnaha River subbasin during the 2001 and 2002 migration years. A migration year for the Imnaha River is defined here as beginning July 31 of the previous year and ending July 30 the following year. The conclusion of the studies at the end of migration year 2002 marked the 11th year of the Nez Perce Tribe's Lower Snake River Emigration Studies. The Nez Perce Tribe has participated in the Fish Passage Center's Smolt Monitoring Program for nine of the 11 years. These studies collect and tag juvenile chinook salmon and steelhead at two locations in the fall, rkm 74 and rkm 7, and at rkm 7 during the spring. Data from captured and tagged fish provide an evaluation of hatchery production and releases strategies, post release survival of hatchery chinook salmon, abundance of natural chinook salmon, and downstream survival and arrival timing of natural and hatchery chinook salmon and steelhead. The hydrologic conditions that migrating fish encountered in 2001 were characterized as a drought and conditions in 2002 were characterized as below average. Hatchery chinook salmon had a mean fork length that was 34 mm greater in 2001 and 35 mm greater in 2002 than the mean fork length of natural chinook smolts. Hatchery steelhead smolt mean fork lengths were 39 mm greater than natural steelhead smolts in 2001 and 44 mm greater than natural steelhead smolt fork lengths in 2002. A significant difference (p < 0.05) between hatchery and natural chinook salmon and steelhead fork lengths has been documented by these emigration studies from 1997 to 2002. Hatchery chinook salmon were volitionally released in 2001 and 2002 and the 90% arrivals for 2001 and 2002 at the lower rkm 7 trap were within the range of past observations of 22 to 38 days observed in 1999 and 2000. We estimated that 93.9% of the 123,014 hatchery chinook salmon released in 2001 survived to the lower trap and 90.2% of the 303

Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez.

Directory of Open Access Journals (Sweden)

Francisco José Rodríguez Marín

2013-01-01

Full Text Available Revistas UMA Encabezado de página Usuaria/o Contraseña No cerrar sesión Notificaciones Vista Suscribirse Idioma Contenidos Examinar Por número Por autor/a Por título Otras revistas Información Para lectores/as Para autores/as Para bibliotecarios/as Open Journal Systems Inicio Acerca de Actual Archivos Avisos Inicio > Núm. 34 (2013 > Rodríguez Marín Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez. Francisco José Rodríguez Marín Resumen Ver Resumen El interés de Rosario Camacho por la multiplicidad de mensajes y la cultura simbólica de carácter funerario fue, inicialmente, una consecuencia natural de sus investigaciones sobre la arquitectura barroca. En uno de sus libros más reconocidos, Málaga barroca. Arquitectura religiosa de los siglos XVII y XVIII (1981 analizó el panteón de los condes de Buenavista en la iglesia del monasterio de la Victoria y su impresionante conjunto de relieves y esculturas en torno a la muerte, recogiendo algunas de las interpretaciones que hasta entonces se habían realizado, como las de Juan Temboury o Santiago Sebastián. El carácter excepcional del conjunto arquitectónico de la iglesia, el monasterio, y especialmente, de la rica y original superposición de espacios verticales integrado por el mencionado panteón, la sacristía y el camarín de la Virgen, justifican la atención pormenorizada que se le prestó en una de las carpetas que, incluyendo planimetría y dedicadas al Barroco, fueron publicadas por el Colegio de Arquitectos de Málaga. La titulada El Santuario de la Victoria de Málaga (1986 tuvo por autores a Rosario Camacho y al arquitecto José María Romero.

El Vignola del Colegio de Arquitectos de Valencia y sus retablos de traza sevillana: Juan Martínez Montañés

Directory of Open Access Journals (Sweden)

Navarrete Prieto, Benito

2005-09-01

Full Text Available Three drawings of altarpieces executed by the Sevillian sculptor Juan Martinez Montañés, preserved in the copy of Vignola's architectural treatise in the Colegio de Arquitectos de Valencia are analyzed here. The first drawing is a preliminary study for the altarpiece of the Immaculate Conception in the Parrochial Church of El Pedroso (Seville. The second drawing, also a preliminary idea, is for the lost altarpiece of the Dominican monastery of Portacelli in Seville, from which only the figure of St Dominic of Guzman flagellating himself has survived (Museo de Bellas Artes de Sevilla. The third is the model for the type of altarpiece-tabernacle used by Montañés in the Convent of Santa Clara (Seville. The author also points out the origin of certain elements of Montañés's designs in the prints of Vignola's treatise.

Presentamos un análisis de tres de los dibujos de retablos que se conservan en el ejemplar del Vignola del Colegio de Arquitectos de Valencia y que pertenecen al escultor sevillano Juan Martínez Montañés. El primero de ellos es preparatorio para el retablo de la Inmaculada de la iglesia parroquial del Pedroso (Sevilla, conservado in situ actualmente. El segundo es para el perdido Retablo de los dominicos de Portacoeli de Sevilla, del que se conserva el Santo Domingo de Guzman azotándose en el Museo de Bellas Artes de Sevilla, y el tercero es modelo para la tipología del Montañés del Retablo-Tabernáculo en la iglesia del convento de Santa Clara de Sevilla, estudiándose además el origen de algunos elementos de Montañés en los propios grabados del libro de Vignola.

Spatially correlated heterogeneous aspirations to enhance network reciprocity

Science.gov (United States)

Tanimoto, Jun; Nakata, Makoto; Hagishima, Aya; Ikegaya, Naoki

2012-02-01

Perc & Wang demonstrated that aspiring to be the fittest under conditions of pairwise strategy updating enhances network reciprocity in structured populations playing 2×2 Prisoner's Dilemma games (Z. Wang, M. Perc, Aspiring to the fittest and promoted of cooperation in the Prisoner's Dilemma game, Physical Review E 82 (2010) 021115; M. Perc, Z. Wang, Heterogeneous aspiration promotes cooperation in the Prisoner's Dilemma game, PLOS one 5 (12) (2010) e15117). Through numerical simulations, this paper shows that network reciprocity is even greater if heterogeneous aspirations are imposed. We also suggest why heterogeneous aspiration fosters network reciprocity. It distributes strategy updating speed among agents in a manner that fortifies the initially allocated cooperators' clusters against invasion. This finding prompted us to further enhance the usual heterogeneous aspiration cases for heterogeneous network topologies. We find that a negative correlation between degree and aspiration level does extend cooperation among heterogeneously structured agents.

Revisiting mouse peritoneal macrophages: heterogeneity, development and function

Directory of Open Access Journals (Sweden)

Alexandra Dos Anjos Cassado

2015-05-01

Full Text Available Tissue macrophages play a crucial role in the maintenance of tissue homeostasis and also contribute to inflammatory and reparatory responses during pathogenic infection and tissue injury. The high heterogeneity of these macrophages is consistent with their adaptation to distinct tissue environments and specialization to develop niche-specific functions. Although peritoneal macrophages are one of best-studied macrophage populations, only recently it was demonstrated the co-existence of two subsets in mouse PerC, which exhibit distinct phenotypes, functions and origins. These macrophage subsets have been classified according to their morphology as LPMs (large peritoneal macrophages and SPMs (small peritoneal macrophages. LPMs, the most abundant subset under steady-state conditions, express high levels of F4/80 and low levels of class II molecules of the major histocompatibility complex (MHC. LPMs appear to be originated from embriogenic precursors, and their maintenance in PerC is regulated by expression of specific transcription factors and tissue-derived signals. Conversely, SPMs, a minor subset in unstimulated PerC, have a F4/80lowMHC-IIhigh phenotype and are generated from bone-marrow-derived myeloid precursors. In response to infectious or inflammatory stimuli, the cellular composition of PerC is dramatically altered, where LPMs disappear and SPMs become the prevalent population together with their precursor, the inflammatory monocyte. SPMs appear to be the major source of inflammatory mediators in PerC during infection whereas LPMs contribute for gut-associated lymphoid tissue (GALT-independent and retinoic acid-dependent IgA production by peritoneal B-1 cells. In the last years, considerable efforts have been made to broaden our understanding of LPM and SPM origin, transcriptional regulation and functional profile. This review addresses these issues, focusing on the impact of tissue-derived signals and external stimulation in the complex

Aportaciones a la flora Granatense, III

OpenAIRE

Martínez Parras, J.Mª.; Molero Mesa, J.

1983-01-01

Se comentan algunas especies nuevas o críticas para la provincia de Granada. Se establecen las nuevas combinaciones siguientes: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa y Cerastium alpinum subsp. nevadense (Pau) Martínez Parras & Molero Mesa. In this paper, some plants from Granada province are studied. The following new combinations are stablished: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa and Cerastium alpinum subsp. ...

Doble difusión a partir de mediciones de microestructura en los canales Martínez y Baker, Patagonia chilena central (47,85°S

Directory of Open Access Journals (Sweden)

Iván Pérez-Santos

2013-03-01

Full Text Available Con un microperfilador SCAMP (Self Contained Autonomous MicroProfile se detectó un proceso de Doble Difusión Convectiva (DDC, en los canales Martínez y Baker de la Patagonia central, Chile. Este perfilador midió temperatura y salinidad en la columna de agua con una resolución del orden de milímetros. El muestreo se efectuó en diciembre 2011, en 19 estaciones oceanográficas de ~55 m de profundidad. Los registros del microperfilador permitieron detectar la formación de escaleras termohalinas que caracterizan la formación de la DDC. Por medio del ángulo de Turner se confirmó que debajo de una capa superficial fuertemente estratificada (7-10 m se registraron eventos de DDC a profundidades entre 15 y 45 m. La DDC fue débil en la mayoría de los registros pero se evidenciaron eventos fuertes entre 15 y 40 m. En la capa subsuperficial, su origen se debió al intercalamiento de las masas aguas estuarinas (aguas frías y menos saladas encima de las oceánicas (aguas más cálidas y saladas, mientras que en la superficie la interacción océano-atmósfera favoreció su ocurrencia. La DDC en conjunto con el viento, las mareas y las ondas internas, puede constituir un mecanismo importante para la mezcla vertical, influenciando los flujos de calor, el hábitat de las especies marinas en estas profundidades y la exportación de carbono hacia los sedimentos.

From event analysis to global lessons: disaster forensics for building resilience

Science.gov (United States)

Keating, Adriana; Venkateswaran, Kanmani; Szoenyi, Michael; MacClune, Karen; Mechler, Reinhard

2016-07-01

With unprecedented growth in disaster risk, there is an urgent need for enhanced learning and understanding of disasters, particularly in relation to the trends in drivers of increasing risk. Building on the disaster forensics field, we introduce the post-event review capability (PERC) methodology for systematically and holistically analysing disaster events, and identifying actionable recommendations. PERC responds to a need for learning about the successes and failures in disaster risk management and resilience, and uncovers the underlying drivers of increasing risk. We draw generalisable insights identified from seven applications of the methodology to date, where we find that across the globe policy makers and practitioners in disaster risk management face strikingly similar challenges despite variations in context, indicating encouraging potential for mutual learning. These lessons highlight the importance of integrated risk reduction strategies. We invite others to utilise the freely available PERC approach and contribute to building a repository of learning on disaster risk management and resilience.

A Novel Role for C5a in B-1 Cell Homeostasis

Directory of Open Access Journals (Sweden)

Katharina Bröker

2018-02-01

Full Text Available B-1 cells constitute a unique subpopulation of lymphocytes residing mainly in body cavities like the peritoneal cavity (PerC but are also found in spleen and bone marrow (BM. As innate-like B cells, they mediate first line immune defense through low-affinity natural IgM (nIgM antibodies. PerC B-1 cells can egress to the spleen and differentiate into nIgM antibody-secreting plasma cells that recognize conserved exogenous and endogenous cellular structures. Homing to and homeostasis within the PerC are regulated by the chemokine CXCL13 released by PerC macrophages and stroma cells. However, the exact mechanisms underlying the regulation of CXCL13 and B-1 homeostasis are not fully explored. B-1 cells play important roles in the inflammatory response to infection, autoimmunity, ischemia/reperfusion injury, obesity, and atherosclerosis. Remarkably, this list of inflammatory entities has a strong overlap with diseases that are regulated by complement suggesting a link between B-1 cells and the complement system. Interestingly, up to now, no data exist regarding the role of complement in B-1 cell biology. Here, we demonstrate for the first time that C5a regulates B-1 cell steady-state dynamics within the peritoneum, the spleen, and the BM. We found decreased B-1a cell numbers in the peritoneum and the spleen of C5aR1−/− mice associated with increased B1-a and B1-b numbers in the spleen and high serum titers of nIgM antibodies directed against phosphorylcholine and several pneumococcal polysaccharides. Similarly, peritoneal B-1a cells were decreased in the peritoneum and splenic B-1a and B-1b cells were increased in C5aR2−/− mice. The decrease in peritoneal B-1 cell numbers was associated with decreased peritoneal CXCL13 levels in C5aR1−/− and C5aR2−/− mice. In search for mechanisms, we found that combined TLR2 and IL-10 receptor activation in PerC macrophages induced strong CXCL13 production, which was significantly reduced in cells

El espejismo nacional-socialista. La relación entre dos catedráticos de Prehistoria, Oswald Menghin y Julio Martínez Santa-Olalla (1935-1952

Directory of Open Access Journals (Sweden)

Mederos Martín, Alfredo

2014-12-01

, Claudio Sanchez-Albornoz. Menghin was not permitted to give lectures until 1953, and only consolidated his position when his criminal trial was cancelled in December 1956. In 1957 at the age of 69, he obtained the position of Acting Professor of Prehistory at the National University of La Plata. In 1958, Menghin was appointed Professor in General and Old World Prehistory at the University of Buenos Aires, where he retired in 1968, aged 80.Oswald Menghin, Catedrático de Prehistoria del Hombre de la Universidad de Viena entre 1922-1945, fue partidario de la unidad de Austria con Alemania y simpatizante con ideas del NSDAP sobre la necesidad de evitar una mezcla racial entre arios y judíos. Durante su etapa como Catedrático-Residente en la Universidad de Fouad en El Cairo entre 1930-1933, por contacto con Hermann Junker, radicalizó sus puntos de vista y redactó su libro Espíritu y sangre. Principios básicos de raza, lengua, cultura y nación. Su etapa como Rector en el curso 1935-1936 le catapultó a la política como miembro del consejo directivo del partido fascista austriaco, Vaterländische Front, entre 1936-1937 y su posterior nombramiento como Ministro de Educación entre marzo y mayo de 1938, justo después de la invasión de Hitler de Austria. Siendo Ministro, solicitó su ingreso en el NSDAP, que no se aceptó hasta junio de 1940, por su pertenencia previa a organizaciones católicas secretas. Menghin entró en contacto con Martínez Santa-Olalla, después de la celebración del Jubileo del Instituto de Morfología Cultural de Frankfurt en junio y julio de 1938. A raíz de una estancia de investigación de Almagro Basch en Alemania y Austria en enero y febrero de 1942, y la posterior visita a Barcelona de Menghin en junio de 1942, optó por distanciarse de Martínez Santa-Olalla, no visitando Madrid, cortando la relación epistolar e informando negativamente sobre él a las SS-Ahnenerbe. Prisionero en dos campos de concentración norteamericanos entre mayo de

Lessons Learned from Creating the Public Earthquake Resource Center at CERI

Science.gov (United States)

Patterson, G. L.; Michelle, D.; Johnston, A.

2004-12-01

The Center for Earthquake Research and Information (CERI) at the University of Memphis opened the Public Earthquake Resource Center (PERC) in May 2004. The PERC is an interactive display area that was designed to increase awareness of seismology, Earth Science, earthquake hazards, and earthquake engineering among the general public and K-12 teachers and students. Funding for the PERC is provided by the US Geological Survey, The NSF-funded Mid America Earthquake Center, and the University of Memphis, with input from the Incorporated Research Institutions for Seismology. Additional space at the facility houses local offices of the US Geological Survey. PERC exhibits are housed in a remodeled residential structure at CERI that was donated by the University of Memphis and the State of Tennessee. Exhibits were designed and built by CERI and US Geological Survey staff and faculty with the help of experienced museum display subcontractors. The 600 square foot display area interactively introduces the basic concepts of seismology, real-time seismic information, seismic network operations, paleoseismology, building response, and historical earthquakes. Display components include three 22" flat screen monitors, a touch sensitive monitor, 3 helicorder elements, oscilloscope, AS-1 seismometer, life-sized liquefaction trench, liquefaction shake table, and building response shake table. All displays include custom graphics, text, and handouts. The PERC website at www.ceri.memphis.edu/perc also provides useful information such as tour scheduling, ask a geologist, links to other institutions, and will soon include a virtual tour of the facility. Special consideration was given to address State science standards for teaching and learning in the design of the displays and handouts. We feel this consideration is pivotal to the success of any grass roots Earth Science education and outreach program and represents a valuable lesson that has been learned at CERI over the last several

Lung structure and function relation in systemic sclerosis: Application of lung densitometry

Energy Technology Data Exchange (ETDEWEB)

Ninaber, Maarten K., E-mail: m.k.ninaber@lumc.nl [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Stolk, Jan; Smit, Jasper; Le Roy, Ernest J. [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Kroft, Lucia J.M. [Department of Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Els Bakker, M. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Vries Bouwstra, Jeska K. de; Schouffoer, Anne A. [Department of Rheumatology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Staring, Marius; Stoel, Berend C. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands)

2015-05-15

Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides

Lung structure and function relation in systemic sclerosis: Application of lung densitometry

International Nuclear Information System (INIS)

Ninaber, Maarten K.; Stolk, Jan; Smit, Jasper; Le Roy, Ernest J.; Kroft, Lucia J.M.; Els Bakker, M.; Vries Bouwstra, Jeska K. de; Schouffoer, Anne A.; Staring, Marius; Stoel, Berend C.

2015-01-01

Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides

Site characterization plan overview: reference repository location, Hanford Site, Washington: Consultation draft: Nuclear Waste Policy Act (Section 113)

International Nuclear Information System (INIS)

1988-01-01

As part of the process for siting the nation's first geologic repository for radioactive waste, the Department of Energy (DOE) is preparing a site characterization plan for the Hanford site in Benton County, Washington. As a step in the preparation of that plan, the DOE has provided, for information and review, a consultation draft of the plan to the State of Washington, the affected Indian Tribes - the Confederated Tribes of the Umatilla Indian Reservation, the Nez Perce Indian Tribe, and the Yakima Indian Nation - and the US Nuclear Regulatory Commission. The Hanford site is one of three sites that the DOE currently plans to characterize;the other sites are the Deaf Smith County site in Texas and the Yucca Mountain site in Nevada. After site characterization has been completed and its results evaluated, the DOE will identify from among the three characterized sites the site that is preferred for the repository. The overview presented here consists of brief summaries of important topics covered in the consulation draft of the site characterization plan;it is not a substitute for the site characterization plan. The arrangement of the overview is similar to that of the plan itself, with breif descriptions of the dispoal system - the site, the repository, and the waste package - preceding the discussion of the characterization program to be carried out at the Hanford site. It is intended primarily for the management staff of organizations involved in the DOE's repository program or other persons who might wish to understand the general scope of the site-characterization program, the activities to be conducted, and the facilities to be constructed rather than the technical details of site characterization

Johnson Creek Artificial Propagation and Enhancement Project Operations and Maintenance Program; Brood Year 1998: Johnson Creek Chinook Salmon Supplementation, Biennial Report 1998-2000.

Energy Technology Data Exchange (ETDEWEB)

Daniel, Mitch; Gebhards, John

2003-05-01

The Nez Perce Tribe, through funding provided by the Bonneville Power Administration, has implemented a small scale chinook salmon supplementation program on Johnson Creek, a tributary in the South Fork of the Salmon River, Idaho. The Johnson Creek Artificial Propagation Enhancement project was established to enhance the number of threatened Snake River summer chinook salmon (Oncorhynchus tshawytscha) returning to Johnson Creek through artificial propagation. Adult chinook salmon collection and spawning began in 1998. A total of 114 fish were collected from Johnson Creek and 54 fish (20 males and 34 females) were retained for Broodstock. All broodstock were transported to Lower Snake River Compensation Plan's South Fork Salmon River adult holding and spawning facility, operated by the Idaho Department of Fish and Game. The remaining 60 fish were released to spawn naturally. An estimated 155,870 eggs from Johnson Creek chinook spawned at the South Fork Salmon River facility were transported to the McCall Fish Hatchery for rearing. Average fecundity for Johnson Creek females was 4,871. Approximately 20,500 eggs from females with high levels of Bacterial Kidney Disease were culled. This, combined with green-egg to eyed-egg survival of 62%, resulted in about 84,000 eyed eggs produced in 1998. Resulting juveniles were reared indoors at the McCall Fish Hatchery in 1999. All of these fish were marked with Coded Wire Tags and Visual Implant Elastomer tags and 8,043 were also PIT tagged. A total of 78,950 smolts were transported from the McCall Fish Hatchery and released directly into Johnson Creek on March 27, 28, 29, and 30, 2000.

Evaluation of available MHD seed-regeneration processes on the basis of energy considerations

International Nuclear Information System (INIS)

Sheth, A.C.; Johnson, T.R.

1978-09-01

Of the several processes described in the literature that are capable of separating sulfur from alkali-metal sulfates, seven processes were selected as candidates for regenerating seed material for reuse in open-cycle MHD. After a brief assessment of each process, two were selected for a detailed analysis, namely, a process developed by the Pittsburgh Energy Research Center (PERC) and a modified version of the Tampella process. The processes were compared on the bases of energy requirements and the amount of research work needed to develop a seed-regeneration process for MHD systems. The energy requirements given should be considered as rough values, because factors such as heat losses and component efficiency were not included in the analysis. On the basis of energy consumption, the PERC process has a slight advantage over the Tampella process; on the basis of the present state of development of various components, the Tampella process has a clear advantage. Accordingly, it was recommended that developmental programs be carried out for both the PERC and Tampella processes

PERCEÇÕES SOBRE AS ABORDAGENS À APRENDIZAGEM – ESTUDO DE VARIÁVEIS PSICOLÓGICAS

OpenAIRE

Lourenço, Abílio Afonso; Nogueira, Carla Maria Leite

2014-01-01

Esta investigação, realizada numa escola básica no norte de Portugal, tem como objetivo analisar as perceções que os alunos apresentam sobre algumas variáveis relativas à forma como desenvolvem a sua aprendizagem, nomeadamente: a autorregulação para a aprendizagem; os processos de estudo utilizados; o controlo volitivo; a planificação da gestão do tempo; e a procrastinação. Outra finalidade deste estudo éverificar se existe uma relação significativa entre estas variáveis e a perceção de autoe...

Influência da auto-percepção do envelhecimento e dos traços de personalidade na satisfação com a reforma

OpenAIRE

Fragoso, Nuno Miguel do Rosário Mendes

2013-01-01

Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2013 O presente trabalho foca-se no estudo da influência da auto-perceção do envelhecimento e dos traços de personalidade na satisfação com a reforma, numa amostra de idosos oriundos da comunidade e sem psicopatologia diagnosticada. Tem como objetivos: (1) analisar a auto-perceção do envelhecimento, os traços de personalidade e a s...

Recordando y descubriendo a Gala, la última descendiente de Rosalía de Castro

OpenAIRE

García Vega, Lucía

2015-01-01

Recientemente, se ha cumplido medio siglo del fallecimiento de Gala Martínez de Castro (1871-1964), último miembro de la familia ilustre fundada por la escritora Rosalía de Castro (1837-1885) y el historiador Manuel Martínez Murguía (1833-1923). A tr

Young Idea People Mix with Old Idea People to Make the World Better

Science.gov (United States)

Hall, M.

2017-12-01

Groups of young idea people come to eat, drink, and talk about new ideas that old idea people are working on to change the world for the better. The ideas may fix our body and mind, make our lives easier or harder, and more. The young idea people lead, learn, listen and act, so they can become old idea people. The young idea people scare the old idea people because their ideas are different. And, sometimes, the young idea people have new ideas that the old idea people have not thought about. When this happens it makes the old idea people happy and better at their work. The old idea people get to go places and share their ideas around the world. They make good money and have fun lives. They write about their work and can be well known, or not. The young idea people learn from the old idea people how they can be like them. Together the young and old idea people build things and talk about crazy ideas that may come to be. Sometimes the old idea people talk too much and don't listen. They use big words that can be hard to understand. But, the young idea people help them learn to use known words so everyone learns. We know the young idea people learn and grow from this act and they grow happier about their life. We also know that the old idea people get happy that the young idea people are so bright.

Different behavioral effect dose–response profiles in mice exposed to two-carbon chlorinated hydrocarbons: Influence of structural and physical properties

International Nuclear Information System (INIS)

Umezu, Toyoshi; Shibata, Yasuyuki

2014-01-01

The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles

Different behavioral effect dose–response profiles in mice exposed to two-carbon chlorinated hydrocarbons: Influence of structural and physical properties

Energy Technology Data Exchange (ETDEWEB)

Umezu, Toyoshi, E-mail: umechan2@nies.go.jp; Shibata, Yasuyuki, E-mail: yshibata@nies.go.jp

2014-09-01

The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles.

People's Education (for People's Power)--A Promise Unfulfilled

Science.gov (United States)

Mathebula, Thokozani

2013-01-01

The central feature of Athenian citizens' rights, that is, people's participation in government, is also enshrined in the South African Constitution. This article argues for the Athenian style of participatory democracy as a viable model of participation in governing South African schools. The author claims that "people's education",…

Effect of extrusion parameters on some properties of dietary fiber ...

African Journals Online (AJOL)

use

2011-11-21

Nov 21, 2011 ... Méndez-García, S.1, Martínez-Flores, H.E.2* and Morales-Sánchez, E.3. 1Student of ... product (Sánchez-Alonso et al., 2007), coconut fiber ..... Rodríguez R, Jiménez A, Fernández-Bolaños J, Guillén R, Heredia A. (2006).

Comparative study of laterality in people with fragile X syndrome, people with intellectual disabilities, and people with typical development.

Science.gov (United States)

Niort, Jannick; Hernández Vázquez, Francisco Javier

2017-07-01

Following on from the studies by McManus and Cornish [(1997). Fractionating handedness in mental retardation: What is the role of the cerebellum? Laterality, 2(2), 81-89] and Cornish, Pigram, and Shaw [(1997). Do anomalies of handedness exist in children with fragile-X syndrome? Laterality, 2(2), 91-101], the aim of this paper was to determine laterality in people with fragile X syndrome (FXS). The sample comprised three study groups: the first with 30 people with FXS (mean age 17.9 years), the second 34 people with various intellectual disabilities (ID, mean age 20.9 years), and the third 160 people with typical development (mean age 14.7 years). Laterality was assessed with a test adapted for this study. The results confirm the preponderance of right-handedness (93.3%) in people with FXS and present new data regarding footedness and sensory dominance (eyedness and earedness), indicating inconsistent footedness and ocular cross-dominance. Almost three-quarters (73.5%) of people with other ID were right-handed. The results corroborate those of McManus and Cornish (1997). People with FXS tend to be right-handed but have ocular cross-dominance.

A la costa de Luis A. Martínez: ¿la defensa de un proyecto liberal para Ecuador?

Directory of Open Access Journals (Sweden)

1998-01-01

Full Text Available A LA COSTA DE LUIS A. MARTINEZ : LA DEFENSE D’UN PROJET LIBERAL POUR L’ÉQUATEUR ? A la Costa est souvent analysé comme une peinture de moeurs, témoignage de la réalité sociale et politique de l´Équateur de la fin du XIX et du début du XX. En effet, ce roman prétend décrire le conflit traditionnel qui oppose socialement, économiquement et politiquement les Andes et la Côte. Mais il se présente aussi et surtout comme la défense d´un projet libéral pour l´Équateur et développe une démonstration idéologique systématique. En outre, il propose une lecture du sens de la vie et une réflexion sur le devenir de l´homme dont la portée dépasse largement l´argumentation idéologique. Ce sont sans aucun doute ces nuances, introduites tout au long de la narration, qui permettent à l´oeuvre d´échapper à son statut exemplaire, simple témoignage d´une époque, pour proposer une vision personnelle et créative. Muchos han visto en A la Costa una novela de tendencia costumbrista, testimonio de la realidad social y política del Ecuador a finales del siglo XIX y comienzos del XX. En efecto, la novela pretende describir el conflicto tradicional social, económico, político entre Sierra y Costa. Pero es también, y ante todo, la defensa de un proyecto liberal para Ecuador, desarrollando una sistemática demostración ideológica. Además, propone una lectura del sentido de la vida y una reflexión sobre el porvenir del hombre cuyo alcance va más allá de la defensa de un proyecto ideológico. Sin duda son estos matices, introducidos a lo largo de la narración, los que permiten que la obra escape del estatuto de novela ejemplar y testimonial para proponer una visión autónoma y creativa. THE NOVEL A LA COSTA OF LUIS A. MARTÍNEZ: THE DEFENSE OF A LIBERAL PROJECT FOR ECUADOR? The novel A la Costa has often been analyzed as a portrait of national costumes, a testimony to the social and political realities of Ecuador at the end of

Analysis of Volatile Organic and Sulfur Compounds in Air Near a Pulp Paper Mill in North-Central Idaho

Science.gov (United States)

Johnston, N. A. C.; Bundy, B. A.; Andrew, J. P.; Grimm, B. K.; Ketcherside, D.; Rivero-Zevallos, J. A.; Uhlorn, R. P.

2017-12-01

Lewiston, Idaho is a small city in the Snake River Valley bordering North-Central Idaho and Southeastern Washington, with a population of over 40,000 including the surrounding areas. One of the main industries and employers in the region is a kraft paper mill in North Lewiston, which results in odorous levels of sulfur air pollutants there. The Idaho Department of Environmental Quality has an air monitoring station in Lewiston but measures only air particulate matter (PM). Surprisingly, not much long-term data exists on this area for specific air constituents such as volatile organics, hazardous air pollutants, and sulfur compounds. One year-long study conducted in 2006-2007 by the Nez Perce Tribe found high formaldehyde levels in the area, and warranted further study in July of 2016-2017. Our ongoing study began in the fall of 2016 and investigates the seasonal air composition in the Lewiston area. Specifically, active air sampling via sorbent tubes and analysis by thermal desorption gas chromatography-mass spectrometry (TD-GC-MS). was utilized to measure over 50 volatile organic compounds, hazardous air pollutants, and sulfurous compounds in ambient air (adapted from EPA Method TO-17). Seasonal, diurnal, and spatial variations in air composition were explored with weekly to monthly grab sampling. Dimethyl sulfide (DMS) and dimethyl disulfide (DMDS) were the primary sulfur compounds detected, and these varied considerably depending on time of day, season, location and meteorology. DMS was more prevalent in the summer months, while DMDS was more prevalent in the spring. Elevated concentrations of benzene and chloroform were found in the region during 2017, with average values of short term grab samples over three times the acceptable ambient concentrations in Idaho. These levels did not persist during longer term sampling of 12-hours, however further monitoring is needed to assess a potential health concern.

Columbia River system operation review. Final environmental impact statement

International Nuclear Information System (INIS)

1995-11-01

The Columbia River and its tributaries are the primary water system in the Pacific Northwest, draining some 219,000 square miles in seven states and another 39,500 square miles in British Columbia. Beginning in the 1930's, the Columbia River has been significantly modified by construction of 30 major dams on the river and its tributaries, along with dozens of non-Federal projects. Construction and subsequent operation of these water development projects have contributed to eight primary uses of the river system, including navigation, flood control, irrigation, electric power generation, fish migration, fish and wildlife habitat, recreation, and water supply and quality considerations. Increasing stress on the water development of the Columbia River and its tributaries has led primary Federal agencies to undertake intensive analysis and evaluation of the operation of these projects. These agencies are the U.S. Army Corps of Engineers and the Bureau of Reclamation, who operate the large Federal dams on the river, and the Bonneville Power Administration who sells the power generated at the dams. This review, termed the System Operation Review (SOR), has as its ultimate goal to define a strategy for future operation of the major Columbia River projects which effectively considers the needs of all river uses. This volume, Appendix D: Cultural resources appendix, Technical imput includes the following: Development of geomorphology based framework for cultural resources management, Dworshak Reservoir, Idaho; Impact profiles for SOR reservoirs; comments from the following Native American tribes: Burns Paiute Tribe; Coville Confederated Tribes; Confederated Tribes of the Warm Springs Indian Reservation; Confederated Tribes and bands of the Yakama Indian Nation (comments); Nez Perce Tribe; Coeur D'Alene Tribe; Spokane Tribe of Indians; The confederated Tribes of the Umatilla Indian Reservation

Columbia River System Operation Review : Final Environmental Impact Statement, Appendix D: Exhibits.

Energy Technology Data Exchange (ETDEWEB)

Columbia River System Operation Review (U.S.)

1995-11-01

The Columbia River and its tributaries are the primary water system in the Pacific Northwest, draining some 219,000 square miles in seven states and another 39,500 square miles in British Columbia. Beginning in the 1930`s, the Columbia River has been significantly modified by construction of 30 major dams on the river and its tributaries, along with dozens of non-Federal projects. Construction and subsequent operation of these water development projects have contributed to eight primary uses of the river system, including navigation, flood control, irrigation, electric power generation, fish migration, fish and wildlife habitat, recreation, and water supply and quality considerations. Increasing stress on the water development of the Columbia River and its tributaries has led primary Federal agencies to undertake intensive analysis and evaluation of the operation of these projects. These agencies are the U.S. Army Corps of Engineers and the Bureau of Reclamation, who operate the large Federal dams on the river, and the Bonneville Power Administration who sells the power generated at the dams. This review, termed the System Operation Review (SOR), has as its ultimate goal to define a strategy for future operation of the major Columbia River projects which effectively considers the needs of all river uses. This volume, Appendix D: Cultural resources appendix, Technical imput includes the following: Development of geomorphology based framework for cultural resources management, Dworshak Reservoir, Idaho; Impact profiles for SOR reservoirs; comments from the following Native American tribes: Burns Paiute Tribe; Coville Confederated Tribes; Confederated Tribes of the Warm Springs Indian Reservation; Confederated Tribes and bands of the Yakama Indian Nation (comments); Nez Perce Tribe; Coeur D`Alene Tribe; Spokane Tribe of Indians; The confederated Tribes of the Umatilla Indian Reservation.

people | News

Science.gov (United States)

of Communication Fermilab news Search Useful links Symmetry magazine Interactions Interact people , people, building, Wilson Hall, farm, planter A John Deere planter is ready for work. Josh Frieman takes the experiment for the next two years. Controlled burn at Pine Street entrance May 9, 2018 Ryan

Daily insulin requirement of children and adolescents with type 1 diabetes: effect of age, gender, body mass index and mode of therapy.

Science.gov (United States)

Wiegand, Susanna; Raile, Klemens; Reinehr, Thomas; Hofer, Sabine; Näke, Andrea; Rabl, Wolfgang; Holl, Reinhard W

2008-04-01

The purpose of this study was to generate insulin dose (ID) percentiles for children and adolescents with type 1 diabetes mellitus (DM1) having the opportunity to assess this important parameter in relation to age and sex. Daily IDs per weight (ID/kg) were recorded in 22,177 patients with DM1 (3-25 years of age, DM1 duration of more than 2 years, 48% female) and ID percentiles (ID-Perc) were created statistically. The ID-Perc were compared between male and female, and between multiple insulin injection therapy (MIT) and continuous s.c. insulin infusion (CSII). A multivariate regression analysis was performed for ID in the third year of DM1 with ID/kg, body weight, age, gender, and insulin delivery regimen as variables. The 50th ID-Perc (P50) varied among 0.67 IU/kg (age 3 years), 0.93 IU/kg (13 years), and 0.70 IU/kg (23 years) increasing from early childhood to adolescence and decreasing toward adulthood. Highest P50 ID was found at 12 years in females (0.94 IU/kg) and at 14 years in males (0.92 IU/kg). Using ICT, the ID was significantly higher compared with CSII (P50: 0.94 IU/kg versus 0.79 IU/kg at 13 years). In multivariate regression analysis, ID was significantly (P>0.001) associated with age, gender, and insulin delivery regime. The ID-Perc were significantly different during various periods of childhood and were influenced by gender, body weight, and insulin injection regimes. Therefore, the presented data 1) provide evidence to interpret individual ID in children and adolescents with DM1 and 2) more specifically identify children with unusually high (insulin resistance and non-compliance) or low (MODY and persistent remission) insulin requirement.

People\\'s Participation in Rural Development: The Examples from ...

African Journals Online (AJOL)

People\\'s Participation in Rural Development: The Examples from Mafikeng. PG Mpolokeng. Abstract. No Abstract Available African Journal of Political Science Vol.8(2) 2003: 55-86. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Article Metrics. Metrics Loading .

People Experiencing Chronic Homelessness

Science.gov (United States)

... People with Disabilities Share Ending Chronic Homelessness Among People with Disabilities Last updated on May 31, 2018 We can end homelessness for people with disabilities in our communities who experience recurring ...

China's People-to-people Diplomacy and Its Importance to China-EU Relations: A Historical Institutionalism Perspective

Directory of Open Access Journals (Sweden)

Shichen Wang

2015-12-01

Full Text Available People-to-people exchange has become a heated topic of the Chinese foreign policy. Since the beginning of the twenty-first century, China has established people-to-people dialogues with the United States, the European Union, the United Kingdom, France and Russia. In 2012, China and the EU established a high-level dialogue for people-to-people exchange, making people-to-people exchange the third pillar of China-EU relations. However, China is not a newcomer to people-to-people exchanges with Europe. Why does China launch the people-to-people diplomacy? Is it a plus or a must for China as well as for China-EU relations? The author reviews the history and current situation of China's people-to-people exchange and investigates China’s motivations behind the policy. Using the historical institutionalism as an approach, this paper argues that people-to-people diplomacy is a key component of the contemporary Chinese foreign policy towards Europe. China has long been an unequal counterpart to Europe since the 1840s. After the development of bilateral political and economic cooperation in the past four decades, people-to-people diplomacy is the last part that China needs to finish in order to regain equal status with Europe. In addition, it is also a step towards realising the "great rejuvenation of the Chinese nation".

Los novatores como etapa histórica

Directory of Open Access Journals (Sweden)

Antonio MESTRE

2009-11-01

Full Text Available Los trabajos de Cenai sobre la historia de la filosofía española del siglo XVII y, en concreto, sobre la presencia de los filósofos modernos, encontraron una sorprendente constatación en el libro de O. V. Quiroz-Martínez. En 1949 aparecía La introducción de la filosofía moderna en España de la autora mexicana. Quiroz- Martínez estudiaba unos años muy complejos del pensamiento español: desde la aparición de la Philosofía libera de Isaac Cardoso (1673 hasta el Ocaso de las formas aristotélicas de Mateo Zapata (1745. Ahora bien, si el tema esencial era la filosofía, dada la implicación de la escolástica con la física aristotélica, la introducción de la filosofía moderna (Descartes o Gassendi provocaba las alusiones a cuestiones científicas. Así lo reconoce Quiroz-Martínez, cuando escribe: «Todas estas obras (de Tosca, Berní, Martín Martínez son favorables a la física moderna».

Little People of America

Science.gov (United States)

... information. World Dwarf Games 2017 Welcome to Little People of America Little People of America (LPA) is a nonprofit organization that provides support and information to people of short stature and their families. LPA is ...

Socioeconomic conditions in cultural communities: The Nez Perce Tribe, the confederated Tribes of the Umatilla Indian Reservation and the confederated tribes and bands of the Yakima Indian Nation: Interim profile report

International Nuclear Information System (INIS)

Stokowski, P.A.; Friedli, E.A.

1987-11-01

A series of BWIP Socioeconomic Profile Reports are being prepared. This report is one of the first set of five separate BWIP Profile Reports, which cover: economic/demographic conditions; fiscal conditions; housing characteristics; public services and facilities; and socioeconomic conditions in cultural communities. The BWIP Socioeconomic Profile Reports are designed to provide information about the characteristics of the communities in which socioeconomic impacts from BWIP may occur. The Profile Reports present a compilation of historical information about socioeconomic conditions in the affected communities. These reports are designed to provide a transition between the BWIP EA, published in 1986, the Monitoring Reports, and other technical reports associated with the BWIP SMMP and CSP. The principal objectives of the Profile Reports are to update the DOE BWIP socioeconomic database by compiling available secondary and primary data and to make this information available to both the DOE program and other interested parties. The initial Profile Reports will help identify the need for additional data. The database developed for the profiles will assemble socioeconomic data in a uniform, readily accessible format. 16 refs., 1 fig., 17 tabs

Organizing homeless people

DEFF Research Database (Denmark)

Anker, Jørgen

2008-01-01

People who are homeless belong to some of the most vulnerable, dispersed and disorganized groups in welfare societies. Yet in 2001, a national interest organization of homeless people was formed for the first time in Denmark. This article identifies the processes that facilitated the formation...... of the organization. It focuses on the importance of ideological and institutional conditions and changes, and it stresses the importance of alliances between progressive actors in the field and in the political-administrative system, in addition to the presence of dedicated activists among people who are or have...... been homeless. The analysis may thus serve as a case of inspiration for activists and professionals who want to improve homeless people's opportunities for participation in other national settings....

People into Employment: supporting people with disabilities and carers into work.

Science.gov (United States)

Arksey, Hilary

2003-05-01

Carers and people with disabilities are two disadvantaged groups at risk of social exclusion. Work is an important route to social inclusion, but carers and people with disabilities are under-represented in the work force. The present paper reports key findings from a new study that evaluated People into Employment (PIE), a pilot employment project in the north-east of England designed to support people with disabilities, carers and former carers in gaining mainstream work. The study aimed to identify what clients, partner agencies and employers perceived to be PIE's most important services, its strengths and areas where there was scope for further development. The study collected quantitative and qualitative data at the mid-point and at the end of the project through two questionnaire surveys, and interviews with PIE clients, the project development officer, partner agencies and employers. Drawing on the 'pathway model', the findings show that PIE's interventions included mobilising, matching, mediating and supporting activities. Key ingredients in PIE's success include: tailor-made job-search activities and training; adjusting the pace at which people move towards sustained employment; recognising and responding to the differing needs of people with disabilities, carers and former carers; confidence boosting; accompanying clients to job interviews; good job matching; and ongoing practical and emotional support for both clients and employers. Rudimentary calculations suggest that the cost per job to the project is less than the cost per job for large national projects. Overall, these findings illustrate how access to employment via flexible job-search services geared up to the local labour market can successfully promote social inclusion for carers and people with disabilities.

Policing Transgender People

Directory of Open Access Journals (Sweden)

Toby Miles-Johnson

2015-04-01

Full Text Available Police policy documents often articulate strategies and approaches that police organizations want to implement in their efforts to break down barriers with minority groups. However, most police policy documents are written for police audiences and not for members of the public. Police policy documents serve as a reflection of the aspirations of the agency and not necessarily the practice of the officers. Differential policing has been a salient experience for members of transgender communities because, as individuals who express gender in ways that deviate from the norm, they have experienced numerous documented cases of police mismanaged practice. In Australia, achieving police reform in the area of policing of diverse community groups has been difficult as new initiatives implemented to educate police officers about diverse groups such as transgender communities are scarce. My study sought to analyze a police policy document to assess how one police agency’s policy aspires to shape police contact/experiences with transgender people and how this document might shape intergroup identity differences between transgender people and the police. It is argued that the policy document will negatively affect police perceptions of transgender people and may enhance adverse perceptions of intergroup difference between police and transgender people. I also argue that using this document to achieve police reform in the area of policing of transgender people will be problematic as the policy document lacks substantial procedural guidelines regarding interaction with transgender people and may not favorably constrain discretionary police power.

Introduction: people at work

NARCIS (Netherlands)

Peeters, M.C.W.; Jonge, de J.; Taris, A.W.; Peeters, M.; Jonge, de J.; Taris, T.

2014-01-01

For as long as mankind has existed, people have worked. Needless to say the nature of work has changed tremendously: our ancestors were mostly hunters and collectors, nowadays people work with data, ‘goods’ or other people, or provide services. What has not changed is that we still spend a

Motivated mind perception: treating pets as people and people as animals.

Science.gov (United States)

Epley, Nicholas; Schroeder, Juliana; Waytz, Adam

2013-01-01

Human beings have a sophisticated ability to reason about the minds of others, often referred to as using one's theory of mind or mentalizing. Just like any other cognitive ability, people engage in reasoning about other minds when it seems useful for achieving particular goals, but this ability remains disengaged otherwise. We suggest that understanding the factors that engage our ability to reason about the minds of others helps to explain anthropomorphism: cases in which people attribute minds to a wide range of nonhuman agents, including animals, mechanical and technological objects, and supernatural entities such as God. We suggest that engagement is guided by two basic motivations: (1) the motivation to explain and predict others' actions, and (2) the motivation to connect socially with others. When present, these motivational forces can lead people to attribute minds to almost any agent. When absent, the likelihood of attributing a mind to others, even other human beings, decreases. We suggest that understanding the factors that engage our theory of mind can help to explain the inverse process of dehumanization, and also why people might be indifferent to other people even when connecting to them would improve their momentary wellbeing.

The 100 People Project

Science.gov (United States)

McLeod, Keri

2007-01-01

This article describes the 100 People Project and how the author integrates the project in her class. The 100 People Project is a nonprofit organization based in New York City. The organization poses the question: If there were only 100 people in the world, what would the world look like? Through the project, students were taught about ethics in…

Pablo Rodríguez Jiménez. Cartas de Amor en tiempos de guerra. Rafael Uribe Uribe. Selección de textos y prólogo. Bogotá: Editorial Universidad del Rosario, Escuela de Ciencias Humanas, 2014. 256 páginas

Directory of Open Access Journals (Sweden)

Eulalia Hernández Ciro

2015-07-01

Full Text Available Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprensión de la historia de nuestro país, no solo porque muestran el lado sensible y cotidiano de la vida de un hombre que ocupa un lugar privilegiado en la historia de Colombia, sino porque dejan entrever los discursos, las representaciones y las prácticas de la clase dirigente del país. Acercarse a esta correspondencia posibilita conocer asuntos concernientes a los roles femeninos y masculinos, a la educación de los hijos, a las relaciones sociales y públicas, a la vida doméstica, es decir, tanto las ideas y los sentimientos, como la geografía y la cultura material de una época.

The impact of silicon solar cell architecture and cell interconnection on energy yield in hot & sunny climates

KAUST Repository

Haschke, Jan; Seif, Johannes P.; Riesen, Yannick; Tomasi, Andrea; Cattin, Jean; Tous, Loï c; Choulat, Patrick; Aleman, Monica; Cornagliotti, Emanuele; Uruena, Angel; Russell, Richard; Duerinckx, Filip; Champliaud, Jonathan; Levrat, Jacques; Abdallah, Amir A.; Aï ssa, Brahim; Tabet, Nouar; Wyrsch, Nicolas; Despeisse, Matthieu; Szlufcik, Jozef; De Wolf, Stefaan; Ballif, Christophe

2017-01-01

architectures, including so-called Aluminum back-surface-field (BSF), passivated emitter and rear cell (PERC), passivated emitter rear totally diffused (PERT), and silicon heterojunction (SHJ) solar cells. We compare measured temperature coefficients (TC

Managing & Developing People.

Science.gov (United States)

Brain, Gill, Ed.

This book presents ideas about and approaches to human resource management (HRM) in British further education (FE) colleges. Introductory material includes author biographies and a preface (Brain) on human resource issues in FE. "Investors in People" (Chambers) considers how working toward recognition as an Investor in People (a British…

Comparison of biophysical factors influencing on emphysema quantification with low-dose CT

Science.gov (United States)

Heo, Chang Yong; Kim, Jong Hyo

2014-03-01

Emphysema Index(EI) measurements in MDCT is known to be influenced by various biophysical factors such as total lung volume, and body size. We investigated the association of the four biophysical factors with emphysema index in low-dose MDCT. In particular, we attempted to identify a potentially stronger biophysical factor than total lung volume. A total of 400 low-dose MDCT volumes taken at 120kVp, 40mAs, 1mm thickness, and B30f reconstruction kernel were used. The lungs, airways, and pulmonary vessels were automatically segmented, and two Emphysema Indices, relative area below -950HU(RA950) and 15th percentile(Perc15), were extracted from the segmented lungs. The biophysical factors such as total lung volume(TLV), mode of lung attenuation(ModLA), effective body diameter(EBD), and the water equivalent body diameter(WBD) were estimated from the segmented lung and body area. The association of biophysical factors with emphysema indices were evaluated by correlation coefficients. The mean emphysema indices were 8.3±5.5(%) in RA950, and -930±18(HU) in Perc15. The estimates of biophysical factors were 4.7±1.0(L) in TLV, -901±21(HU) in ModLA, 26.9±2.2(cm) in EBD, and 25.9±2.6(cm) in WBD. The correlation coefficients of biophysical factors with RA950 were 0.73 in TLV, 0.94 in ModLA, 0.31 in EBD, and 0.18 WBD, the ones with Perc15 were 0.74 in TLV, 0.98 in ModLA, 0.29 in EBD, and 0.15 WBD. Study results revealed that two biophysical factors, TLV and ModLA, mostly affects the emphysema indices. In particular, the ModLA exhibited strongest correlation of 0.98 with Perc15, which indicating the ModLA is the most significant confounding biophysical factor in emphysema indices measurement.

What's different about older people.

Science.gov (United States)

Crome, Peter

2003-10-01

Older people can be regarded as a marginalised group within society from a number of perspectives including that of health. When it comes to the use of medication older people have suffered from a double whammy. Not only are they more at risk from the adverse effects of drugs but also their involvement in clinical trials has been limited so that rational prescribing both to maximise benefit and to reduce risk has been problematic. Their special problems have been recognised formerly by the Department of Health in its NSF for Older People [National Service Framework for Older People. Department of Health, London (2001a)], [Medicines and Older People. Implementing medicines-related aspects of the NSF for Older People. Department of Health (2001b)]. Early studies focussed on compliance, the avoidance of poly-pharmacy and the high prevalence of adverse effects of drugs and the reasons for this. Studies in long-stay patients showed dramatic differences in pharmacokinetics between such older people and young healthy volunteers. Initially such differences were ascribed to age alone and the overall message became "start low and go slow". Studies in healthy older people then revealed that age differences in drug metabolism were, as a rule, not so marked although clearance of renally excreted drugs was reduced in line with the age associated decline in renal function. Including older people in clinical trials poses challenges. Many traditional trialists do not have ready access to older people, co-morbidity and poly-pharmacy are common and most people feel reluctant to ask older people to take part in complex and potentially hazardous trials. Concern about compliance is unwarranted. Adverse events may be more serious. Thus in a younger patient postural hypotension may make a subject unsteady but in an older subject the unsteadiness may lead to a fall, the fall to a fracture, and the fracture to poor recovery. The choice of end-points is crucial. Although reduction of

Case 3. "Jiang Tao v. Chengdu Branch, People's People's Bank of China": Opinion by the People's Court in Wuhou District, Chengdu, Sichuan Province

Science.gov (United States)

Chinese Education and Society, 2006

2006-01-01

This article presents the decision of the People's Court in Wuhou District, Chengdu, Sichuan Province on the Jiang Tao v. Chengdu Branch, People's People's Bank of China case. Jiang Tao, the plaintiff, claimed that the defendant Chengdu Branch placed an announcement in the "Chengdu Business Daily" to "recruit tellers for Chengdu…

People searching for people: analysis of a people search engine log

NARCIS (Netherlands)

Weerkamp, W.; Berendsen, R.; Kovachev, B.; Meij, E.; Balog, K.; de Rijke, M.

2011-01-01

Recent years show an increasing interest in vertical search: searching within a particular type of information. Understanding what people search for in these "verticals" gives direction to research and provides pointers for the search engines themselves. In this paper we analyze the search logs of

Levels And Spectra Of Aircraft Noise And People\\'s Reactions In ...

African Journals Online (AJOL)

A study of sound levels and spectral distribution as well as people\\'s reactions to aircraft noise in three Nigerian international airports have been conducted. The study comprised physical measurements and social survey. Results show that maximum octave band pressure levels (BPLs) for Margaret Ekpo, Port Harcourt and ...

Disabled people - rehabilitation with sport

Directory of Open Access Journals (Sweden)

Tomasz Łosień

2017-05-01

Full Text Available Sport was used to complement  therapy in original form, improve of motor patterns and reeducate functions of people with disabilities. With a passing of time, sport evolved to integrated part of rehabilitation as an element of improvement. Moreover, he became as a tool to improve the social integration of people which finished the treatment or/and have deficits. We can notice the huge sport development of people with disabilities, which was initiated by Sir Ludwig Guttmann’s who claimed that view of sport is equal for people with disabilities and able-bodied people. The quality of physical activity of people with disabilities is indicated by motor preparation, training and sport (wellness, nutritionist, sport and exercise psychologist which currently is all the same except individual approach to particular dysfunction of the person with disability. Sport allow to develop not only physical sphere, but also teaches social integration, teamwork skills, self-discipline, improves the quality of life and outcome of the  ADL scale (activities of daily living scale of people with disabilities which do sport actively. The variety of sports disciplines and ability to use appropriate orthopedic stuff allows to activate people with every kind of disabilities and dysfunction.

Large impacted upper ureteral calculi: A comparative study between retrograde ureterolithotripsy and percutaneous antegrade ureterolithotripsy in the modified lateral position

Directory of Open Access Journals (Sweden)

Kamal Moufid

2013-01-01

Conclusions: In our series, Perc-URS is a safe and efficient treatment option for proximal ureteral stone, especially when the stone size is superior to 15 mm with the presence of moderate or severe hydronephrosis.

Portfolio as a tool to evaluate clinical competences of traumatology in medical students

OpenAIRE

Santonja-Medina, Fernando; Garc?a-Sanz, M Paz; Mart?nez-Mart?nez, Francisco; B?, David; Garc?a-Esta?, Joaqu?n

2016-01-01

Fernando Santonja-Medina,1,2 M Paz García-Sanz,3 Francisco Martínez-Martínez,1,2 David Bó,1,2,4 Joaquín García-Estañ,5 1Faculty of Medicine, Department of Traumatology, 2Faculty of Medicine, University Hospital Virgen de la Arrixaca, 3Faculty of Medicine, Department of Education, 4Faculty of Medicine, University Hospital Morales Meseguer, 5Faculty of Medicine, Department of Physiology, University of Murcia, Murcia, S...

Contribution à étymologie de l' oronyme slovène Nanos

Directory of Open Access Journals (Sweden)

Anton Grad

1982-12-01

Full Text Available Pour ll' origine de l' oronyme slovène Nanos (a l' est de Trieste, obscure jusqu'ici, l' auteur propose, en se basant sur le nom italien de la montagne, à savoir Naso (= nez df M.onte Re, la base romane Nason (= gros nez, désignation populaire - supposée par l' auteur - de la montagne, d' où par metathèse s - n > n - s, en slovène Nanos.

Secrets of over-indebted people

Directory of Open Access Journals (Sweden)

Valérie BILLAUDEAU

2013-12-01

Full Text Available Today, the economic and financial crisis is brought to light and it is now clear that many people are directly impacted by this phenomenon. However, a lot of situations are obviously hidden and in particular those concerning over-indebted people. These people often find that it is difficult to express the hardship they are going through and keep silent because is more comfortable for them. The media also does not tackle this burning issue because the complexity of some situations complicates the message. Therefore, a giant gap has appeared leaving over-indebted people entrapped in their secret. Starting from this hypothesis, this article will examine the results of a research conducted on the over-indebted people (survey on written press, analysis of TV broadcasts, analysis of records related to person in debts and responses of people in debts and the secrets that this phenomenon involves.

People and oaks

Science.gov (United States)

Paul F. Starrs

2015-01-01

While technical knowledge of oaks, acorns, habitat, wildlife, and woodland environments is evolving and a sought-after field of study, there are profound linkages, at once humanistic and artistic, where it comes to people and oaks. Looking at six distinct facets of humans and oak woodlands, this essay suggests that the bonds of people to place can be mediated by the...

Management Mangrove Experiences Form Coastal People

Science.gov (United States)

Indah, P. N.; Radianto, I.; Abidin, Z.; Amir, I. T.; Pribadi, D. U.

2018-01-01

The mangrove area has an important meaning in beach ecosystem, both from ecological and economical aspects. For this, the rehabilitation of mangrove forest is done as one effort that aims to maintain and return the mangrove forest function as one of life system supporters, especially in beach area. The most respondent ages of coast people of Gending, Pajarakan, dan Kraksaan districts, Probolinggo Regency are between 30 to 59 years old, i.e. as 86 people or 95.55% indicates that coast people are productive ages so they can be hoped very potential for having role in supporting mangrove ecosystem management of Probolinggo Regency coast. The average respondent educational rates are mostly Elementary School to Senior High School, i.e. as 76 people. Generally, human resources of coast people have relatively good education level. Thereby, it can be hoped to have positive potencies for the role of coast people themselves toward the mangrove ecosystem management support of Probolinggo Regency coast. The average most respondents have family burdens two and three people as six people or 6.67 percent. But, there are still three respondents who have not have family burdens. Generally, more and more members help in respondent’s jobs. The mangrove ecosystem management strategy of Probolinggo Regency coast is by involving people role (people and people figures) and governmental supports through the models of mangrove forest management strategy, the model of embankment cultivation management by entering mangrove as input resources of production facilities, and ecotourism management by the purpose of improving people income.

Transgender People (For Parents)

Science.gov (United States)

... best support your child. For people who are transgender, the realization that they feel different from others also can be very difficult. They may face rejection, discrimination, and even anger from people who don't ...

Older People and Social Connectedness: How Place and Activities Keep People Engaged

Directory of Open Access Journals (Sweden)

Irene H. Yen

2012-01-01

Full Text Available To understand how older adults perceive and navigate their neighborhoods, we examined the implications of activity in their neighborhoods for their health. We interviewed 38 adults (ages 62–85 who lived in San Francisco or Oakland, California. Seven key themes emerged: (1 people express a wide range of expectations for neighborliness, from “we do not bother each other” to “we have keys to each other’s houses”, (2 social distance between “other” people impede a sense of connection, (3 ethnic differences in living arrangements affect activities and activity locations, (4 people try to stay busy, (5 people able to leave their homes do many activities outside their immediate residential neighborhoods, (6 access to a car is a necessity for most, and (7 it is unusual to plan for the future when mobility might become limited. Multiple locations influence older adults’ health, including residential neighborhoods. Older adults value mobility, active lives, and social connections.

Nitrogen-doped carbon nanotubes as a metal catalyst support

CSIR Research Space (South Africa)

Mabena, LF

2011-05-01

Full Text Available ., which are among the most commonly used heterogeneous catalyst supports (Mart??nez-Me?ndez et al. 2006). Catalyst activity depends on the particle size and appropriate dis- tance between each particle. These catalysts deposited on a support... supported Pt electrodes. Appl Catal B Environ 80:286?295 Maldonado S, Morin S, Stevenson KJ (2006) Structure, composition, and chemical reactivity of carbon nanotubes by selective nitrogen doping. Carbon 44:1429?1437 Mart??nez-Me?ndez S, Henr??quez Y...

Healthy Pets and People

Science.gov (United States)

... prevent the spread of germs between pets and people. Keep pets and their supplies out of the kitchen, and ... a local wildlife rehabilitation facility. More Information Healthy Pets Healthy People Clean Hands Save Lives! Stay Healthy at Animal ...

“Gaucho primero, después hombre, después negro”. Identidad y relaciones en la pieza teatral El gaucho negro

Directory of Open Access Journals (Sweden)

Matías Emiliano Casas

2014-11-01

Full Text Available The semantic of the word "gaucho" has been attributed with many meanings in different fields of study and artistic productions. The word's new signification and etymology and the gaucho participation in the economic development of Argentina, among other questions, have been the subject of dispute since the first studies about Independence until today. The play The Gaucho Black of Claudio Martínez Payva, premiered in 1927 at the National Theatre in Buenos Aires, revealed a series of problems, such as: the link with foreign settlers, the construction of identity through the gaucho figure and the relationship with black people. This study provides new tools to analyze the Rioplatense society and culture in the early Twentieth Century.

Do jobs follow people or people follow jobs? A meta-analysis of Carlino–Mills studies

NARCIS (Netherlands)

Hoogstra, Gerke J.; Van Dijk, Jouke; Florax, Raymond J. G. M.

2017-01-01

Do jobs follow people or people follow jobs? A meta-analysis of Carlino–Mills studies. Spatial Economic Analysis. This study examines the classic question as to whether ‘jobs follow people’ or ‘people follow jobs’ by performing a meta-analysis of 321 results from 64 Carlino–Mills studies. It is

Understanding "people" people.

Science.gov (United States)

Butler, Timothy; Waldroop, James

2004-06-01

Nearly all areas of business--not just sales and human resources--call for interpersonal savvy. Relational know-how comprises a greater variety of aptitudes than many executives think. Some people can "talk a dog off a meat truck," as the saying goes. Others are great at resolving interpersonal conflicts. Some have a knack for translating high-level concepts for the masses. And others thrive when they're managing a team. Since people do their best work when it most closely matches their interests, the authors contend, managers can increase productivity by taking into account employees' relational interests and skills when making personnel choices and project assignments. After analyzing psychological tests of more than 7,000 business professionals, the authors have identified four dimensions of relational work: influence, interpersonal facilitation, relational creativity, and team leadership. This article explains each one and offers practical advice to managers--how to build a well-balanced team, for instance, and how to gauge the relational skills of potential employees during interviews. To determine whether a job candidate excels in, say, relational creativity, ask her to describe her favorite advertising campaign, slogan, or image and tell you why she finds it to be so effective. Understanding these four dimensions will help you get optimal performance from your employees, appropriately reward their work, and assist them in setting career goals. It will also help you make better choices when it comes to your own career development. To get started, try the authors' free online assessment tool, which will measure both your orientation toward relational work in general and your interest level in each of its four dimensions.

QTL list: SpRg-7 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

Lifescience Database Archive (English)

Full Text Available entage concerning shoot regeneration 2 ME10-141 ... Chr07 19.51 6.84 ... 10.1186/1471-2229-11-140 22014149 ... QT73653 Solanum lycopersicum Solanaceae SpRg-7 In vitro plant regeneraion bud perc

Effect of electroless nickel on the series resistance of high-efficiency inkjet printed passivated emitter rear contacted solar cells

Energy Technology Data Exchange (ETDEWEB)

Lenio, Martha A.T. [REC Technology US, Inc., 1159 Triton Dr., Foster City, CA 94301 (United States); Lennon, A.J.; Ho-Baillie, A.; Wenham, S.R. [ARC Photovoltaics Centre of Excellence, University of NSW, Sydney, NSW 2052 (Australia)

2010-12-15

Many existing and emerging solar cell technologies rely on plated metal to form the front surface contacts, and aluminium to form the rear contact. Interactions between the metal plating solutions and the aluminium rear can have a significant impact on cell performance. This paper describes non-uniform nickel deposition on the sintered aluminium rear surface of passivated emitter and rear contacted (PERC) cells patterned using an inkjet printing technique. Rather than being plated homogeneously over the entire rear surface as is observed on an alloyed aluminium rear, the nickel is plated only in the vicinity of the point openings in the rear surface silicon dioxide dielectric layer. Furthermore, this non-uniform nickel deposition was shown to increase the contact resistance of the rear point contacts by an order of magnitude, resulting in higher series resistance values for these fabricated PERC cells. (author)

Making people be healthy.

Science.gov (United States)

Wilkinson, Timothy Martin

2009-09-01

How are we supposed to decide the rights and wrongs of banning smoking in bars, restricting adverts for junk food, nagging people into being screened for cancers, or banning the sale of party pills? The aim of this paper is to think through the political ethics of trying to make people healthier through influencing or restricting their choices. This paper covers: (1) Paternalism. What it is, what it assumes. (2) The place of health in well-being, and how this makes paternalism problematic. (3) The mistakes people make in acting in their own interests, and the implications for pro-health paternalism. (4) Autonomy objections to paternalism. The paper (5) finishes on a note of hope, by commending the currently fashionable libertarian paternalism: trying to have one's carrot cake and eat it too. A persistent theme is that thinking sensibly about making people healthier needs subtlety, not broad, ringing declarations.

Psychodrama with Deaf People

Science.gov (United States)

Clayton, Lynette; Robinson, Luther D.

1971-01-01

Observations based on psychodrama with deaf people, relating to interaction between people and the communication process, are made. How role training skills, which involve some of the skills of psychodrama, can be applied by professionals in vocational and social learning situations is illustrated. (KW)

Driver response to the TetraStar Navigation Assistance System by age and sex

Science.gov (United States)

1997-07-01

This study is part of the evaluation of the FAST-TRAC operational test of an Intelligent Transportation System (ITS) in Michigan and is concerned with user perceptions and behaviors with Advanced Traveler Information Systems (ATIS). The use and perce...

Conflicto de identidad : indefinición sexual en tres poetas de la Edad de Plata

OpenAIRE

Gómez Garrido, Marta

2013-01-01

Artículo sobre la presencia de un conflicto identitario relacionado con el género en la obra de tres poetas de la llamada Edad de Plata Española: Lucía Sánchez Saornil, Ana María Martínez Sagi y Carmen Conde. Article about the existence of a gender-related identity conflict in three female poets of the Silver Age of Spanish Literature: Lucía Sánchez Saornil, Ana María Martínez Sagi and Carmen Conde.

El acortamiento de los isquiosurales

OpenAIRE

Miguel Vidal Barbier; Tania Vidal Almiñana; Mercedes Almela Zamorano; Miguel Vidal Almiñana

2011-01-01

El acortamiento de los isquiosurales, según varios autores (Bado, 1977; Jordà, 1971; Lambrinudi, 1934; Latorre & Hernández, 2003; López, Ferragut, Alacid, Yuste, & García, 2008; Santonja, Andújar, & Martínez, 1994; Santonja, Ferrer, & Martínez, 1995), puede producir alteraciones en la estática del raquis que pueden desencadenar anomalías en su estructura y procesos álgidos. Estos hechos hacen que la detección temprana de un acortamiento en estos músculos sea importante para prevenir posibles ...

ICT Interface Design for Ageing People and People with Dementia

Science.gov (United States)

Wallace, Jonathan; Mulvenna, Maurice D.; Martin, Suzanne; Stephens, Sharon; Burns, William

Ageing population trends, rising healthcare costs and social and digital inclusion are all factors in the background to the problem of older adults interacting with technology. Approaches to address "physical accessibility" and "access to technology" issues, as well as training for existing systems are evident, yet a usability issue still prevails. The primary aim of this chapter is to provide an overview of the research and literature and discuss the differing contexts in which older people and people with dementia interact with computerised systems and their associated issues.

Conflicting discourses of church youths on masculinity and sexuality ...

African Journals Online (AJOL)

However, a small number of participants challenged current gender norms and ... sexuality, young churchgoers, HIV prevention, gender equality, DR Congo ... Les garc¸ons ont e´te´ perc¸us comme des personnes qui ont des rapports sexuels ...

Power to the people

International Nuclear Information System (INIS)

Anon.

1997-01-01

Looking for an edge in the highly competitive North Sea oil and gas market has sector companies turning to a sometimes overlooked asset - people. OE opens its latest north east Scotland review with a look at how the Investors in People programme is boosting some companies' 'business performance'. (Author)

Reseña de Casas Gómez, M. e I. Penadés Martínez (Coords., M. T. Díaz Hormigo (ed. (1998, Estudios sobre el Diccionario de uso del español de María Moliner, Cádiz, Universidad de Cádiz.

Directory of Open Access Journals (Sweden)

Juan Pedro Rojas Pichardo

2011-04-01

Full Text Available Normal 0 21 false false false ES X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Se trata de reseña de Casas Gómez, M. e I. Penadés Martínez (Coords., M. T. Díaz Hormigo (ed. (1998, Estudios sobre el Diccionario de uso del español de María Moliner, Cádiz, Universidad de Cádiz.

People Capability Maturity Model. SM.

Science.gov (United States)

1995-09-01

tailored so it consumes less time and resources than a traditional software process assessment or CMU/SEI-95-MM-02 People Capability Maturity Model...improved reputation or customer loyalty. CMU/SEI-95-MM-02 People Capability Maturity Model ■ L5-17 Coaching Level 5: Optimizing Activity 1...Maturity Model CMU/SEI-95-MM-62 Carnegie-Mellon University Software Engineering Institute DTIC ELECTE OCT 2 7 1995 People Capability Maturity

Explaining Sad People's Memory Advantage for Faces.

Science.gov (United States)

Hills, Peter J; Marquardt, Zoe; Young, Isabel; Goodenough, Imogen

2017-01-01

Sad people recognize faces more accurately than happy people (Hills et al., 2011). We devised four hypotheses for this finding that are tested between in the current study. The four hypotheses are: (1) sad people engage in more expert processing associated with face processing; (2) sad people are motivated to be more accurate than happy people in an attempt to repair their mood; (3) sad people have a defocused attentional strategy that allows more information about a face to be encoded; and (4) sad people scan more of the face than happy people leading to more facial features to be encoded. In Experiment 1, we found that dysphoria (sad mood often associated with depression) was not correlated with the face-inversion effect (a measure of expert processing) nor with response times but was correlated with defocused attention and recognition accuracy. Experiment 2 established that dysphoric participants detected changes made to more facial features than happy participants. In Experiment 3, using eye-tracking we found that sad-induced participants sampled more of the face whilst avoiding the eyes. Experiment 4 showed that sad-induced people demonstrated a smaller own-ethnicity bias. These results indicate that sad people show different attentional allocation to faces than happy and neutral people.

Young people in adult education

Directory of Open Access Journals (Sweden)

Albert Mrgole

1997-01-01

Full Text Available The increasing number of young people participating in adult education programmes has, in the recent years, raised the question of transfer from regular education system to labour market where a large proportion of young people remain socially marginalized and isolated. Young people in adult education are a special target group; in order to plan educational programmes properly, we need to be familiar with their specific characteristics. The article, on the level of a statistical data outline and its paradoxes, introduces the category of young people in adult education as an impact of system factors, and defines related problems in the register, which - for more thorough understanding - dictates sociologically and anthropologically directed analytical approach. The first effect of this, not solely pedagogical view, is presented in the second part of the article, where Mrgole proposes an analysis of educational needs definition and its dangerous consequences in original planning of educational programmes. The concluding part takes a wider perspective and treats the factors of early school-leaving of young people, taking into consideration direct experience in experimental educational programmes for the young. The article ends with an outline of basic elements which the planners of andragogical educational programmes intended for young people should consider in their planning to achieve effective curricula.

Do People Want Optimal Deterrence?

OpenAIRE

Sunstein, Cass Robert; Schkade, David; Kahneman, Daniel

2014-01-01

Two studies test whether people believe in optimal deterrence. The first provides people with personal injury cases that are identical except for variations in the probability of detection and explores whether lower probability cases produce higher punitive damage awards and whether higher probability cases produce lower awards. No such effect is observed. The second asks people whether they agree or disagree with administrative and judicial policies that increase penalties when the probabili...

Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 6, 1995--June 20, 1995

International Nuclear Information System (INIS)

Blenden, M.L.; Osborne, R.S.; Kucera, P.A.

1996-01-01

For the second consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 6 to June 20, 1995. We PIT tagged and released 421 wild chinook salmon smolts, 747 hatchery chinook salmon smolts (445 HxW and 302 HxH), 227 wild steelhead trout smolts and 1,296 hatchery steelhead trout smolts. Cumulative interrogation rates at mainstem Snake and Columbia River dams were 78.4% for wild chinook salmon, 58.9% for hatchery chinook salmon (HxW), 56.6% for hatchery chinook salmon (HxH), 76.2% for wild steelhead trout, and 69.2% for hatchery steelhead trout. Peak outmigration of NPT tagged wild Imnaha River chinook salmon smolts occurred from early to mid-May at Lower Granite, Little Goose, and Lower Monumental Dams. Median and 90% passage dates for wild chinook salmon smolts at Lower Granite Dam were May 1 and May 11, respectively. Continuous spill at Lower Granite Dam was initiated on May 3 and lasted for 51 days. The 90% passage date of wild chinook salmon smolts at Lower Granite Dam (May 11) preceded peak Snake River and Lower Granite (June 6) flows by 26 days. Although hatchery chinook salmon exhibited a shorter outmigration period through the Snake River than their wild counterparts, peak arrival for both groups occurred at approximately the same time. Median and 90% passage dates at Lower Granite Dam for other PIT tagged groups were: hatchery chinook salmon (NPT-HxW) - May 2 and May 13; hatchery chinook salmon (FPC-HxH) - May 8 and May 15; wild steelhead trout - May 2 and May 9; and hatchery steelhead trout (NPT and FPC) - May 31 and June 16. Hatchery steelhead trout displayed small peaks in arrival timing at Lower Granite and Little Goose Dams in mid-May to mid-June

Hobbies of Retired People in the People's Republic of China: A Preliminary Study.

Science.gov (United States)

Hu, Jun-Chen

1990-01-01

Described and analyzed hobbies of over 500 individuals in the People's Republic of China. Results indicated there were significant differences between the hobbies of retired and younger people; reading was the hobby most preferred; and gender, age, education, and previous occupation were factors that most influenced the retired person's choice of…

Consumption patterns and why people fish

International Nuclear Information System (INIS)

Burger, Joanna

2002-01-01

Recreational and subsistence fishing play major roles in the lives of any people, although their importance in urban areas is often underestimated. There are fish and shellfish consumption advisories in the new York-New Jersey harbor estuary, particularly in the waters of the Newark Bay Complex. This paper examines fishing behavior, consumption patterns, and the reasons that people fish in the Newark Bay Complex. I test the null hypotheses that there are no differences among Asians, Blacks, Hispanics, and whites in consumption patterns for fish and crabs and in the reasons that they fish or crab. Most people either fished or crabbed, but not both. People who fish and crab ate more grams of crab than fish in a given meal; people who crab only consumed more grams of crab at a meal than those who fish only consumed of fish. Although 30% or more of the people who fished and crabbed in the Newark Bay Complex did not eat their self-caught fish or crabs 8-25% of the people ate more than 1500 g/month. Some people angling in the Newark Bay Complex are eating crabs at a rate well over 1500 g/month, and about 70% are eating crabs even though there is a total ban on both harvest and consumption because of the health risks from dioxin. Consumption patterns were negatively correlated with mean income and positively correlated with mean age. Most people rated relaxation and being outdoors the highest reasons or angling, although on an open-ended question they usually listed recreation. There were no ethnic differences in reasons for angling, although other studies have shown ethnic differences in consumption. Obtaining fish or crabs to eat, give away, trade, or sell were rated low, suggesting that consumption advisories fail partly because people are not primarily fishing or food

Esmeralda

Directory of Open Access Journals (Sweden)

Gonzalo Cerda Brintrup

1988-06-01

Full Text Available El Hotel Luxor, era un edificio de madera construido por Don Luis Jiménez, de varios pisos: el más alto de Castro. Situado entre la plaza y calle Serrano, acogía a los viajeros y junto a él, en la planta baja, la antigua casa donde funcionaba el único estudio fotográfico del pueblo: Foto Provoste. Don Gilberto Provoste había aprendido el arte de la imagen de su amigo Don Lucho Jiménez, a su llegada a Castro en 1934.

Valorar la lectura

OpenAIRE

Feldman, Jonathan

2016-01-01

Fil: Feldman, Jonathan. Universidad Nacional de las Artes. Área Transdepartamental de Crítica de Artes. Instituto de Investigación y Experimentación en Arte y Crítica; Argentina Fil: Feldman, Jonathan. Universidad Nacional de Tres de Febrero. Instituto de Investigación en Arte y Cultura “Dr. Norberto Griffa”; Argentina Fil: Dámaso Martínez, Carlos. Universidad de Buenos Aires. Facultad de Filosofía y Letras; Argentina Fil: Dámaso Martínez, Carlos. Universidad Nacional de las Artes. Á...

Perspectivas de la niñez adulta: El cómic como espacio de denuncia desde la marginalidad de sus personajes

OpenAIRE

Ana Merino

2010-01-01

Este artículo analiza la representación de la niñez en varios cómics iberoamericanos: Mafalda de Quino, Paracuellos de Carlos Jiménez y Socorro de Miguel Rep. En ellos se articula la infancia desde una perspectiva adulta y crítica con la sociedad mostrando una dimensión comprometida que interpela al lector. This article analyzes the representation of childhood in several Latin American comics: Mafalda by Quino, Paracuellos by Carlos Jiménez, and Socorro by Miguel Rep. In these comics, infancy...

Perspectivas de la niñez adulta: el cómic como espacio de denuncia desde la marginalidad de sus personajes

OpenAIRE

Merino, Ana

2010-01-01

Este artículo analiza la representación de la niñez en varios cómics iberoamericanos: mafalda de quino, paracuellos de carlos jiménez y socorro de miguel rep. En ellos se articula la infancia desde una perspectiva adulta y crítica con la sociedad mostrand This article analyzes the representation of childhood in several latin american comics: mafalda by quino, paracuellos by carlos jiménez, and socorro by miguel rep. In these comics, infancy is articulated from an adult angle critical with ...

Estrategia de marketing y comunicación de la empresa Marangoni Cioccolato

OpenAIRE

García Giménez, María; Martínez Llácer, Azahara

2011-01-01

Este proyecto pretende establecer un sistema de comunicación que permita difundir los valores, productos e imagen de la empresa Marangoni Cioccolato, enmarcada en la región italiana Le Marche dónde destaca por su tradición artesanal pero aún no es todo lo conocida que pretende ser. García Giménez, M.; Martínez Llácer, A. (2011). Estrategia de marketing y comunicación de la empresa Marangoni Cioccolato. http://hdl.handle.net/10251/13399. Archivo delegad...

Are People With Whiplash-Associated Neck Pain Different from People With Nonspecific Neck Pain?

DEFF Research Database (Denmark)

Anstey, Ricci; Kongsted, Alice; Kamper, Steven

2016-01-01

Study Design Secondary analysis of a prospective cohort study with cross sectional and longitudinal analyses. Background The clinical importance of a history of whiplash associated disorder (WAD) in people with neck pain remains uncertain. Objective To compare people with WAD to people with non......-specific neck pain, in terms of their baseline characteristics, and pain and disability outcomes over 1 year. Methods Consecutive patients with neck pain presenting to a secondary care spine centre answered a comprehensive self-report questionnaire and underwent a physical examination. Patients were classified...

Comparative pharmacology of a new recombinant FSH expressed by a human cell line

DEFF Research Database (Denmark)

Koechling, Wolfgang; Plaksin, Daniel; Croston, Glenn E.

2017-01-01

Recombinant FSH proteins are important therapeutic agents for the treatment of infertility, including follitropin alfa expressed in Chinese Hamster Ovary (CHO) cells and, more recently, follitropin delta expressed in the human cell line PER.C6. These recombinant FSH proteins have distinct glycosy...

How to win friends and influence people

CERN Document Server

Carnegie, Dale

2010-01-01

For more than sixty years the rock-solid, time-tested advice in this book has carried thousands of now famous people up the ladder of success in their business and personal lives. With more than fifteen million copies sold, How to Win Friends and Influence People is one of the best known motivational books in history, with proven advice for achieving success in life. You’ll learn: three fundamental techniques in handling people; six ways to make people like you; twelve ways to win people to you way of thinking; nine ways to change people without arousing resentment; and much, much more!

Older people in the information society

Directory of Open Access Journals (Sweden)

Aleksandra Marcinkiewicz-Wilk

2016-06-01

Full Text Available This paper focuses on the situation of older people in the information society. In the theoretical part of article phenomena of aging population and information society were described. This paper includes results of research conducted in qualitative strategy. The method of collecting data was biographical method. The method for data processing was qualitative content analysis. In the research 2 older, educationally active people took part. Results of research shows how older people understand the information society and what risk and opportunities they notice in this new reality. Narratives of the respondents indicated that education is of crucial importance for participation in the information society. Older people who take part in lifelong learning cope better with the new reality than people who do not learn. Based on the research results we can point out areas of education which should be development. Moreover, it is visible that educational activity of older people is very important in adaptation to the information society. Narratives of seniors indicate reasons for the lack of educational activity of other seniors. According to this, it can be specified what action should be undertaken to prevent the exclusion of older people in this new reality

Flu and People with Diabetes

Science.gov (United States)

... Seasonal Avian Swine Variant Pandemic Other Flu and People with Diabetes Language: English (US) Español Recommend on Facebook Tweet Share Compartir People with diabetes (type 1 or type 2), even ...

Deafblind people, communication, independence, and isolation.

Science.gov (United States)

Hersh, Marion

2013-10-01

This paper discusses issues related to communication, independence, and isolation for an understudied group of deaf people who also have visual impairments. The discussion is based on the experiences of 28 deafblind people in 6 different countries, obtained from interviews that were carried out as part of a larger research project on travel issues. However, the similarities in experiences between countries were stronger than the differences. In particular, barriers to communication and inadequate support, with resulting problems of isolation and depression, were found in all the countries. Equally, deafblind people in all the countries were interested in being involved in and contributing to society and supporting other people, particularly through organizations of blind and deafblind people. This runs counter to the tendency to present deafblind and other disabled people purely as recipients of support rather than also as active participants in society. However, there were some differences in the support available in the different countries.

French people and energy issues

International Nuclear Information System (INIS)

Chesnais, L.

2006-01-01

An opinion poll made in France in 2006 shows that: - French people backs nuclear energy with a slight margin (45% versus 42%), - French people agrees with the electricity production policy led by the government, - about 4 people out of 10 expect a sharp increase in prices concerning car fuels, natural gas and heating fuels in a near future, on the other hand fewer people than in previous years are expecting a price rise for electricity. In this article some figures concerning the consumption of energy in France are given: - 230.000 jobs are directly or indirectly involved in the energy sector, this sector represents 5% of all investment, - a total bill of 24 milliard euros for the energy imports, and - energy spending represents 7.6% of the household budget. (A.C.)

Older people. Courtesy entitles.

Science.gov (United States)

Calnan, Michael; Woolhead, Gillian; Dieppe, Paul

2003-02-20

A study of 72 people, with an average age of 72, showed that dignity--and lack of it--were key issues in their estimation of care. Concerns about lack of dignity centred on lack of privacy, mixed sex wards, forms of address and loss of independence. The study suggested that older people do not complain about care for fear of retaliation.

People on the Move

Science.gov (United States)

Mohan, Audrey

2018-01-01

The purpose of this 2-3 day lesson is to introduce students in Grades 2-4 to the idea that people move around the world for a variety of reasons. In this activity, students explore why people move through class discussion, a guided reading, and interviews. The teacher elicits student ideas using the compelling question (Dimension 1 of the C3…

Helping Young People Engage with Scientists

Science.gov (United States)

Leggett, Maggie; Sykes, Kathy

2014-01-01

There can be multiple benefits of scientists engaging with young people, including motivation and inspiration for all involved. But there are risks, particularly if scientists do not consider the interests and needs of young people or listen to what they have to say. We argue that "dialogue" between scientists, young people and teachers…

Bogota - Urban Expansion Social Segregation and Land Degradation

Science.gov (United States)

Czerny, Mirosława; Czerny, Andrzej

2016-01-01

Colombia's capital city Bogota was founded in 1538 by Gonzalo Jiménez de Quesada, a Spanish Conquistador who came down from the north to reach the Sabana de Bogotá, i.e. the intermountain plateau (and "Savannah") around Bogota. The whole region was already well-developed by then, and inhabited by the Muisca people. Their settlements were dispersed across the plateau, though only rarely did these encompass flat areas suitable for crop-growing. Today's Bogota is the largest metropolitan area in the country, with more than 8 million residents currently, and occupying a considerable part of the extensive high plateau. Processes which have resulted in Bogota's present spatial form and its - in some ways - unique functional and spatial structure, are manifold, and highly complex. They include environmental, political, social and economic factors. Nevertheless, among all of these cause-and-effect processes, institutionalized segregation (called estratificación in Colombia) is the reason why rigid spatial structures are maintained, while the spontaneous and uncontrolled movement of groups of people within the city and from one social class to another is restricted.

The relationship of French people with energy

International Nuclear Information System (INIS)

Levy, Jean-Daniel; Potereau, Julien; Gautier, Antoine

2017-12-01

This Power Point document presents graphs and tables containing results of a survey performed on the relationship French people have with energy. After a presentation of the survey methodology, it addresses how France commitment in the struggle against climate change is perceived (French people think that their country could do better), which perceptions French people have of stakes and of the French energy policy (the management of the energy issue is perceived as perfectible, and French people have a positive view on energy transition and on the development of renewable energies), and which investments French people stand for (French people are in favour of a more important role of Europe and of citizen cooperatives in the field of energy)

Health Care Access Among Deaf People.

Science.gov (United States)

Kuenburg, Alexa; Fellinger, Paul; Fellinger, Johannes

2016-01-01

Access to health care without barriers is a clearly defined right of people with disabilities as stated by the UN Convention on the Rights of People with Disabilities. The present study reviews literature from 2000 to 2015 on access to health care for deaf people and reveals significant challenges in communication with health providers and gaps in global health knowledge for deaf people including those with even higher risk of marginalization. Examples of approaches to improve access to health care, such as providing powerful and visually accessible communication through the use of sign language, the implementation of important communication technologies, and cultural awareness trainings for health professionals are discussed. Programs that raise health knowledge in Deaf communities and models of primary health care centers for deaf people are also presented. Published documents can empower deaf people to realize their right to enjoy the highest attainable standard of health. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

LIFE AND DEATH AMONGST INDIGENOUS PEOPLES

Directory of Open Access Journals (Sweden)

Jane Felipe Beltrão

2015-06-01

Full Text Available Considering the frequent rights violations perpetrated against indigenous peoples, which affect people and territories, compromising their lives and even their right to mourn the dead, it is imperative to understand the care and concerns of the indigenous towards life and death. Thus, we propose to analyze ethnographic narratives about the Apinayé, Ka'apor, Tapirapé, Tembé, Tenetehara, Terena and Asurini, in order to discuss the caring of people, considering the context of funerary rituals. The texts analyzed are able to reveal: (1 the existence (or not of the practice; (2 the specific contexts in which the funeral rites are (or not practiced; and (3 the meanings that the practice gain in ethnically differentiated societies. The narratives of indigenous peoples are included in order to attempt to make the peoples that nowadays find themselves accused by both the media and (reportedly pro-life organizations “be heard”. Therefore, using the classical literature we study the heritage of ritual practices, which besides confering dignity to the dead, indicate that life is the greater good among indigenous peoples.

Intuitive Understanding of Base Rates

DEFF Research Database (Denmark)

Austin, Laurel

Purpose: This study examines whether physicians and other adults intuitively understand that the probability a positive test result is a true positive (positive predictive value, PPV) depends on the base rate of disease in the population tested. In particular, this research seeks to examine perce...

Sensitivity analysis of bridge health index to element failure and element conditions.

Science.gov (United States)

2009-11-01

Bridge Health Index (BHI) is a bridge performance measure based on the condition of the bridge elements. It : is computed as the ratio of remaining value of the bridge structure to the initial value of the structure. Since it : is expressed as a perc...

Sharing Space

DEFF Research Database (Denmark)

Liversage, Anika; Jakobsen, Vibeke

2010-01-01

While considerable research exists on U.S. immigrant groups living in extended households, little is available on such households in Europe. This article therefore analyzes extended household living among Turkish immigrants in Denmark. From register and survey data, the article finds that 77 perc...

Self-perceived lactose intolerance results in lower intakes of calcium and dairy foods and is associated with hypertension and diabetes in adults

Science.gov (United States)

Self-perceived lactose intolerance may result in adverse dietary modifications; thus, more studies are needed to understand the prevalence of self-perceived lactose intolerance and how it relates to calcium intake and selected health conditions. The objective was to examine the effects of self-perce...

Escala de Representações dos Professores acerca da Sobredotação: Construção de uma escala de avaliação (ERPAS)

OpenAIRE

Veiga, Feliciano; Marques, Paulo

2001-01-01

A falta de instrumentos de avaliação da perceção dos professores acerca dos alunos sobredotados justificou o desenvolvimento da denominada "Escala de Representações dos Professores acerca dos Alunos Sobredotados" (ERPAS). Esta escala revelou adequadas qualidades psicométricas.

Drug Policy and Indigenous Peoples.

Science.gov (United States)

Burger, Julian; Kapron, Mary

2017-06-01

This paper identifies the principal concerns of indigenous peoples with regard to current international treaties on certain psychoactive substances and policies to control and eradicate their production, trafficking, and sale. Indigenous peoples have a specific interest in the issue since their traditional lands have become integrated over time into the large-scale production of coca, opium poppy, and cannabis crops, in response to high demand from the American and European markets, among others. As a consequence, indigenous peoples are persecuted because of their traditional use of these and other plant-based narcotics and hallucinogens. They are also victims of the drug producers who remove them from their lands or forcibly recruit them into the production process. As indigenous peoples are caught in the violent world of illicit drug production, law enforcement often targets them first, resulting in disproportionate rates of criminalization and incarceration.

Comparison of transports expected under different waste management concepts: determination of basic data for application in risk analyses

International Nuclear Information System (INIS)

Alter, U.; Mielke, H.G.; Wehner, G.

1983-01-01

According to the Atomic Act, article 9a, paragraph 1, the licensees of nuclear power plants in the Federal Republic of Germany are obliged to provide for the management of radioactive wastes resulting from the operation of these plants. Concerning the provisions to be made for the management of such wastes, two concepts are discussed: nuclear reprocessing and final waste disposal center (Nukleares Entsorgungszentrum, NEZ); and the integrated spent fuel and waste management concept (Integriertes Entsorgungskonzept, IEK). Unlike the NEZ, the IEK-concept may have different sites for the following fuel cycle facilities: intermediate spent fuel storage, reprocessing, waste conditioning and final disposal, and uranium and plutonium fuel element fabrication facilities. The fundamental differences of the pertinent transports are presented. Transport scenarios expected under the two alternatives NEZ and IEK have been elaborated for the purpose of a data collection covering the following aspects: materials to be shipped, number of packages shipped, number of packages shipped per transport, transport by rail or by road, transport routes and distances, and duration of transports

Spanish Minister of Science and Technology visits the LHC magnet test facility

CERN Multimedia

Patrice Loïez

2002-01-01

H.E. Mr Josep Piqué i Camps, Minister of Science and Technology, Spain, toured the test facility for LHC magnets in building SM18 during his visit to CERN in November. In this series of photos Felix Rodriguez Mateo explains the operation of the test facilty to the ministerial party. Photo 01: (left to right) Felix Rodriguez Mateo; the Minister; Francisco Giménez-Reyna, Spanish delegate to the CERN Finance Committee; M. Aguilar Benitez, Spanish delegate to the CERN Council; G. Babé and G. Léon. Photo 02: (left to right) Felix Rodriguez Mateos; César Dopazo, Director-General of CIEMAT (Spanish Research Centre for Energy, Environment and Technology); the Minister; G. Babé; M. Aguilar Benitez; and G. Léon. Photo 03: Francisco Giménez-Reyna; Felix Rodriguez Mateos; César Dopazo; the Minister; Juan Antonio Rubio, leader of the Education and Technology Transfer division at CERN; G. Babé behind M. Aguilar Benitez. Photo 04: Francisco Giménez-Reyna, partially hidden behind Felix Rodriguez Mateos; César Dop...

Curso básico de didáctica de las ciencias enseñanza secundaria profesorado de ciencias en formación y en activo

Directory of Open Access Journals (Sweden)

Adriana Patricia Gallego Torres

2016-06-01

Full Text Available Este escrito presenta una reseña del libro escrito por los investigadores: Jaime Carrascosa Alís, Josep Lluís Domenech, Joaquín Martínez Torregrosa, Luis Osuna García y Rafaela Verdú Carbonell y con ISBN: 978-84-616-9964-3. Basic course teaching science secondary education science teachers in training and active This paper presents a book review written by researchers: Jaime Carrascosa Alis, Josep Lluis Domenech, Joaquín Martínez Torregrosa, Luis Osuna García and Verdú Carbonell and Rafaela ISBN: 978-84-616-9964-3 Básico ciências curso de ensino ensino secundário professores de ciências em formação e active Este trabalho apresenta uma resenha do livro escrito por pesquisadores: Jaime Carrascosa Alis, Josep Lluis Domenech, Joaquín Martínez Torregrosa, Luis Osuna García e Verdú Carbonell e Rafaela ISBN: 978-84-616-9964-3

Health Care Access among Deaf People

Science.gov (United States)

Kuenburg, Alexa; Fellinger, Paul; Fellinger, Johannes

2016-01-01

Access to health care without barriers is a clearly defined right of people with disabilities as stated by the UN Convention on the Rights of People with Disabilities. The present study reviews literature from 2000 to 2015 on access to health care for deaf people and reveals significant challenges in communication with health providers and gaps in…

Attitudes towards People with Disabilities--What Do People with Intellectual Disabilities Have to Say?

Science.gov (United States)

Corr McEvoy, Sandra; Keenan, Emer

2014-01-01

Attitudes towards people with intellectual disabilities have traditionally been very negative, resulting in people with intellectual disabilities being treated badly by other. This claim was explored by conducting focus groups with adults who have an intellectual disability to find out about their everyday experiences in different places and using…

Prussian blue as an antidote for radioactive thallium and cesium poisoning

Directory of Open Access Journals (Sweden)

Altagracia-Martinez M

2012-06-01

Full Text Available Marina Altagracia-Martínez, Jaime Kravzov-Jinich, Juan Manuel Martínez-Núñez, Camilo Ríos-Castañeda, Francisco López-NaranjoDepartments of Biological Systems and Health Care, Biological and Health Sciences Division, Universidad Autónoma Metropolitana-Xochimilco, Mexico DF, MexicoBackground: Following the attacks on the US on September 11, 2001, potentially millions of people might experience contamination from radioactive metals. However, before the specter of such accidents arose, Prussian blue was known only as an investigational agent for accidental thallium and cesium poisoning. The purpose of this review is to update the state of the art concerning use of Prussian blue as an effective and safe drug against possible bioterrorism attacks and to disseminate medical information in order to contribute to the production of Prussian blue as a biodefense drug.Methods: We compiled articles from a systematic review conducted from January 1, 1960 to March 30, 2011. The electronic databases consulted were Medline, PubMed, the Cochrane Library, and Scopus.Results: Prussian blue is effective and safe for use against radioactive intoxications involving cesium-137 and thallium. The US Food and Drug Administration has approved Prussian blue as a drug, but there is only one manufacturer providing Prussian blue to the US. Based on the evidence, Prussian blue is effective for use against radioactive intoxications involving cesium-137 and thallium, but additional clinical research on and production of Prussian blue are needed.Keywords: Prussian blue, radioactive cesium, thallium, intoxication, biodefense drug

Estratigrafía, evolución estructural y restauración. El caso de la iglesia de Santa Eulalia en Marquínez (Álava

Directory of Open Access Journals (Sweden)

Cámara, Leandro

2010-12-01

breve revisión de la teoría de estados límite y su aplicación a las estructuras de fábrica y a la iglesia de Santa Eulalia de Marquínez en particular; en paralelo se presenta el resultado del estudio histórico de su evolución constructiva; y se conjugan las conclusiones de ambos análisis en una secuencia temporal de la evolución estructural, una revisión de su seguridad y una propuesta de intervención

How Do People Get AIDS?

Science.gov (United States)

... Educators Search English Español How Do People Get AIDS? KidsHealth / For Teens / How Do People Get AIDS? Print en español ¿Cómo contrae alguien el SIDA? AIDS stands for acquired immunodeficiency syndrome , a disease that ...

African Peoples and Western Education

Science.gov (United States)

Onwauchi, P. Chike

1972-01-01

Argues that if the educational process is to be functionally relevant for the African peoples, it must be structured so as to maintain a dynamic pattern of continuity with the family and the cultural life patterns of the people. (Author/JM)

Tupamaro de Caxamarca: tonadas sobre la muerte del Inca Atahualpa contenidas en el códice Martínez Compañón (1782-85 Tupamaro de Caxamarca: Tunes about the Death of the Inca Atahualpa contained in the Codex Martínez Compañón (1782-85

Directory of Open Access Journals (Sweden)

Tiziana Palmiero

2011-12-01

Full Text Available A lo largo de la Colonia se va construyendo una memoria de la historia de los pueblos andinos que considera al Imperio incaico como su principal referente y a la figura del Inca1 como su símbolo natural. La narración de los hechos de la historia incaica, en especial aquellos relativos a la conquista española, generaron el mito de la muerte del Inca2, a la cual habrán contribuido colonizados y colonizadores. Durante el siglo XVIII serán numerosas las representaciones teatral-musicales de estos hechos. El códice Martínez Compañón (1782-85 consta de nueve tomos con alrededor de 1.500 láminas en colores que ilustran los diferentes aspectos de la vida social y natural de la zona de Trujillo, Perú. Treinta y ocho láminas, incluidas en el tomo II, se refieren directa o indirectamente a la música de tradición oral de la época, las láminas numeradas -foliación original, E. está por "Estampa"- desde la E.176 hasta la E.193 contienen un total de veinte partituras. A primera vista el título de las dos tonadas: "E.188: Allegro tonada El tupamaro, Caxamarca" y "E.191 (b: Adagio tonada el Tuppamaro de caxa-marca" sugiere que el contenido de las mismas podría tener relación con los sucesos de Cajamarca, es decir, con la captura y muerte del Inca Atahualpa3. En el mismo tomo II se encuentran además dos láminas que representan la decapitación del Inca: "Danza de la degollación del Ynga E.172; E.173.". De ser así las dos tonadas podrían ser dos fragmentos musicales únicos de las representaciones teatrales antes mencionadas4. Durante el análisis de las dos partituras encontramos que éstas tendrían relación con otras partituras del mismo códice: "E. 191, Magestuoso Cachua la Despedida de Guamachuco"; "E. 190 Allegro tonada la brugita para cantar de Guamachuco" y "E.187, Andantino Tonada El Diamante, para baylar de Chachapoyas". Se trató de analogías musicales o textuales que permitieron crear un hilo conductor con los tr

Sixth Conference on China-ASEAN People-to-People Friendship Organizations Held in Bangkok

Institute of Scientific and Technical Information of China (English)

2011-01-01

<正>With the theme of "Opportunities and Challenges of China-ASEAN Friendly Cooperation", the Sixth Conference on China-ASEAN People-to-People Friendship Organizations organized by the Thai-Chinese Friendship Association was held in Bangkok August 18 and 19. A delegation of China-ASEAN Association led by its president Gu Xiulian joined about 200 representatives from friendship-with-China organizations in 10 ASEAN countries.

What Do Older People Learn from Young People? Intergenerational Learning in "Day Centre" Community Settings in Malta

Science.gov (United States)

Spiteri, Damian

2016-01-01

This study analyses what motivates older people to attend "day centres" in Malta and what they believe that they derive from young people who carry out their placements at these day "centres" These young people, who are aged 16-17, attend a vocational college in Malta and are studying health and social care. The study is based…

People

Science.gov (United States)

2001-01-01

Thrilled at @Bristol Kathy Sykes in conversation with Liz Whitelegg. Kathy Sykes is Senior Science Consultant at @Bristol - a new area on Bristol's Harbourside with a Science Centre Explore, a Wildlife Centre Wildscreen, with sculptures and fountains. Kathy was one of five people in 1999 to be awarded an IOP Public Awareness of Physics award. Dr Kathy Sykes What attracted you to Physics in the first place? It was really when I discovered that Physics was all about making models of the world, because then suddenly the ability to be creative became important. I liked the idea that you could have a picture of the world that might work quite well but you could always replace that with a better one. That was what made science come alive and make it seem like something that I'd really love to be involved in, rather than science as a stale body of facts that I needed to learn. I was much more interested in ideas than in facts. I think that finding out about 'models' happened around the time I was discovering quantum mechanics and how the act of observing something can actually affect the outcome. I found it incredibly exciting - especially how that changed the whole philosophy of science. I also had a fantastic teacher in physics and I owe an awful lot to him. He just swooped in at the last moment when I was considering giving it up so that made an enormous difference. After my degree I went to teach maths and physics A-level in Zimbabwe with the VSO, and it was partly wanting to share my excitement with other people about physics that made me want to go and teach abroad. When I came back and began my PhD in Physics at Bristol University, I missed teaching and thought it was important to get the public more involved in science and debates about science. My supervisor, Pete Barham, was doing lots of this himself, and he helped and encouraged me enormously. I can't thank him enough. Did you consider teaching as a career? Well I like having the carpet whipped away from

Young people and sexual orientation

NARCIS (Netherlands)

Lisette Kuyper

2015-01-01

Original title: Young people and sexual orientation The Netherlands Institute for Social Research ¦ SCP carries out regular research on lesbian, gay, bisexual and transgender (LGBT) individuals. In this report, the focus is on young people in the Netherlands. The report addresses two issues:

Beyond Generalized Sexual Prejudice: Need for Closure Predicts Negative Attitudes Toward Bisexual People Relative to Gay/Lesbian People.

Science.gov (United States)

Burke, Sara E; Dovidio, John F; LaFrance, Marianne; Przedworski, Julia M; Perry, Sylvia P; Phelan, Sean M; Burgess, Diana J; Hardeman, Rachel R; Yeazel, Mark W; van Ryn, Michelle

2017-07-01

Increasing evidence suggests that bisexual people are sometimes evaluated more negatively than heterosexual and gay/lesbian people. A common theoretical account for this discrepancy argues that bisexuality is perceived by some as introducing ambiguity into a binary model of sexuality. The present brief report tests a single key prediction of this theory, that evaluations of bisexual people have a unique relationship with Need for Closure (NFC), a dispositional preference for simple ways of structuring information. Participants ( n =3406) were heterosexual medical students from a stratified random sample of 49 U.S. medical schools. As in prior research, bisexual targets were evaluated slightly more negatively than gay/lesbian targets overall. More importantly for the present investigation, higher levels of NFC predicted negative evaluations of bisexual people after accounting for negative evaluations of gay/lesbian people, and higher levels of NFC also predicted an explicit evaluative preference for gay/lesbian people over bisexual people. These results suggest that differences in evaluations of sexual minority groups partially reflect different psychological processes, and that NFC may have a special relevance for bisexual targets even beyond its general association with prejudice. The practical value of testing this theory on new physicians is also discussed.

Research with Arctic peoples

DEFF Research Database (Denmark)

Smith, H Sally; Bjerregaard, Peter; Chan, Hing Man

2006-01-01

Arctic peoples are spread over eight countries and comprise 3.74 million residents, of whom 9% are indigenous. The Arctic countries include Canada, Finland, Greenland (Denmark), Iceland, Norway, Russia, Sweden and the United States. Although Arctic peoples are very diverse, there are a variety...... of environmental and health issues that are unique to the Arctic regions, and research exploring these issues offers significant opportunities, as well as challenges. On July 28-29, 2004, the National Heart, Lung, and Blood Institute and the Canadian Institutes of Health Research co-sponsored a working group...... entitled "Research with Arctic Peoples: Unique Research Opportunities in Heart, Lung, Blood and Sleep Disorders". The meeting was international in scope with investigators from Greenland, Iceland and Russia, as well as Canada and the United States. Multiple health agencies from Canada and the United States...

Consortium formation for a coal-fired power plant in the People`s Republic of China

Energy Technology Data Exchange (ETDEWEB)

Kostal, K.T.

1994-12-31

The advent of developed power projects within the People`s Republic of China brings the benefits of new financing methods and the energies and resources of new participants. By necessity, it also results in fundamental changes in the many contractual relationships needed to support financial closing. The key element is the contract to design, procure, and construct the power plant. This paper compares and contrasts the requirements of these turnkey contracts with more traditional fixed price equipment supply contracts within the People`s Republic of China. The emphasis of the paper is upon issues and concerns related to the successful formation of a consortium, including the effective integration of Chinese construction companies and design institutes into the process. The issues are explored from the viewpoint of the consortium`s international engineer, who often participates as consortium leader and equipment procurer, in addition to detailed designer.

Marginalised people: solo exhibition

OpenAIRE

Meredith-Vula, L. A.

2002-01-01

I was awarded the prestigious Sargant Fellowship at the British School in Rome (2001). My project involved bringing people at the margins of society, mainly Albanian refugees and immigrants, into locations where their destitution would appear incongruous in relation to displays of high art. My aim was to photograph these people, in settings that revealed their innate dignity, whilst challenging gallery visitors’ perceptions of appropriate audiences for high culture. I wanted to open my subje...

A recepção crítica das obras: A menina do Narizinho arrebitado (1920) e Narizinho arrebitado (1921)

OpenAIRE

Brero, Caroline Elizabeth [UNESP

2003-01-01

Cette recherche a pour but l organisation chronologique et l analyse critique des articles, des assais et des références consacrés aux oeuvres La fillette au petit nez pointu (1920) et Petit nez pointu (1921), de Monteiro Lobato, publiées en livres et en périodiques entre 1920 et 2001. Ce travail a eu encore le but d évaluer les études critiques scindés, finalment, en deux catégories: les études qui ont contribués à des analyses éclaircissantes et inovatrices sur les deux oeuvres et ceux ...

Mapas conceptuales y aprendizaje cooperativo. Experiencias en la enseñanza del Derecho

OpenAIRE

Cobas Cobiella, María Elena; Montes Rodríguez, María Pilar; Alventosa del Río, Josefina; Guillén Catalán, Raquel; Ortega Giménez, Alfonso; Meco Tébar, Fabiola; Chaparro Matamoros, Pedro; Valero Llorca, Javier; Company Alcañiz, Mireia; Cano Donate, Asunción

2014-01-01

En la elaboración de este libro también participaron los siguientes estudiantes: Carlota Ramírez Pérez / Jose Gil García / Jose Manuel Aznar Cerdán / Teresa Pérez Huertas / Jorge Alarcón Fernández / Rodrigo Climent Pedrosa / Clara Beltrán Segarra / José Luis Mayordomo Lledó / Carlos Mingote Hernández / Miguel Castillo Ortega / Juan Martínez Leal / Daniel Martínez Rojano / Rocío Grondona Vives / Rubén Pons Solanes / Álvar Garay Pingarrón / Ioana Alexandra Neacsu / Carlos Lerma Poveda / Begoña ...

French people and nuclear wastes

International Nuclear Information System (INIS)

D'Iribarne, Ph.

2005-01-01

On March 21, 2005, the French minister of industry gave to the author of this document, the mission to shade a sociological light on the radioactive wastes perception by French people. The objective of this study was to supply an additional information before the laying down in 2006 of the decisions about the management of high-level and long-lived radioactive wastes. This inquiry, carried out between April 2004 and March 2005, stresses on the knowledge and doubts of the questioned people, on the vision they have of radioactive wastes and of their hazards, and on their opinion about the actors in concern (experts, nuclear companies, government, anti-nuclear groups, public). The last two parts of the report consider the different ways of waste management under study today, and the differences between the opinion of people living close to the Bure site and the opinion of people living in other regions. (J.S.)

Public attitudes towards people with intellectual disabilities: a qualitative comparison of white British & South Asian people.

Science.gov (United States)

Coles, Sarah; Scior, Katrina

2012-03-01

National and international polices promote the acceptance, integration and inclusion of people with intellectual disabilities into mainstream society. However, there is little systematic research into general population attitudes towards people with intellectual disabilities, and even less research, which considers the impact of culture on attitudes. The aim of this study was to explore how young people from White British and South Asian backgrounds differ in their attitudes towards people with intellectual disabilities and above all, how they arrive at their beliefs. A qualitative design utilizing focus groups and individual interviews with White British and South Asian adolescents aged 16-19 years (N = 61) was employed. Questionnaire data were collected to compare this sample to findings from a larger study run concurrently (Attitudes to people with intellectual disabilities: a cross cultural study. Thesis, University College London). Interview and focus group data were analysed using thematic analysis. Thematic analysis yielded five themes and pointed to widespread confusion about the concept of 'intellectual disability', not helped by the continuing invisibility of people with intellectual disabilities in the media. Participants expressed many positive beliefs, yet closer analysis revealed that underlying these may be more ambivalent or even hostile attitudes. Key differences between the two cultural groups are discussed. The findings highlight the need for raising public awareness and the importance of culturally sensitive support. © 2011 Blackwell Publishing Ltd.

Older People with Learning Disabilities:Workforce issues

OpenAIRE

Hussein, S; Manthorpe, J

2005-01-01

The life expectancy of people with learning disabilities has increased substantially. Services for older people with learning disabilities are provided by various sectors and practitioners (generic health and social care, or specialist learning disability or old age). The literature suggests that practitioners do not feel well-equipped to support people with learning disabilities as they grow older, and older people's services do not always have the opportunity to share experiences and skills...

GIS Application Management for Disabled People

Science.gov (United States)

Tongkaw, Sasalak

2017-08-01

This research aimed to develop and design Geographical Information Systems (GIS) for facilitating disabled people by presenting some useful disabled information on the Google Map. The map could provide information about disabled types of people such as blind, deaf and physical movement. This research employed the Multiview 2 theory and method to plan and find out the problems in real world situation. This research used many designing data structure methods such as Data Flow Diagram, and ER-Diagram. The research focused into two parts: server site and client site which included the interface for Web-based application. The clear information of disable people on the map was useful for facilitating disabled people to find some useful information. In addition, it provided specialized data for company and government officers for managing and planning local facilities for disabled people in the cities. The disable could access the system through the Internet access at any time by using mobile or portable devices.

Instituciones y personas : la Sociedad Española de Educación Comparada 2002-2006 = Institutions and people : the Spanish Comparative Education Society 2002-2006

Directory of Open Access Journals (Sweden)

Diego Sevilla

2014-09-01

Full Text Available La Presidencia del Profesor Ferran Ferrer se extendió del 22.11.2002 al 08.09.2006. En estos años, la vida de la Sociedad estuvo marcada por sus grandes capacidades que le permitieron dirigirla con notable eficacia y ayudar a mejorar en todos sus miembros la docencia y la investigación en esta materia. Entre otras acciones de este período, merecen destacarse la publicación de la Revista Española de Educación Comparada también en formato electrónico, la celebración de dos Congresos Nacionales, dedicados al estudio de las Convergencias en la Educación Superior y al Derecho a la Educación en un mundo globalizado, la participación de los miembros de la Sociedad en Congresos europeos y mundiales, la calidad y fuerza comunicativa del Boletín de la SEEC, editado por Joan María Senent Sánchez y María Jesús Martínez Usarralde, y la puesta en marcha del Premio Pedro Rosselló.Professor Ferran Ferrer’s presidency lasted from the 22th of November 2002 until the 8th of August 2006. During this period, life within the society was conditioned by his great abilities, which allowed him to direct the society with remarkable efficiency and help to improve teaching and research regards all its members within this field. Among the actions undertaken during this period, especially worth of mentioning are the publication of the Spanish Journal of Comparative Education also in digital format, the celebration of two National Congresses dealing with the studying of the Convergences in Higher Education and the Right to Education in a Globalized World, the participation of the members of the Society in European and World Congresses, the quality and the communicative strength of the Spanish Society of Comparative Education Journal, which was published by Joan María Senet Sanchez and María Jesús Martínez Usarralde and the putting in operation of the Pedro Roselló price.

Care home design for people with dementia: What do people with dementia and their family carers value?

Science.gov (United States)

Innes, Anthea; Kelly, Fiona; Dincarslan, Ozlem

2011-07-01

To report on the views of people with dementia who live in care homes and their family carers on aspects of design that are important to them, and discuss these in relation to developing physical care environments that respond to the wishes of people with dementia and their family carers. Six focus groups were held: two in Northern Ireland and four in Scotland. A total of 40 people participated in the focus groups. Twenty nine people were with dementia (24 female and five male), and 11 were family carers (10 female and one male). Carers discussed the features of a building they took into account when selecting a care home, and discussed this in relation to 'bricks and mortar versus people'. Key themes reported by people with dementia and their family carers included how the space in the environment is used, for example, what happens in the building and the presence or absence of certain design features. Outside space and wayfinding aids were identified as positive features of the home, along with a general lack of concern about ensuite provision. The results demonstrate the complexity of building design as it must provide living space acceptable to people with dementia living there and family members who visit, as well as provide a workable environment for staff. The findings highlight areas that should be considered by care home teams involved in the build of a new home or the redevelopment of an existing care home.

Large impacted upper ureteral calculi: A comparative study between retrograde ureterolithotripsy and percutaneous antegrade ureterolithotripsy in the modified lateral position.

Science.gov (United States)

Moufid, Kamal; Abbaka, Najib; Touiti, Driss; Adermouch, Latifa; Amine, Mohamed; Lezrek, Mohammed

2013-07-01

The treatment for patients with large impacted proximal ureteral stone remains controversial, especially at institutions with limited resources. The aim of this study is to compare and to evaluate the outcome and complications of two main treatment procedures for impacted proximal ureteral calculi, retrograde ureterolithotripsy (URS), and percutaneous antegrade ureterolithotripsy (Perc-URS). Our inclusion criteria were solitary, radiopaque calculi, >15 mm in size in a functioning renal unit. Only those patients in whom the attempt at passing a guidewire or catheter beyond the calculus failed were included in this study. Between January 2007 and July 2011, a total of 52 patients (13 women and 39 men) with large impacted upper-ureteral calculi >15 mm and meeting the inclusion criteria were selected. Of these, Perc-URS was done in 22 patients (group 1) while retrograde ureteroscopy was performed in 30 patients (group 2). We analyzed operative time, incidence of complications during and after surgery, the number of postoperative recovery days, median total costs associated per patient per procedure, and the stone-free rate immediately after 5 days and after 1 month. Bivariate analysis used the Student t-test and the Mann-Whitney test to compare two means and Chi-square and Fisher's exact tests to compare two percentages. The significance level was set at 0.05. The mean age was 42.3 years (range 22-69). The mean stone sizes (mm) were 34 ± 1.2 and 29.3 ± 1.8 mm in group 1 and 2, respectively. In the Perc-URS group, 21 patients (95.45%) had complete calculus clearance through a single tract in one session of percutaneous surgery, whereas in the URS group, only 20 patients (66.7%) had complete stone clearance (P = 0.007). The mean operative time was higher in the Perc-URS group compared to group 2 (66.5 ± 21.7 vs. 52.13 ± 17.3 min, respectively; P = 0.013). Complications encountered in group 1 included transient postoperative fever (2 pts) and simple urine outflow (2

SOCIAL JUSTICE FOR DISABLED PEOPLE

Directory of Open Access Journals (Sweden)

Nazire Diker

2013-07-01

Full Text Available This paper aims to question the living conditions of disabled people in the 21st century from  the framework of social justice. The concept of “social justice” has a long history, influenced  by the works of numerous writers including Rawls (1971, Miller (1999, Reeves (2005, Fainstein (2009, Marcuse (2009 and Harvey (1992, 2009 and by the recent debates on  inequality, diversity, segregation, exclusion, and discrimination. The debates on segregation, exclusion and discrimination are generally focused on inequalities in terms of economic,  ethnic and gender dimensions; however, in these debates, there is very little reference to unequal opportunities of disabled people. On the other hand, the diversity issue is generally discussed with respect to ethnic and cultural elements, again with very little concern for the  rights of disabled people. In many developing countries, including Turkey, a legal framework  for addressing disability issues has started to be put in place. Awareness among governments and society of the needs and rights of people with disabilities is growing. In the  last decade in Turkey, the difficulties faced by disabled people have started to be taken into  consideration seriously. Before that, the only information about the disabled population could  be obtained from General Population Census in Turkey. In 2002 “Turkey Disability Survey” was carried out collectively by the State Institute of Statistics and the Presidency of  Administration on Disabled People. In this survey, it has been targeted to estimate the number of disabled people and comprehend their socio-economic characteristics, their  problems in social life, expectations, types and causes of disability, regional differences and also the proportion of population having chronic illnesses. After this survey, many projects  have started to be realized in order to propose strategies for eliminating discrimination in  Turkey. In this paper, we will

Image and Video for Hearing Impaired People

Directory of Open Access Journals (Sweden)

Aran Oya

2007-01-01

Full Text Available We present a global overview of image- and video-processing-based methods to help the communication of hearing impaired people. Two directions of communication have to be considered: from a hearing person to a hearing impaired person and vice versa. In this paper, firstly, we describe sign language (SL and the cued speech (CS language which are two different languages used by the deaf community. Secondly, we present existing tools which employ SL and CS video processing and recognition for the automatic communication between deaf people and hearing people. Thirdly, we present the existing tools for reverse communication, from hearing people to deaf people that involve SL and CS video synthesis.

Pärt, Arvo: De profundis / Barry Witherden

Index Scriptorium Estoniae

Witherden, Barry

1997-01-01

Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass)". Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)

Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio / Marc Rochester

Index Scriptorium Estoniae

Rochester, Marc

1997-01-01

Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass). Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)"

Impression mismanagement : People as inept self-presenters

NARCIS (Netherlands)

Steinmetz, J.F.; Sezer, O.; Sedikides, C.

2017-01-01

People routinely manage the impressions they make on others, attempting to project a favorable self-image. The bulk of the literature has portrayed people as savvy self-presenters who typically succeed at conveying a desired impression. When people fail at making a favorable impression, such as when

Commentary Examination of young people's attitudes towards ...

African Journals Online (AJOL)

Young people's attitude towards entrepreneurship contributes tremendously to the rapid increase in innovation. Income and social economic status of people also have strong effect on innovation because in developing countries, stronger payment ability and higher income level enables more people to spend more on a ...

Glucocorticosteroids for people with alcoholic hepatitis

DEFF Research Database (Denmark)

Pavlov, Chavdar S; Varganova, Daria L; Casazza, Giovanni

2017-01-01

BACKGROUND: Alcoholic hepatitis is a form of alcoholic liver disease, characterised by steatosis, necroinflammation, fibrosis, and potential complications to the liver disease. Typically, alcoholic hepatitis presents in people between 40 and 50 years of age. Alcoholic hepatitis can be resolved...... if people abstain from drinking, but the risk of death will depend on the severity of the liver damage and abstinence from alcohol. Glucocorticosteroids are used as anti-inflammatory drugs for people with alcoholic hepatitis. Glucocorticosteroids have been studied extensively in randomised clinical trials...... in order to assess their benefits and harms. However, the results have been contradictory. OBJECTIVES: To assess the benefits and harms of glucocorticosteroids in people with alcoholic hepatitis. SEARCH METHODS: We identified trials through electronic searches in Cochrane Hepato-Biliary's (CHB) Controlled...

Subjective daytime functioning assessment in people with insomnia.

Science.gov (United States)

Grabowski, Karol; Nowicka-Sauer, Katarzyna; Zdrojewski, Tomasz; Rutkowski, Marcin; Bandosz, Piotr; Nowicki, Zbigniew

2017-10-29

The aim of this study was to assess the prevalence and severity of subjective daytime functioning impairment among people with insomnia complaints. Another goal was to establish its relationships with age, gender, type and duration of subjective insomnia. Study group consisted of NATPOL study participants - 2,413 people (1,245 women and 1,168 men) aged 18-79. We extracted group with declared insomnia complaints, consisting of 1,221 people (736 women and 485 men) aged 18-79. Data on insomnia symptoms characteristics, their duration and subjective functioning impairment were further analyzed. Functioning impairment was declared by 825 people (67.7% of those who declared subjective insomnia) and it was more common in women. It was most common among people with insomnia complaints lasting over two weeks - 72.4%. In people with symptoms lasting less than two weeks or for a few days it was 70.7% and 64.9% respectively. People with insomnia symptoms lasting over two weeks accounted for 20% of group with severe functioning impairment. For shorter duration of symptoms it was 8.6% and 6.9% respectively. Among people with mild functioning impairment, persons with symptoms lasting for a few days and less than two weeks were predominant - 32.5% and 35.3% respectively. In people aged 18-24 years mild functioning impairment was predominant (66.66%). Subjective daytime functioning impairment is common in people declaring insomnia symptoms. It is more common in women and its prevalence and intensity are greater in people with longer duration of sleep problems. Its prevalence is not correlated with age and it is the mildest in people aged 18-24.

E-inclusion: Digital equality - young people with disabilities.

Science.gov (United States)

Hemmingsson, H; Bolic-Baric, V; Lidström, H

2015-01-01

The United Nations' position is that digital access is a matter involving equality between groups of people, the securing of democratic rights, and equal opportunities for all citizens. This study investigates digital equality in school and leisure between young people with and without disabilities. A cross-sectional design with group comparisons was applied. Participants were young people (10-18 years of age) with disabilities (n=389) and a reference group in about the same ages. Data were collected by a survey focusing on access to and engagement in ICT activities in school and during leisure time. The results demonstrated young people with disabilities had restricted participation in computer use in educational activities, in comparison to young people in general. During leisure time young people with disabilities had a leading position compared to the reference group with respect to internet use in a variety of activities. Beneficial environmental conditions at home (and the reverse in schools) are discussed as parts of the explanation for the differing engagement levels at home and in school, and among young people with disabilities and young people in general. Schools need to prioritise use of ICT by young people with disabilities.

Effective Communication with Young People

Science.gov (United States)

Shanahan, Patrick; Elliott, David

2009-01-01

The Australian Government established the Office for Youth (the Office) in September 2008 in an effort to engage with the young people of Australia. The Office will work with other government agencies to help young people reach their full potential; make effective transitions to adulthood as they continue to learn, start work, make decisions that…

Healthy People 2020 Tobacco Use Objectives

Data.gov (United States)

U.S. Department of Health & Human Services — U.S. Department of Health and Human Services (HHS). Centers for Disease Control and Prevention (CDC). Healthy People 2020 Tobacco Use Objectives. Healthy People...

Including People with Disabilities: An Indigenous Perspective

Science.gov (United States)

Bevan-Brown, Jill

2013-01-01

Being victims of racial prejudice, religious intolerance, poverty, disempowerment and language loss it could be expected that indigenous people would be supportive of the Inclusion Movement with its philosophy of valuing and acceptance of all people. This supposition is examined for Maori, the indigenous people of Aotearoa/New Zealand. In…

People learn other people's preferences through inverse decision-making.

Science.gov (United States)

Jern, Alan; Lucas, Christopher G; Kemp, Charles

2017-11-01

People are capable of learning other people's preferences by observing the choices they make. We propose that this learning relies on inverse decision-making-inverting a decision-making model to infer the preferences that led to an observed choice. In Experiment 1, participants observed 47 choices made by others and ranked them by how strongly each choice suggested that the decision maker had a preference for a specific item. An inverse decision-making model generated predictions that were in accordance with participants' inferences. Experiment 2 replicated and extended a previous study by Newtson (1974) in which participants observed pairs of choices and made judgments about which choice provided stronger evidence for a preference. Inverse decision-making again predicted the results, including a result that previous accounts could not explain. Experiment 3 used the same method as Experiment 2 and found that participants did not expect decision makers to be perfect utility-maximizers. Copyright © 2017 Elsevier B.V. All rights reserved.

OFDA People-Trak

Data.gov (United States)

US Agency for International Development — People-Trak HRIS is a workforce management tool. It will provide tracking and management tools for recruiting, training, contact info, performance, travel monitoring...

Health and People with Usher syndrome

OpenAIRE

Wahlqvist, Moa

2015-01-01

The present thesis concerns people with Usher syndrome (USH) and their health. People with USH have a congenital hearing loss of various degrees and an eye disease with a progressive course; for some, the balance is also affected. Three clinical groups have been identified 1, 2 and 3, and 13 genes have currently been identified. USH is the most common cause of deafblindness. Clinical knowledge and the limited research that exists have shown that people with deafblindness can experience diffic...

Moving On: Young People and Substance Abuse

Science.gov (United States)

Daley, Kathryn; Chamberlain, Chris

2009-01-01

To help explain why some young people move from recreational drug use to substance abuse, twelve in-depth interviews were conducted with young people who had experienced problematic substance use. The data were supplemented by statistical data on 111 young people. The researchers found a variety of "structural" factors that help explain…

Key health outcomes for children and young people with neurodisability: qualitative research with young people and parents

Science.gov (United States)

Allard, Amanda; Fellowes, Andrew; Shilling, Valerie; Janssens, Astrid; Beresford, Bryony; Morris, Christopher

2014-01-01

Objectives To identify key health outcomes, beyond morbidity and mortality, regarded as important in children and young people with neurodisability, and their parents. Design Qualitative research incorporating a thematic analysis of the data supported by the Framework Approach; the International Classification of Functioning, Disability and Health (ICF) provided a theoretical foundation. Setting The study was conducted in community settings. Participants Participants were 54 children and young people with neurodisability: 50 participated in focus groups, and 4 in interviews; 53 parents participated: 47 in focus groups and 6 in interviews. Children/young people and parents were recruited through different networks, and were not related. Results Children/young people and parents viewed health outcomes as inter-related. Achievement in some outcomes appeared valued to the extent that it enabled or supported more valued domains of health. Health outcomes prioritised by both young people and parents were: communication, mobility, pain, self-care, temperament, interpersonal relationships and interactions, community and social life, emotional well-being and gaining independence/future aspirations. Parents also highlighted their child's sleep, behaviour and/or safety. Conclusions Those responsible for health services for children/young people with neurodisability should take account of the aspects of health identified by families. The aspects of health identified in this study provide a basis for selecting appropriate health indicators and outcome measures. PMID:24747792

Health care reform and people with disabilities.

Science.gov (United States)

Batavia, A I

1993-01-01

As a group, people with disabilities or chronic conditions experience higher-than-average health care costs and have difficulty gaining access to affordable private health insurance coverage. While the Americans with Disabilities Act will enhance access by prohibiting differential treatment without sound actuarial justification, it will not guarantee equal access for people in impairment groups with high utilization rates. Health care reform is needed to subsidize the coverage of such individuals. Such subsidization can be achieved under either a casualty insurance model, in which premiums based on expected costs are subsidized directly, or a social insurance model, in which low-cost enrollees cross-subsidize high-cost enrollees. Cost containment provisions that focus on the provider, such as global budgeting and managed competition, will adversely affect disabled people if providers do not have adequate incentives to meet these people's needs. Provisions focusing on the consumer, such as cost sharing, case management, and benefit reductions, will adversely affect disabled people if they unduly limit needed services or impose a disproportionate financial burden on disabled people.

Cognitive assessment of older people

OpenAIRE

Young, John; Meagher, David; MacLullich, Alasdair J

2011-01-01

peer-reviewed Cognitive assessment involves examination of higher cortical functions, particularly memory, attention, orientation, language, executive function (planning activities), and praxis (sequencing of activities). This article will focus on cognitive assessment of older people (those aged over about 65 years) in the context of possible dementia, delirium, and depression. These are common and serious clinical syndromes affecting older people, and accurate cognit...

“Disabled People Are Sexual Citizens Too”: Supporting Sexual Identity, Well-being, and Safety for Disabled Young People

Directory of Open Access Journals (Sweden)

Sonali Shah

2017-09-01

Full Text Available Disabled young people are sexual beings, and deserve equal rights and opportunities to have control over, choices about, and access to their sexuality, sexual expression, and fulfilling relationships throughout their lives. This is critical to their overall physical, emotional, and social health and well-being. However, societal misconceptions of disabled bodies being non-normative, other, or deviant has somewhat shaped how the sexuality of disabled people has been constructed as problematic under the public gaze. The pervasive belief that disabled people are asexual creates barriers to sexual citizenship for disabled young people, thereby causing them to have lower levels of sexual knowledge and inadequate sex education compared to their non-disabled peers. As a consequence, they are more vulnerable to “bad sex”—relationships, which are considered to be exploitative and disempowering in different ways. Access to good sex and relationships education for disabled young people is, therefore, not only important for them to learn about sexual rights, sexual identity, and sexual expression but also about how to ensure their sexual safety. In so doing, it will contribute to the empowerment and societal recognition of disabled people as sexual beings, and also help them resist and report sexual violence. Therefore, it is critical that parents, educationalists, and health and social care professionals are aware and appropriately equipped with knowledge and resources to formally educate disabled young people about sexuality and well-being on par to their non-disabled peers.

Industrially relevant Al2O3 deposition techniques for the surface passivation of Si solar cells

NARCIS (Netherlands)

Schmidt, J.; Werner, F.; Veith, B.; Zielke, D.; Bock, R.; Tiba, M.V.; Poodt, P.; Roozeboom, F.; Li, A.; Cuevas, A.; Brendel, R.

2010-01-01

We present independently confirmed efficiencies of 21.4% for PERC cells with plasma-assisted atom-ic-layer-deposited (plasma ALD) Al2O3 rear passivation and 20.7% for cells with thermal ALD-Al2O3. Additionally, we evaluate three different industrially relevant techniques for the deposition of

increases in cross-sectional samples

African Journals Online (AJOL)

1971-03-27

Mar 27, 1971 ... TABLE Ill. PERCE 'TAGE INCREASES IN BODY M EASU REM ENTS .... population means (polynomials) for calculating total per- ... with age in males, except for very small increases in Bantu. ..... this applies at high levels of energy expenditure is another .... available for adults of all 4 populations studied.

A longitudinal study of change in falls risk and balance and mobility in healthy older people and people with Alzheimer disease.

Science.gov (United States)

Suttanon, Plaiwan; Hill, Keith D; Said, Catherine M; Dodd, Karen J

2013-08-01

The aim of this study was to determine the rate of change in falls risk and balance and mobility performance in people with Alzheimer disease (AD) compared with those of healthy older people over a 1-yr period. A 1-yr follow-up study of change in levels of falls risk, balance, and mobility performance in 15 community-dwelling older people with mild to moderate AD and 15 healthy age-matched older people was conducted. Each participant completed a comprehensive assessment of balance and mobility, falls and falls risk, and level of physical activity at baseline and 1 yr later. The rate of increase in the number of falls and risk of falling was greater in people with AD. The rate of deterioration on a number of balance and mobility measures was also significantly greater in people with AD compared with the healthy older people. People with mild to moderate AD have an increased rate of decline in falls risk, balance, and mobility over a 12-mo period compared with age-matched healthy older people. Given this increased rate of decline, intermittent review of falls, balance and mobility, and interventions to address identified contributory risk factors should be considered by health practitioners.

Social innovation for People-Centred Development

DEFF Research Database (Denmark)

Hulgård, Lars; P.K., Shajahan

2013-01-01

Social innovation is closely related to the people-centred development (PCD) framework of knowledge production. The discussion of PCD in this chapter particularly expands on the feature of empowerment and socio-political mobilization of people in social innovation...

Responses to Change Helping People Make Transitions

CERN Document Server

(CCL), Center for Creative Leadership

2011-01-01

The ongoing state of many organizations is one of change. People who experience major change tend to exhibit one of four patterns of response: entrenched, overwhelmed, poser, or learner. As a leader, you need to understand the patterns of response that people express and to customize intervention strategies to help them make the transition. People can pass through a given response stage and move to one that is more effective--especially if you provide timely intervention and support. This guidebook will help you understand how people, including yourself, are responding to change and what you c

Transgender people: health at the margins of society.

Science.gov (United States)

Winter, Sam; Diamond, Milton; Green, Jamison; Karasic, Dan; Reed, Terry; Whittle, Stephen; Wylie, Kevan

2016-07-23

In this paper we examine the social and legal conditions in which many transgender people (often called trans people) live, and the medical perspectives that frame the provision of health care for transgender people across much of the world. Modern research shows much higher numbers of transgender people than were apparent in earlier clinic-based studies, as well as biological factors associated with gender incongruence. We examine research showing that many transgender people live on the margins of society, facing stigma, discrimination, exclusion, violence, and poor health. They often experience difficulties accessing appropriate health care, whether specific to their gender needs or more general in nature. Some governments are taking steps to address human rights issues and provide better legal protection for transgender people, but this action is by no means universal. The mental illness perspective that currently frames health-care provision for transgender people across much of the world is under scrutiny. The WHO diagnostic manual may soon abandon its current classification of transgender people as mentally disordered. Debate exists as to whether there should be a diagnosis of any sort for transgender children below the age of puberty. Copyright © 2016 Elsevier Ltd. All rights reserved.

Do Social Networks Differ? Comparison of the Social Networks of People with Intellectual Disabilities, People with Autism Spectrum Disorders and Other People Living in the Community

Science.gov (United States)

van Asselt-Goverts, A. E.; Embregts, P. J. C. M.; Hendriks, A. H. C.; Wegman, K. M.; Teunisse, J. P.

2015-01-01

The aim of this study was to determine the similarities and differences in social network characteristics, satisfaction and wishes with respect to the social network between people with mild or borderline intellectual disabilities (ID), people with autism spectrum disorders (ASD) and a reference group. Data were gathered from 105 young adults…

Reseñas

OpenAIRE

Alternativas. Cuadernos de Trabajo Social

2013-01-01

Contiene: Título: Vivienda y exclusión residencial, Autor: Manuel Hernández Pedreño (coord.), Edita: Editum. Murcia. 2013. 317 pp., ISBN: 978-84-15463-72-6 / María Teresa Martínez Fuentes; Título: Trabajo Social, Concepto y Metodología, Autora: María José Aguilar Idañez, Edita: Ediciones Paraninfo y Consejo General del Trabajo Social, Madrid, 2013, 435 p., ISBN: 978-84-283-3485-3 / María Asunción Martínez Román; Título: Presente y futuro de la formación en Trabajo Social. III Congreso Andaluz...

El movimiento de todas las cosas. Física y Química 4º E.S.O. Mecánica_6. Límites en los cambios: Energía

OpenAIRE

Martínez-Torregrosa, Joaquín; Alonso Sánchez, Manuel; Carbonell Gisbert, Francisco; Carrascosa Alís, Jaime; Domenech Blanco, Josep Lluís; Domenech Pastor, Ángeles; Domínguez Blay, Álvaro; Osuna García, Luis; Verdú Carbonell, Rafaela

1998-01-01

Último tema del curso "El movimiento de todas las cosas" (para alumnos de 15-16 años). ¿Existen límites, restricciones, en los cambios mecánicos que permitan predecir qué va a ocurrir antes de que ocurra?. Introducción al principio de conservación de la energía. Continúa con los temas sobre trabajo, calor, principio general de la energía, del libro de Física y Química de primer curso de Bachillerato (16-17 años) de Editorial Santillana (Carrascosa, Martínez y Martínez Torregrosa, 2001) La ...

Indigenous people's detection of rapid ecological change.

Science.gov (United States)

Aswani, Shankar; Lauer, Matthew

2014-06-01

When sudden catastrophic events occur, it becomes critical for coastal communities to detect and respond to environmental transformations because failure to do so may undermine overall ecosystem resilience and threaten people's livelihoods. We therefore asked how capable of detecting rapid ecological change following massive environmental disruptions local, indigenous people are. We assessed the direction and periodicity of experimental learning of people in the Western Solomon Islands after a tsunami in 2007. We compared the results of marine science surveys with local ecological knowledge of the benthos across 3 affected villages and 3 periods before and after the tsunami. We sought to determine how people recognize biophysical changes in the environment before and after catastrophic events such as earthquakes and tsunamis and whether people have the ability to detect ecological changes over short time scales or need longer time scales to recognize changes. Indigenous people were able to detect changes in the benthos over time. Detection levels differed between marine science surveys and local ecological knowledge sources over time, but overall patterns of statistically significant detection of change were evident for various habitats. Our findings have implications for marine conservation, coastal management policies, and disaster-relief efforts because when people are able to detect ecological changes, this, in turn, affects how they exploit and manage their marine resources. © 2014 Society for Conservation Biology.

Swallowing frequency in elderly people during daily life.

Science.gov (United States)

Tanaka, N; Nohara, K; Kotani, Y; Matsumura, M; Sakai, T

2013-10-01

Disuse atrophy of swallowing-related organs due to an excessive decrease in swallowing frequency is suspected to occur in patients with poor oral intake, especially elderly people. However, swallowing frequency in daily life has not previously been examined in the elderly. This study examined swallowing frequency in elderly people and compared these findings to those in a younger population and differences in the degree of activity in daily life. (i) We compared swallowing frequency in 20 elderly people (82·0 ± 8·3 year) and 15 healthy young people (26·5 ± 3·5 year). (ii) 20 elderly people were divided into two groups according to the degree of activity in daily life: a semi-bedridden group and bedridden group; the swallowing frequency was compared between these groups. (i) The swallowing frequency in the elderly people was 2-19 times per hour and the mean was 9·4 ± 4·9, and that in the healthy young people was 16-76 times per hour and the mean was 40·7 ± 19·5. Swallowing frequency in elderly people was significantly lower than that in young healthy people (P bedridden group was 2-11 times per hour and the mean was 6·8 ± 3·3, and that in semi-bedridden group was 3-19 times per hour and the mean was 11·9 ± 5·1. Swallowing frequency in bedridden group was significantly lower than that in semi-bedridden group (P elderly people tend to swallow less frequently than young people. In addition, swallowing frequency was lower in elderly subjects with a low degree of activity in daily life. © 2013 John Wiley & Sons Ltd.

Mental health issues and discrimination among older LGBTI people.

Science.gov (United States)

Tinney, Jean; Dow, Briony; Maude, Phillip; Purchase, Rachel; Whyte, Carolyn; Barrett, Catherine

2015-09-01

LGBT is an acronym used to describe people from diverse sexual orientation or gender identity, people that are gay, lesbian, bisexual, or transgender. LGBT people do not constitute a single group nor does each individual "group" constitute a homogeneous unity. However, as higher rates of depression and/or anxiety have been observed in older LGBT people, compared to their heterosexual counterparts (Guasp, 2011) there is a need to raise the profile of mental health issues amongst these groups. The additional letter I is also often included in the acronym LGBTI as intersex people are often included as another gender diverse group. However, there is very little research that includes intersex people and none on older intersex people's mental health so this editorial is restricted to consideration of older LGBT people.

Rehabilitation and indigenous peoples: the Māori experience.

Science.gov (United States)

Harwood, Matire

2010-01-01

Indigenous peoples often have the worst health status in comparison to non-indigenous people in their own nations; urgent action to address the health inequities for indigenous people is required. The role of rehabilitation in addressing health and disability inequities is particularly important due to the health need of indigenous peoples; the unequal distribution of health determinants; and disparities in access to, quality of care through and outcomes following rehabilitation. This article will present a perspective for Māori, the indigenous peoples of New Zealand, on a framework for improving rehabilitation services for Māori and ultimately their health and wellbeing.

Technology for helping people

CERN Multimedia

Rosaria Marraffino

2014-01-01

The first THE Port hackathon problem-solving workshop was held at CERN from 31 October to 2 November in the framework of the 60th anniversary celebrations. The aim of the event was to develop technological projects that can help to solve the day-to-day needs of people living in areas of the planet that experience conflicts or natural disasters.   Collage of shots from THE Port hackathon. Credit: THE Port association The event was dedicated to humanitarian and social topics inspired by members of non-governmental organisations‬. “There is plenty of room for technology to help in humanitarian fields. That’s why we came up with the idea of bringing people together to work on these topics,” explains Ines Knäpper, Project Manager of THE Port hackathon. “We started six months ago setting up THE Port association.* The success of the event was only possible because of the joint effort of a team of roughly twenty people. They were inspired by the aim...

Predicting survival in oldest old people

NARCIS (Netherlands)

Taekema, Diana G.; Gussekloo, J.; Westendorp, Rudi G J; De Craen, Anton J M; Maier, Andrea B.

2012-01-01

Objective: Measures of physical performance are regarded as useful objective clinical tools to estimate survival in elderly people. However, oldest old people, aged 85 years or more, are underrepresented in earlier studies and frequently unable to perform functional tests. We studied the association

People and Oceans.

Science.gov (United States)

NatureScope, 1988

1988-01-01

Discusses people's relationship with oceans, focusing on ocean pollution, use, and protective measures of the sea and its wildlife. Activities included are "Mythical Monsters"; "Globetrotters"; "Plastic in the Sea"; and "Sea of Many Uses." (RT)

Agents That Negotiate Proficiently with People

Science.gov (United States)

Kraus, Sarit

Negotiation is a process by which interested parties confer with the aim of reaching agreements. The dissemination of technologies such as the Internet has created opportunities for computer agents to negotiate with people, despite being distributed geographically and in time. The inclusion of people presents novel problems for the design of autonomous agent negotiation strategies. People do not adhere to the optimal, monolithic strategies that can be derived analytically, as is the case in settings comprising computer agents alone. Their negotiation behavior is affected by a multitude of social and psychological factors, such as social attributes that influence negotiation deals (e.g., social welfare, inequity aversion) and traits of individual negotiators (e.g., altruism, trustworthiness, helpfulness). Furthermore, culture plays an important role in their decision making and people of varying cultures differ in the way they make offers and fulfill their commitments in negotiation.

Psychotherapy with people with developmental disabilities

Directory of Open Access Journals (Sweden)

Barbara Zafošnik

2011-08-01

Full Text Available People with developmental disabilities can experience any psychological abnormalitiy and psychiatric illness as do people without developmental disabilities. Due to different diagnostic criteria, assessment procedures and instruments, we lack definite prevalence rates for people with developmental disabilities, also suffering from mental health problems, eventhough most studies place the rate at 20 to 40%. One of the possible treatment alternatives for augmenting psychological well-being is psychotherapy, but is extremely rarely used for people with severe and profound disabilities, where speech cannot be the main therapeutic medium. So, those that are included in the psychotherapuetic process are predominantly clients with mild developmental disabilities, and they are mostly in cognitive-behavioral therapy. Recently, two models of (psychotherapy for persons with severe and profound developmental disabilities were developed: developmental-dynamic relationship therapy and attachment-based behaviour therapy for children. Conceptually, they both originate form developmental psychoanalytic theories.

Evacuation characteristics of visually impaired people

DEFF Research Database (Denmark)

Sørensen, Janne Gress; Dederichs, Anne

2015-01-01

speed depends on the degree of vision loss. The design of the building environment is important for the ability to orientation for people with reduced sight. Walls and handrails are important for the orientation possibilities for people with visual impairments. Furthermore, obstacles placed......-D). The mean free walking speed descending stairs for category C and D were found to be comparable with values found in Danish and Swedish guidelines. The walking speed of people with visible impairments was not affected by an increasing density on stairs to the same extent as the walking speed of able......-bodied adults. It was found that people with visual impairments were able to uphold a higher walking speed descending stairs than able-bodied adults for increasing person density. The initial walking speed on horizontal planes is lower than the value suggested by the N&M-model. The horizontal mean free walking...

The Comparison between Conceived Stress and Personality traits, in People Suffering from Migraine and Healthy People

Directory of Open Access Journals (Sweden)

B Peymannia

2014-06-01

Full Text Available Introduction: Migraine is a common familial disease and is diagnosed with recurring throbbing headache. Investigation of biological and psychological factors in the initiation and aggravation of migraine headaches have shown that there is a relationship between the psychological factors, personality, and migraine headache. Therefore, this study aimed to compare the conceived stress and Personality traits between ill persons suffering from Migraine and healthy people. Methods: This is an analytical cross-sectional study which involves a sample including 30 migrainours and 30 healthy people. The migraine-suffering participants were chosen among the people who referred to specialized clinic of migraine in Ardabil in the first half of 2012. The study participants filled the Eysenck's personality questionnaire and Kohen' s Perceived stress scale. Descriptive statistics as well as MANOVA were utilized to analyze the research data. Results: The results showed that migraine-suffering participants conceived the stress negatively (P<0.01, F=11 compared to healthy participants. Moreover, migrainours scored significantly higher in regard to Neuroticism score compared to healthy people (P<0.05, F=5.91. Also, there was a significant difference between migrainours and healthy people in their extroversion score (P<0.05, F=6.57. Conclusion: According to the study findings, it appears that migraine patients are more vulnerable to the neurotic disease. Therefore, considering the psychological and personality characteristics may impact on the prognosis of disease.

Sexual health for people with intellectual disability.

Science.gov (United States)

Eastgate, Gillian

2008-01-01

People with intellectual disability experience the same range of sexual needs and desires as other people. However, they experience many difficulties meeting their needs. They may be discouraged from relieving sexual tension by masturbating. They face a high risk of sexual abuse. They are likely not to be offered the full range of choices for contraception and sexual health screening. Poor education and social isolation may increase their risk of committing sexual offences. However, with appropriate education and good social support, people with intellectual disability are capable of safe, constructive sexual expression and healthy relationships. Providing such support is an essential part of supporting people with intellectual disability.

"Guns do not kill, people do!"

DEFF Research Database (Denmark)

Lemche, Niels Peter

2011-01-01

The Bible does not kill, but many people who have read the Bible (in their way) have killed, virtually or in real.......The Bible does not kill, but many people who have read the Bible (in their way) have killed, virtually or in real....

Examining the Need for a Code of Conduct in New Jersey Teacher Union Contracts

Science.gov (United States)

Guarneri, Cristina M.

2009-01-01

The purpose of this cross-sectional, comparison study attempted to investigate if a code of conduct existed in New Jersey teacher union contracts to nursing/hospital union contracts. Archived data of public school district and nursing/hospital union contracts held with the New Jersey Public Employment Relations Committee (NJ PERC) and Health…

Static Thrust and Power Characteristics of Six Full-Scale Propellers

Science.gov (United States)

1940-01-01

8217 v’arri’a’t aaINt Ilio- adasigns tip) speed’a by 1ii1) ,i vinag .10 perce’ant aI’a’aita’n Itiliil tha’ thar’ist a’auaflia’i’iit o’’~af n faictaoi

Validation of the rapid fluorescent focus inhibition test for rabies virus-neutralizing antibodies in clinical samples

NARCIS (Netherlands)

Kostense, Stefan; Moore, Susan; Companjen, Arjen; Bakker, Alexander B. H.; Marissen, Wilfred E.; von Eyben, Rie; Weverling, Gerrit Jan; Hanlon, Cathleen; Goudsmit, Jaap

2012-01-01

Monoclonal antibodies are successful biologics in treating a variety of diseases, including the prevention or treatment of viral infections. CL184 is a 1:1 combination of two human monoclonal IgG1 antibodies (CR57 and CR4098) against rabies virus, produced in the PER.C6 human cell line. The two

Increasing awareness among fluid milk processors of the economic feasibility of energy efficiency projects, and encouraging their adoption through access to benchmarking and other decision-support tools

Science.gov (United States)

Based on a study done by Thoma et al. (2010) the energy used in fluid milk processing in the United States of America is responsible for approximately 2 million metric tons of greenhouse gas (GHG) emissions within the total life cycle of milk. These emissions come from electricity use (about 75 perc...

Pärt, Arvo: De profundis. Missa Sillabica / Patric Wiklacz

Index Scriptorium Estoniae

Wiklacz, Patric

1997-01-01

Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. 7 Antiennes du Magnificat. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass)" Harmonia Mundi HMU907 182 F (CD:165F). 1996. TT:1h 16'06"

Chalearn looking at people 2015

DEFF Research Database (Denmark)

Escalera, Sergio; Fabian, Junior; Baro, Xavier

2015-01-01

Following previous series on Looking at People (LAP) competitions [14, 13, 11, 12, 2], in 2015 ChaLearn ran two new competitions within the field of Looking at People: (1) age estimation, and (2) cultural event recognition, both in still images. We developed a crowd-sourcing application to collect...... by the participants of the competition. Details of the ChaLearn LAP competitions can be found at http://gesture.chalearn.org/....

POVERTY IN AND ABOUT THE AMERINDIOS PEOPLES

Directory of Open Access Journals (Sweden)

Luis Oquendo

2012-11-01

Full Text Available Poverty has come to be understood as the lack of income to cover basic needs. The World Bank (2002 defined it as hunger, while ECLAC (2000 within a more relative framework, he said, consists of "lack of economic and social resources that the referential society considers basic." Are indigenous peoples considered poor according to these conceptual frameworks? The episteme of the indigenous peoples is built with another language / language which will fit into these paradigms. However, work as an activity, as action is the universal difference between man and animals. The man when he works uses the language because the work itself is a language and constitutes the tool to organize and benefit from nature. The language of Amerindian peoples has been displaced by modernism. How does Amerindian peoples participate in the work if their language does not participate in the institutions of wage-labor societies? With these questions I will address the differentiality of the term poverty in and on Amerindian peoples.

Nutritional habits of elderly people living at home

OpenAIRE

Premoš, Barbara

2014-01-01

Aging is a process that is accompanied by biological, psychological and social changes. These changes can affect the nourishment of elderly people. Elderly people are becoming less independent with years and more dependent on others. Family members, to whom the elderly people trust the most, offer them assistance. On the market, there are various services that provide assistance in different cases. In the diploma work I have been investigating how the elderly people eat, which foods are u...

Older people, food and satisfaction with life

DEFF Research Database (Denmark)

Dean, Moira; Raats, Monique M.; Grunert, Klaus G.

2009-01-01

This chapter discusses food-related satisfaction with life of older people, identifying some of the determinants and barriers to satisfaction with food-related quality of life, and discusses possible ways of enhancing older people's quality of life in the domain of food. Despite being strongly...... associated with life, and heavily contributing to the quality of life, food has so far been neglected and not much research has been conducted into people's satisfaction with their food-related life and its relationship to overall life satisfaction. As people age, their goals and available resources in terms...... of health, social networks, income and skills change. Changes in resources can be expected to have an impact on satisfaction with life....

Body weight, anorexia, and undernutrition in older people.

Science.gov (United States)

Soenen, Stijn; Chapman, Ian M

2013-09-01

Ideal body weight for maximum life expectancy increases with advancing age. Older people, however, tend to weigh less than younger adults, and old age is also associated with a tendency to lose weight. Weight loss in older people is associated with adverse outcomes, particularly if unintentional, and initial body weight is low. When older people lose weight, more of the tissue lost is lean tissue (mainly skeletal muscle) than in younger people. When excessive, the loss of lean muscle tissue results in sarcopenia, which is associated with poor health outcomes. Unintentional weight loss in older people may be a result of protein-energy malnutrition, cachexia, the physiological anorexia of aging, or a combination of these. The physiological anorexia of aging is a decrease in appetite and energy intake that occurs even in healthy people and is possibly caused by changes in the digestive tract, gastrointestinal hormone concentrations and activity, neurotransmitters, and cytokines. A greater understanding of this decrease in appetite and energy intake during aging, and the responsible mechanisms, may aid the search for ways to treat undernutrition and weight loss in older people. Copyright © 2013 American Medical Directors Association, Inc. Published by Elsevier Inc. All rights reserved.

Urban Bird Feeding: Connecting People with Nature.

Directory of Open Access Journals (Sweden)

Daniel T C Cox

Full Text Available At a time of unprecedented biodiversity loss, researchers are increasingly recognizing the broad range of benefits provided to humankind by nature. However, as people live more urbanized lifestyles there is a progressive disengagement with the natural world that diminishes these benefits and discourages positive environmental behaviour. The provision of food for garden birds is an increasing global phenomenon, and provides a readily accessible way for people to counter this trend. Yet despite its popularity, quite why people feed birds remains poorly understood. We explore three loosely defined motivations behind bird feeding: that it provides psychological benefits, is due to a concern about bird welfare, and/or is due to a more general orientation towards nature. We quantitatively surveyed households from urban towns in southern England to explore attitudes and actions towards garden bird feeding. Each household scored three Likert statements relating to each of the three motivations. We found that people who fed birds regularly felt more relaxed and connected to nature when they watched garden birds, and perceived that bird feeding is beneficial for bird welfare while investing time in minimising associated risks. Finally, feeding birds may be an expression of a wider orientation towards nature. Overall, we found that the feelings of being relaxed and connected to nature were the strongest drivers. As urban expansion continues both to threaten species conservation and to change peoples' relationship with the natural world, feeding birds may provide an important tool for engaging people with nature to the benefit of both people and conservation.

Older people dying with dementia: a nationwide study

NARCIS (Netherlands)

Meeussen, K.; van den Block, L.; Echteld, M.; Boffin, N.; Bilsen, J.; van Casteren, V.; Deliens, L.

2012-01-01

Background: Large-scale nationwide data describing the end-of-life characteristics of older people with dementia are lacking. This paper describes the dying process and end-of-life care provided to elderly people with mild or severe dementia in Belgium. It compares with elderly people dying without

Perceived stigma and associated factors among people with ...

African Journals Online (AJOL)

Background: Epilepsy is the world's most common neurological disorder, affecting approximately 69 million people worldwide. Perceived stigma affects many domains of the lives of people with epilepsy. However, in Ethiopia there is dearth of study on perceived stigma specifically among people with epilepsy. Objective: To ...

Seniors-on-line: introducing older people to technology.

Science.gov (United States)

Irizarry, C; Downing, A; Elford, C

1997-03-01

Retired Engineers are playing an important role in ensuring that older people are not excluded from the benefits of technological advances. Technology is playing an increasingly important role in the lives of older people as it is incorporated into assistive devices, home security, access to health care, banking, communication and many other areas. However, if older people are unfamiliar with new technologies and find them daunting, they may not benefit fully from these advances. In order to minimize difficulties arising from unfamiliarity with technology, an introductory computer course was offered to people aged 55 and over. Teaching methods appropriate to the needs of older people were used: small classes, students and instructors from same age cohort, slow pace of presentation and ample opportunity to ask questions. Retired Engineers make up the majority of instructors. Three hundred and sixty nine older people have participated in the course and most plan to continue using a computer.

Mladé nezávislé cestování ve městech: případová studie v Praze

OpenAIRE

Kačmáčková, Kamila

2012-01-01

The subject of this bachelor thesis is an alternative form of tourism, the youth independent travelling, which is an increasingly important aspiration for young people around the world. Theoretical part describes specific traits of young travellers, the evaluation of tourism in Prague and it draws attention to the issues of concentration of tourism. Practical part of the thesis focuses on research of young travelers and their perception of Prague. It evaluates information sources and reveals ...

Relationship between lung function and quantitative computed tomographic parameters of airway remodeling, air trapping, and emphysema in patients with asthma and chronic obstructive pulmonary disease: A single-center study.

Science.gov (United States)

Hartley, Ruth A; Barker, Bethan L; Newby, Chris; Pakkal, Mini; Baldi, Simonetta; Kajekar, Radhika; Kay, Richard; Laurencin, Marie; Marshall, Richard P; Sousa, Ana R; Parmar, Harsukh; Siddiqui, Salman; Gupta, Sumit; Brightling, Chris E

2016-05-01

There is a paucity of studies comparing asthma and chronic obstructive pulmonary disease (COPD) based on thoracic quantitative computed tomographic (QCT) parameters. We sought to compare QCT parameters of airway remodeling, air trapping, and emphysema between asthmatic patients and patients with COPD and explore their relationship with airflow limitation. Asthmatic patients (n = 171), patients with COPD (n = 81), and healthy subjects (n = 49) recruited from a single center underwent QCT and clinical characterization. Proximal airway percentage wall area (%WA) was significantly increased in asthmatic patients (62.5% [SD, 2.2]) and patients with COPD (62.7% [SD, 2.3]) compared with that in healthy control subjects (60.3% [SD, 2.2], P Emphysema assessed based on lung density measured by using Hounsfield units below which 15% of the voxels lie (Perc15) was a feature of COPD only (patients with COPD: mean, -964 [SD, 19.62] vs asthmatic patients: mean, -937 [SD, 22.7] and healthy subjects: mean, -937 [SD, 17.1], P < .001). Multiple regression analyses showed that the strongest predictor of lung function impairment in asthmatic patients was %WA, whereas in the COPD and asthma subgrouped with postbronchodilator FEV1 percent predicted value of less than 80%, it was air trapping. Factor analysis of QCT parameters in asthmatic patients and patients with COPD combined determined 3 components, with %WA, air trapping, and Perc15 values being the highest loading factors. Cluster analysis identified 3 clusters with mild, moderate, or severe lung function impairment with corresponding decreased lung density (Perc15 values) and increased air trapping. In asthmatic patients and patients with COPD, lung function impairment is strongly associated with air trapping, with a contribution from proximal airway narrowing in asthmatic patients. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

Relationships between water table and model simulated ET

Science.gov (United States)

Prem B. Parajuli; Gretchen F. Sassenrath; Ying Ouyang

2013-01-01

This research was conducted to develop relationships among evapotranspiration (ET), percolation (PERC), groundwater discharge to the stream (GWQ), and water table fluctuations through a modeling approach. The Soil and Water Assessment Tool (SWAT) hydrologic and crop models were applied in the Big Sunflower River watershed (BSRW; 7660 km2) within the Yazoo River Basin...

Are groups working in the Information Technology class? | Mentz ...

African Journals Online (AJOL)

We discuss teache rs' perce ption of the use of group work in the Information Technology (IT) classroom. We describe the current situation regarding the implementation of group work in IT classrooms in South Africa as well as the challenges that IT teachers face when implementing group work. This information will be used ...

Parental Attitudes and Young People's Online Sexual Activities

Science.gov (United States)

Sorbring, Emma; Hallberg, Jonas; Bohlin, Margareta; Skoog, Therése

2015-01-01

Parental attitudes towards young people's sexuality in traditional (i.e. non-online media) settings have been associated with young people's sexual activities. In this study, we explored the association between key parent and youth characteristics and parental attitudes towards young people's online sexual activities. We also examined the…

Young People Volunteering in Uganda

OpenAIRE

Riiser, Nina Milling

2011-01-01

Socio economic conditions in Uganda causes the youth to be caught between childhood and adulthood. They are young people moving towards adulthood, with no option of becoming independent. How does volunteering affect the youth and why does the youth volunteer? Does the youth get closer to adulthood by volunteering and what di they gain? Socio economic conditions in Uganda causes the youth to be caught between childhood and adulthood. They are young people moving towards adulthood, with no o...

Dietary management of older people with diabetes.

Science.gov (United States)

McClinchy, Jane

2018-05-02

Diabetes UK's revised nutrition guidelines for the prevention and management of diabetes, published recently, encourage education in self-management and include additional guidance for older people with diabetes. The incidence of diabetes in older people is increasing. Many older people with diabetes are healthy and mobile, and live in the community, but a number are frail and living in care homes. Those who are frail are at increased risk of malnutrition from a range of causes. Older people with diabetes should be assessed for malnutrition risk and referred to a dietitian if required. Management of these patients focuses on foods that are high in protein and energy foods. A case study gives an example of how a community nurse may be involved.

The Musical Taste of Young People

Science.gov (United States)

Mozgot, V. G.

2014-01-01

Data from a longitudinal survey of the musical tastes of young people distinguish five basic vectors of its development: an orientation toward the Western paradigm; young people's unlimited amount of time spent in the consumption of music; the indiscriminate nature of their music interests; the influence that a person's membership in a particular…

The Human Element: Believing in People.

Science.gov (United States)

Boyle, Peter S.

1996-01-01

Suggestions for developing a creative and synergistic organization include the following: believe that people want to do their effective best in their work; communicate with people face-to-face; share virtually all information regularly and freely; use humor to create an upbeat work atmosphere; and always establish a timeline when asking someone…

Cognitive Changes among Institutionalized Elderly People

Science.gov (United States)

Navarro, Jose I.; Menacho, Inmaculada; Alcalde, Concepcion; Marchena, Esperanza; Ruiz, Gonzalo; Aguilar, Manuel

2009-01-01

The efficiency of different cognitive training procedures in elderly people was studied. Two types of methods to train cognitive and memory functions were compared. One method was based on new technologies and the other one on pencil-and-paper activities. Thirty-six elderly institutionalized people aged 68-94 were trained. Quantitative and memory…

People who use

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. People who use. Three companies are employing the technologies in India. One company is in the advanced stages in being able to commercialize the products in Malaysia shortly. Some new collaborations are being built.

Emotion recognition in Chinese people with schizophrenia.

Science.gov (United States)

Chan, Chetwyn C H; Wong, Raymond; Wang, Kai; Lee, Tatia M C

2008-01-15

This study examined whether people with paranoid or nonparanoid schizophrenia would show emotion-recognition deficits, both facial and prosodic. Furthermore, this study examined the neuropsychological predictors of emotion-recognition ability in people with schizophrenia. Participants comprised 86 people, of whom: 43 were people diagnosed with schizophrenia and 43 were controls. The 43 clinical participants were placed in either the paranoid group (n=19) or the nonparanoid group (n=24). Each participant was administered the Facial Emotion Recognition task and the Prosodic Recognition task, together with other neuropsychological measures of attention and visual perception. People suffering from nonparanoid schizophrenia were found to have deficits in both facial and prosodic emotion recognition, after correction for the differences in the intelligence and depression scores between the two groups. Furthermore, spatial perception was observed to be the best predictor of facial emotion identification in individuals with nonparanoid schizophrenia, whereas attentional processing control predicted both prosodic emotion identification and discrimination in nonparanoid schizophrenia patients. Our findings suggest that patients with schizophrenia in remission may still suffer from impairment of certain aspects of emotion recognition.

Human Rights and Indigenous Peoples

Directory of Open Access Journals (Sweden)

Garth Nettheim

2009-09-01

Full Text Available The paper begins by noting the low level of reference to Indigenous Australians in the Commonwealth Constitution at the start of Federation, and goes on to discuss the limits to what was achieved by the 1967 amendments. The situation represents a marked contrast with the USA and Canada in terms of treaties and constitutional recognition. In Australia, particularly during the period of the ‘Reconciliation’ process in the 1990s, important steps were taken by Indigenous Australians to identify items of ‘unfinished business’ in a ‘Statement of Indigenous Rights’. But there has been limited progress to meet these aspirations. And Australian law still lacks a tradition of recognition of human rights generally, let alone Indigenous rights. International law, too, largely lacked recognition of human rights, generally prior to the adoption in 1945 of the Charter of the United Nations. The brief references in the Charter were subsequently developed in a range of declarations and of treaties. These applied to people generally, with scant reference to Indigenous peoples. But, since the 1970s, there has been growing international recognition of the rights of Indigenous peoples under existing declarations and treaties. Since the 1990s, in particular, the UN system has established specific mechanisms for addressing such issues. On 13 September 2007, the General Assembly finally adopted a Declaration on the Rights of Indigenous Peoples.

Recensiones

Directory of Open Access Journals (Sweden)

M.L. Neira

1995-01-01

Full Text Available RESEÑA 1 de : Blázquez, J.M.; Martínez Pinna, J.; Montero, S. Historia de ias Religiones antiguas. Oriente, Grecia y Roma. Madrid : Cátedra, 1993. RESEÑA 2 de : Blázquez, J.M. Fenicios, Griegos y Cartagineses en Occidente. Madrid : Cátedra. RESEÑA 3 de : Alvar, J.; Blázquez, J.M.; Fernández, S.; López, G.; Monteagudo, A.(y otros. Cristianismo primitivo y religiones mistéricas. Madrid : Cátedra, 1995. RESEÑA 4 de : Blázquez, J.M.; Martínez Pinna, J.; Montero, S.; (y otros. Historia de las Religiones de la Europa Antigua. Madrid : Cátedra, 1994

Perspectivas de la niñez adulta: El cómic como espacio de denuncia desde la marginalidad de sus personajes

Directory of Open Access Journals (Sweden)

Ana Merino

2010-01-01

Full Text Available Este artículo analiza la representación de la niñez en varios cómics iberoamericanos: Mafalda de Quino, Paracuellos de Carlos Jiménez y Socorro de Miguel Rep. En ellos se articula la infancia desde una perspectiva adulta y crítica con la sociedad mostrando una dimensión comprometida que interpela al lector. This article analyzes the representation of childhood in several Latin American comics: Mafalda by Quino, Paracuellos by Carlos Jiménez, and Socorro by Miguel Rep. In these comics, infancy is articulated from an adult angle critical with society, showing a dimension of commitment appealing to their readership.

Young People with a Twist

DEFF Research Database (Denmark)

Sørensen, Bo Wagner; Madsen, Diana Højlund

The report is based on group interviews with 33 young people with ethnic minority backgrounds. They have been asked about their educational and vocational wishes and also touch on a number of issues such as family, gender equality, discrimination and integration.......The report is based on group interviews with 33 young people with ethnic minority backgrounds. They have been asked about their educational and vocational wishes and also touch on a number of issues such as family, gender equality, discrimination and integration....

Communication Support for People with ALS

Directory of Open Access Journals (Sweden)

David Beukelman

2011-01-01

Full Text Available Almost all people with amyotrophic lateral sclerosis (ALS experience a motor speech disorder, such as dysarthria, as the disease progresses. At some point, 80 to 95% of people with ALS are unable to meet their daily communication needs using natural speech. Unfortunately, once intelligibility begins to decrease, speech performance often deteriorates so rapidly that there is little time to implement an appropriate augmentative and alternative communication (AAC intervention; therefore, appropriate timing of referral for AAC assessment and intervention continues to be a most important clinical decision-making issue. AAC acceptance and use have increased considerably during the past decade. Many people use AAC until within a few weeks of their deaths.

How Do People Cope with Muscular Dystrophy?

Science.gov (United States)

... topic are answered in this section. How do people cope with muscular dystrophy (MD)? Although MD presents ... improve health and quality of life. Almost all people with any form of MD experience a worsening ...

Nurse Educator Attitudes Toward People With Disabilities.

Science.gov (United States)

Lyon, Lori; Houser, Rick

As educators strongly influence the attitudes of their students, the purpose of this study was to determine nurse educator attitudes toward people with disabilities. Inadequate education of health professionals is a known barrier to care for people with disability. Continuing calls for improved education of health professionals compel an assessment of nurse educator attitudes. This was a cross-sectional, correlational web-based survey of nurse educators (n = 126). Nurse educator attitudes were analyzed using descriptive statistics, analysis of variance, and multiple regression analysis. Nurse educators held discriminatory attitudes toward people with disabilities, though most preferred a biopsychosocial model of disability. Forty-four percent lacked knowledge of disability-related aims, objectives, or outcomes within the curriculum. To advance equity in health care, nurse educators must confront personal bias and teach competent care of people with disabilities.

On interviewing people with pets: reflections from qualitative research on people with long-term conditions.

Science.gov (United States)

Ryan, Sara; Ziebland, Sue

2015-01-01

There is mounting evidence that pets are associated with physiological, psychological and social benefits for humans. Much of this research has come from western countries, where there have been consistent calls for greater engagement with pet ownership and health. Drawing on a secondary analysis of 61 in-depth interviews with people, or carers of people, with long-term conditions, we explore how pets feature in people's narrative accounts of their experiences. Our findings demonstrate the multifaceted nature of people's relationships with pets, and the embedded and embodied ways in which human-nonhuman interactions are played out in narratives of chronic illness. Our study differs from other work on pets and health in that, by returning to the interview video recordings, we were able to explore the sometimes three-way interactions, the co(a)gency, between participants, pets and researchers. Pets were often presented as important family members, yet the researchers' responses to the presence or talk about pets was often markedly different from their reactions to other household members. We conclude with cautioning against the downgrading of pets in narrative health research. Narrative approaches may invite participants to talk about what is important to them, yet they clearly have limitations in practice. © 2015 The Authors. Sociology of Health & Illness © 2015 Foundation for the Sociology of Health & Illness/John Wiley & Sons Ltd.

The 'unnecessary' use of emergency departments by older people: findings from hospital data, hospital staff and older people.

Science.gov (United States)

Faulkner, Debbie; Law, Julia

2015-11-01

Increasing demands are being placed on emergency departments in Australia and there is a view that older Australians are more likely than other age groups to attend for non-urgent conditions. The objective of this paper is to compare and contrast administrative data with the views of hospital staff and older people with regard to their presentation at two emergency departments in metropolitan Adelaide and how this aligns with the Australian Institute of Health and Welfare definition of 'potentially avoidable general practitioner-type presentations'. The study used three sources of data from two emergency departments: hospital data for the financial year 2010-11 for patients aged 65 years and over and identified as triage category four or five; three focus groups with medical, nursing and allied staff from these two hospitals; and interviews with 58 older people who presented at the two emergency departments over a two-week period. The hospital administrative data provided a very limited insight into why older people attended the emergency department, other than the medical diagnosis. Professional staff identified individual determinants, societal determinants and the health services system as explanations. Older people attended the emergency department for a range of reasons that may not necessarily reflect the opinions of health professionals. For many older people the emergency department was an appropriate place to attend considering their condition, though some presentations could be circumvented with appropriate and increased services in the community. However, as many older people suffer comorbidities, careful consideration needs to be given as to the best possible practices to achieve this.

Acceptability for French People of Physician-Assisted Suicide

Science.gov (United States)

Frileux, Stephanie; Sastre, Maria Teresa Munoz; Antonini, Sophie; Mullet, Etienne; Sorum, Paul Clay

2004-01-01

Our aim was to understand better how people judge the acceptability of physician-assisted suicide (PAS). We found that, for people in France of all ages and for elderly people with life-threatening illnesses, acceptability is an additive combination of the number of requests for PAS, the patient's age, the amount of physical suffering, and the…

Comparison of anxiety as reported by older people with intellectual disabilities and by older people with normal intelligence

NARCIS (Netherlands)

Hermans, H.; Beekman, A.T.F.; Evenhuis, H.M.

2014-01-01

Objectives Older people with intellectual disabilities (ID) may experience more and different symptoms of anxiety than older people with normal intelligence. Study questions: (1) Is the reported severity of anxiety in this group similar to that in the general older population; (2) Are specific

Priorities for children and young people - opportunities and challenges for children and young people's nurses.

Science.gov (United States)

Smith, Fiona

2016-05-09

Across Europe children's nurses today face many challenges, including rising childhood obesity, the soaring incidence of issues with the mental health of children and young people, the effects of social media, child maltreatment and the impact of poverty, war and conflict on children and families. There are opportunities for children's nurses to undertake new roles and to influence both policy and practice to improve the health outcomes of children and young people, and thereby the future health of the population.

India | Page 121 | IDRC - International Development Research Centre

International Development Research Centre (IDRC) Digital Library (Canada)

Read more about Environmental pollution. Language English. Dans le monde arabe, on assiste à des percées historiques alors que tombent les obstacles au plein exercice, par les femmes, de leurs droits de citoyennes dans leur propre pays. Depuis quelques années, en Algérie, en Égypte et au Maroc, des femmes ...

THE ACTIVE FUTURE OF THE AGED PEOPLE IN SPAIN

Directory of Open Access Journals (Sweden)

ANTONIO GUTIÉRREZ RESA

2015-11-01

Full Text Available In the following article we try to establish the foundations that support “the active future of the aged people in Spain”. We base our work on data from the National Institute of Statistics (INE, the Statistics Annuary of Spain, the Information System of the System for Autonomy and Dependency Caring (SISAAD and the Aged People Observatory-Institute of Aged People and Social Services (IMSERSO. Actually, one can notice that, if human beings are linked to production and utility, after 65–70 years of age, the possibilities of happiness can be accomplished now. We try to show that, with the number of people aged over 65 (8 million people in Spain increasing more than any other group and in acceptable health conditions, the context is more reasonable and facilitates an active future of the aged people. That is, the development of a process of optimization of health, participation and security opportunities, aiming at bettering the quality of life according as people age. We maintain that aging is not necessarily negative, the chronological age being a more and more unsatisfactory criterion. In the following pages we show the undeniable reality that we are going to live longer and probably in better conditions. Nevertheless, according to our data, it is convenient to distinguish from now on between people of 65 to 79 years and people of 80 and more. This stems, above all, from the domination of the dependency situations which go unsolved in Spain, despite the Law No. 6 of 2006. The article presents those services (IMSERSO which promote the active ageing: nurseries and clubs, vacations and thermal therapy, universities for aged people, accessibility programs and telealarms. Also presented are those services of familial solidarity promotion and maintaining: home help, residences, day nurseries and familial support services. The available data show the insufficiency of the aforementioned services in Spain. Therefore, we can say that the clearly pro

Nurses' understandings of suitable footwear for older people.

Science.gov (United States)

Borland, Andrea; Martin, Caroline Hollins; Locke, John

2013-01-01

The purpose of this paper is to gain insight into nurses' understandings of what constitutes suitable footwear for older people in care homes. An exploratory descriptive qualitative survey was carried out of 20 registered nurses employed in six Scottish care homes for older people. Data were collected using a semi-structured questionnaire that included five open-ended questions. Content analysis was used to theme footwear perceptions. Participants had several views about what encompasses safe footwear; some were erroneous. The link between inappropriate footwear and falls was recognised by 80 per cent of respondents, but some were unclear about the features that effect or inhibit safety. No UK or international standardised guidelines were identified that advise nurses about appropriate footwear for older people. It is unknown whether respondents represent the nurse population because findings are restricted by a small sample size. Nonetheless, the group showed variable understanding of what constitutes safe footwear for older people and links with fall prevention. Improved nurse-education about what comprises safe footwear and the links with falls prevention in older people is required. Structured guidelines to direct nurse educators about what to teach student nurses about appropriate footwear for older people may work towards reducing falls. No guidelines to direct nurses about appropriate footwear for older people in care homes have been written. Key points have been developed.

Attending to others: how digital technologies direct young people's nightlife

Directory of Open Access Journals (Sweden)

J. Truong

2018-05-01

Full Text Available It is a growing phenomenon that young people use mobile information and communication technologies during their nightlife. This article offers an empirical examination of how young people's nightlife is shaped by engagement with the mobile phone application WhatsApp. Drawing on Sara Ahmed's phenomenological concept of orientation, I examine how WhatsApp extends young people's nightlife and how young people become orientated therein. On the one hand, I show that nightlife acquires new boundaries and fixities that encourage young people to direct their attention towards missing social relations and absent nightlife places. On the other hand, I find that young people create new perceptions of how to inhabit and spend leisure time and space. I argue that digital technologies reorientate young people, which I suggest offers novel means of addressing young people's contemporary nightlife practices, places, spaces, and social relations.

Physical exercise for people with cirrhosis

DEFF Research Database (Denmark)

Aamann, Luise; Dam, Gitte; Rinnov, Anders

2017-01-01

This is a protocol for a Cochrane Review (Intervention). The objectives are as follows: To assess the beneficial and harmful effects of physical exercise versus no intervention for people with cirrhosis.......This is a protocol for a Cochrane Review (Intervention). The objectives are as follows: To assess the beneficial and harmful effects of physical exercise versus no intervention for people with cirrhosis....

Food patterns of Polish older people

DEFF Research Database (Denmark)

Wadolowska, L.; Danowska-Oziewicz, M.; Niedzwiedzka, E.

2006-01-01

Food patterns of Polish older people were separated and described. The research included 422 people aged 65+ years, living in 5 geographical locations. Participants of the study were selected in quota sampling. Criteria for recruitment included sex, age (65-^74 or 75+ years) and family status...... (living alone or living with other people). Respondents were asked questions about consumption of 55 food products. The factor analysis allowed for separating 21 food patterns. They included from 1 to 3 groups of products, intake of which was mutually dependant. Big number of separated food patterns...... and small number of products fonning joint food patterns speak in advocacy of relatively small reciprocal relationship between different food items consumed by the seniors in Poland....

Improving care for people with learning disabilities.

Science.gov (United States)

Turner, Sue

2014-11-25

People with learning disabilities have poorer health than the general population and experience health inequalities - partly as a result of problems with accessing health services. Health services have a duty to address health inequalities, by making reasonable adjustments to their services so they are more accessible to people with learning disabilities, but this does not always happen. Failure to make reasonable adjustments can have significant adverse effects for people with learning disabilities and their families. Nurses are well placed to implement reasonable adjustments, many of which are simple to do and can save lives.

Sudden Death in Young People--Heart Problems Often Blamed

Science.gov (United States)

Sudden death in young people: Heart problems often blamed Sudden death in young people is rare, but those at ... causes and treatments. By Mayo Clinic Staff Sudden death in people younger than 35, often due to ...

[From care to consideration of disabled people].

Science.gov (United States)

Chossy, Jean-François

2014-05-01

The law of 11th February 2005 relating to the equality of the rights and opportunities, participation and citizenship of disabled people was a major step forward. Nevertheless, more progress is needed to ensure more consideration is given to disabled people.

Sexual and reproductive health services for young people in Kenya and Zambia : Providers attitudes and young peoples needs and experiences

OpenAIRE

Warenius, Linnéa

2008-01-01

Background: Unintended pregnancy, abortion and STI, including HIV are common sexual and reproductive health problems among young people in Kenya and Zambia. Yet, the reproductive health services are underutilised. Nurses and midwives are key providers in the promotion young people s sexual and reproductive health in Kenya and Zambia. Aim: The overall aim was to describe and explore young people s sexual and reproductive health needs and experiences and to describe health ...

Review Paper: Rehabilitation of Blind People and People With Low Vision in Iran

Directory of Open Access Journals (Sweden)

Marzieh Pashmdarfard

2016-06-01

Discussion: Proper assessment of the visually disabled is required to implement the appropriate intervention technique. Occupational therapists need to pay special attention to the visually disabled people. 

Why do People Stop Playing On-Line Games?

DEFF Research Database (Denmark)

Sudzina, Frantisek; Razmerita, Liana

2012-01-01

The recent initial public offering of shares of Zynga, probably the most important on-line game provider, drew interest of potential investors but also of general public to their business model. What the most interested people learned so far is that if Zynga had not changed their accounting...... practice, they would be in red numbers for several months already. This is most likely caused by people stopping to play their games. This paper provides an estimate of what proportion of people, who played on-line games, already stopped playing them. Additionally, it analyzed the reasons why people...... stopped playing on-line games. It also compares Facebook and other on-line games....

Chernobyl liquidators. The people and the doses

International Nuclear Information System (INIS)

Belyakov, Oleg V.; Steinhaeusler, Friedrich; Trott, Klaus-Ruediger

2000-01-01

This study is an attempt to evaluate the data available from the scientific literature concerning clean-up workers, or so-called liquidators, of the Chernobyl accident. There are several different definitions of liquidators: Legal definitions of 'liquidators'. Their importance rests on the fact that some state Chernobyl registers are based on these definitions. Definitions from various scientific reports. Definitions for the purpose, which have been published in scientific papers and books. The simplified definition of liquidators would be people who were directly involved in clean-up operations in the exclusion zone in 1986-1991. Estimations of the number of liquidators vary from 100 000 to 800 000 people. Four major cohorts of liquidators are now split among Russia (168,000 people), Belarus (63,500 people), Ukraine (123,536 people) and the Baltic States (about 15,000 people from Estonia, Latvia and Lithuania). The definition of liquidator and the formation of cohort are the most critical factor in liquidator-related studies and not enough attention is paid to this matter by researchers. The term 'liquidator' describes a very heterogeneous group of people. Liquidators may be grouped according to work performed in the exclusion zone or affiliation to various organisations. The majority of liquidators in 1986-1987 were conscripts and reservists of the Soviet Union Army. According to data from Russian National Medical and Dosimetric Registry, 76% of liquidators were 25-39 years old at the moment of arrival to the Chernobyl area. Only about 1% of liquidators was women. From the results of biodosimetry we know that the average accumulated dose estimation for the liquidator group is about 0.2 Gy. The official documented average dose from the Russian National Medical Dosimetric Registry is 0.13 Gy. However, the liquidator group contains some overexposed subgroups with a higher accumulated dose. Individual dosimetry is only available for small subgroups of liquidators

Chernobyl liquidators. The people and the doses

Energy Technology Data Exchange (ETDEWEB)

Belyakov, Oleg V. [Gray Laboratory Cancer Research Trust, Mount Vernon Hospital, Northwood (United Kingdom); Steinhaeusler, Friedrich [University of Salzburg, Institute of Physic and Biophysics, Salzburg (Austria); Trott, Klaus-Ruediger [Univ. of London, Queen Mary and Westfield College, St. Bartholomew' s and the Royal London Hospital School of Medicine and Dentistry, London (United Kingdom)

2000-05-01

This study is an attempt to evaluate the data available from the scientific literature concerning clean-up workers, or so-called liquidators, of the Chernobyl accident. There are several different definitions of liquidators: Legal definitions of 'liquidators'. Their importance rests on the fact that some state Chernobyl registers are based on these definitions. Definitions from various scientific reports. Definitions for the purpose, which have been published in scientific papers and books. The simplified definition of liquidators would be people who were directly involved in clean-up operations in the exclusion zone in 1986-1991. Estimations of the number of liquidators vary from 100 000 to 800 000 people. Four major cohorts of liquidators are now split among Russia (168,000 people), Belarus (63,500 people), Ukraine (123,536 people) and the Baltic States (about 15,000 people from Estonia, Latvia and Lithuania). The definition of liquidator and the formation of cohort are the most critical factor in liquidator-related studies and not enough attention is paid to this matter by researchers. The term 'liquidator' describes a very heterogeneous group of people. Liquidators may be grouped according to work performed in the exclusion zone or affiliation to various organisations. The majority of liquidators in 1986-1987 were conscripts and reservists of the Soviet Union Army. According to data from Russian National Medical and Dosimetric Registry, 76% of liquidators were 25-39 years old at the moment of arrival to the Chernobyl area. Only about 1% of liquidators was women. From the results of biodosimetry we know that the average accumulated dose estimation for the liquidator group is about 0.2 Gy. The official documented average dose from the Russian National Medical Dosimetric Registry is 0.13 Gy. However, the liquidator group contains some overexposed subgroups with a higher accumulated dose. Individual dosimetry is only available for small

Cancer survival among Alaska Native people.

Science.gov (United States)

Nash, Sarah H; Meisner, Angela L W; Zimpelman, Garrett L; Barry, Marc; Wiggins, Charles L

2018-03-26

Recent cancer survival trends among American Indian and Alaska Native (AN) people are not well understood; survival has not been reported among AN people since 2001. This study examined cause-specific survival among AN cancer patients for lung, colorectal, female breast, prostate, and kidney cancers. It evaluated whether survival differed between cancers diagnosed in 1992-2002 (the earlier period) and cancers diagnosed in 2003-2013 (the later period) and by the age at diagnosis (<65 vs ≥65 years), stage at diagnosis (local or regional/distant/unknown), and sex. Kaplan-Meier and Cox proportional hazards models were used to estimate univariate and multivariate-adjusted cause-specific survival for each cancer. An improvement was observed in 5-year survival over time from lung cancer (hazard ratio [HR] for the later period vs the earlier period, 0.83; 95% confidence interval [CI], 0.72-0.97), and a marginally nonsignificant improvement was observed for colorectal cancer (HR, 0.81; 95% CI, 0.66-1.01). Site-specific differences in survival were observed by age and stage at diagnosis. This study presents the first data on cancer survival among AN people in almost 2 decades. During this time, AN people have experienced improvements in survival from lung and colorectal cancers. The reasons for these improvements may include increased access to care (including screening) as well as improvements in treatment. Improving cancer survival should be a priority for reducing the burden of cancer among AN people and eliminating cancer disparities. Cancer 2018. © 2018 American Cancer Society. © 2018 American Cancer Society.

What do colour-blind people really see?

NARCIS (Netherlands)

Hogervorst, M.A.; Alferdinck, J.W.A.M.

2008-01-01

Problem: colour perception of dichromats (colour-blind persons) Background: Various models have been proposed (e. g. Walraven & Alferdinck, 1997; Brettel et al. , 1997) to model reduced colour vision of colour-blind people. It is clear that colour-blind people cannot distinguish certain object

Perceptions of disaster preparedness among older people in South Korea.

Science.gov (United States)

Yoo, Myoungran; Lee, Mijung; Tullmann, Dorothy

2016-03-01

Older people are a major vulnerable population. During disasters, given their physical frailty, lower social status, loss of medications and medical care, the vulnerability of older people increases. The purpose of this study was to examine the perceptions of older people in Korea on various aspects of disaster preparedness to better understand their special needs and to facilitate appropriate disaster planning. The study was qualitative and used focus group interviews with 12 older people in one major city and one rural area of South Korea. Four themes were identified by the analysis of the interviews: defenceless state, reality of accepting limitations, strong will to live, importance of disaster preparedness governmental efforts for the older people. Findings indicated that preparation of shelters and transportation was critical to help older people survive in times of disasters and suggested that there should be active involvement of the government in terms of disaster planning, managing and preparing older people for disasters. In addition, healthy older people can be assets to disaster relief efforts by providing practical and emotional support for the most fragile older people. Older people can also provide knowledge of their special needs to the government to improve their disaster response policy. © 2015 John Wiley & Sons Ltd.

People's Judgments About Classic Property Law Cases.

Science.gov (United States)

DeScioli, Peter; Karpoff, Rachel

2015-06-01

People's judgments about property shape how they relate to other people with respect to resources. Property law cases can provide a valuable window into ownership judgments because disputants often use conflicting rules for ownership, offering opportunities to distinguish these basic rules. Here we report a series of ten studies investigating people's judgments about classic property law cases dealing with found objects. The cases address a range of issues, including the relativity of ownership, finder versus landowner rights, object location, objects below- versus above-ground, mislaid versus lost objects, contracts between landowners and finders, and the distinction between public and private space. The results show nuanced patterns in ownership judgments that are not well-explained by previous psychological theories. Also, people's judgments often conflict with court decisions and legal principles. These empirical patterns can be used to generate and test novel hypotheses about the intuitive logic of ownership.

What Makes People Good or Bad? (MisAnthropological Essay on Searching for Social/ Cultural Reasons on Judging the Other People

Directory of Open Access Journals (Sweden)

Bojan Žikić

2016-03-01

Full Text Available The aim of this paper is to discuss thinking of people which is informed by culture, social institutions and personal experiences, and which shows significant tendency not to operate in simply binary mode when it is about people from somebody’s imminent social surrounding. Two examples are presented form the nowadays Belgrade. It is argued that at least people of this particular social context, who tend to deploy more nuances in the judging on and labelling their neighbours seen as bringing some kind of disruption of the social order then to those people they think as of generic categories only, are informed by such social/cultural perspectives on human being which paramount it, but also suggest its capacity for serious wrong doing.

The CUIB: A source of motivation for research on librarianship and information science in Latin America

OpenAIRE

Editores Biblios

2012-01-01

Interview with Filiberto Felipe Martínez Arellano (Mexico) researcher of the Centro Universitario de Investigaciones Bibliotecologicas (CUIB) in the context of the thirtieth anniversary of this academic center.

Typology of people with first-episode psychosis.

Science.gov (United States)

Subramaniam, Mythily; Zheng, Huili; Soh, Pauline; Poon, Lye Yin; Vaingankar, Janhavi A; Chong, Siow Ann; Verma, Swapna

2016-08-01

The aim of the current study was to create a typology of patients with first-episode psychosis based on sociodemographic and clinical characteristics, service use and outcomes using cluster analysis. Data from all respondents who were accepted into the Early Psychosis Intervention Programme (EPIP), Singapore from 2007 to 2011 were analysed. A two-step clustering method was carried out to classify the patients into distinct clusters. Two clusters were identified. Cluster 1 comprised largely of younger people with mean age of 25.5 (6.0) years at treatment contact, who were predominantly male (55.3%), single (98.3%) and living with parents (86.3%). Cluster 1 had a higher proportion of people diagnosed with the schizophrenia spectrum disorder (71.4%) and with a positive family history of psychiatric illness. Patients in cluster 2 were generally older with a mean age of 33.6 (4.7) years and the majority were women (74.2%). Cluster 1 had people with higher Positive and Negative Syndrome Scale (PANSS) scores at baseline as compared with cluster 2. After a 1-year follow up, their scores were still poorer than their counterparts in cluster 2, especially for PANSS negative score. The functioning level of people in cluster 1 showed less improvement than the people in cluster 2 after a year of treatment. There is a compelling need to develop new therapies and intensively treat young people presenting with psychosis as this group tends to have poorer outcomes even after 1 year of treatment. © 2014 Wiley Publishing Asia Pty Ltd.

Emergency warning for people with disabilities.

Science.gov (United States)

Putkovich, Kenneth

2013-01-01

The intent of this article is to assess the current state of Emergency Warning capabilities in the United States and make recommendations on what needs to be done to cost effectively establish a National Emergency Warning System to best serve the people of the United States, including those with disabilities. As part of this assessment, terminology will be defined, existing systems will be examined, critical needs and functions will be explained, and recommendations made for a system to deliver emergency messages to those people immediately at risk from natural and human-caused disasters in a timely and effective manner, regardless of location or situational circumstance. The assessment will include the needs and available technologies for delivering emergency warnings to people with disabilities, which are generally little understood, poorly addressed, and often ignored.

How do people define moderation?

Science.gov (United States)

vanDellen, Michelle R; Isherwood, Jennifer C; Delose, Julie E

2016-06-01

Eating in moderation is considered to be sound and practical advice for weight maintenance or prevention of weight gain. However, the concept of moderation is ambiguous, and the effect of moderation messages on consumption has yet to be empirically examined. The present manuscript examines how people define moderate consumption. We expected that people would define moderate consumption in ways that justified their current or desired consumption rather than view moderation as an objective standard. In Studies 1 and 2, moderate consumption was perceived to involve greater quantities of an unhealthy food (chocolate chip cookies, gummy candies) than perceptions of how much one should consume. In Study 3, participants generally perceived themselves to eat in moderation and defined moderate consumption as greater than their personal consumption. Furthermore, definitions of moderate consumption were related to personal consumption behaviors. Results suggest that the endorsement of moderation messages allows for a wide range of interpretations of moderate consumption. Thus, we conclude that moderation messages are unlikely to be effective messages for helping people maintain or lose weight. Copyright © 2016 Elsevier Ltd. All rights reserved.

Consumer panel study on elderly people's wishes concerning services.

Science.gov (United States)

Valkila, Noora; Litja, Heli; Aalto, Leena; Saari, Arto

2010-01-01

This study informs on the wishes and needs of elderly people themselves regarding services for the elderly. The data for the study were gathered using a consumer panel method. Elderly people desire assistance in heavy cleaning chores, in outdoor activities and in carrying out their personal business. Elderly people felt that there should be more recreational services available. Elderly people link aging with feelings of insecurity and loneliness. Becoming a service user for the first time is felt to be a very difficult step to take, and so this decision is postponed as long as possible. The elderly people desire a service for assessing their individual service needs in an organized, expert and objective fashion. The study indicates that elderly people value the human contact gained through service provision. The consumer panel method for collecting data was successful. Copyright © 2009 Elsevier Ireland Ltd. All rights reserved.

Auditory Memory deficit in Elderly People with Hearing Loss

Directory of Open Access Journals (Sweden)

Zahra Shahidipour

2013-06-01

Full Text Available Introduction: Hearing loss is one of the most common problems in elderly people. Functional side effects of hearing loss are various. Due to the fact that hearing loss is the common impairment in elderly people; the importance of its possible effects on auditory memory is undeniable. This study aims to focus on the hearing loss effects on auditory memory.   Materials and Methods: Dichotic Auditory Memory Test (DVMT was performed on 47 elderly people, aged 60 to 80; that were divided in two groups, the first group consisted of elderly people with hearing range of 24 normal and the second one consisted of 23 elderly people with bilateral symmetrical ranged from mild to moderate Sensorineural hearing loss in the high frequency due to aging in both genders.   Results: Significant difference was observed in DVMT between elderly people with normal hearing and those with hearing loss (P

Future Remains: Industrial Heritage at the Hanford Plutonium Works

Science.gov (United States)

Freer, Brian

This dissertation argues that U.S. environmental and historic preservation regulations, industrial heritage projects, history, and art only provide partial frameworks for successfully transmitting an informed story into the long range future about nuclear technology and its related environmental legacy. This argument is important because plutonium from nuclear weapons production is toxic to humans in very small amounts, threatens environmental health, has a half-life of 24, 110 years and because the industrial heritage project at Hanford is the first time an entire U.S. Department of Energy weapons production site has been designated a U.S. Historic District. This research is situated within anthropological interest in industrial heritage studies, environmental anthropology, applied visual anthropology, as well as wider discourses on nuclear studies. However, none of these disciplines is really designed or intended to be a completely satisfactory frame of reference for addressing this perplexing challenge of documenting and conveying an informed story about nuclear technology and its related environmental legacy into the long range future. Others have thought about this question and have made important contributions toward a potential solution. Examples here include: future generations movements concerning intergenerational equity as evidenced in scholarship, law, and amongst Native American groups; Nez Perce and Confederated Tribes of the Umatilla Indian Reservation responses to the Hanford End State Vision and Hanford's Canyon Disposition Initiative; as well as the findings of organizational scholars on the advantages realized by organizations that have a long term future perspective. While these ideas inform the main line inquiry of this dissertation, the principal approach put forth by the researcher of how to convey an informed story about nuclear technology and waste into the long range future is implementation of the proposed Future Remains clause, as

Mapping of past stand-level forest disturbances and estimation of time since disturbance using simulated spaceborne LiDAR data

Science.gov (United States)

Sanchez Lopez, N.; Hudak, A. T.; Boschetti, L.

2017-12-01

, and Elk Creek watersheds ( 54,000 ha) within the Nez Perce-Clearwater National Forest in Idaho, where airborne LiDAR and reference maps on TSD were available. Simulated GEDI footprints and waveforms were obtained from airborne LiDAR point clouds and the results were compared to similar analysis performed with airborne LiDAR.

Salmonid Gamete Preservation in the Snake River Basin, 2001 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Armstrong, Robyn; Kucera, Paul

2002-06-01

Steelhead (Oncorhynchus mykiss) and chinook salmon (Oncorhynchus tshawytscha) populations in the Northwest are decreasing. Genetic diversity is being lost at an alarming rate. Along with reduced population and genetic variability, the loss of biodiversity means a diminished environmental adaptability. The Nez Perce Tribe (Tribe) strives to ensure availability of genetic samples of the existing male salmonid population by establishing and maintaining a germplasm repository. The sampling strategy, initiated in 1992, has been to collect and preserve male salmon and steelhead genetic diversity across the geographic landscape by sampling within the major river subbasins in the Snake River basin, assuming a metapopulation structure existed historically. Gamete cryopreservation conserves genetic diversity in a germplasm repository, but is not a recovery action for listed fish species. The Tribe was funded in 2001 by the Bonneville Power Administration (BPA) and the U.S. Fish and Wildlife Service Lower Snake River Compensation Plan (LSRCP) to coordinate gene banking of male gametes from Endangered Species Act (ESA) listed steelhead and spring and summer chinook salmon in the Snake River basin. In 2001, a total of 398 viable chinook salmon semen samples from the Lostine River, Catherine Creek, upper Grande Ronde River, Lookingglass Hatchery (Imnaha River stock), Lake Creek, the South Fork Salmon River weir, Johnson Creek, Big Creek, Capehorn Creek, Marsh Creek, Pahsimeroi Hatchery, and Sawtooth Hatchery (upper Salmon River stock) were cryopreserved. Also, 295 samples of male steelhead gametes from Dworshak Hatchery, Fish Creek, Grande Ronde River, Little Sheep Creek, Pahsimeroi Hatchery and Oxbow Hatchery were also cryopreserved. The Grande Ronde chinook salmon captive broodstock program stores 680 cryopreserved samples at the University of Idaho as a long-term archive, half of the total samples. A total of 3,206 cryopreserved samples from Snake River basin steelhead and

Salmonid Gamete Preservation in the Snake River Basin, Annual Report 2002.

Energy Technology Data Exchange (ETDEWEB)

Young, William; Kucera, Paul

2003-07-01

In spite of an intensive management effort, chinook salmon (Oncorhynchus tshawytscha) and steelhead (Oncorhynchus mykiss) populations in the Northwest have not recovered and are currently listed as threatened species under the Endangered Species Act. In addition to the loss of diversity from stocks that have already gone extinct, decreased genetic diversity resulting from genetic drift and inbreeding is a major concern. Reduced population and genetic variability diminishes the environmental adaptability of individual species and entire ecological communities. The Nez Perce Tribe (NPT), in cooperation with Washington State University and the University of Idaho, established a germplasm repository in 1992 in order to preserve the remaining salmonid diversity in the region. The germplasm repository provides long-term storage for cryopreserved gametes. Although only male gametes can be cryopreserved, conserving the male component of genetic diversity will maintain future management options for species recovery. NPT efforts have focused on preserving salmon and steelhead gametes from the major river subbasins in the Snake River basin. However, the repository is available for all management agencies to contribute gamete samples from other regions and species. In 2002 a total of 570 viable semen samples were added to the germplasm repository. This included the gametes of 287 chinook salmon from the Lostine River, Catherine Creek, upper Grande Ronde River, Imnaha River (Lookingglass Hatchery), Lake Creek, South Fork Salmon River, Johnson Creek, Big Creek, Capehorn Creek, Marsh Creek, Pahsimeroi River (Pahsimeroi Hatchery), and upper Salmon River (Sawtooth Hatchery) and the gametes of 280 steelhead from the North Fork Clearwater River (Dworshak Hatchery), Fish Creek, Little Sheep Creek, Pahsimeroi River (Pahsimeroi Hatchery) and Snake River (Oxbow Hatchery). In addition, gametes from 60 Yakima River spring chinook and 34 Wenatchee River coho salmon were added to the

BIG SKY CARBON SEQUESTRATION PARTNERSHIP

Energy Technology Data Exchange (ETDEWEB)

Susan M. Capalbo

2005-01-31

The Big Sky Carbon Sequestration Partnership, led by Montana State University, is comprised of research institutions, public entities and private sectors organizations, and the Confederated Salish and Kootenai Tribes and the Nez Perce Tribe. Efforts under this Partnership in Phase I fall into four areas: evaluation of sources and carbon sequestration sinks that will be used to determine the location of pilot demonstrations in Phase II; development of GIS-based reporting framework that links with national networks; designing an integrated suite of monitoring, measuring, and verification technologies and assessment frameworks; and initiating a comprehensive education and outreach program. The groundwork is in place to provide an assessment of storage capabilities for CO{sub 2} utilizing the resources found in the Partnership region (both geological and terrestrial sinks), that would complement the ongoing DOE research. Efforts are underway to showcase the architecture of the GIS framework and initial results for sources and sinks. The region has a diverse array of geological formations that could provide storage options for carbon in one or more of its three states. Likewise, initial estimates of terrestrial sinks indicate a vast potential for increasing and maintaining soil C on forested, agricultural, and reclaimed lands. Both options include the potential for offsetting economic benefits to industry and society. Steps have been taken to assure that the GIS-based framework is consistent among types of sinks within the Big Sky Partnership area and with the efforts of other western DOE partnerships. The Partnership recognizes the critical importance of measurement, monitoring, and verification technologies to support not only carbon trading but all policies and programs that DOE and other agencies may want to pursue in support of GHG mitigation. The efforts in developing and implementing MMV technologies for geological sequestration reflect this concern. Research is

Evaluate Potential Means of Rebuilding Sturgeon Populations in the Snake River between Lower Granite and Hells Canyon Dams, 1997 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Hoefs, Nancy (Nez Perce Tribe, Department of Fisheries Resource Management, Lapwai, ID)

2004-02-01

During 1997 the first phase of the Nez Perce Tribe White Sturgeon Project was completed and the second phase was initiated. During Phase I the ''Upper Snake River White Sturgeon Biological Assessment'' was completed, successfully: (1) compiling regional white sturgeon management objectives, and (2) identifying potential mitigation actions needed to rebuild the white sturgeon population in the Snake River between Hells Canyon and Lower Granite dams. Risks and uncertainties associated with implementation of these potential mitigative actions could not be fully assessed because critical information concerning the status of the population and their habitat requirements were unknown. The biological risk assessment identified the fundamental information concerning the white sturgeon population that is needed to fully evaluate the effectiveness of alternative mitigative strategies. Accordingly, a multi-year research plan was developed to collect specific biological and environmental data needed to assess the health and status of the population and characterize habitat used for spawning and rearing. In addition, in 1997 Phase II of the project was initiated. White sturgeon were captured, marked, and population data were collected between Lower Granite Dam and the mouth of the Salmon River. During 1997, 316 white sturgeon were captured in the Snake River. Of these, 298 were marked. Differences in the fork length frequency distributions of the white sturgeon were not affected by collection method. No significant differences in length frequency distributions of sturgeon captured in Lower Granite Reservoir and the mid- and upper free-flowing reaches of the Snake River were detected. The length frequency distribution indicated that white sturgeon between 92 and 183 cm are prevalent in the reaches of the Snake River that were sampled. However, white sturgeon >183 have not changed markedly since 1970. I would speculate that some factor other than past over

Older peoples' lived experiences after hip fracture

DEFF Research Database (Denmark)

Rasmussen, Birgit; Uhrenfeldt, Lisbeth

add to the load of wellbeing-challenges after HF. Evidence-based knowledge in order to address the wellbeing of older people and the challenges they meet in changing times after HF is needed for professionals. Aim To explore the support older people with HF may need to optimize their wellbeing during...... striving for wellbeing in an active daily life after HF; steering-group meetings clarify clinical questions regarding functional ability after HF. This knowledge is the basis for developing the interview guide used when interviewing 13 at-home-living older people with limited functional ability prior...

Utilitarianism, poverty and development of disabled people.

Science.gov (United States)

Xavier de França, Inacia Sátiro; Freitag Pagliuca, Lorita Marlena

2007-01-01

This study aims to analyze the influences of human development factors in the experience of disabled people based on social scenarios of inequality. The data collected were standardized and allocated in thematic categories. The analysis was based on liberal utilitarianism. The conclusion is that there is legislation in Brazil that guarantees the disabled people's development in areas such as health, education and work. However despite the attempts of decision makers in combating discriminatory behaviors and the theory based on equity, these people still face difficulties in breaking the barrier of poverty and achieving all humans rights deserved.

What Makes People Good or Bad? (Mis)Anthropological Essay on Searching for Social/ Cultural Reasons on Judging the Other People

OpenAIRE

Bojan Žikić

2016-01-01

The aim of this paper is to discuss thinking of people which is informed by culture, social institutions and personal experiences, and which shows significant tendency not to operate in simply binary mode when it is about people from somebody’s imminent social surrounding. Two examples are presented form the nowadays Belgrade. It is argued that at least people of this particular social context, who tend to deploy more nuances in the judging on and labelling their neighbours seen as bringing s...

How People Get Hantavirus Pulmonary Syndrome (HPS)

Science.gov (United States)

... Preventing Seoul Virus Infection in Pet Rats and People FAQs: Seoul Virus Cleaning Up After Pet Rodents to Reduce the Risk of Seoul Virus ... Bolivia, Brazil, Chile, Panama, Paraguay, and Uruguay. Can pets ... rodents into contact with people if they catch such animals and carry them ...

Group Counseling for People with Physical Disabilities

Science.gov (United States)

Livneh, Hanoch; Wilson, Lisa M.; Pullo, Robert E.

2004-01-01

Group counseling has been used with a wide range of people who have physical disorders including psychosomatic conditions, sensory (visual and auditory) disabilities, neuromuscular and orthopedic impairments, and life-threatening diseases. The needs and concerns of these people can be generally delineated as physical, psychological, social,…

Needs of people with severe mental illness

NARCIS (Netherlands)

Wiersma, D

2006-01-01

Objective: This study reviews conceptual and methodological issues of needs for care among people with severe mental illness (SMI) and presents data on their prevalence, correlates and consequences for mental health care. Method: Focus is on the definition of the concept of need as what people can

Sibling advocates of people with intellectual disabilities.

Science.gov (United States)

Ying Li, Eria Ping

2006-06-01

The aim of this study was to examine the experience of the first generation of sibling advocates in Hong Kong. A qualitative approach was adopted and six sibling advocates of people with intellectual disabilities from one non-government organization were interviewed. Data were analyzed using a constant comparative method and content analysis. Findings revealed that the six participants were reactive in the process of taking up the caregiver responsibility and they performed three functions: to advocate for more service provision, to improve service quality, and to facilitate communication between individual service units and family members of people with intellectual disabilities. All of the participants expressed that they needed support from service providers when they tried to function as the sibling advocates. Strategies to promote the involvement of siblings of people with intellectual disabilities as advocates are discussed and it is expected that more siblings of people with intellectual disabilities will be supported to have a higher level of involvement in advocacy.

Disparities -- Healthy People 2020

Science.gov (United States)

... health based on their racial or ethnic group; religion; socioeconomic status; gender; age; mental health; cognitive, sensory, ... Contact Us Site Map Accessibility Privacy Policy Disclaimers Freedom of Information Act Healthy People 2010 Archive Nondiscrimination ...

People Are a Resource.

Science.gov (United States)

Schubert, Clarence

1979-01-01

This is a description of a model for demonstrating an approach to improving slums in Indonesia and the Philippines. The strategy of using people rather than financial capital as a resource is discussed. (SA)

An attentional bias for LEGO® people using a change detection task: Are LEGO® people animate?

Science.gov (United States)

LaPointe, Mitchell R P; Cullen, Rachael; Baltaretu, Bianca; Campos, Melissa; Michalski, Natalie; Sri Satgunarajah, Suja; Cadieux, Michelle L; Pachai, Matthew V; Shore, David I

2016-09-01

Animate objects have been shown to elicit attentional priority in a change detection task. This benefit has been seen for both human and nonhuman animals compared with inanimate objects. One explanation for these results has been based on the importance animate objects have served over the course of our species' history. In the present set of experiments, we present stimuli, which could be perceived as animate, but with which our distant ancestors would have had no experience, and natural selection could have no direct pressure on their prioritization. In the first experiment, we compared LEGO® "people" with LEGO "nonpeople" in a change detection task. In a second experiment, we attempt to control the heterogeneity of the nonanimate objects by using LEGO blocks, matched in size and colour to LEGO people. In the third experiment, we occlude the faces of the LEGO people to control for facial pattern recognition. In the final 2 experiments, we attempt to obscure high-level categorical information processing of the stimuli by inverting and blurring the scenes. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

'HAs fail to consult Irish people in UK'.

Science.gov (United States)

1992-11-10

Health authorities are failing to consult local people on their health needs, a conference on the mental health of Irish people living in the UK heard last week. Consulting Irish people was often only 'symbolic', despite the requirements of the NHS and Community Care Act, conference Chair Padraic Kenna, Director of Innisfree Housing Association, told delegates. 'The Irish caught the boat in the 1950s only to miss the boat ever since,' he said.

Brand personality traits: the Chilean Pension Fund Administrators case

Directory of Open Access Journals (Sweden)

Manuel Escobar Farfán

2017-12-01

Full Text Available Chilean pension fund industry is largely questioned by public; therefore it becomes essential to work on a strategy to enhance brand’s credibility and positioning. This study objective is to analyze and build a brand personality scale to identify consumer’s perception. An exploratory study aided by qualitative tools was carried out to track those brand’s personality traits not considered in Latorre, Martínez and Sotelo (2016. As a result, 38 personality traits have been evidenced in the pension fund administrators industry, some of which are specific to this industrial sector, such as transparency and ambition. This study findings come to complement the five dimensions identified by Aaker (1997 and subsequently validated by Latorre, Martínez y Sotelo (2016.

Additions to the Encyrtidae and Mymaridae (Chalcidoidea of India with new distribution and host records for some species

Directory of Open Access Journals (Sweden)

A. Rameshkumar

2015-06-01

Results and conclusions. A total of 961 specimens were collected, from which 883 COI sequences were obtained. The sequences generated corresponded to 289 barcoding species and 30 identified genera. The most speciose genera were Heterospilus Haliday (170 spp., Ecphylus Förster (19 spp., Allorhogas Gahan (15 spp. and Callihormius Ashmead (14 spp.. Addition of previously collected material increased the diversity of the subfamily in the region to 34 genera and 290 species. Paraphyly of Heterospilus with respect to Neoheterospilus and Heterospathius was again recovered. Twenty new species and two new genera (Sabinita Belokobylskij, Zaldívar-Riverón et Martínez, Ficobolus Martínez, Belokobylskij et Zaldívar-Riverón have been described so far from the material collected in this work.

Health care for people with disability

Directory of Open Access Journals (Sweden)

Francisco Javier Leturia Arrazola

2014-06-01

Full Text Available Although the majority of disabled people aren’t or don’t feel ill, and despite that they should be taken care of by the general medical services as many other citizens, most of them need a more intense and frequent health care. This is explained by a higher prevalence of some medical conditions as well as a higher risk of comorbidity among the people with disabilities (in comparison to the general population. At the moment there are many problems concerning accessibility, underdiagnose and overtreatment. National health systems should be able to offer all their services adapted to disabled people in order to obtain results for this group that are similar to those of the rest of the population. To achieve this objective it is necessary to improve professional competencies and skills and develop some specific health programmes.

PTSD in older bereaved people

DEFF Research Database (Denmark)

O'Connor, Maja

2010-01-01

  Late life bereavement has been associated with psychological problems, mainly depression. A few studies indicated that Posttraumatic Stress Disorder (PTSD) was an important issue to investigate in late life bereavement reactions. This study aimed to assess the prevalence of PTSD in recently...... bereaved elderly people compared to married controls and to investigate whether the loss of a spouse in old age, in contrast with earlier assumptions, could lead to PTSD. Two hundred and ninety six Danish elderly bereaved people (mean age 73 years, 113 males) were chosen from national registers and were...... subsequently assessed two months post-bereavement. They were compared with a control group of 276 married elderly people. The prevalence of PTSD and depression were measured through a self-report questionnaire. Results showed that 16% of the bereaved and 4% of the control group had a PTSD diagnosis (ES=.35...

Are People With Whiplash-Associated Neck Pain Different From People With Nonspecific Neck Pain?

Science.gov (United States)

Anstey, Ricci; Kongsted, Alice; Kamper, Steven; Hancock, Mark J

2016-10-01

Study Design Secondary analysis of a prospective cohort study with cross-sectional and longitudinal analyses. Background The clinical importance of a history of whiplash-associated disorder (WAD) in people with neck pain remains uncertain. Objective To compare people with WAD to people with nonspecific neck pain, in terms of their baseline characteristics and pain and disability outcomes over 1 year. Methods Consecutive patients with neck pain who presented to a secondary-care spine center answered a comprehensive self-report questionnaire and underwent a physical examination. Patients were classified into a group of either those with WAD or those with nonspecific neck pain. We compared the outcomes of baseline characteristics of the 2 groups, as well as pain intensity and activity limitation at follow-ups of 6 and 12 months. Results A total of 2578 participants were included in the study. Of these, 488 (19%) were classified as having WAD. At presentation, patients with WAD were statistically different from patients without WAD for almost all characteristics investigated. While most differences were small (1.1 points on an 11-point pain-rating scale and 11 percentage points on the Neck Disability Index), others, including the presence of dizziness and memory difficulties, were substantial. The between-group differences in pain and disability increased significantly (Pneck pain. Conclusion People referred to secondary care with WAD typically had more self-reported pain and disability and experienced worse outcomes than those with nonspecific neck pain. Caution is required when interpreting the longitudinal outcomes due to lower-than-optimal follow-up rates. Level of Evidence Prognosis, level 2. J Orthop Sports Phys Ther 2016;46(10):894-901. Epub 3 Sep 2016. doi:10.2519/jospt.2016.6588.

Plants and people

Science.gov (United States)

Kathryn Lynch

2012-01-01

Salal! Salmonberries! Sword ferns! The Northwest is home to a great number of native plant species that humans have used for centuries. Sadly, many local children are unaware of the history and culture connecting people and plants. Yet, from the beginning of time, plants have provided us food, medicine, and material for clothing, shelter, transportation, decoration,...

Financial situation of people living with HIV in Europe

NARCIS (Netherlands)

Schrooten, W.; Dreezen, C.; Borleffs, J.; Dijkgraaf, M.; Borchert, M.; de Graeve, D.; Hemmer, R.; Fleerackers, Y.; Colebunders, R.

2002-01-01

The objective was to investigate the financial situation of people living with HIV in Europe. Two surveys using an anonymous questionnaire were organized in Europe among people living with HIV, the first in 1996-97 and the second in 1998-99. One thousand one hundred and sixty-one people from the

Alternative Spaces of "Work" and Inclusion for Disabled People

Science.gov (United States)

Hall, Edward; Wilton, Robert

2011-01-01

Western governments have emphasized paid work as a key route to social inclusion for disabled people. Although the proportion of disabled people in "mainstream" employment has increased in recent decades, rates remain significantly below those for non-disabled people. Moreover, disabled workers continue to face discrimination and a lack of…

Perceiving groups: The people perception of diversity and hierarchy.

Science.gov (United States)

Phillips, L Taylor; Slepian, Michael L; Hughes, Brent L

2018-05-01

The visual perception of individuals has received considerable attention (visual person perception), but little social psychological work has examined the processes underlying the visual perception of groups of people (visual people perception). Ensemble-coding is a visual mechanism that automatically extracts summary statistics (e.g., average size) of lower-level sets of stimuli (e.g., geometric figures), and also extends to the visual perception of groups of faces. Here, we consider whether ensemble-coding supports people perception, allowing individuals to form rapid, accurate impressions about groups of people. Across nine studies, we demonstrate that people visually extract high-level properties (e.g., diversity, hierarchy) that are unique to social groups, as opposed to individual persons. Observers rapidly and accurately perceived group diversity and hierarchy, or variance across race, gender, and dominance (Studies 1-3). Further, results persist when observers are given very short display times, backward pattern masks, color- and contrast-controlled stimuli, and absolute versus relative response options (Studies 4a-7b), suggesting robust effects supported specifically by ensemble-coding mechanisms. Together, we show that humans can rapidly and accurately perceive not only individual persons, but also emergent social information unique to groups of people. These people perception findings demonstrate the importance of visual processes for enabling people to perceive social groups and behave effectively in group-based social interactions. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

Sud du Sahara | Page 6 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Langue French. Read more about Journal supplement features 10 years of West African health systems research. Langue English. Un virologiste canadien a réalisé une percée : il a créé un vaccin unique contre cinq maladies du bétail qui pourrait transformer la vie de millions de gens en Afrique et ailleurs dans le monde.

Effects of Moist Heat and Dry Heat on the Nutritional Value of Velvet ...

African Journals Online (AJOL)

constitute lOand 20 perc~nt of the experimental diets andfed to laying hens. The results revealed an over- ... was ci better method of heat treatment than roasting, for velvet bfans fed to the laying hens. Keywords: Heat .... 'Vegetable oil was added to make up the required amount of energy in the diets. bProvide per kg diet: Vit ...

India : Maternal and Reproductive Health at a Glance

OpenAIRE

Sameh El-Saharty; Naoko Ohno; Intissar Sarker; Federica Secci; Vikram Rajan

2014-01-01

India is the third largest economy and has the second largest population in the world. It achieved millennium development goal (MDG) on poverty reduction; however, gender inequality still persists. Maternal mortality rate is 190 deaths per 100,000 live births, representing a 65 percent decline from 1990. Fertility fell to 2.5, while contraceptive prevalence rate increased to nearly 55 perc...

Arhitektuuriuudised / Urmas Oja

Index Scriptorium Estoniae

Oja, Urmas, 1981-2012

2009-01-01

Silotorni otsas asuvast eramust USAs Alabama osariigis Hale'i maakonnas, Artechic Architects'i Ovaalsest majast Jaapanis, Boeri Studio korterelamust Itaalias Seregnos ja arhitekt Antonio Jiménez Torrecillas'i sotsiaalmajast Andaluusias

THE ASSERTIVENESS OF PEOPLE WHO PRACTICE KARATE

Directory of Open Access Journals (Sweden)

Szark-Eckardt Miroslawa

2012-04-01

Full Text Available Assertiveness is the ability to express your thoughts, beliefs and opinions without the feeling of internal tension, that is why it is a desired trait of character. One of the examples of sports disciplines in which assertiveness can play a desired role is karate. One of the aims of this paper was to answer the question, whether the act of doing karate influences the level of assertiveness among people who practice it and to compare the results with the level of assertiveness declared by people who do other sports. The method applied in this paper was the diagnostics survey, while the tool was the questionnaire form based on the Rathus Assertiveness Scale. 50 students who practice karate on regular basis and 50 students who do other sports participated in the research. It is undeniable that the level of assertiveness among people who practice karate is higher in comparison to people who do other sports. Karate doers, both men and women obtained better results compared to the second group of sportsmen/women. This regularity can be observed among men, but it is more perceptible among women. As the research presents, people who attend karate trainings at least three times a week are characterized by a higher level of assertiveness in comparison to those who attend the training once a week.

Internet Usage among Children and Young People

Directory of Open Access Journals (Sweden)

Gonca Karayagiz Muslu

2009-10-01

Full Text Available Computers have occupied increasingly central roles in children’s world with the advance of technology. They have proved to be an ideal companion for children in developing and developed countries who spend most of their time at school or home with computers. As a measure of development and modernization, technology has made people’s lives easier and contributed positively to social well-being so far while it has also brought about some problems and threats stemming from irresponsible use of Internet. Unmonitored use of Internet may cause damages in children’s and young people’s physical, psychological, social and cognitive development. It seems imperative to assure that children and young people can benefit from computers and Internet resources effectively and productively while measures for appropriate and safe use of Internet are to be taken into serious consideration. Therefore, the government offices and institutions should lay stress upon the issue; education professionals and parents should be well-informed and regularly updated; and finally children and young people should be educated and monitored to achieve a better and efficient use of Internet. In this paper, has been mentioned to negative effect of internet usage on physical, psychosocial and cognitive health of children and young people. [TAF Prev Med Bull 2009; 8(5.000: 445-450

Games people play the psychology of human relationships

CERN Document Server

Berne, Eric

2010-01-01

The bestselling Games People Play is the book that has helped millions of people understand the dynamics of relationships, by psychiatrist Eric Berne.We all play games. In every encounter with other people we are doing so. The nature of these games depends both on the situation and on who we meet.Eric Berne's classic Games People Play is the most accessible and insightful book ever written about the games we play: those patterns of behaviour that reveal hidden feelings and emotions. Wise and witty, it shows the underlying motivations behind our relationships and explores the roles that we try to play - and are forced to play.Games People Play gives you the keys to unlock the psychology of others - and yourself. You'll become more honest, more effective, and a true team player.'A brilliant, amusing, and clear catalogue of the psychological theatricals that human beings play over and over again' Kurt VonnegutEric Berne was a prominent psychiatrist and bestselling author.After inventing his groundbreaking Transa...

Accelerator developments since the ZGS by ZGS people

International Nuclear Information System (INIS)

Cho, Y.

1994-01-01

The ZGS was a facility, as well as an organization, where people got together to pursue a common goal of doing exciting science of the day. In this note, the authors describe notable events related to accelerators and accelerator people since the closing of the ZGS program some 15 years ago. Many of the same ZGS people have been carrying out the state-of-the art accelerator work around the Laboratory with the same dedication that characterized their work in the earlier days. First the authors describe how the activities were re-organized after the closing of the ZGS, the migration of people, and the organizational evolution since that time. Doing this shows the similarity between the birth of the ZGS and the birth of the Advanced Photon Source (APS). Then, some of the accelerator work by the former ZGS people are described. These include: (1) Intense Pulsed Neutron Source (IPNS), (2) GeV Electron Microtron (GEM), (3) Wake Field Accelerator Test Facility, (4) Advanced Photon Source, and (5) IPNS Upgrade

RUDO: A Home Ambient Intelligence System for Blind People.

Science.gov (United States)

Hudec, Milan; Smutny, Zdenek

2017-08-22

The article introduces an ambient intelligence system for blind people which besides providing assistance in home environment also helps with various situations and roles in which blind people may find themselves involved. RUDO, the designed system, comprises several modules that mainly support or ensure recognition of approaching people, alerting to other household members' movement in the flat, work on a computer, supervision of (sighted) children, cooperation of a sighted and a blind person (e.g., when studying), control of heating and zonal regulation by a blind person. It has a unified user interface that gives the blind person access to individual functions. The interface for blind people offers assistance with work on a computer, including writing in Braille on a regular keyboard and specialized work in informatics and electronics (e.g., programming). RUDO can complement the standard aids used by blind people at home, it increases their independence and creates conditions that allow them to become fully involved. RUDO also supports blind people sharing a home with sighted people, which contributes to their feeling of security and greater inclusion in society. RUDO has been implemented in a household for two years, which allows an evaluation of its use in practice.

Sexual Assemblages: Mobile Phones/Young People/School

Science.gov (United States)

Allen, Louisa

2015-01-01

This paper asks, what more can we think in relation to debates around young people's use of mobile phones at school? Rather than attempting to answer the question of whether mobile phones are "good" or "bad" for young people, this paper recasts the debate's ontological underpinnings. To do this feminist appropriations of the…

Young people and environment, technology, nuclear energy in France

International Nuclear Information System (INIS)

Bernhardt-Crochet, L.

1995-01-01

Young people have a particular attitude on the questions about environment and energy, and also about technology. Several inquiries show that young people are more aware of environmental questions than their elders. Their anxiety is bigger against pollution than the average of French people and it seems that they are more attentive to dangers for the planet: it is the sign of a broader opening on the world. Young people are ready to adhere to a group or association for environment and have sympathy for ecologists; they have hostility against nuclear energy. Age and education level have to be specified to complicate the question. This contribution gives some elements about the opinion of young people between 15-25 years old on environment, technology and nuclear energy in France. (N.C.)

Health-related profiles of people with lower limb loss.

Science.gov (United States)

Amtmann, Dagmar; Morgan, Sara J; Kim, Jiseon; Hafner, Brian J

2015-08-01

To construct profiles of self-reported health indicators to examine differences and similarities between people with lower limb loss and a normative sample (hereafter called the norm) and to compare health indicators between subgroups based on level and etiology of limb loss. Survey. General community. Adults with unilateral lower limb loss (N=1091) participated in this study. Eligibility criteria included lower limb loss due to trauma or dysvascular complications and regular use of a prosthesis. Not applicable. The Patient-Reported Outcomes Measurement Information System 29-item Health Profile version 1.0 measures physical function, pain interference, fatigue, sleep disturbance, anxiety, depression, and satisfaction with participation in social roles. The norm includes 5239 individuals representative of the U.S. general population in sex, age, race, ethnicity, and education. People with lower limb loss reported statistically significantly worse physical function, pain interference, and satisfaction with participation in social roles and significantly less fatigue than did the norm. People with transfemoral (ie, above-knee) amputation significantly differed in physical function from people with transtibial (ie, below-knee) amputation. Similarly, people with amputation due to trauma and dysvascular etiology significantly differed in physical function and satisfaction with social roles after adjusting for relevant clinical characteristics. People with lower limb loss generally report worse physical function, pain interference, and satisfaction with social roles than do the norm. People with dysvascular amputation reported worse physical function and satisfaction with social roles than did people with traumatic amputation. Health indicator profiles are an efficient way of providing clinically meaningful information about numerous aspects of self-reported health in people with lower limb loss. Copyright © 2015 American Congress of Rehabilitation Medicine. Published by

31 CFR 515.574 - Support for the Cuban People.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Support for the Cuban People. 515.574..., Authorizations, and Statements of Licensing Policy § 515.574 Support for the Cuban People. (a) Specific licenses....560(c) and other transactions that are intended to provide support for the Cuban people including, but...

People and renewable energy

International Nuclear Information System (INIS)

Rosenvald, Avo

2002-01-01

The use of renewable energy is tightly connected to solving social problems in Estonia by creating more new jobs. It is essential that Estonia should increase the use of biofuels. One of the biofuels, firewood, has been used already for centuries. For wider use of renewable energy in Estonia, it is not enough to rely only on enterprices. Rather, before any serious progress can take place, the state should create the appropriate legal environment. Due to its many social and environmental aspects, renewable energy is more important to the state than a sole enterprice. Unfortunately, Estonian government has been delaying its duties. Estonia has two resources that should be taken advantage of, fertile spare land and people still used to the country life. The country people would get work by growing different energy crops on the spare land. (author)

Destination Memory Impairment in Older People

OpenAIRE

Gopie, Nigel; Craik, Fergus I. M.; Hasher, Lynn

2010-01-01

Older adults are assumed to have poor destination memory— knowing to whom they tell particular information—and anecdotes about them repeating stories to the same people are cited as informal evidence for this claim. Experiment 1 assessed young and older adults’ destination memory by having participants tell facts (e.g., “A dime has 118 ridges around its edge”) to pictures of famous people (e.g., Oprah Winfrey). Surprise recognition memory tests, which also assessed confidence, revealed that o...

Finding people and their utterances in social media

OpenAIRE

Weerkamp, W.; Chen, H.-H.; Efthimiadis, E.N.; Savoy, J.; Crestani, F.; Marchand-Millet, S.

2010-01-01

The increase in usage of content creation platforms of various forms, has led to a huge number of people sharing their utterances. These so-called social media are attractive for many applications, and offering access to the information contained in them is the goal of my research. Given the two main ingredients of social media, people and their utterances, I explore ways of improving finding either of these. My research is divided into three parts: (i) finding utterances; (ii) finding people...

The reliability of three-dimensional scapular attitudes in healthy people and people with shoulder impingement syndrome

Directory of Open Access Journals (Sweden)

Hébert Luc J

2007-06-01

Full Text Available Abstract Background Abnormal scapular displacements during arm elevation have been observed in people with shoulder impingement syndrome. These abnormal scapular displacements were evaluated using different methods and instruments allowing a 3-dimensional representation of the scapular kinematics. The validity and the intrasession reliability have been shown for the majority of these methods for healthy people. However, the intersession reliability on healthy people and people with impaired shoulders is not well documented. This measurement property needs to be assessed before using such methods in longitudinal comparative studies. The objective of this study is to evaluate the intra and intersession reliability of 3-dimensional scapular attitudes measured at different arm positions in healthy people and to explore the same measurement properties in people with shoulder impingement syndrome using the Optotrak Probing System. Methods Three-dimensional scapular attitudes were measured twice (test and retest interspaced by one week on fifteen healthy subjects (mean age 37.3 years and eight subjects with subacromial shoulder impingement syndrome (mean age 46.1 years in three arm positions (arm at rest, 70° of humerothoracic flexion and 90° of humerothoracic abduction using the Optotrak Probing System. Two different methods of calculation of 3-dimensional scapular attitudes were used: relative to the position of the scapula at rest and relative to the trunk. Intraclass correlation coefficient (ICC and standard error of measure (SEM were used to estimate intra and intersession reliability. Results For both groups, the reliability of the three-dimensional scapular attitudes for elevation positions was very good during the same session (ICCs from 0.84 to 0.99; SEM from 0.6° to 1.9° and good to very good between sessions (ICCs from 0.62 to 0.97; SEM from 1.2° to 4.2° when using the method of calculation relative to the trunk. Higher levels of

Young people's time use and maternal employment in the UK.

Science.gov (United States)

Mullan, Killian

2009-12-01

This paper analyses the relationship between young people's time use and maternal employment in the United Kingdom (UK). Two dimensions of young people's time use are important for understanding the impact of maternal employment. The first of these is family context. This concerns the time young people are near their parents or not. The second relates to young people's activity patterns. Combining information from both dimensions is necessary to provide a comprehensive overview of the impact of maternal employment on young people's time use. The paper demonstrates that young people's time use is associated with maternal employment both in terms of activity patterns and family context. Young people with employed mothers spend more time alone with a father, and more time with neither parent. More specifically, young people with mothers employed full time (FT) spend significantly more time watching TV than those whose mothers are not employed, especially when they are not near any parents. There is a negative association between FT maternal employment and the time young people spend in achievement-related activities, concentrated in time when alone with a mother. Unlike time in leisure activities or time watching TV, time in achievement-related activities when in the presence of a father does not increase to compensate for the loss in time spent in achievement-related activities when alone with a mother.

The CUIB: A source of motivation for research on librarianship and information science in Latin America

Directory of Open Access Journals (Sweden)

Editores Biblios

2012-08-01

Full Text Available Interview with Filiberto Felipe Martínez Arellano (Mexico researcher of the Centro Universitario de Investigaciones Bibliotecologicas (CUIB in the context of the thirtieth anniversary of this academic center.

What do young people think about their school-based sex and relationship education? A qualitative synthesis of young people's views and experiences.

Science.gov (United States)

Pound, Pandora; Langford, Rebecca; Campbell, Rona

2016-09-13

Although sex and relationship education (SRE) represents a key strand in policies to safeguard young people and improve their sexual health, it currently lacks statutory status, government guidance is outdated and a third of UK schools has poor-quality SRE. We aimed to investigate whether current provision meets young people's needs. Synthesis of qualitative studies of young people's views of their school-based SRE. Eligible studies originated from the UK, Ireland, the USA, Australia, New Zealand, Canada, Japan, Iran, Brazil and Sweden. Studies of students aged 4-19 in full-time education, young adults ≤19 (not necessarily in full-time education) or adults ≤25 if recalling their experiences of school-based SRE. -69 publications were identified, with 55 remaining after quality appraisal (representing 48 studies). The synthesis found that although sex is a potent and potentially embarrassing topic, schools appear reluctant to acknowledge this and attempt to teach SRE in the same way as other subjects. Young people report feeling vulnerable in SRE, with young men anxious to conceal sexual ignorance and young women risking sexual harassment if they participate. Schools appear to have difficulty accepting that some young people are sexually active, leading to SRE that is out of touch with many young people's lives. Young people report that SRE can be negative, gendered and heterosexist. They expressed dislike of their own teachers delivering SRE due to blurred boundaries, lack of anonymity, embarrassment and poor training. SRE should be 'sex-positive' and delivered by experts who maintain clear boundaries with students. Schools should acknowledge that sex is a special subject with unique challenges, as well as the fact and range of young people's sexual activity, otherwise young people will continue to disengage from SRE and opportunities for safeguarding and improving their sexual health will be reduced. Published by the BMJ Publishing Group Limited. For permission

When CERN goes out to meet people

CERN Multimedia

Pauline Gagnon

2014-01-01

Giving lectures about high-energy physics and particle accelerators to the public is an activity that several people from CERN enjoy and pursue all around the globe. Sometimes, this happens on the moose and pony trails, as Pauline Gagnon recounts…   CERN is really a unique place and people want to hear more about what we do. With the internet, people are keeping abreast of the latest scientific developments and many crave the opportunity to meet scientists and find out more about what is going on at CERN. So do not hesitate to contact local colleges and astronomy clubs. Get yourself invited to talk about our research. Last autumn, I gave a series of public lectures all around the province of Québec (Canada) and in the Shetland Islands (Northern Scotland). Both tours took me to remote areas where I was amazed to see the public interest for lectures in physics. In Québec, one of my six stops was Chibougamau, a town of 7500 people (and probably as many moose) locat...

Crisis and Communication among Rural Poor People

Directory of Open Access Journals (Sweden)

Agus Ganjar Runtiko

2015-07-01

Full Text Available The effect of the crisis is often multiple on people in rural poverty that secluded and away from the reach of government. Main factor cannot be ignored in crisis is communication. Prolonged crisis will occur when the channels of communication in society clogged. This study establishes three specific targets: (1 To obtain a comprehensive overview of the rural poor people’s knowledge about the crisis and the potential impact, (2 To discover crisis problems faced by the rural people poor, (3 To enlist communication problems in a crisis situation. This study used a qualitative method with a case study approach. Research data collect by conducting FGD of 40 informants selected based on purposive sampling, furthermore eight people were interviewed in depth, plus other supporting informant. The results of the research show people on those two locations have understood the crisis based on their experience of dealing with it. They believe the economic crisis as the first aspect that must be resolved. The completion of crisis should consider indigenous wisdom to avoid a new crisis.

Young people's perspectives on health-related risks

Directory of Open Access Journals (Sweden)

Grace Elisabeth Spencer

2008-07-01

Full Text Available Drawing upon current socio-cultural understandings of risk, this study highlights the disjunction between the expert risk discourses that permeate official public health policy and practice, and young people’s own perspectives on health and risk. Data were collected from young people aged 14-16 years through the use of group and individual interviews in a school and community youth centre setting. Findings from this study question the saliency of expert-defined health-related risks to young people’s everyday lives. Young people in this study saw health as closely linked to ‘being happy’. Friendships and a sense of personal achievement were particularly important to participants’ health and well-being. When accounting for their participation in health-related practices identified as ‘risky’ in government policy – such as smoking, alcohol and substance use – young people emphasised the levels of pressure they experienced. Sources of pressure included arguments and bullying, school work, and negative stereotypes of young people in general. These areas indicated young people’s concerns that reach beyond the official prescriptions permeating current health policy.

Developing Support for Siblings of Young People with Disabilities

Science.gov (United States)

Conway, Sally; Meyer, Donald

2008-01-01

In the USA and UK, at least one in ten children and young people have special health, developmental and mental health concerns. Most of these people have typically developing brothers and sisters. As the people who, over the course of their lifetimes together, will be most involved with their siblings with special needs, it is important that…

Factors Influencing And Alternative Policies Offered Of Social Conflicts Indigenous Peoples Rights

Directory of Open Access Journals (Sweden)

Saiful Deni

2017-06-01

Full Text Available This paper is a review of the social conflicts of indigenous peoples especially in North Maluku. The purpose of this review is to find out some factors causing indigenous peoples social conflicts in North Maluku and to produce alternative solutions as a policy to develop indigenous peoples livelihoods. The review resulted in several factors causing social conflicts of indigenous peoples such as the unclear boundary between the two parties the customary violations by the forest businessmen the injustice of the law enforcement officers in solving the problems the destruction of the indigenous people and the forest community narrow forest the lack positive contribution of forest management so far to indigenous peoples and forest communities companies do not involve indigenous peoples andor forest communities in forest exploitation destruction of customary buildings as places of worship deforestation timber exploitation while timber by indigenous peoples is sacred wood or abstinence to be felled. Alternative solutions are required by local government such as policy on legal recognition of indigenous peoples indigenous peoples empowerment implementation of indigenous peoples aspirations indigenous peoples economic development based on local wisdom and dispute resolution of indigenous peoples through special courts of a holistic nature.

Information needs of people with asthma.

Science.gov (United States)

Kong, Ming Ley; Armour, Carol; LeMay, Kate; Smith, Lorraine

2014-06-01

To describe the information needs of a group of Australians with asthma and the extent to which their needs had been met. A self-administered survey was completed by people with asthma either presenting at community pharmacies or registered with a medical research institute database. The survey questions were developed based on a review of the literature, and included questions regarding participants' information needs about their asthma, their sources of asthma information and the extent to which these information needs had been met. The responses concerning information needs were analysed thematically. Responses concerning sources of asthma information and the extent to which needs were met were analysed using descriptive and correlational statistics. Seventy-one people completed the survey. Key information needs that were identified included medications, management of asthma, asthma triggers, cure, aetiology of asthma and latest research. A third of participants reported having only 'very little', 'a little' or 'some' of their information needs met. The most common source of information was from a doctor (94% respondents), followed by a pharmacist or pharmacy assistant (56%). Insights into the information needs of people with asthma have been provided. In light of the level of unmet information needs of people with asthma, and the types of information sought, pharmacists are in an ideal position to close the information gap and promote optimal asthma self-management practices. © 2013 Royal Pharmaceutical Society.

How Children and Young People Win Friends and Influence People:Children and Young People’s Association, their opportunities, strategies and obstacles

OpenAIRE

Cleaver, Frances; Cockburn, T

2009-01-01

This research was commissioned by the Carnegie UK Trust to inform the Inquiry into the Future of Civil Society in the UK and Ireland, which was established to strenghen civil society…This report connects with the work that the Inquiry has conducted to explore the relationships between children, young people and civil society. The report is based on extensive literature review and on primary research amongst three groups of young people in the UK. The report explores how young people associate...

How older people with learning disabilities perceive ageing.

Science.gov (United States)

Jenkins, Robert

2010-07-01

This article discusses the author's use of reflexivity in trying to gain a better understanding of ageing in older people with learning disabilities. In the general population ageing is viewed in rather negative terms and as a significant life transition. However, for some older people with learning disabilities this transition may go unnoticed because of their past negative life experiences and lack of opportunities. Reflexivity has the potential to provide nurses with greater understanding of the personal perspectives of older people with learning disabilities.

Postboard : Free-form tangible messaging for people with aphasia (and other people)

NARCIS (Netherlands)

Al Mahmud, A.; Dijkhuis, S.Q.; Blummel, L.; Elberse, I.

2012-01-01

In this paper we report the design of a communication system for people with aphasia. It consists of pairs of physical whiteboards that are connected over the internet. This allows users to combine any personal language skills with visuals and already existing materials at hand. The design has been

Domotics in existing houses for elderly people. Evaluation of the project Lidwinahof. People, Planet, Profit; Domotica in bestaande seniorenwoningen. Evaluatie project Lidwinahof. People, Planet, Profit

Energy Technology Data Exchange (ETDEWEB)

Schouw, J.; Corpeleijn, M.; Poiesz, E. [CEA, Rotterdam (Netherlands)

2003-08-01

Domotics is applied in 49 houses for elderly people of the building complex Lidwinahof in Best, Netherlands. The domotics application concerns the functions safety (burglary, control of access, fire), care (emergency call, measurement of activity) and comfort (lighting). Among all residents an evaluation has been carried out from the perspective of sustainable development. A precondition for sustainable development is a balance between social, ecological and economical benefits (People, Planet and Profit). Results before and after the application of domotics are compared. [Dutch] De afgelopen jaren hebben diverse woningcorporaties een pilot-project met domotica uitgevoerd, met name met toepassingen op het gebied van wonen en zorg. Domein (woningcorporatie in Eindhoven, Best en Son en Breugel) was in het voorjaar van 2002 de eerste woningcorporatie die domotica heeft toegepast in de bestaande bouw (49 seniorenwoningen van het complex Lidwinahof in Best). Het systeem bevatte de functies veiligheid (inbraak, toegangscontrole, brand), zorg (noodoproep, activiteitsmeting) en comfort (verlichting). Onder alle bewoners is een evaluatie uitgevoerd vanuit het perspectief van duurzame ontwikkeling. Voorwaarde voor duurzame ontwikkeling is een balans tussen sociale, ecologische en economische opbrengsten (People, Planet en Profit). De resultaten op deze drie gebieden voor en na toepassing van domotica zijn vergeleken.

Going beyond the most exposed people in a dose assessment

Energy Technology Data Exchange (ETDEWEB)

Hjerpe, Thomas; Broed, Robert [Facilia AB, Gustavslundsvaegen 151C, SE-167 51 Bromma (Sweden); Ikonen, Ari T.K. [Environmental Research and Assessment, EnviroCase, Ltd., Hallituskatu 1 D 4, FI-28 100 Pori (Finland)

2014-07-01

The dose assessment in a long-term radiation safety assessment often focus on assessing dose of a representative person to be used for determining compliance with a radiation dose constraint. This representative person is often assumed to receive a dose that is representative of the most exposed people, i.e., the more highly exposed individuals in the population. This is not always sufficient, the Finnish regulations for disposal of nuclear waste has radiation dose constraint to the most exposed people as well as for larger groups of exposed people. This work presents the methodology to assessing dose of a representative person for a larger group of exposed people as applied by Posiva in the TURVA-2012 safety case for the spent nuclear fuel disposal at Olkiluoto. In addition, annual doses from the set of biosphere calculation cases analysed in TURVA-2012 are presented and discussed. Special focus is given on explaining the differences in exposure levels and exposure routes between the estimated annual doses to representative persons for most exposed people and a larger exposed group. The results show that the annual doses to a larger group of people ranges from one to three orders of magnitude below the annual doses to the most exposed people. Furthermore, the exposure route related to food ingestion is less significant for the larger group of people compared to the most exposed people and that the exposure route related to water ingestion shows the opposite behaviour. (authors)

Peopling Global Health

Directory of Open Access Journals (Sweden)

João Biehl

2014-06-01

Full Text Available The field of Global Health brings together a vastly diverse array of actors working to address pressing health issues worldwide with unprecedented financial and technological resources and informed by various agendas. While Global Health initiatives are booming and displacing earlier framings of the field (such as tropical medicine or international health, critical analyses of the social, political, and economic processes associated with this expanding field — an “open source anarchy” on the ground — are still few and far between. In this essay, we contend that, among the powerful players of Global Health, the supposed beneficiaries of interventions are generally lost from view and appear as having little to say or nothing to contribute. We make the case for a more comprehensive and people-centered approach and demonstrate the crucial role of ethnography as an empirical lantern in Global Health. By shifting the emphasis from diseases to people and environments, and from trickle-down access to equality, we have the opportunity to set a humane agenda that both realistically confronts challenges and expands our vision of the future of global communities.

[Emotional distress in elderly people with heart disease].

Science.gov (United States)

Martínez Santamaría, Emilia; Lameiras Fernández, María; González Lorenzo, Manuel; Rodríguez Castro, Yolanda

2006-06-30

To analyse the emotional distress associated with ageing, and its prevalence among elderly people who suffer from heart disease. Personal interviews with elderly people with and without heart problems. Interviews were conducted in public hospitals and old people's homes in the south of Galicia, Spain. The sample was made up of 130 elderly people (65 with heart problems and 65 without). The Inventory of Coping Strategies, of Halroyd and Reynolk (1984); Scheir, Caver, and Bridges Test (1984); the Life Satisfaction Scale of Diener, Emmuns, Larsen, and Griffen (1985); Rosenberg's Self-Esteem Scale (1965); and an instrument to measure Associated Symptoms (SCL-90; Derogatis, 1975). Elderly people with heart problems experienced greater anxiety and had lower self-esteem than those without such problems. Heart patients also tended to suffer more phobic anxiety and to retreat from social interaction more. With the passing of time, heart patients over 60 showed more anxiety, irritability and psychosomatic disorders. This study clearly shows the existence of emotional distress in elderly heart patients. This makes it particularly important to conduct risk-prevention programmes, since a lot of heart disease is brought on by unhealthy conduct.

Document recognition serving people with disabilities

Science.gov (United States)

Fruchterman, James R.

2007-01-01

Document recognition advances have improved the lives of people with print disabilities, by providing accessible documents. This invited paper provides perspectives on the author's career progression from document recognition professional to social entrepreneur applying this technology to help people with disabilities. Starting with initial thoughts about optical character recognition in college, it continues with the creation of accurate omnifont character recognition that did not require training. It was difficult to make a reading machine for the blind in a commercial setting, which led to the creation of a nonprofit social enterprise to deliver these devices around the world. This network of people with disabilities scanning books drove the creation of Bookshare.org, an online library of scanned books. Looking forward, the needs for improved document recognition technology to further lower the barriers to reading are discussed. Document recognition professionals should be proud of the positive impact their work has had on some of society's most disadvantaged communities.

From CERN people to the world

CERN Multimedia

Sophie Louise Hetherton

2014-01-01

Created by filmmaker Liz Mermin, a new YouTube series puts the spotlight on CERN people. This set of short films offers new insight into the daily lives of CERN physicists.   The new online video series, CERN people, takes you behind the headlines of some of the biggest physics breakthroughs of our time, capturing the invention and discovery in the lives of CERN’s scientists. “CERN offered a fascinating blend of people from so many different backgrounds combined with exciting and groundbreaking physics,” says filmmaker Liz Mermin. “So, my aim was to show the real-life characters – the ones that stay up all night analysing data and tweaking the code for the experiments – and communicate their passion for particle physics.” The films give a first-hand experience of what it’s like day-to-day at CERN by showing the ups and downs of working at the frontier of modern science. For the participants, it was an excellent opport...

Pneumonia in Immunocompromised People

Science.gov (United States)

... Cancer and the chemotherapy drugs used to treat cancer Defects in white blood cells Diseases, such as AIDS Certain drugs (such as corticosteroids, chemotherapy drugs, and drugs used to treat autoimmune or connective tissue disorders) Causes In people with a weakened immune ...

Obesity and people with disabilities: the implications for health care expenditures.

Science.gov (United States)

Anderson, Wayne L; Wiener, Joshua M; Khatutsky, Galina; Armour, Brian S

2013-12-01

This study estimates additional average health care expenditures for overweight and obesity for adults with disabilities vs. without. Descriptive and multivariate methods were used to estimate additional health expenditures by service type, age group, and payer using 2004-2007 Medical Expenditure Panel Survey data. In 2007, 37% of community-dwelling Americans with disabilities were obese vs. 27% of the total population. People with disabilities had almost three times ($2,459) the additional average obesity cost of people without disabilities ($889). Prescription drug expenditures for obese people with disabilities were three times as high and outpatient expenditures were 74% higher. People with disabilities in the 45- to 64-year age group had the highest obesity expenditures. Medicare had the highest additional average obesity expenditures among payers. Among people with prescription drug expenditures, obese people with disabilities had nine times the prevalence of diabetes as normal weight people with disabilities. Overweight people with and without disabilities had lower expenditures than normal-weight people with and without disabilities. Obesity results in substantial additional health care expenditures for people with disabilities. These additional expenditures pose a serious current and future problem, given the potential for higher obesity prevalence in the coming decade. Copyright © 2013 The Obesity Society.

Better housing and living conditions for older people

DEFF Research Database (Denmark)

housing stock and local neighbourhood facilites be made more responsive to the demands of older people? How can housing and planning measures contribute to the integration of older people in local communities? How can urban renewal be implemented in elderly-friendly forms? What forms of coordination......There is an increasing emphasis on strategies designed to combat the exclusion of older people from society. The development of social policies oriented towards community care and community living has important consequences for housing policies and urban planning policies. How can the general...

Complex health service needs for people who are homeless.

Science.gov (United States)

Moore, Gaye; Manias, Elizabeth; Gerdtz, Marie Frances

2011-11-01

Homeless people face many challenges in accessing and utilising health services to obtain psychosocial supports offered in hospital and community settings. The complex nature of health issues is compounded by lack of accessibility to services and lack of appropriate and safe housing. To examine the perceptions and experiences of homeless people in relation to their health service needs as well as those of service providers involved with their care. A purposive sampling approach was undertaken with a thematic framework analysis of semi-structured interviews. Participants. Interviews were undertaken with 20 homeless people who accessed the emergency department in an acute hospital in Melbourne, Australia and 27 service providers involved in hospital and community care. Six key themes were identified from interviews: complexity of care needs, respect for homeless people and co-workers, engagement as a key strategy in continued care, lack of after-hour services, lack of appropriate accommodation and complexity of services. Findings revealed the complex and diverse nature of health concerns in homeless people. The demand on hospital services continues to increase and unless government policies take into consideration the psychosocial demands of the communities most vulnerable people efforts to divert hospital demand will continue to fail.

Why Social Exclusion Persists among Older People in Australia

Directory of Open Access Journals (Sweden)

Riyana Miranti

2015-07-01

Full Text Available The existing literature on social exclusion among older people, though relatively limited, suggests that disadvantage among older people is cumulative in nature. Some aspects of disadvantage starting at early life stages have long-term consequences. As such, older people with disadvantages may be subject to higher risks of persistent social exclusion. This article aims to improve understanding of social exclusion and its persistence among senior Australians in three ways. Firstly, the incidence of social exclusion among older people is analysed using selected indicators. Secondly, the study examines whether an older person experiencing social exclusion at one time is more likely to experience it again (persistence. Thirdly, it investigates what factors may be protecting older people from social exclusion. The analysis is conducted using the first eight waves of the Household, Income and Labour Dynamics in Australia (HILDA Survey. The sample of older people is disaggregated into a younger group (55–64 years at wave 1 and an older group (65+ years. The article suggests that higher education and income, as well as better health conditions and previous employment experiences, are important protective factors from social exclusion for older Australians.